WO2021138474A2 - Anti-tcr antibody molecules and uses thereof - Google Patents

Anti-tcr antibody molecules and uses thereof Download PDF

Info

Publication number
WO2021138474A2
WO2021138474A2 PCT/US2020/067543 US2020067543W WO2021138474A2 WO 2021138474 A2 WO2021138474 A2 WO 2021138474A2 US 2020067543 W US2020067543 W US 2020067543W WO 2021138474 A2 WO2021138474 A2 WO 2021138474A2
Authority
WO
WIPO (PCT)
Prior art keywords
tcrβv
tcrβ
antibody
molecule
antibody molecule
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/067543
Other languages
English (en)
French (fr)
Other versions
WO2021138474A3 (en
Inventor
Seng-Lai TAN
Brian Edward Vash
Jonathan Hsu
Dilini Charmain GUNASEKERA
Sangeetha Sagar PALAKURTHI
Andreas Loew
Madan Katragadda
Peter Marek
Gurkan Guntas
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Marengo Therapeutics Inc
Original Assignee
Marengo Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN202080098701.7A priority Critical patent/CN116234829A/zh
Priority to AU2020416273A priority patent/AU2020416273A1/en
Priority to GB2210131.5A priority patent/GB2609554B/en
Priority to CA3166629A priority patent/CA3166629A1/en
Priority to EP20910571.7A priority patent/EP4084823A4/en
Priority to JP2022541232A priority patent/JP2023509708A/ja
Application filed by Marengo Therapeutics Inc filed Critical Marengo Therapeutics Inc
Publication of WO2021138474A2 publication Critical patent/WO2021138474A2/en
Publication of WO2021138474A3 publication Critical patent/WO2021138474A3/en
Priority to US17/855,332 priority patent/US20230227552A1/en
Anticipated expiration legal-status Critical
Priority to US18/341,688 priority patent/US12486326B2/en
Priority to US19/339,740 priority patent/US20260022173A1/en
Priority to JP2025168426A priority patent/JP2026027226A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • anti-CD3e monoclonal antibody mAb
  • anti-CD3e mAbs bind to all T cells and thus activate a large number of T cells.
  • Such non-physiological massive activation of T cells by these anti- CD3e mAbs can result in the production of proinflammatory cytokines such as IFN-gamma, IL- 1-beta, IL-6, IL-10 and TNF-alpha, causing a “cytokine storm” known as the cytokine release syndrome (CRS), which is also associated with neurotoxicity (NT).
  • CRS cytokine release syndrome
  • NT neurotoxicity
  • anti-TCR ⁇ V antibody molecules directed to the variable chain of the beta subunit of TCR (TCR ⁇ V) which bind and, e.g., activate or expand, T cells, e.g., a subset of T cells
  • anti-TCR ⁇ V antibody molecules e.g., the anti-TCR ⁇ V antibody molecules disclosed herein result in a cytokine profile, e.g., a cytokine secretion profile, that differs from that of a T cell engager that binds to a receptor or molecule other than a TCR ⁇ V region (“a non-TCR ⁇ V-binding T cell engager”).
  • the anti-TCR ⁇ V antibody molecules disclosed herein result in lesser, minimal, or no production of cytokines associated with cytokine release syndrome (CRS), e.g., IL-6, IL-1beta, IL-10 and TNF alpha; and enhanced and/or delayed production of IL-2 and IFN-gamma.
  • CRS cytokine release syndrome
  • the anti-TCR ⁇ V antibodies disclosed herein result in expansion of an immune cell, e.g., a T cell, a tumor infiltrating lymphocyte (TIL), an NK cell, or other immune cells (e.g., as described herein).
  • compositions comprising anti-TCR ⁇ V antibody molecules of the present disclosure can be used, e.g., to activate and/or redirect T cells to promote tumor cell lysis for cancer immunotherapy.
  • compositions comprising anti-TCR ⁇ V antibody molecules as disclosed herein limit the unwanted side-effects of CRS and/or NT, e.g., CRS and/or NT associated with anti-CD3e targeting.
  • the anti-TCR ⁇ V antibody molecules disclosed herein result in lesser, minimal, or no production of cytokines associated with cytokine release syndrome (CRS), e.g., IL-6, IL-1beta, IL-10 and TNF alpha; and enhanced and/or delayed production of IL-2 and IFN-gamma, compared with an anti-CD3 antibody molecule (e.g., a low affinity anti-CD3 antibody molecule).
  • CRS cytokine release syndrome
  • administering results in reduced cytokine release syndrome (CRS) (e.g., lesser duration of CRS or no CRS), a reduced severity of CRS (e.g., absence of severe CRS, e.g., CRS grade 4 or 5), reduced neurotoxicity (NT), or a reduced severity of NT, compared with similar administration of an anti-CD3 antibody molecule (e.g., a low affinity anti-CD3 antibody molecule).
  • CRS cytokine release syndrome
  • NT neurotoxicity
  • anti-TCR ⁇ V antibody molecules multispecific or multifunctional molecules (e.g., multispecific or multifunctional antibody molecules) (also referred to herein as a “composition”) that comprise anti-TCR ⁇ V antibody molecules, nucleic acids encoding the same, methods of producing the aforesaid molecules, pharmaceutical compositions comprising aforesaid molecules, and methods of treating a disease or disorder, e.g., cancer, using the aforesaid molecules.
  • the antibody molecules and pharmaceutical compositions disclosed herein can be used (alone or in combination with other agents or therapeutic modalities) to treat, prevent and/or diagnose disorders and conditions, e.g., cancer, e.g., as described herein.
  • the disclosure provides an antibody molecule, e.g., a non-murine, e.g., a human-like (e.g., a human, or humanized antibody molecule), which binds, e.g., specifically binds, to a T cell receptor beta variable (TCR ⁇ V) region.
  • the anti-TCRBV antibody molecule comprises an antigen binding domain of an antibody disclosed in any of Tables 1-2, or 10-13, or a sequence with at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
  • the anti-TCRBV antibody molecule comprises a leader sequence comprising the amino acid sequence of SEQ ID NO: 3288.
  • the anti-TCRBV antibody molecule does not comprise a leader sequence comprising the amino acid sequence of SEQ ID NO: 3288.
  • binding of the anti-TCR ⁇ V antibody molecule to a TCR ⁇ V region results in a cytokine profile, e.g., a cytokine secretion profile, (e.g., comprising one or more cytokines and/or one or more chemokines), that differs from that of a T cell engager that binds to a receptor or molecule other than a TCR ⁇ V region (“a non-TCR ⁇ V-binding T cell engager”).
  • the cytokine profile e.g., cytokine secretion profile, comprises one, two, three, four, five, six, seven, or all of the following: (i) increased level, e.g., expression level, and/or activity of IL-2; (ii) reduced level, e.g., expression level, and/or activity of IL-1 ⁇ ; (iii) reduced level, e.g., expression level, and/or activity of IL-6; (iv) reduced level, e.g., expression level, and/or activity of TNF ⁇ ; (v) reduced level, e.g., expression level, and/or activity of IL-10; (vi) a delay, e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more hours delay, in increased level, e.g., expression level, and/or activity of IL-2; (vii) a delay, e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 hours delay, in increased
  • binding of the anti-TCRBV antibody to a TCR ⁇ V region results in reduced cytokine storm, e.g., reduced cytokine release syndrome (CRS) and/or neurotoxicity (NT), as measured by an assay of Example 3, e.g., relative to the cytokine storm induced by the non-TCR ⁇ V-binding T cell engager.
  • binding of the anti-TCRBV antibody to a TCR ⁇ V region results in one, two, three or all of: (ix) reduced T cell proliferation kinetics; (x) cell killing, e.g., target cell killing, e.g.
  • cancer cell killing e.g., as measured by an assay of Example 4; (xi) increased Natural Killer (NK) cell proliferation, e.g., expansion; or (xii) expansion, e.g., at least about 1.1-10 fold expansion (e.g., at least about 1.1, 1.2, 1.3, 1.4, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, or 10 fold expansion), of a population of T cells having a memory-like phenotype, e.g., as described herein, e.g., wherein (ix)-(xii) are relative to the non-TCR ⁇ V-binding T cell engager.
  • NK Natural Killer
  • an anti-TCR ⁇ V antibody molecule disclosed herein recognizes (e.g., binds to), a structurally conserved domain on the TCR ⁇ V protein (e.g., as denoted by the circled area in FIG.24A).
  • an anti-TCRV ⁇ antibody disclosed herein comprises an Fc region, e.g., as described herein.
  • the Fc region is a wildtype Fc region, e.g., a wildtype human Fc region.
  • the Fc region comprises a variant, e.g., an Fc region comprising an addition, substitution, or deletion of at least one amino acid residue in the Fc region which results in, e.g., reduced affinity for and/or binding to, at least one Fc receptor.
  • the reduced affinity is compared to an otherwise similar antibody with a wildtype Fc region.
  • an anti-TCRV ⁇ antibody comprising a variant Fc region has one or more of the following properties: (1) reduced effector function (e.g., reduced ADCC, ADCP and/or CDC); (2) reduced binding to one or more Fc receptors; and/or (3) reduced binding to C1q complement.
  • the reduction in any one, or all of properties (1)-(3) is compared to an otherwise similar antibody with a wildtype Fc region.
  • an anti-TCRV ⁇ antibody comprising a variant Fc region has reduced affinity to a human Fc receptor, e.g., Fc ⁇ R I, Fc ⁇ R II and/or Fc ⁇ R III.
  • the anti-TCRV ⁇ antibody comprising a variant Fc region comprises a human IgG1 region or a human IgG4 region.
  • an anti-TCRV ⁇ antibody disclosed herein comprises any one or all, or any combination of Fc region variants, e.g., mutations, disclosed in Table 21.
  • an anti-TCRV ⁇ antibody disclosed herein comprise an Asn297Ala (N297A) mutation. In some embodiments, an anti-TCRV ⁇ antibody disclosed herein comprise a Leu234Ala/Leu235Ala (LALA) mutation. In some embodiments, an anti-TCR ⁇ V antibody molecule disclosed herein does not recognize, e.g., bind to, an interface of a TCR ⁇ V:TCRalpha complex. In some embodiments, an anti-TCR ⁇ V antibody molecule disclosed herein does not recognize, e.g., bind to, a constant region of a TCR ⁇ V protein.
  • an exemplary antibody that binds to a constant region of a TCRBV region is JOVI.1 as described in Viney et al., (Hybridoma.1992 Dec;11(6):701-13).
  • an anti-TCR ⁇ V antibody molecule disclosed herein does not recognize, e.g., bind to, one or more (e.g., all) of a complementarity determining region (e.g., CDR1, CDR2 and/or CDR3) of a TCR ⁇ V protein.
  • binding of the anti-TCR ⁇ V antibody molecule to a TCR ⁇ V region results in one, two, three, four, five, six, seven, eight, nine, ten or more (e.g., all) of the following: (i) reduced level, e.g., expression level, and/or activity of IL-1 ⁇ ; (ii) reduced level, e.g., expression level, and/or activity of IL-6; (iii) reduced level, e.g., expression level, and/or activity of TNF ⁇ ; (iv) increased level, e.g., expression level, and/or activity of IL-2; (v) a delay, e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more hours delay, in increased level, e.g., expression level, and/or activity of IL-2; (vi) a delay, e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 hours delay, in increased level, e.g., expression level, and/or activity
  • cancer cell killing e.g., as measured by an assay of Example 4; (x) increased level, e.g., expression level, and/or activity of IL-15; or (xi) increased Natural Killer (NK) cell proliferation, e.g., expansion.
  • any one or all of (i)-(xi) or any combination thereof resulting from an anti-TCR ⁇ V antibody molecule disclosed herein is compared to an antibody that binds to: a CD3 molecule, e.g., CD3 epsilon (CD3e) molecule; or a TCR alpha (TCR ⁇ ) molecule.
  • binding of the anti-TCR ⁇ V antibody molecule to a TCR ⁇ V region results in secretion, e.g., production of perforin and/or Granzyme B.
  • the disclosure provides an antibody molecule which binds, e.g., specifically binds, to a T cell receptor beta variable chain (TCR ⁇ V) region, wherein the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (a) a light chain variable region (VL) comprising: (i) one, two or all of (e.g., three) a light chain complementarity determining region 1 (LC CDR1), a light chain complementarity determining region 2 (LC CDR2), and a light chain complementarity determining region 3 (LC CDR3) of SEQ ID NO: 10 or SEQ ID NO: 11; and (ii) a framework region (FR) having at least 95% identity with one, two, three, or all of (e.g., four) a non-mur
  • the VL comprises a sequence having a consensus sequence of SEQ ID NO: 230 or 3289. In some embodiments, the VH comprises a sequence having a consensus sequence of SEQ ID NO: 231 or 3290.
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V6, e.g., one or more of TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01, or a variant thereof.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of SEQ ID NO: 1 or SEQ ID NO: 9, or an amino acid sequence listed in Table 1; or (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of SEQ ID NO: 2, SEQ ID NO: 10 or SEQ ID NO: 11, or an amino acid sequence listed in Table 1.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of SEQ ID NO: 2, SEQ ID NO: 10 or SEQ ID NO: 11, or an amino acid sequence listed in Table 1.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of SEQ ID NO:1 or SEQ ID NO: 9, or an amino acid sequence listed in Table 1.
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a VL comprising: a LC CDR1 amino acid sequence of SEQ ID NO: 6 (or an amino acid sequence with not more than 1, 2, 3 or 4 modifications, e.g., substitutions, additions or deletions thereof), a LC CDR2 amino acid sequence of SEQ ID NO:7 (or an amino acid sequence with not more than 1, 2, 3 or 4 modifications, e.g., substitutions, additions or deletions thereof), and/or a LC CDR3 amino acid sequence of SEQ ID NO:8 (or an amino acid sequence with not more than 1, 2, 3 or 4 modifications, e.g., substitutions, additions or deletions thereof); and/or (ii) a VH comprising: a HC CDR1 amino acid sequence of SEQ ID NO: 3 (or an amino acid sequence with not more than 1, 2, 3 or 4 modifications, e.g., substitutions, additions or deletions thereof), a HC
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: a variable heavy chain (VH) of an amino acid sequence listed in Table 1, e.g., SEQ ID NO: 9, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to an amino acid sequence listed in Table 1, e.g., SEQ ID NO: 9 or SEQ ID NO: 1312; and/or a variable light chain (VL) of an amino acid sequence listed in Table 1, e.g., SEQ ID NO: 10 or SEQ ID NO: 11, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to an amino acid sequence listed in Table 1, e.g., SEQ ID NO: 10 or SEQ ID NO: 11 or SEQ ID NO: 1314.
  • VH variable heavy chain
  • SEQ ID NO: 9 9
  • VL variable light chain
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) the VH amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 1312; (ii) an amino acid sequence having at least about 85%, 90%, 95%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 1312; (iii) the VL amino acid sequence of SEQ ID NO: 10 or SEQ ID NO: 1314; and/or (iv) an amino acid sequence having at least about 85%, 90%, 95%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 10 or SEQ ID NO: 1314.
  • an antibody molecule which binds, e.g., specifically binds, to a T cell receptor beta variable chain (TCR ⁇ V) region, wherein the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (a) a light chain variable region (VL) comprising: (i) one, two or all of (e.g., three) a light chain complementarity determining region 1 (LC CDR1), a light chain complementarity determining region 2 (LC CDR2), and a light chain complementarity determining region 3 (LC CDR3) of a humanized B-H light chain (LC) of Table 2; and (ii) a framework region (FR) having at least 95% identity with one, two, three or all (e.g., four) of a framework region 1 (FR1), a framework region 2 (FR2), a framework region 3 (FR3), and a framework region 4 (FR4) of a humanized B-H LC of Table 2; and/or
  • the anti-TCRBV binds to TCR ⁇ V12, e.g., TCR ⁇ V12-4*01, TCR ⁇ V12-3*01, or TCR ⁇ V12-5*01, or a variant thereof.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of Antibody B listed in Table 2; or (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of Antibody B listed in Table 2.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of a humanized B-H antibody listed in Table 2.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of a humanized B-H antibody listed in Table 2.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of a humanized B-H antibody listed in Table 2.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises: a VH sequence of a humanized B-H antibody listed in Table 2, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VH of a humanized B-H antibody listed in Table 2; and/or a VL sequence of a humanized B-H antibody listed in Table 2, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VL of a humanized B-H antibody listed in Table 2.
  • the anti-TCR ⁇ V antibody molecule comprises a framework region (FR) having at least 95% identity with one of: a FR1, a FR2, a FR3, and a FR4 of a humanized B-H LC of Table 2. In some embodiments, the anti-TCR ⁇ V antibody molecule comprises a framework region (FR) having at least 95% identity with any two of: a FR1, a FR2, a FR3, and a FR4 of a humanized B-H LC of Table 2.
  • the anti-TCR ⁇ V antibody molecule comprises a framework region (FR) having at least 95% identity with any three of: a FR1, a FR2, a FR3, and a FR4 of a humanized B-H LC of Table 2. In some embodiments, the anti-TCR ⁇ V antibody molecule comprises a framework region (FR) having at least 95% identity with all of: a FR1, a FR2, a FR3, and a FR4 of a humanized B-H LC of Table 2.
  • the anti-TCR ⁇ V antibody molecule comprises a framework region (FR) having at least 95% identity with one of: a FR1, a FR2, a FR3, and a FR4 of a humanized B-H HC of Table 2. In some embodiments, the anti-TCR ⁇ V antibody molecule comprises a framework region (FR) having at least 95% identity with any two of: a FR1, a FR2, a FR3, and a FR4 of a humanized B-H HC of Table 2.
  • the anti-TCR ⁇ V antibody molecule comprises a framework region (FR) having at least 95% identity with any three of: a FR1, a FR2, a FR3, and a FR4 of a humanized B-H HC of Table 2. In some embodiments, the anti-TCR ⁇ V antibody molecule comprises a framework region (FR) having at least 95% identity with all of: a FR1, a FR2, a FR3, and a FR4 of a humanized B-H HC of Table 2.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of Antibody C listed in Table 10; or (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of Antibody C listed in Table 10.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of antibody C or humanized C-H antibody listed in Table 10.
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of antibody C or humanized C-H antibody listed in Table 10.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises: a VH sequence of a humanized C-H antibody listed in Table 10, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VH of a humanized C-H antibody listed in Table 10; and/or a VL sequence of a humanized C-H antibody listed in Table 10, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VL of a humanized C-H antibody listed in Table 10.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of Antibody E listed in Table 11; or (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of Antibody E listed in Table 11.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of antibody E or humanized E-H antibody listed in Table 11.
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of antibody E or humanized E-H antibody listed in Table 11.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises: a VH sequence of a humanized E-H antibody listed in Table 11, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VH of a humanized E-H antibody listed in Table 11; and/or a VL sequence of a humanized E-H antibody listed in Table 11, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VL of a humanized E-H antibody listed in Table 11.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of Antibody D listed in Table 12; or (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of Antibody D listed in Table 12.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of antibody D or humanized D-H antibody listed in Table 12.
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of antibody D or humanized D-H antibody listed in Table 12.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises: a VH sequence of a humanized D-H antibody listed in Table 12, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VH of a humanized D-H antibody listed in Table 12; and/or a VL sequence of a humanized D-H antibody listed in Table 12, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VL of a humanized D-H antibody listed in Table 12.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of Antibody G listed in Table 13; or (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of Antibody G listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of antibody G or humanized G-H antibody listed in Table 13.
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of antibody G or humanized G-H antibody listed in Table 13.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises: a VH sequence of a humanized G-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VH of a humanized G-H antibody listed in Table 13; and/or a VL sequence of a humanized G-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VL of a humanized G-H antibody listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of Antibody H listed in Table 13; or (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of Antibody H listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of antibody H or humanized H-H antibody listed in Table 13.
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of antibody H or humanized H-H antibody listed in Table 13.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises: a VH sequence of a humanized H-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VH of a humanized H-H antibody listed in Table 13; and/or a VL sequence of a humanized H-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VL of a humanized H-H antibody listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of Antibody I listed in Table 13; or (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of Antibody I listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of antibody I or humanized I-H antibody listed in Table 13.
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of antibody I or humanized I-H antibody listed in Table 13.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises: a VH sequence of a humanized I-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VH of a humanized I-H antibody listed in Table 13; and/or a VL sequence of a humanized I-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VL of a humanized I-H antibody listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of Antibody J listed in Table 13; or (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of Antibody J listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of antibody J or humanized J-H antibody listed in Table 13.
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of antibody J or humanized J-H antibody listed in Table 13.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises: a VH sequence of a humanized J-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VH of a humanized J-H antibody listed in Table 13; and/or a VL sequence of a humanized J-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VL of a humanized J-H antibody listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of Antibody K listed in Table 13; or (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of Antibody K listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of antibody K or humanized K-H antibody listed in Table 13.
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of antibody K or humanized K-H antibody listed in Table 13.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises: a VH sequence of a humanized G-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VH of a humanized K-H antibody listed in Table 13; and/or a VL sequence of a humanized G-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VL of a humanized K-H antibody listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of Antibody L listed in Table 13; or (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of Antibody L listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of antibody L or humanized L-H antibody listed in Table 13.
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of antibody L or humanized L-H antibody listed in Table 13.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises: a VH sequence of a humanized L-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VH of a humanized L-H antibody listed in Table 13; and/or a VL sequence of a humanized L-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VL of a humanized L-H antibody listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of Antibody M listed in Table 13; or (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of Antibody M listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of antibody M or humanized M-H antibody listed in Table 13.
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of antibody M or humanized M-H antibody listed in Table 13.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises: a VH sequence of a humanized M-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VH of a humanized M-H antibody listed in Table 13; and/or a VL sequence of a humanized M-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VL of a humanized M-H antibody listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of Antibody N listed in Table 13; or (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of Antibody N listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of antibody N or humanized N-H antibody listed in Table 13.
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of antibody N or humanized N-H antibody listed in Table 13.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises: a VH sequence of a humanized N-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VH of a humanized N-H antibody listed in Table 13; and/or a VL sequence of a humanized N-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VL of a humanized N-H antibody listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a HC CDR1, a HC CDR2 and a HC CDR3 of Antibody O listed in Table 13; or (ii) a LC CDR1, a LC CDR2, and a LC CDR3 of Antibody O listed in Table 13.
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of antibody O or humanized O-H antibody listed in Table 13.
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of antibody O or humanized O-H antibody listed in Table 13.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule comprises: a VH sequence of a humanized O-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VH of a humanized O-H antibody listed in Table 13; and/or a VL sequence of a humanized O-H antibody listed in Table 13, or a sequence having at least about 85%, 90%, 95%, or 99% sequence identity to a VL of a humanized O-H antibody listed in Table 13.
  • the disclosure provides a non-murine, e.g., a human-like antibody molecule (e.g., a human or humanized antibody molecule), which binds, e.g., specifically binds, to a T cell receptor beta variable (TCR ⁇ V) region.
  • a human-like antibody molecule e.g., a human or humanized antibody molecule
  • TCR ⁇ V T cell receptor beta variable
  • binding of the anti- TCR ⁇ V antibody molecule results in expansion, e.g., at least about 1.1-50 fold expansion (e.g., at least about 1.5-40 fold, 2-35 fold, 3-30 fold, 5-25 fold, 8-20 fold, or 10-15 fold expansion), of a population of T cells, e.g., a population of T cells having a memory-like phenotype, e.g., CD45RA+ CCR7- T cells.
  • the population of T cells having a memory- like phenotype comprises CD4+ and/or CD8+ T cells.
  • the population of T cells having a memory-like phenotype comprises a population of memory T cells, e.g., T effector memory (T EM ) cells, e.g., T EM cells expressing CD45RA (T EMRA ) cells, e.g., CD4+ or CD8+ T EMRA cells.
  • T EM T effector memory
  • T EMRA CD45RA
  • CD57 CD57
  • CD57 e.g., CD57
  • the population of T cells having a memory-like phenotype does not express an inhibitory receptor, e.g., OX40, 4-1BB, and/or ICOS.
  • the population of T cells having a memory-like phenotype is a population of T cells with CD45RA+ CCR7- CD57-. In some embodiments, the population of T cells having a memory-like phenotype does not express an inhibitory receptor, e.g., OX40, 4- 1BB, and/or ICOS. In some embodiments, the population of T cells having a memory-like phenotype, e.g., as described herein, has increased proliferative capacity, e.g., as compared to a reference cell population, e.g., an otherwise similar population of cells that has not been contacted with an anti-TCR ⁇ V antibody.
  • an inhibitory receptor e.g., OX40, 4- 1BB, and/or ICOS.
  • the population of T cells having a memory-like phenotype e.g., as described herein, has increased proliferative capacity, e.g., as compared to a reference cell population, e.g., an
  • the expansion is at least about 1.1-10 fold expansion (e.g., at least about 1.1, 1.2, 1.3, 1.4, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, or 10 fold expansion).
  • expansion of the population of T cells having a memory-like phenotype e.g., memory effector T cells, e.g., TEM cells, e.g., TEMRA cells, e.g., CD4+ or CD8+ T EMRA cells
  • expansion of the population of T cells having a memory-like phenotype e.g., memory effector T cells, e.g., TEM cells, e.g., TEMRA cells, e.g., CD4+ or CD8+ T EMRA cells
  • a CD3 molecule e.g., CD3 epsilon (CD3e) molecule
  • TCR ⁇ TCR alpha
  • the population of expanded T cells having a memory-like phenotype comprises cells T cells, e.g., CD3+, CD8+ or CD4+ T cells.
  • the population of expanded T cells having a memory-like phenotype, T effector memory cells comprises CD3+ and CD8+ T cells.
  • the population of expanded T cells having a memory-like phenotype, e.g., T effector memory cells comprises CD3+ and CD4+ T cells.
  • the population of expanded T cells having a memory-like phenotype, T effector memory (TEM) cells comprises cells T cells, e.g., CD3+, CD8+ or CD4+ T cells, which express or re-express, CD45RA, e.g., CD45RA+.
  • the population comprises T EM cells expressing CD45RA, e.g., T EMRA cells.
  • expression of CD45RA on TEMRA cells, e.g., CD4+ or CD8+ TEMRA cells can be detected by a method disclosed herein, e.g., flow cytometry.
  • the population of T cells having a memory-like phenotype, e.g., T EMRA cells have low or no expression of CCR7, e.g., CCR7- or CCR7 low.
  • expression of CCR7 on TEMRA cells cannot be detected by a method disclosed herein, e.g., flow cytometry.
  • the population of T cells having a memory-like phenotype, e.g., TEMRA cells express CD95, e.g., CD95+.
  • expression of CD95 on TEMRA cells can be detected by a method disclosed herein, e.g., flow cytometry.
  • the population of T cells having a memory-like phenotype express CD45RA, e.g., CD45RA+, have low or no expression of CCR7, e.g., CCR7- or CCR7 low, and express CD95, e.g., CD95+.
  • the population of T cells having a memory-like phenotype, e.g., T EMRA cells can be identified as CD45RA+, CCR7- and CD95+ cells.
  • the population of T cells having a memory-like phenotype comprise CD3+, CD4+ or CD8+ T cells (e.g., CD3+ T cells, CD3+ CD8+ T cells, or CD3+ CD4+ T cells).
  • the population of T cells having a memory-like phenotype does not express a senescent marker, e.g., CD57.
  • the population of T cells having a memory-like phenotype does not express an inhibitory receptor, e.g., OX40, 4-1BB, and/or ICOS.
  • binding of the anti-TCR ⁇ V antibody molecule results in expansion, e.g., at least about 1.1-50 fold expansion (e.g., at least about 1.5-40 fold, 2-35 fold, 3- 30 fold, 5-25 fold, 8-20 fold, or 10-15 fold expansion), of a subpopulation of T cells.
  • the anti-TCR ⁇ V antibody molecule-activated (e.g., expanded) subpopulation of T cells resemble T EMRA cells in high expression of CD45RA and/or low expression of CCR7.
  • the anti-TCR ⁇ V antibody molecule-activated (e.g., expanded) subpopulation of T cells do not display upregulation of the senescence markers CD57 and/or KLRG1.
  • the anti-TCR ⁇ V antibody molecule-activated (e.g., expanded) subpopulation of T cells do not display upregulation of co-stimulatory molecules CD27 and/or CD28.
  • the anti-TCR ⁇ V antibody molecule-activated (e.g., expanded) subpopulation of T cells are highly proliferative.
  • the anti-TCR ⁇ V antibody molecule-activated (e.g., expanded) subpopulation of T cells secrete IL-2.
  • expression of surface markers on T cells can be detected by a method disclosed herein, e.g., flow cytometry.
  • the proliferative capability of T cells can be detected by a method disclosed herein, e.g., a method described in Example 4.
  • cytokine expression of T cells can be detected by a method disclosed herein, e.g., a method described in Examples 10 and 21.
  • the expansion is at least about 1.1-10 fold expansion (e.g., at least about 1.1, 1.2, 1.3, 1.4, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, or 10 fold expansion).
  • the expansion is compared to expansion of a similar population of cells with an antibody that binds to a CD3 molecule, e.g., CD3 epsilon (CD3e) molecule; or a TCR alpha (TCR ⁇ ) molecule.
  • a CD3 molecule e.g., CD3 epsilon (CD3e) molecule; or a TCR alpha (TCR ⁇ ) molecule.
  • binding of the anti-TCR ⁇ V antibody molecule to a TCR ⁇ V region results in one, two, three, four, five, six, seven, eight, nine, ten or more (e.g., all) of the following: (i) reduced level, e.g., expression level, and/or activity of IL-1 ⁇ ; (ii) reduced level, e.g., expression level, and/or activity of IL-6; (iii) reduced level, e.g., expression level, and/or activity of TNF ⁇ ; (iv) increased level, e.g., expression level, and/or activity of IL-2; (v) a delay, e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more hours delay, in increased level, e.g., expression level, and/or activity of IL-2; (vi) a delay, e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 hours delay, in increased level, e.g., expression level, and/or activity
  • cancer cell killing e.g., as measured by an assay of Example 4; (x) increased level, e.g., expression level, and/or activity of IL-15; or (xi) increased Natural Killer (NK) cell proliferation, e.g., expansion, compared to an antibody that binds to: a CD3 molecule, e.g., CD3 epsilon (CD3e) molecule; or a TCR alpha (TCR ⁇ ) molecule.
  • a CD3 molecule e.g., CD3 epsilon (CD3e) molecule
  • TCR ⁇ TCR alpha
  • binding of the anti- TCR ⁇ V antibody molecule to a TCR ⁇ V region results in a reduction of at least 2, 5, 10, 20, 50, 100, or 200 fold, or at least 2-200 fold (e.g., 5-150, 10-100, 20-50 fold) in the expression level and or activity of IL-1 ⁇ as measured by an assay of Example 3.
  • binding of the anti- TCR ⁇ V antibody molecule to a TCR ⁇ V region results in a reduction of at least 2, 5, 10, 20, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 fold, or at least 2-1000 fold (e.g., 5-900, 10-800, 20-700, 50-600, 100-500, or 200-400 fold) in the expression level and or activity of IL-6 as measured by an assay of Example 3.
  • binding of the anti- TCR ⁇ V antibody molecule to a TCR ⁇ V region results in a reduction of at least 2, 5, 10, 20, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, or 2000 fold, or at least 2-2000 fold (e.g., 5- 1000, 10-900, 20-800, 50-700, 100-600, 200-500, or 300-400 fold) in the expression level and or activity of TNF ⁇ as measured by an assay of Example 3.
  • binding of the anti- TCR ⁇ V antibody molecule to a TCR ⁇ V region results in an increase of at least 2, 5, 10, 20, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, or 2000 fold, or at least 2-2000 fold (e.g., 5- 1000, 10-900, 20-800, 50-700, 100-600, 200-500, or 300-400 fold) in the expression level and or activity of IL-2 as measured by an assay of Example 3.
  • binding of the anti- TCR ⁇ V antibody molecule to a TCR ⁇ V region results in an increase of at least 2, 5, 10, 20, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, or 2000 fold, or at least 2-2000 fold (e.g., 5- 1000, 10-900, 20-800, 50-700, 100-600, 200-500, or 300-400 fold) in the expression level and or activity of IL-15 as measured by an assay of Example 4.
  • binding of the anti- TCR ⁇ V antibody molecule results in proliferation, e.g., expansion, e.g., at least about 1.1-50 fold expansion (e.g., at least about 1.5-40 fold, 2-35 fold, 3-30 fold, 5-25 fold, 8-20 fold, or 10- 15 fold expansion), of a population of Natural Killer (NK) cells.
  • expansion of NK cells is at least about 1.1-30 fold expansion (e.g., at least about 1.1, 1.2, 1.3, 1.4, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, or at least about 1.1-5, 5-10, 10-15, 15-20, 20-25, or 25-30 fold expansion).
  • the expansion of NK cells is measure by an assay of Example 4.
  • the expansion of NK cells by, e.g., binding of, the anti- TCR ⁇ V antibody molecule is compared to expansion of an otherwise similar population not contacted with the anti-TCR ⁇ V antibody molecule.
  • binding of the anti- TCR ⁇ V antibody molecule results in cell killing, e.g., target cell killing, e.g. cancer cell killing.
  • the cancer cell is a hematological cancer cell or a solid tumor cell. In some embodiments, the cancer cell is a multiple myeloma cell.
  • binding of the anti-TCR ⁇ V antibody molecule results in cell killing in vitro or in vivo. In some embodiments, cell killing is measured by an assay of Example 4. In some embodiments of any of the compositions disclosed herein, binding of the anti- TCR ⁇ V antibody molecule to a TCR ⁇ V region results in an increase or decrease of at least 2, 5, 10, 20, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, or 2000 fold, or at least 2-2000 fold (e.g., 5-1000, 10-900, 20-800, 50-700, 100-600, 200-500, or 300-400 fold) of any of the activities described herein compared the activity of 16G8 or TM23 murine antibody, or a humanized version thereof as described in US Patent 5,861,155.
  • an antibody molecule which binds, e.g., specifically binds, to a T cell receptor beta variable chain (TCR ⁇ V) region (an anti-TCR ⁇ V antibody molecule), wherein the anti-TCR ⁇ V antibody molecule: (i) binds specifically to an epitope on TCR ⁇ V, e.g., the same or similar epitope as the epitope recognized by an anti-TCR ⁇ V antibody molecule as described herein, e.g., a second anti-TCR ⁇ V antibody molecule; (ii) shows the same or similar binding affinity or specificity, or both, as an anti-TCR ⁇ V antibody molecule as described herein, e.g., a second anti-TCR ⁇ V antibody molecule; (iii) inhibits, e.g., competitively inhibits, the binding of an anti-TCR ⁇ V antibody molecule as described herein, e.g., a second anti-TCR ⁇ V antibody molecule; (iv)
  • the second anti-TCR ⁇ V antibody molecule comprises an antigen binding domain, comprising: a heavy chain complementarity determining region 1 (HC CDR1), a heavy chain complementarity determining region 2 (HC CDR2) and/or a heavy chain complementarity determining region 3 (HC CDR3) of SEQ ID NO: 1 or SEQ ID NO: 9; and/or a light chain complementarity determining region 1 (LC CDR1), a light chain complementarity determining region 2 (LC CDR2), and/or a light chain complementarity determining region 3 (LC CDR3) of SEQ ID NO: 2, SEQ ID NO: 10 or SEQ ID NO: 11.
  • HC CDR1 heavy chain complementarity determining region 1
  • HC CDR2 heavy chain complementarity determining region 2
  • HC CDR3 heavy chain complementarity determining region 3
  • binding of the anti- TCR ⁇ V antibody molecule to a TCR ⁇ V region results in a change in any (e.g., one, two, three, four or all) of (i)-(v) that is different, e.g., an increase or decrease, of at least 2, 5, 10, 20, 50, 100-fold, compared the activity of 16G8 or TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to a TCRBV family (e.g., gene family), e.g., a TCRBV gene family comprising subfamilies, e.g., as described herein.
  • a TCRBV family e.g., gene family
  • a TCRBV gene family comprising subfamilies, e.g., as described herein.
  • the TCRBV family e.g., gene family, comprises: a TCR ⁇ V6 subfamily, a TCR ⁇ V10 subfamily, a TCR ⁇ V12 subfamily, a TCR ⁇ V5 subfamily, a TCR ⁇ V7 subfamily, a TCR ⁇ V11 subfamily, a TCR ⁇ V14 subfamily, a TCR ⁇ V16 subfamily, a TCR ⁇ V18 subfamily, a TCR ⁇ V9 subfamily, a TCR ⁇ V13 subfamily, a TCR ⁇ V4 subfamily, a TCR ⁇ V3 subfamily, a TCR ⁇ V2 subfamily, a TCR ⁇ V15 v, a TCR ⁇ V30 subfamily, a TCR ⁇ V19 subfamily, a TCR ⁇ V27 subfamily, a TCR ⁇ V28 subfamily, a TCR ⁇ V24 subfamily, a TCR ⁇ V20 subfamily, TCR ⁇ V25 subfamily, a TCR ⁇ V29 subfamily, a TCR ⁇ V6 subfamily,
  • the anti-TCR ⁇ V antibody binds to a TCR ⁇ V6 subfamily chosen from: TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01.
  • TCR ⁇ V6 subfamily comprises TCR ⁇ V6-5*01.
  • the anti-TCR ⁇ V antibody binds to a TCR ⁇ V10 subfamily chosen from: TCR ⁇ V10-1*01, TCR ⁇ V10-1*02, TCR ⁇ V10-3*01 or TCR ⁇ V10-2*01. In some embodiments, the anti-TCR ⁇ V antibody binds to a TCR ⁇ V12 subfamily chosen from: TCR ⁇ V12-4*01, TCR ⁇ V12-3*01 or TCR ⁇ V12-5*01.
  • the anti-TCR ⁇ V antibody molecule does not bind to TCR ⁇ V12, or binds to TCR ⁇ V12 with an affinity and/or binding specificity that is less than (e.g., less than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V12 with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to a TCR ⁇ V region other than TCR ⁇ V12 (e.g., TCR ⁇ V region as described herein, e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • TCR ⁇ V region e.g., TCR ⁇ V region as described herein, e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10-
  • the anti-TCR ⁇ V antibody molecule does not comprise at least one CDR of Antibody B. In some embodiments of any of the compositions disclosed herein, the anti-TCR ⁇ V antibody molecule does not comprise the CDRs of Antibody B. In some embodiments of any of the compositions disclosed herein, the anti-TCR ⁇ V antibody binds to a TCR ⁇ V5 subfamily chosen from: TCR ⁇ V5-5*01, TCR ⁇ V5-6*01, TCR ⁇ V5-4*01, TCR ⁇ V5-8*01, TCR ⁇ V5-1*01.
  • the anti-TCR ⁇ V antibody binds to a TCR ⁇ V5 subfamily chosen from: TCR ⁇ V5-5*01, TCR ⁇ V5-6*01, TCR ⁇ V5-4*01, TCR ⁇ V5-8*01, TCR ⁇ V5-1*01.
  • the anti-TCR ⁇ V antibody molecule does not bind to TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01, or binds to TCR ⁇ V5- 5*01 or TCR ⁇ V5-1*01 with an affinity and/or binding specificity that is less than (e.g., less than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to a TCR ⁇ V region other than TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01 (e.g., TCR ⁇ V region as described herein, e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • TCR ⁇ V region e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity
  • the anti-TCR ⁇ V antibody molecule does not comprise at least one CDR of the TM23 murine antibody. In some embodiments of any of the compositions disclosed herein, the anti-TCR ⁇ V antibody molecule does not comprise the CDRs of the TM23 murine antibody. In some embodiments of any of the compositions disclosed herein, an anti-TCR ⁇ V antibody molecule disclosed herein does not comprise the sequence of a murine anti-rat TCR antibody R73, e.g., as disclosed in J Exp Med.1989 Jan 1; 169(1): 73–86, herein incorporated by reference in its entirety.
  • a multispecific antibody molecule disclosed herein does not comprise the sequence of a murine anti-rat TCR antibody R73, e.g., as disclosed in J Immunol.1993 Mar 15;150(6):2305-15, herein incorporated by reference in its entirety.
  • an anti-TCR ⁇ V antibody molecule disclosed herein does not comprise a viral peptide-MHC complex, e.g., as disclosed in Oncoimmunology.2016; 5(1): e1052930, herein incorporated by reference in its entirety.
  • a multispecific antibody molecule disclosed herein does not comprise a viral peptide-MHC complex, e.g., as disclosed in Oncoimmunology.2016; 5(1): e1052930, herein incorporated by reference in its entirety.
  • the anti-TCR ⁇ V antibody molecule binds to one or more (e.g., all) of the following TCR ⁇ V subfamilies: (i) TCR ⁇ V6 subfamily comprising, e.g., one or more of TCR ⁇ V6-4*01, TCR ⁇ V6- 4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01; (ii) TCR ⁇ V10 subfamily comprising, e.g., one or more of TCR ⁇ V10-1*01, TCR ⁇ V10- 1*02, TCR ⁇ V10-3*01 or TCR ⁇ V10-2*01; (iii) TCR ⁇ V5 subfamily comprising, e.g., one or more of TCR ⁇ V5-6*
  • the anti-TCR ⁇ V antibody molecule binds to one or more (e.g., all) of the following TCR ⁇ V subfamilies: (i) TCR ⁇ V6, e.g., one or more of TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6- 3*01 or TCR ⁇ V6-1*01; (ii) TCR ⁇ V10, e.g., one or more of TCR ⁇ V10-1*01, TCR ⁇ V10-1*02, TCR ⁇ V10-3*01 or TCR ⁇ V10-2*01; (iii) TCR ⁇ V12, e.g., one or more of TCR ⁇ V12-4*01, TCR ⁇ V12-3*01, or TCR
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V6, e.g., one or more of TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01.
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V6-5*01.
  • the anti-TCR ⁇ V antibody molecule does not bind to TCR ⁇ V12.
  • the anti-TCR ⁇ V antibody molecule does not bind to TCR ⁇ V5- 5*01 or TCR ⁇ V5-1*01.
  • a multispecific molecule e.g., a bispecific molecule
  • a first moiety e.g., a first immune cell engager
  • an antibody molecule which binds (e.g., specifically binds) to a T cell receptor beta variable region (TCR ⁇ V) (“anti- TCR ⁇ V antibody molecule”).
  • the multispecific molecule comprises a second moiety which comprises one or more of: a tumor-targeting moiety, a cytokine molecule, a stromal modifying moiety, or an anti-TCR ⁇ V antibody molecule other than the first moiety.
  • binding of the first moiety to the TCR ⁇ V region results in a cytokine profile, e.g., cytokine secretion profile, that differs from that of a T cell engager that binds to a receptor or molecule other than a TCR ⁇ V region (“a non-TCR ⁇ V-binding T cell engager”).
  • the disclosure provides a multispecific molecule, e.g., a bispecific molecule, comprising the anti-TCR ⁇ V antibody molecule disclosed herein.
  • the multispecific molecule further comprises: a tumor-targeting moiety, a cytokine molecule, an immune cell engager, e.g., a second immune cell engager, and/or a stromal modifying moiety.
  • a multispecific molecule e.g., a bispecific molecule, comprising: (i) a first moiety comprising a first immune cell engager comprising an anti-TCR ⁇ V antibody molecule disclosed herein; and (ii) a second moiety comprising one or more of: a tumor-targeting moiety; a second immune cell engager; a cytokine molecule or a stromal modifying moiety.
  • the disclosure provides an isolated nucleic acid molecule comprising a nucleotide sequence encoding an anti-TCR ⁇ V antibody molecule disclosed herein, or a nucleotide sequence having at least 75%, 80%, 85%, 90%, 95%, or 99% identity thereto.
  • the disclosure provides an isolated nucleic acid molecule comprising a nucleotide sequence encoding a multispecific molecule disclosed herein, or a nucleotide sequence having at least 75%, 80%, 85%, 90%, 95%, or 99% identity thereto.
  • the disclosure provides a vector, e.g., an expression vector, comprising a nucleotide sequence encoding an anti-TCR ⁇ V antibody molecule disclosed herein, or a nucleotide sequence having at least 75%, 80%, 85%, 90%, 95%, or 99% identity thereto.
  • a vector e.g., an expression vector, comprising a nucleotide sequence encoding a multispecific molecule disclosed herein, or a nucleotide sequence having at least 75%, 80%, 85%, 90%, 95%, or 99% identity thereto.
  • the disclosure provides a cell, e.g., host cell, e.g., a population of cells, comprising a nucleic acid molecule encoding an anti-TCR ⁇ V antibody molecule disclosed herein, or a nucleotide sequence having at least 75%, 80%, 85%, 90%, 95%, or 99% identity thereto.
  • a cell e.g., host cell, e.g., a population of cells, comprising a nucleic acid molecule encoding an anti-TCR ⁇ V antibody molecule disclosed herein, or a nucleotide sequence having at least 75%, 80%, 85%, 90%, 95%, or 99% identity thereto.
  • the cell or population of cells comprising a nucleic acid molecule encoding anti-TCR ⁇ V antibody molecule comprises: (i) a heavy chain comprising: a variable region (VH), e.g., a VH listed in Tables 1-2 or 10-13, or a sequence having at least 75%, 80%, 85%, 90%, 95%, or 99% identity thereto; and one or more heavy chain constant regions, e.g., as described herein; and/or (ii) a light chain comprising: a variable region (VL) e.g., a VL listed in Tables 1-2 or 10-13, or a sequence having at least 75%, 80%, 85%, 90%, 95%, or 99% identity thereto; and a light chain constant region, e.g., as described herein, e.g., a kappa chain constant region comprising the sequence of SEQ ID NO: 39, or a sequence with at least 85%, 90%, 95%, or
  • the cell or population of cells further comprises an IgJ heavy chain constant region or a fragment thereof.
  • the IgJ heavy chain constant region comprises the sequence of SEQ ID NO: 76 or a sequence with at least 85%, 90%, 95%, or 99% sequence identity thereto.
  • the IgJ is comprised in, e.g., expressed in, the same cell or population of cells comprising, e.g., expressing, the anti-TCR ⁇ V antibody molecule, e.g., the heavy chain and/or the light chain of the anti-TCR ⁇ V antibody molecule.
  • the IgJ is expressed in a different cell or population of cells than the cell or population of cells comprising, e.g., expressing, the anti-TCR ⁇ V antibody molecule, e.g., the heavy chain and/or the light chain of the anti-TCR ⁇ V antibody molecule.
  • the disclosure provides a cell, e.g., host cell, e.g., a population of cells, comprising a nucleic acid molecule encoding a multispecific molecule disclosed herein, or a nucleotide sequence having at least 75%, 80%, 85%, 90%, 95%, or 99% identity thereto.
  • an anti-TCR ⁇ V antibody molecule for use in the manufacture of a medicament for treating a disease, e.g., cancer, in a subject.
  • a multispecific molecule comprising an anti-TCR ⁇ V antibody molecule for use in the manufacture of a medicament for treating a disease, e.g., cancer, in a subject.
  • the disclosure provides a method of making, e.g., producing, an anti- TCR ⁇ V antibody molecule, a multispecific molecule described herein, comprising culturing a host cell described herein, under suitable conditions.
  • the conditions comprise, e.g., conditions suitable for gene expression and/or homo- or heterodimerization.
  • the disclosure provides a pharmaceutical composition comprising an anti-TCR ⁇ V antibody molecule, or a multispecific molecule described herein, and a pharmaceutically acceptable carrier, excipient, or stabilizer.
  • the disclosure provides a method of modulating, e.g., enhancing, an immune response in a subject comprising administering to the subject an effective amount of an antibody molecule which binds (e.g., specifically binds) to a T cell receptor beta variable region (TCR ⁇ V) (“anti-TCR ⁇ V antibody molecule”).
  • TCR ⁇ V T cell receptor beta variable region
  • the disclosure provides a method of modulating, e.g., enhancing, an immune response in a subject comprising administering to the subject an effective amount of a multispecific molecule disclosed herein.
  • the method comprises expanding, e.g., increasing the number of, an immune cell population in the subject.
  • the disclosure provides a method of expanding, e.g., increasing the number of, an immune cell population comprising, contacting the immune cell population with an effective amount of an antibody molecule which binds (e.g., specifically binds) to a T cell receptor beta variable region (TCR ⁇ V) (“anti-TCR ⁇ V antibody molecule”).
  • TCR ⁇ V T cell receptor beta variable region
  • the disclosure provides a method of expanding, e.g., increasing the number of, an immune cell population comprising, contacting the immune cell population with an effective amount of a multispecific molecule disclosed herein.
  • the expansion occurs in vivo or ex vivo (e.g., in vitro).
  • the immune cell population comprises a TCR ⁇ V expressing cell, e.g., a TCR ⁇ V+ cell.
  • the TCR ⁇ V expressing cell is a T cell, e.g., a CD8+ T cell, a CD3+ T cell or a CD4+ T cell.
  • the immune cell population comprises a T cell (e.g., a CD4 T cell, or a CD8 T cell). In some embodiments, the immune cell population comprises a T cell having a memory-like phenotype, e.g., CD45RA+ CCR7-. In some embodiments, the immune cell population comprises an effector T cell or a memory T cell (e.g., a memory effector T cell (e.g., TEM cell, e.g., TEMRA cell), or a tumor infiltrating lymphocyte (TIL)). In some embodiments, the immune cell population comprises a T cell, a Natural Killer cell, a B cell, or a myeloid cell.
  • TIL tumor infiltrating lymphocyte
  • the immune cell population is obtained from a healthy subject.
  • a method of treating a disease e.g., cancer, in a subject comprising administering to the subject an effective amount, e.g., a therapeutically effective amount, of an anti-TCR ⁇ V antibody molecule or a multispecific molecule comprising an anti- TCR ⁇ V antibody molecule disclosed herein, thereby treating the disease.
  • a composition comprising an anti-TCR ⁇ V antibody molecule or a multispecific molecule comprising an anti-TCR ⁇ V antibody molecule disclosed herein, for use in the treatment of a disease, e.g., cancer, in a subject.
  • the disease is a cancer, e.g., a solid tumor or a hematological cancer, or a metastatic lesion.
  • the method further comprises administering a second agent, e.g., therapeutic agent, e.g., as described herein.
  • second agent comprises a therapeutic agent (e.g., a chemotherapeutic agent, a biologic agent, hormonal therapy), radiation, or surgery.
  • therapeutic agent is selected from: a chemotherapeutic agent, or a biologic agent.
  • a method of targeting e.g., directing or re-directing, a therapy, e.g., treatment, to a T cell, e.g., in a subject, e.g., having a disease, e.g., cancer, comprising administering an effective amount of: (i) an anti-TCR ⁇ V antibody disclosed herein; and (ii) the therapy, e.g., a tumor targeting therapy (e.g., an antibody that binds to a cancer antigen), e.g., as described herein, thereby targeting the T cell.
  • a tumor targeting therapy e.g., an antibody that binds to a cancer antigen
  • (i) and (ii) are conjugated, e.g., linked.
  • (i) and (ii) are administered simultaneously or concurrently.
  • the method results in: reduced cytokine release syndrome (CRS) (e.g., lesser duration of CRS or no CRS), or a reduced severity of CRS (e.g., absence of severe CRS, e.g., CRS grade 4 or 5) compared to administration of (ii) alone.
  • CRS is assessed by an assay of Example 3.
  • the method results in: reduced neurotoxicity (NT) (e.g., lesser duration of NT or no NT), or a reduced severity of NT (e.g., absence of severe NT) compared to administration of (ii) alone.
  • the disclosure provides, a method of targeting a T cell, e.g., in a subject having a disease, e.g., cancer, with an anti-TCR ⁇ V antibody disclosed herein or a multispecific molecule comprising an anti-TCR ⁇ V antibody disclosed herein.
  • the disclosure provides a method of treating, e.g., preventing or reducing, cytokine release syndrome (CRS) and/or neurotoxicity (NT) in a subject, e.g., CRS and/or NT associated with a treatment, e.g., a previously administered treatment, comprising administering to the subject an effective amount of an anti-TCR ⁇ V antibody disclosed herein or a multispecific molecule comprising an anti-TCR ⁇ V antibody disclosed herein, wherein, the subject has a disease, e.g., a cancer, thereby treating, e.g., preventing or reducing, CRS and/or NT in the subject.
  • CRS cytokine release syndrome
  • NT neurotoxicity
  • the disclosure provides a composition comprising an anti-TCR ⁇ V antibody disclosed herein or a multispecific molecule comprising an anti-TCR ⁇ V antibody disclosed herein, for use in the treatment, e.g., prevention or reduction, of cytokine release syndrome (CRS) and/or neurotoxicity (NT) in a subject, e.g., CRS and/or NT associated with a treatment, e.g., a previously administered treatment, comprising administering to the subject an effective amount of the anti-TCR ⁇ V antibody, wherein the subject has a disease, e.g., a cancer.
  • CRS cytokine release syndrome
  • NT neurotoxicity
  • the anti- TCR ⁇ V antibody is administered concurrently with or after the administration of the treatment associated with CRS and/or NT.
  • a method of expanding, e.g., increasing the number of, an immune cell population comprising, contacting the immune cell population with an antibody molecule, e.g., humanized antibody molecule, which binds, e.g., specifically binds, to a T cell receptor beta variable chain (TCR ⁇ V) region (e.g., anti-TCR ⁇ V antibody molecule described herein or a multispecific molecule comprising an anti-TCR ⁇ V antibody molecule described herein), thereby expanding the immune cell population.
  • TCR ⁇ V T cell receptor beta variable chain
  • the expansion occurs in vivo or ex vivo (e.g., in vitro).
  • a method of evaluating a subject having a cancer comprising acquiring a value of the status of a TCR ⁇ V molecule for the subject, wherein said value comprises a measure of the presence of, e.g., level or activity of, a TCR ⁇ V molecule in a sample from the subject, wherein the value of the status of a TCR ⁇ V molecule is higher, e.g., increased, in a sample from the subject compared to a reference value, e.g., a value from a healthy subject, e.g., a subject that does not have cancer.
  • the disclosure provides a method of treating a subject having a cancer, the method comprising (i) acquiring a value of the status of a TCR ⁇ V molecule for the subject, wherein said value comprises a measure of the presence of, e.g., level or activity of, a TCR ⁇ V molecule in a sample from the subject, and (ii) responsive to said value, administering an effective amount of an anti- TCR ⁇ V antibody molecule described herein (e.g., a TCR ⁇ V agonist) to the subject, thereby treating the cancer.
  • an anti- TCR ⁇ V antibody molecule described herein e.g., a TCR ⁇ V agonist
  • the value is higher, e.g., increased, in a sample from the subject compared to a reference value, e.g., a value from a healthy subject, e.g., a subject that does not have cancer.
  • a composition comprising an anti- TCR ⁇ V antibody molecule for use in the treatment of a subject having a cancer, comprising (i) acquiring a value of the status of a TCR ⁇ V molecule for the subject, wherein said value comprises a measure of the presence of, e.g., level or activity of, a TCR ⁇ V molecule in a sample from the subject, and (ii) responsive to said value, administering an effective amount of an anti- TCR ⁇ V antibody molecule described herein (e.g., a TCR ⁇ V agonist) to the subject.
  • an anti- TCR ⁇ V antibody molecule described herein e.g., a TCR ⁇ V agonist
  • a value of the status of one or more TCR ⁇ V molecules for the subject comprising: (i) acquiring a value of the status of one or more TCR ⁇ V molecules for the subject, e.g., in a biological sample from the subject, wherein said value comprises a measure of the presence of, e.g., level or activity of, a TCR ⁇ V molecule in a sample from the subject, and (ii) determining whether the value for the one or more TCR ⁇ V molecules is higher, e.g., increased, in a sample from the subject compared to a reference value, e.g., a value from a healthy subject, e.g., a subject that does not have cancer, wherein a value that is higher, e.g., increased, in the subject relative to the reference, e.g., healthy subject, is indicative of the presence of cancer in the subject.
  • the disclosure provides, a method of treating a subject having cancer, the method comprising: (i) acquiring a value of the status of one or more TCR ⁇ V molecules for the subject, e.g., in a biological sample from the subject, wherein said value comprises a measure of the presence of, e.g., level or activity of, a TCR ⁇ V molecule in a sample from the subject; (ii) determining whether the value for the one or more TCR ⁇ V molecules is higher, e.g., increased, in a sample from the subject compared to a reference value, e.g., a value from a healthy subject, e.g., a subject that does not have cancer, and (iii) if a value that is higher, e.g., increased, in the subject relative to the reference value is determined, administering an effective amount of an anti- TCR ⁇ V antibody molecule, e.g., as described herein (e.g., a TCR ⁇ V agonist), to
  • compositions comprising anti- TCR ⁇ V antibody molecule for use in a method of treating a subject having a cancer, comprising (i) acquiring a value of the status of one or more TCR ⁇ V molecules for the subject, e.g., in a biological sample from the subject, wherein said value comprises a measure of the presence of, e.g., level or activity of, a TCR ⁇ V molecule in a sample from the subject; (ii) determining whether the value for the one or more TCR ⁇ V molecules is higher, e.g., increased, in a sample from the subject compared to a reference value, e.g., a value from a healthy subject, e.g., a subject that does not have cancer, and (iii) if a value that is higher, e.g., increased, in the subject relative to the reference value is determined, administering an effective amount of an anti- TCR ⁇ V antibody molecule, e.g., as described
  • the status is indicative of the subject having cancer, or a symptom thereof. In some embodiments of any of the methods of treatment or composition for use disclosed herein, the status is indicative of responsiveness to a therapy, e.g., a therapy comprising an anti-TCR ⁇ V antibody molecule, e.g., as described herein. In some embodiments of any of the methods of treatment or composition for use disclosed herein, the value of the status is determined, e.g., measured, by an assay described herein.
  • a method of treating a subject having a cancer comprising administering to the subject an effective amount of an anti-TCRBV antibody molecule described herein, wherein the subject has a higher, e.g., increased, level or activity of one or more TCRBV molecules, e.g., as described herein, compared to a reference level or activity of one or more TCRBV molecules, e.g., in a healthy subject, e.g., a subject not having a cancer
  • the disclosure provides, method of treating a subject having a cancer, comprising (i) isolating a biological sample from the subject; e.g., a peripheral blood sample, biopsy sample, or bone marrow sample; and (ii) acquiring a value of the status of one or more TCR ⁇ V molecules for the subject, e.g., in the biological sample from the subject, wherein said value comprises a measure of the presence of, e.g., level or activity of, a T
  • a method of expanding a population of immune effector cells from a subject having a cancer comprising: (i) isolating a biological sample comprising a population of immune effector cells from the subject; e.g., a peripheral blood sample, biopsy sample, or bone marrow sample; (ii) acquiring a value of the status of one or more TCR ⁇ V molecules for the subject, e.g., in the biological sample from the subject, wherein said value comprises a measure of the presence of, e.g., level or activity of, a TCR ⁇ V molecule in a sample from the subject compared to a reference value, e.g., a sample from a health subject, wherein a value that is higher, e.g., increased, in the subject relative to the reference, e.g., healthy subject, is indicative of the presence of cancer in the subject, and (iii) contacting the biological sample comprising a population of immune effector cells with an anti- TCR ⁇ V
  • the method further comprises administering the population of immune effector cells contacted with the anti-TCR ⁇ V antibody molecule to the subject.
  • a method of expansion, or method of treatment, or composition for use disclosed herein comprises measuring T cell function (e.g., cytotoxic activity, cytokine secretion, or degranulation) in the population of immune effector cells, e.g., compared to a reference population, e.g., an otherwise similar population not contacted with the anti-TCR ⁇ V antibody molecule or a population of immune effector cells obtained from a healthy subject (e.g., a subject that does not have a cancer).
  • T cell function e.g., cytotoxic activity, cytokine secretion, or degranulation
  • the biological sample comprising the population of immune effector cells is contacted with an anti- TCR ⁇ V antibody molecule that binds to the one or more TCR ⁇ V molecules (e.g., the same TCR ⁇ V molecule) identified as being higher, e.g., increased, in the biological sample.
  • the biological sample comprising the population of immune effector cells is contacted with an anti- TCR ⁇ V antibody molecule that does not bind to the one or more TCR ⁇ V molecules (e.g., a different TCR ⁇ V molecule) identified as being higher, e.g., increased, in the biological sample.
  • a method of identifying one or more TCR ⁇ V molecules associated with a cancer comprising: (i) acquiring a status for a plurality of TCR ⁇ V molecules in a biological sample from a first subject having the disease and in a biological sample from a second subject not having the disease; and (ii) determining whether the level or activity of one or more of the TCR ⁇ V molecules is higher, e.g., increased, in the first subject relative to the second subject; thereby identifying one or more TCR ⁇ V molecules associated with the cancer.
  • the one or more of the TCR ⁇ V molecules comprises one or more, (e.g., all) of the following TCR ⁇ V subfamilies: (i) TCR ⁇ V6 subfamily comprising, e.g., one or more of TCR ⁇ V6-4*01, TCR ⁇ V6- 4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01; (ii) TCR ⁇ V10 subfamily comprising, e.g., one or more of TCR ⁇ V10-1*01, TCR ⁇ V10- 1*02, TCR ⁇ V10-3*01 or TCR ⁇ V10-2*01; (iii) TCR ⁇ V5 subfamily comprising, e.g., one or more of TCR ⁇ V5
  • the cancer is a solid tumor including but not limited to: melanoma, pancreatic (e.g., pancreatic adenocarcinoma) cancer, breast cancer, colorectal cancer (CRC), lung cancer (e.g., small or non- small cell lung cancer), skin cancer, ovarian cancer, or liver cancer.
  • pancreatic e.g., pancreatic adenocarcinoma
  • breast cancer colorectal cancer (CRC)
  • lung cancer e.g., small or non- small cell lung cancer
  • skin cancer e.g., ovarian cancer, or liver cancer.
  • the cancer is a hematological cancer including, but not limited to: a B-cell or T cell malignancy, e.g., Hodgkin’s lymphoma, Non-Hodgkin’s lymphoma (e.g., B cell lymphoma, diffuse large B cell lymphoma (DLBCL), follicular lymphoma, chronic lymphocytic leukemia (B-CLL), mantle cell lymphoma, marginal zone B-cell lymphoma, Burkitt lymphoma, lymphoplasmacytic lymphoma, hairy cell leukemia), acute myeloid leukemia (AML), chronic myeloid leukemia, myelodysplastic syndrome, multiple myeloma, and acute lymphocytic leukemia.
  • a B-cell or T cell malignancy e.g., Hodgkin’s lymphoma, Non-Hodgkin’s lymphoma (e.g., B cell lymphoma, diffuse
  • a higher, e.g., increased, level or activity of one or more TCR ⁇ V molecules in a subject is indicative of a bias, e.g., a preferential expansion, e.g., clonal expansion, of T cells expressing said one or more TCR ⁇ V molecules in the subject.
  • a subject having a cancer e.g., as disclosed herein, has a higher, e.g., increased, level or activity of one or more TCR ⁇ V molecules associated with the cancer.
  • the TCR ⁇ V molecule is associated with, e.g., recognizes, a cancer antigen, e.g., a cancer associated antigen or a neoantigen.
  • a cancer antigen e.g., a cancer associated antigen or a neoantigen.
  • the subject has B-CLL.
  • a subject having B-CLL has a higher, e.g., increased, level or activity of one or more TCR ⁇ V molecules, e.g., one or more TCR ⁇ V molecules comprising: (i) TCR ⁇ V6 subfamily comprising, e.g., TCR ⁇ V6-4*01, TCR ⁇ V6- 4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01; (ii) TCR ⁇ V5 subfamily comprising TCR ⁇ V5- 6*01, TCR ⁇ V5-4*01, or TCR ⁇ V5-8*01; (iii) TCR ⁇ V3 subfamily comprising TCR ⁇ V3-1*01; (iv) TCR ⁇ V2 subfamily comprising TCR ⁇ V2*01; or (v) TCR ⁇ V6 subfamily
  • a subject having B-CLL has a higher, e.g., increased, level or activity of a TCR ⁇ V6 subfamily comprising, e.g., TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6- 9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01.
  • a TCR ⁇ V6 subfamily comprising, e.g., TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6- 9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01.
  • the subject is administered an anti-TCR ⁇ V molecule (e.g., an agonistic anti- TCR ⁇ V molecule as described herein) that binds to one or more members of the TCR ⁇ V6 subfamily.
  • administration of the an anti- TCR ⁇ V molecule results in expansion of immune cells expressing one or more members of the TCR ⁇ V6 subfamily.
  • a subject having B-CLL has a higher, e.g., increased, level or activity of a TCR ⁇ V5 subfamily comprising TCR ⁇ V5-6*01, TCR ⁇ V5-4*01, or TCR ⁇ V5- 8*01.
  • the subject is administered an anti-TCR ⁇ V molecule (e.g., an agonistic anti- TCR ⁇ V molecule as described herein) that binds to one or more members of the TCR ⁇ V5 subfamily.
  • administration of the an anti-TCR ⁇ V molecule results in expansion of immune cells expressing one or more members of the TCR ⁇ V5 subfamily.
  • a subject having B-CLL has a higher, e.g., increased, level or activity of a TCR ⁇ V3 subfamily comprising TCR ⁇ V3-1*01.
  • the subject is administered an anti-TCR ⁇ V molecule (e.g., an agonistic anti- TCR ⁇ V molecule as described herein) that binds to one or more members of the TCR ⁇ V3 subfamily.
  • administration of the an anti-TCR ⁇ V molecule results in expansion of immune cells expressing one or more members of the TCR ⁇ V3 subfamily.
  • a subject having B-CLL has a higher, e.g., increased, level or activity of a TCR ⁇ V2 subfamily comprising TCR ⁇ V2*01.
  • the subject is administered an anti-TCR ⁇ V molecule (e.g., an agonistic anti- TCR ⁇ V molecule as described herein) that binds to one or more members of the TCR ⁇ V2 subfamily.
  • administration of the an anti-TCR ⁇ V molecule results in expansion of immune cells expressing one or more members of the TCR ⁇ V2 subfamily.
  • a subject having B-CLL has a higher, e.g., increased, level or activity of a TCR ⁇ V19 subfamily comprising TCR ⁇ V19*01, or TCR ⁇ V19*02.
  • the subject is administered an anti-TCR ⁇ V molecule (e.g., an agonistic anti- TCRBV molecule as described herein) that binds to one or more members of the TCR ⁇ V19 subfamily.
  • administration of the an anti-TCR ⁇ V molecule results in expansion of immune cells expressing one or more members of the TCR ⁇ V19 subfamily.
  • the subject has melanoma.
  • a subject having melanoma has a higher, e.g., increased, level or activity of one or more TCR ⁇ V molecules, e.g., one or more TCR ⁇ V molecules comprising the TCR ⁇ V6 subfamily comprising, e.g., TCR ⁇ V6-4*01, TCR ⁇ V6- 4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01.
  • the subject is administered an anti-TCR ⁇ V molecule (e.g., an agonistic anti-TCR ⁇ V molecule as described herein) that binds to one or more members of the TCR ⁇ V6 subfamily.
  • administration of the an anti-TCR ⁇ V molecule results in expansion of immune cells expressing one or more members of the TCR ⁇ V6 subfamily.
  • the subject has DLBCL.
  • a subject having melanoma has a higher, e.g., increased, level or activity of one or more TCR ⁇ V molecules, e.g., one or more TCR ⁇ V molecules comprising: (i) TCR ⁇ V13 subfamily comprising TCR ⁇ V13*01; (ii) TCR ⁇ V3 subfamily comprising TCR ⁇ V3-1*01; or (iii) TCR ⁇ V23 subfamily.
  • a subject having DLBCL has a higher, e.g., increased, level or activity of a TCR ⁇ V13 subfamily comprising TCR ⁇ V13*01.
  • the subject is administered an anti-TCR ⁇ V molecule (e.g., an agonistic anti- TCR ⁇ V molecule as described herein) that binds to one or more members of the TCR ⁇ V13 subfamily.
  • administration of the an anti-TCR ⁇ V molecule results in expansion of immune cells expressing one or more members of the TCR ⁇ V13 subfamily.
  • a subject having DLBCL has a higher, e.g., increased, level or activity of a TCR ⁇ V3 subfamily comprising TCR ⁇ V3-1*01.
  • the subject is administered an anti-TCR ⁇ V molecule (e.g., an agonistic anti- TCR ⁇ V molecule as described herein) that binds to one or more members of the TCR ⁇ V3 subfamily.
  • administration of the an anti-TCR ⁇ V molecule results in expansion of immune cells expressing one or more members of the TCR ⁇ V3 subfamily.
  • a subject having DLBCL has a higher, e.g., increased, level or activity of a TCR ⁇ V23 subfamily.
  • the subject is administered an anti- TCR ⁇ V molecule (e.g., an agonistic anti- TCR ⁇ V molecule as described herein) that binds to one or more members of the TCR ⁇ V23 subfamily.
  • administration of the an anti-TCR ⁇ V molecule results in expansion of immune cells expressing one or more members of the TCR ⁇ V23 subfamily.
  • the subject has CRC.
  • a subject having melanoma has a higher, e.g., increased, level or activity of one or more TCR ⁇ V molecules, e.g., one or more TCR ⁇ V molecules comprising: (i) TCR ⁇ V19 subfamily comprising TCR ⁇ V19*01, or TCR ⁇ V19*02; (ii) TCR ⁇ V12 subfamily comprising TCR ⁇ V12-4*01, TCR ⁇ V12-3*01, or TCR ⁇ V12-5*01; (iii) TCR ⁇ V16 subfamily comprising TCR ⁇ V16*01; or (iv) TCR ⁇ V21 subfamily.
  • a subject having CRC has a higher, e.g., increased, level or activity of a TCR ⁇ V19 subfamily comprising TCR ⁇ V19*01, or TCR ⁇ V19*02.
  • the subject is administered an anti-TCR ⁇ V molecule (e.g., an agonistic anti- TCR ⁇ V molecule as described herein) that binds to one or more members of the TCR ⁇ V19 subfamily.
  • administration of the an anti-TCR ⁇ V molecule results in expansion of immune cells expressing one or more members of the TCR ⁇ V19 subfamily.
  • a subject having CRC has a higher, e.g., increased, level or activity of a TCR ⁇ V12 subfamily comprising TCR ⁇ V12-4*01, TCR ⁇ V12-3*01, or TCR ⁇ V12-5*01.
  • the subject is administered an anti-TCR ⁇ V molecule (e.g., an agonistic anti- TCR ⁇ V molecule as described herein) that binds to one or more members of the TCR ⁇ V12 subfamily.
  • administration of the an anti-TCR ⁇ V molecule results in expansion of immune cells expressing one or more members of the TCR ⁇ V12 subfamily.
  • a subject having CRC has a higher, e.g., increased, level or activity of a TCR ⁇ V16 subfamily comprising TCR ⁇ V16*01.
  • the subject is administered an anti-TCR ⁇ V molecule (e.g., an agonistic anti- TCR ⁇ V molecule as described herein) that binds to one or more members of the TCR ⁇ V16 subfamily.
  • administration of the an anti-TCR ⁇ V molecule results in expansion of immune cells expressing one or more members of the TCR ⁇ V16 subfamily.
  • a subject having CRC has a higher, e.g., increased, level or activity of a TCR ⁇ V21 subfamily.
  • the subject is administered an anti- TCR ⁇ V molecule (e.g., an agonistic anti- TCR ⁇ V molecule as described herein) that binds to one or more members of the TCR ⁇ V21 subfamily.
  • administration of the an anti-TCR ⁇ V molecule results in expansion of immune cells expressing one or more members of the TCR ⁇ V21 subfamily.
  • an anti-TCR ⁇ V antibody molecule which: (i) binds specifically to an epitope on TCR ⁇ V, e.g., the same or similar epitope as the epitope recognized by an anti-TCR ⁇ V antibody molecule as described herein, e.g., a second anti-TCR ⁇ V antibody molecule; (ii) shows the same or similar binding affinity or specificity, or both, as an anti-TCR ⁇ V antibody molecule as described herein, e.g., a second anti-TCR ⁇ V antibody molecule; (iii) inhibits, e.g., competitively inhibits, the binding of an anti-TCR ⁇ V antibody molecule as described herein, e.g., a second anti-TCR ⁇ V antibody molecule; (iv) binds the same or an overlapping epitope with an anti-TCR ⁇ V antibody molecule as described herein, e.g., a second anti-
  • the second anti-TCR ⁇ V antibody molecule comprises an antigen binding domain, comprising: a heavy chain complementarity determining region 1 (HC CDR1), a heavy chain complementarity determining region 2 (HC CDR2) and/or a heavy chain complementarity determining region 3 (HC CDR3) of SEQ ID NO: 1 or SEQ ID NO: 9; and/or a light chain complementarity determining region 1 (LC CDR1), a light chain complementarity determining region 2 (LC CDR2), and/or a light chain complementarity determining region 3 (LC CDR3) of SEQ ID NO: 2, SEQ ID NO: 10 or SEQ ID NO: 11.
  • HC CDR1 heavy chain complementarity determining region 1
  • HC CDR2 heavy chain complementarity determining region 2
  • HC CDR3 heavy chain complementarity determining region 3
  • the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a heavy chain complementarity determining region 1 (HC CDR1), a heavy chain complementarity determining region 2 (HC CDR2) and/or a heavy chain complementarity determining region 3 (HC CDR3) of SEQ ID NO: 1 or SEQ ID NO: 9, or a sequence disclosed in Table 1; or (ii) a light chain complementarity determining region 1 (LC CDR1), a light chain complementarity determining region 2 (LC CDR2), and/or a light chain complementarity determining region 3 (LC CDR3) of SEQ ID NO: 2, SEQ ID NO: 10 or SEQ ID NO: 11, or a sequence disclosed in Table 1.
  • HC CDR1 heavy chain complementarity determining region 1
  • HC CDR2 heavy chain complementarity determining region 2
  • HC CDR3 heavy chain complementarity determining region 3
  • the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all (e.g., three) of a LC CDR1, a LC CDR2 and a LC CDR3 of SEQ ID NO: 2, SEQ ID NO: 10 or SEQ ID NO: 11.
  • VL light chain variable region
  • the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all (e.g., three) of a HC CDR1, a HC CDR2 and a HC CDR3 of SEQ ID NO:1 or SEQ ID NO: 9.
  • VH heavy chain variable region
  • the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a VL comprising: a LC CDR1 amino acid sequence of SEQ ID NO: 6 (or an amino acid sequence with not more than 1, 2, 3 or 4 modifications, e.g., substitutions, additions or deletions thereof), a LC CDR2 amino acid sequence of SEQ ID NO:7 (or an amino acid sequence with not more than 1, 2, 3 or 4 modifications, e.g., substitutions, additions or deletions thereof), and/or a LC CDR3 amino acid sequence of SEQ ID NO:8 (or an amino acid sequence with not more than 1, 2, 3 or 4 modifications, e.g., substitutions, additions or deletions thereof); and/or (ii) a VH comprising: a HC CDR1 amino acid sequence of SEQ ID NO: 3 (or an amino acid sequence with not more than 1, 2, 3 or 4 modifications, e.g., substitutions,
  • the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: a variable heavy chain (VH) of SEQ ID NO: 9 or SEQ ID NO: 1312, or a sequence having at least about 75%, 80%, 85%, 90%, 95%, or 99% sequence identity thereto; and/or a variable light chain (VL) of SEQ ID NO: 10 or SEQ ID NO: 11 or SEQ ID NO: 1314, or a sequence having at least about 75%, 80%, 85%, 90%, 95%, or 99% sequence identity thereto.
  • VH variable heavy chain
  • VL variable light chain
  • the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising the VH amino acid sequence of SEQ ID NO: 9 and the VL amino acid sequence of SEQ ID NO: 10. In some embodiments of any of the compositions or methods disclosed herein, the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising the VH amino acid sequence of SEQ ID NO: 9 and the VL amino acid sequence of SEQ ID NO: 11. In some embodiments of any of the compositions or methods disclosed herein, the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising the VH amino acid sequence of SEQ ID NO: 1312 and the VL amino acid sequence of SEQ ID NO: 1314.
  • the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising the amino acid sequence of SEQ ID NO: 1337, or a sequence with at least 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereto. In some embodiments of any of the compositions or methods disclosed herein, the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising the amino acid sequence of SEQ ID NO: 1500, or a sequence with at least 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereto.
  • the anti- TCR ⁇ V antibody molecule comprises a heavy chain comprising a framework region, e.g., framework region 3 (FR3), comprising one or both of: (i) a Threonine at position 73, e.g., a substitution at position 73 according to Kabat numbering, e.g., a Glutamic Acid to Threonine substitution; or (ii) a Glycine at position, e.g., a substitution at position 94 according to Kabat numbering, e.g., a Arginine to Glycine substitution.
  • the substitution is relative to a human germline heavy chain framework region sequence.
  • the anti- TCR ⁇ V antibody molecule comprises a light chain comprising a framework region, e.g., framework region 1 (FR1), comprising a Phenylalanine at position 10, e.g., a substitution at position 10 according to Kabat numbering, e.g., a Serine to Phenyalanine substitution.
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti- TCR ⁇ V antibody molecule comprises a light chain comprising a framework region, e.g., framework region 2 (FR2), comprising one or both of: (i) a Histidine at position 36, e.g., a substitution at position 36 according to Kabat numbering, e.g., a Tyrosine to Histidine substitution; or (ii) an Alanine at position 46, e.g., a substitution at position 46 according to Kabat numbering, e.g., a Arginine to Alanine substitution.
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti- TCR ⁇ V antibody molecule comprises a light chain comprising a framework region, e.g., framework region 3 (FR3), comprising a Phenylalanine at position 87, e.g., a substitution at position 87 according to Kabat numbering, e.g., a Tyrosine to Phenyalanine substitution.
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti- TCR ⁇ V antibody molecule binds to TCR ⁇ V6, e.g., TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6- 9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01.
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V6-5*01.
  • TCR ⁇ V6 e.g., TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6- 3*01 or TCR ⁇ V6-1*01, is recognized, e.g., bound, by SEQ ID NO: 1 and/or SEQ ID NO: 2.
  • TCR ⁇ V6 e.g., TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01, is recognized, e.g., bound, by SEQ ID NO: 9 and/or SEQ ID NO: 10.
  • TCR ⁇ V6 e.g., TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6-9*01, TCR ⁇ V6- 8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01, is recognized, e.g., bound, by SEQ ID NO: 9 and/or SEQ ID NO: 11.
  • TCR ⁇ V6-5*01 is recognized, e.g., bound by SEQ ID NO: 9 and/or SEQ ID NO: 10, or a sequence having at least about 75%, 80%, 85%, 90%, 95%, or 99% sequence identity thereto.
  • TCR ⁇ V6-5*01 is recognized, e.g., bound by SEQ ID NO: 9 and/or SEQ ID NO: 11, or a sequence having at least about 75%, 80%, 85%, 90%, 95%, or 99% sequence identity thereto.
  • the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a heavy chain complementarity determining region (HC CDR1), a HC CDR2 and/or a HC CDR3 of SEQ ID NO: 15, SEQ ID NO: 23, SEQ ID NO: 24 or SEQ ID NO: 25, or a sequence disclosed in Table 2; and/or (ii) a light chain complementarity determining region 1 (LC CDR1), a LC CDR2, and/or a LC CDR3 of SEQ ID NO: 16, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 or SEQ ID NO:30, or a sequence disclosed in Table 2.
  • HC CDR1 heavy chain complementarity determining region
  • HC CDR2 heavy chain complementarity determining region 2
  • a HC CDR3 of SEQ ID NO: 15, SEQ ID NO: 23, SEQ ID NO: 24 or SEQ ID NO: 25, or a sequence disclosed in Table 2
  • the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a light chain variable region (VL) comprising one, two or all of a LC CDR1, a LC CDR2 and a LC CDR3 of SEQ ID NO: 16, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 or SEQ ID NO:30.
  • VL light chain variable region
  • the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a heavy chain variable region (VH) comprising one, two or all of a HC CDR1, a HC CDR2 and a HC CDR3 of SEQ ID NO: 15, SEQ ID NO: 23, SEQ ID NO: 24 or SEQ ID NO: 25.
  • VH heavy chain variable region
  • the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: (i) a VL comprising: a LC CDR1 amino acid sequence of SEQ ID NO: 20 (or an amino acid sequence with not more than 1, 2, 3 or 4 modifications, e.g., substitutions, additions or deletions thereof), a LC CDR2 amino acid sequence of SEQ ID NO:21 (or an amino acid sequence with not more than 1, 2, 3 or 4 modifications, e.g., substitutions, additions or deletions thereof), and/or a LC CDR3 amino acid sequence of SEQ ID NO:22 (or an amino acid sequence with not more than 1, 2, 3 or 4 modifications, e.g., substitutions, additions or deletions thereof); and/or (ii) a VH comprising: a HC CDR1 amino acid sequence of SEQ ID NO: 17 (or an amino acid sequence with not more than 1, 2, 3 or 4 modifications, e.g., substitutions,
  • the anti- TCR ⁇ V antibody molecule comprises an antigen binding domain comprising: a variable heavy chain (VH) of SEQ ID NO: 23, SEQ ID NO: 24 or SEQ ID NO: 25, or a sequence having at least about 75%, 80%, 85%, 90%, 95%, or 99% sequence identity thereto; and/or a variable light chain (VL) of SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 or SEQ ID NO:30, or a sequence having at least about 75%, 80%, 85%, 90%, 95%, or 99% sequence identity thereto.
  • VH variable heavy chain
  • SEQ ID NO: 24 or SEQ ID NO: 25 or a sequence having at least about 75%, 80%, 85%, 90%, 95%, or 99% sequence identity thereto
  • VL variable light chain
  • the anti- TCR ⁇ V antibody molecule comprises a light chain comprising a framework region, e.g., framework region 1 (FR1), comprising one, two or all (e.g., three) of: (i) an Aspartic Acid at position 1, e.g., a substitution at position 1 according to Kabat numbering, e.g., a Alanine to Aspartic Acid substitution; or (ii) an Asparagine at position 2, e.g., a substitution at position 2 according to Kabat numbering, e.g., a Isoleucine to Asparagine substitution, a Serine to Asparagine substitution, or a Tyrosine to Asparagine substitution; or (iii) a Leucine at position 4, e.g., a substitution at position 4 according to Kabat numbering, e.g., a Methionine to Leucine substitution.
  • FR1 framework region 1
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti- TCR ⁇ V antibody molecule comprises a light chain comprising a framework region, e.g., framework region 3 (FR3), comprising one, two or all (e.g., three) of: (i) a Glycine as position 66, e.g., a substitution at position 66 according to Kabat numbering, e.g., a Lysine to Glycine substitution, or a Serine to Glycine substitution; or (ii) an Asparagine at position 69, e.g., a substitution at position 69 according to Kabat numbering, e.g., a Threonine to Asparagine substitution; or (iii) a Tyrosine at position 71, e.g., a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti- TCR ⁇ V antibody molecule binds to TCR ⁇ V12, e.g., TCR ⁇ V12-4*01, TCR ⁇ V12-3*01, or TCR ⁇ V12-5*01. In some embodiments the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V12-4*01 or TCR ⁇ V12-3*01.
  • TCR ⁇ V12 e.g., TCR ⁇ V12-4*01, TCR ⁇ V12-3*01, or TCR ⁇ V12-5*01 is recognized, e.g., bound, by SEQ ID NO: 15 and/or SEQ ID NO: 16.
  • TCR ⁇ V12 e.g., TCR ⁇ V12-4*01, TCR ⁇ V12-3*01, or TCR ⁇ V12-5*01, is recognized, e.g., bound, by any one of SEQ ID NOs 23-25, and/or any one of SEQ ID NO: 26- 30, or an amino acid sequence having at least about 75%, 80%, 85%, 90%, 95%, or 99% sequence identity thereto.
  • TCR ⁇ V12-4*01 is recognized, e.g., bound, by any one of SEQ ID NOs 23-25, and/or any one of SEQ ID NO: 26-30, or an amino acid sequence having at least about 75%, 80%, 85%, 90%, 95%, or 99% sequence identity thereto.
  • TCR ⁇ V12-3*01 is recognized, e.g., bound, by any one of SEQ ID NOs 23- 25, and/or any one of SEQ ID NO: 26-30, or an amino acid sequence having at least about 75%, 80%, 85%, 90%, 95%, or 99% sequence identity thereto.
  • the anti- TCR ⁇ V antibody molecule comprises the anti-TCR ⁇ V antibody molecule comprises an antigen binding domain comprising a single chain Fv (scFv) or a Fab. In some embodiments of any of the compositions or methods disclosed herein, the anti- TCR ⁇ V antibody molecule comprises binds to a conformational or a linear epitope on the T cell. In some embodiments of any of the compositions or methods disclosed herein, the tumor comprises an antigen, e.g., a tumor antigen, e.g., a tumor associated antigen or a neoantigen.
  • the anti-TCR ⁇ V antibody molecule recognize, e.g., bind to, the tumor antigen.
  • the anti- TCR ⁇ V antibody molecule is a full antibody (e.g., an antibody that includes at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains), or an antigen-binding fragment (e.g., a Fab, F(ab') 2 , Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific antibody or fragment thereof, a single domain variant thereof, a camelid antibody, or a rat-derived VH.
  • a full antibody e.g., an antibody that includes at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains
  • an antigen-binding fragment e.g., a Fab, F(ab') 2 , Fv, a single chain Fv fragment,
  • the anti- TCR ⁇ V antibody molecule comprises the anti-TCR ⁇ V antibody molecule comprises one or more heavy chain constant regions chosen from IgG1, IgG2, IgG3, IgGA1, IgGA2, IgM, IgJ or IgG4, or a fragment thereof, e.g., as disclosed in Table 3.
  • the anti- TCR ⁇ V antibody molecule comprises a heavy chain constant region of an IgM or a fragment thereof, optionally wherein the IgM heavy chain constant region comprises the sequence of SEQ ID NO: 73, or a sequence with at least 85%, 90%, 95%, or 99% sequence identity thereto.
  • the anti-TCR ⁇ V antibody molecule comprising an IgM constant region, further comprises a heavy chain constant region of an IgJ or a fragment thereof, optionally wherein the IgJ heavy chain constant region comprises the sequence of SEQ ID NO: 76 or a sequence with at least 85%, 90%, 95%, or 99% sequence identity thereto.
  • the anti- TCR ⁇ V antibody molecule comprises a heavy chain constant region of an IgJ or a fragment thereof, optionally wherein the IgJ heavy chain constant region comprises the sequence of SEQ ID NO: 76 or a sequence with at least 85%, 90%, 95%, or 99% sequence identity thereto.
  • the anti- TCR ⁇ V antibody molecule comprises a heavy chain constant region of an IgGA1, or a fragment thereof, optionally wherein the IgGA1 heavy chain constant region comprises the sequence of SEQ ID NO: 74, or a sequence with at least 85%, 90%, 95%, or 99% sequence identity thereto.
  • the anti- TCR ⁇ V antibody molecule comprises a heavy chain constant region of an IgGA2, or a fragment thereof, optionally wherein the IgGA2 heavy chain constant region comprises a sequence listed in Table 3, e.g., SEQ ID NO: 75, or a sequence with at least 85%, 90%, 95%, or 99% sequence identity thereto.
  • binding of the anti-TCR ⁇ V antibody molecule to a TCR ⁇ V region results in a cytokine profile, e.g., a cytokine secretion profile, (e.g., comprising one or more cytokines and/or one or more chemokines), that differs from that of a T cell engager that binds to a receptor or molecule other than a TCR ⁇ V region (“a non-TCR ⁇ V-binding T cell engager”).
  • a cytokine profile e.g., a cytokine secretion profile, (e.g., comprising one or more cytokines and/or one or more chemokines)
  • the cytokine profile comprises the level and/or activity of one or more cytokines and/or one or more chemokines (e.g., as described herein).
  • a cytokine profile e.g., a cytokine secretion profile, comprises the level and/or activity of one or more of: IL-2 (e.g., full length, a variant, or a fragment thereof); IL-1beta (e.g., full length, a variant, or a fragment thereof); IL-6 (e.g., full length, a variant, or a fragment thereof); TNF ⁇ (e.g., full length, a variant, or a fragment thereof); IFNg (e.g., full length, a variant, or a fragment thereof) IL-10 (e.g., full length, a variant, or a fragment thereof); IL-4 (e.g., full length, a variant, a variant
  • the cytokine profile e.g., cytokine secretion profile, comprises one, two, three, four, five, six, seven, or all of the following: (i) increased level, e.g., expression level, and/or activity of IL-2; (ii) reduced level, e.g., expression level, and/or activity of IL-1 ⁇ ; (iii) reduced level, e.g., expression level, and/or activity of IL-6; (iv) reduced level, e.g., expression level, and/or activity of TNF ⁇ ; (v) reduced level, e.g., expression level, and/or activity of IL-10; (vi) a delay, e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more hours delay, in increased level, e.g., expression level, and/or activity of IL-2; (vii) a delay, e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 hours delay, in increased
  • binding of the anti-TCRBV antibody to a TCR ⁇ V region results in reduced cytokine storm, e.g., reduced cytokine release syndrome (CRS) and/or neurotoxicity (NT), as measured by an assay of Example 3, e.g., relative to the cytokine storm induced by the non-TCR ⁇ V-binding T cell engager.
  • binding of the anti-TCRBV antibody to a TCR ⁇ V region results in one, two, three or all of: (ix) reduced T cell proliferation kinetics; (x) cell killing, e.g., target cell killing, e.g.
  • cancer cell killing e.g., as measured by an assay of Example 4; (xi) increased Natural Killer (NK) cell proliferation, e.g., expansion; or (xii) expansion, e.g., at least about 1.1-10 fold expansion (e.g., at least about 1.1, 1.2, 1.3, 1.4, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, or 10 fold expansion), of a population of T cells having a memory-like phenotype, e.g., wherein (ix)-(xii) are relative to the non-TCR ⁇ V-binding T cell engager.
  • NK Natural Killer
  • an anti-TCR ⁇ V antibody molecule disclosed herein recognizes (e.g., binds to), a structurally conserved domain on the TCR ⁇ V protein (e.g., as denoted by the circled area in FIG.24A). In some embodiments, an anti-TCR ⁇ V antibody molecule disclosed herein does not recognize, e.g., bind to, an interface of a TCR ⁇ V:TCRalpha complex. In some embodiments, an anti-TCR ⁇ V antibody molecule disclosed herein does not recognize, e.g., bind to, a constant region of a TCR ⁇ V protein.
  • an exemplary antibody that binds to a constant region of a TCRBV region is JOVI.1 as described in Viney et al., (Hybridoma.1992 Dec;11(6):701-13).
  • an anti-TCR ⁇ V antibody molecule disclosed herein does not recognize, e.g., bind to, one or more (e.g., all) of a complementarity determining region (e.g., CDR1, CDR2 and/or CDR3) of a TCR ⁇ V protein.
  • the anti- TCR ⁇ V antibody molecule comprises a light chain constant region chosen from the light chain constant regions of kappa or lambda, or a fragment thereof, e.g., as disclosed in Table 3.
  • the anti- TCR ⁇ V antibody molecule comprises a light chain constant region of a kappa chain, or a fragment thereof, optionally wherein the kappa chain constant region comprises the sequence of SEQ ID NO: 39, or a sequence with at least 85%, 90%, 95%, or 99% sequence identity thereto
  • the anti- TCR ⁇ V antibody molecule comprises: (i) one or more heavy chain constant regions comprising a heavy chain constant region chosen from IgG1, IgG2, IgG3, IgGA1, IgGA2, IgG4, IgJ, IgM, IgD, or IgE, or a fragment thereof, e.g., as described in Table 3; and (ii) a light chain constant region comprising a light chain constant region chosen from the light chain constant regions of kappa or lambda, or a fragment thereof, e.g., as described in Table 3.
  • the anti- TCR ⁇ V antibody molecule comprises or a cell comprising an anti- TCR ⁇ V antibody molecule comprises: (i) a heavy chain comprising a variable region (VH), e.g., a VH of an antibody disclosed herein; and/or one or more heavy chain constant regions, e.g., as disclosed herein; and/or (ii) a light chain comprising a variable light (VL), e.g., a VL of an antibody disclosed herein; and/or one or more light chain constant regions, e.g., as disclosed herein.
  • VH variable region
  • VL variable light
  • the anti- TCR ⁇ V antibody molecule comprises, or a cell comprising an anti- TCR ⁇ V antibody molecule comprises: (i) a heavy chain comprising a heavy chain constant region comprising: (a) an IgM heavy chain constant region or a fragment thereof, comprising the sequence of SEQ ID NO: 73, or a sequence with at least 85%, 90%, 95%, or 99% sequence identity thereto; (b) an IgGA1 heavy chain constant region or a fragment thereof, comprising the sequence of SEQ ID NO: 74, or a sequence with at least 85%, 90%, 95%, or 99% sequence identity thereto; or (c) an IgGA2 heavy chain constant region or a fragment thereof, comprising the sequence of SEQ ID NO: 75, or a sequence with at least 85%, 90%, 95%, or 99% sequence identity thereto; and (ii) a light chain comprising a light chain constant region comprising a kappa chain constant region comprising
  • the anti- TCR ⁇ V antibody molecule comprises, or a cell comprising an anti- TCR ⁇ V antibody molecule comprises: (i) a heavy chain comprising: a VH chosen from a VH of Tables 1-2 or 10-13, or a sequence with at least 85%, 90%, 95%, or 99% sequence identity thereto; and a heavy chain constant region comprising: (a) an IgM heavy chain constant region or a fragment thereof, comprising the sequence of SEQ ID NO: 73, or a sequence with at least 85%, 90%, 95%, or 99% sequence identity thereto; (b) an IgGA1 heavy chain constant region or a fragment thereof, comprising the sequence of SEQ ID NO: 74, or a sequence with at least 85%, 90%, 95%, or 99% sequence identity thereto; or (c) an IgGA2 heavy chain constant region or a fragment thereof, comprising the sequence of SEQ ID NO: 75, or a sequence with at least 85%, 90%, 95%, or 99% sequence identity thereto; or
  • the anti-TCR ⁇ V antibody molecule binds to one or more (e.g., all) of the following TCR ⁇ V subfamilies: (i) TCR ⁇ V6 subfamily comprising, e.g., one or more of TCR ⁇ V6-4*01, TCR ⁇ V6- 4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01; (ii) TCR ⁇ V10 subfamily comprising, e.g., one or more of TCR ⁇ V10-1*01, TCR ⁇ V10- 1*02, TCR ⁇ V10-3*01 or TCR ⁇ V10-2*01; (iii) TCR ⁇ V5 subfamily comprising, e.g., one or more of TCR ⁇ V5-6*01
  • the anti-TCR ⁇ V antibody molecule binds to one or more (e.g., all) of the following TCR ⁇ V subfamilies: (i) TCR ⁇ V6, e.g., TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01; (ii) TCR ⁇ V10, e.g., TCR ⁇ V10-1*01, TCR ⁇ V10-1*02, TCR ⁇ V10-3*01 or TCR ⁇ V10- 2*01; (iii) TCR ⁇ V12, e.g., TCR ⁇ V12-4*01, TCR ⁇ V12-3*01, or TCR ⁇ V12-5*01; or (iv) TCR
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V6, e.g., TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6- 6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01.
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V6-5*01.
  • the anti-TCR ⁇ V antibody molecule does not bind to TCR ⁇ V12.
  • the anti-TCR ⁇ V antibody molecule does not bind to TCR ⁇ V5- 5*01 or TCR ⁇ V5-1*01. In some embodiments of any of the methods disclosed herein, the anti-TCR ⁇ V antibody molecule does not bind to TCR ⁇ V12, or binds to TCR ⁇ V12 with an affinity and/or binding specificity that is less than (e.g., less than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • an affinity and/or binding specificity that is less than (e.g., less than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V12 with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to a TCR ⁇ V region other than TCR ⁇ V12 (e.g., TCR ⁇ V region as described herein, e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • TCR ⁇ V region as described herein, e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of
  • the anti-TCR ⁇ V antibody molecule does not comprise at least one CDR of Antibody B. In some embodiments of any of the methods disclosed herein, the anti-TCR ⁇ V antibody molecule does not comprise the CDRs of Antibody B.
  • the anti-TCR ⁇ V antibody molecule does not bind to TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01, or binds to TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01 with an affinity and/or binding specificity that is less than (e.g., less than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to a TCR ⁇ V region other than TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01 (e.g., TCR ⁇ V region as described herein, e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • TCR ⁇ V region e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity
  • the anti-TCR ⁇ V antibody molecule does not comprise at least one CDR of the TM23 murine antibody. In some embodiments of any of the methods disclosed herein, the anti-TCR ⁇ V antibody molecule does not comprise the CDRs of the TM23 murine antibody. In some embodiments of any of the methods disclosed herein, an anti-TCR ⁇ V antibody molecule disclosed herein does not comprise the sequence of a murine anti-rat TCR antibody R73, e.g., as disclosed in J Exp Med.1989 Jan 1; 169(1): 73–86, herein incorporated by reference in its entirety.
  • a multispecific antibody molecule disclosed herein does not comprise the sequence of a murine anti-rat TCR antibody R73, e.g., as disclosed in J Immunol.1993 Mar 15;150(6):2305-15, herein incorporated by reference in its entirety.
  • an anti-TCR ⁇ V antibody molecule disclosed herein does not comprise a viral peptide-MHC complex, e.g., as disclosed in Oncoimmunology.2016; 5(1): e1052930, herein incorporated by reference in its entirety.
  • a multispecific antibody molecule disclosed herein does not comprise a viral peptide-MHC complex, e.g., as disclosed in Oncoimmunology.2016; 5(1): e1052930, herein incorporated by reference in its entirety.
  • the immune cell population comprises a T cell, a Natural Killer cell, a B cell, an antigen presenting cell, or a myeloid cell (e.g., a monocyte, a macrophage, a neutrophil or a granulocyte).
  • the immune cell population comprises a T cell, e.g., a CD4+ T cell, a CD8+ T cell, a TCR alpha-beta T cell, or a TCR gamma-delta T cell.
  • a T cell comprises a memory T cell (e.g., a central memory T cell, or an effector memory T cell (e.g., a T EMRA ) or an effector T cell.
  • a T cell comprises a tumor infiltrating lymphocyte (TIL).
  • TIL tumor infiltrating lymphocyte
  • the immune cell population is obtained from a healthy subject.
  • the immune cell population is obtained from a subject (e.g., from an apheresis sample from the subject) having a disease, e.g., a cancer, e.g., as described herein.
  • the immune cell population obtained from a subject having a disease, e.g., a cancer comprises a tumor infiltrating lymphocyte (TIL).
  • TIL tumor infiltrating lymphocyte
  • the method results in an expansion of at least 1.1-10 fold (e.g., at least 1.1, 1.2, 1.3, 1.4, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, or 10 fold expansion).
  • the method further comprises contacting the population of cells with an agent that promotes, e.g., increases, immune cell expansion.
  • the agent includes an immune checkpoint inhibitor, e.g., as described herein.
  • the agent includes a 4-1BB (CD127) agonist, e.g., an anti-4-1BB antibody.
  • the method further comprises comprising contacting the population of cells with a non-dividing population of cells, e.g., feeder cells, e.g., irradiated allogenic human PBMCs.
  • an expansion method described herein comprises expanding the cells for a period of at least about 4 hours, 6 hours, 10 hours, 12 hours, 15 hours, 18 hours, 20 hours, or 22 hours, or for at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 1,617, 18, 19, 20 or 21 days, or for at least about 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks or 8 weeks.
  • expansion of the population of immune cells is compared to expansion of a similar population of cells with an antibody that binds to: a CD3 molecule, e.g., CD3 epsilon (CD3e) molecule; or a TCR alpha (TCR ⁇ ) molecule.
  • expansion of the population of immune cells is compared to expansion of a similar population of cells not contacted with the anti-TCR ⁇ V antibody molecule.
  • expansion of the population of memory effector T cells is compared to expansion of a similar population of cells with an antibody that binds to: a CD3 molecule, e.g., CD3 epsilon (CD3e) molecule; or a TCR alpha (TCR ⁇ ) molecule.
  • the method results in expansion of, e.g., selective or preferential expansion of, T cells expressing a T cell receptor (TCR) comprising a TCR alpha and/or TCR beta molecule, e.g., TCR alpha-beta T cells ( ⁇ T cells).
  • TCR T cell receptor
  • the method results in expansion of ⁇ T cells over expansion of T cells expressing a TCR comprising a TCR gamma and/or TCR delta molecule, e.g., TCR gamma-delta T cells ( ⁇ T cells).
  • expansion of ⁇ T cells over ⁇ T cells results in reduced production of cytokines associated with CRS.
  • expansion of ⁇ T cells over ⁇ T cells results in immune cells that have reduced capacity to, e.g., are less prone to, induce CRS upon administration into a subject.
  • an immune cell population e.g., T cells (e.g., T EMRA cells or TILs) or NK cells) cultured in the presence of, e.g., expanded with, an anti- TCR ⁇ V antibody disclosed herein does not induce CRS and/or NT when administered into a subject, e.g., a subject having a disease or condition as described herein.
  • the anti-TCR ⁇ V antibody molecule in a multispecific molecule disclosed herein is a first immune cell engager moiety.
  • the anti-TCR ⁇ V antibody molecule does not bind to TCR ⁇ V12, or binds to TCR ⁇ V12 with an affinity and/or binding specificity that is less than (e.g., less than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V12 with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to a TCR ⁇ V region other than TCR ⁇ V12 (e.g., TCR ⁇ V region as described herein, e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6- 5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule does not comprise the CDRs of the Antibody B murine antibody.
  • the anti-TCR ⁇ V antibody molecule in a multispecific molecule disclosed herein is a first immune cell engager moiety.
  • the anti-TCR ⁇ V antibody molecule does not bind to TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01, or binds to TCR ⁇ V5- 5*01 or TCR ⁇ V5-1*01 with an affinity and/or binding specificity that is less than (e.g., less than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti- TCR ⁇ V antibody molecule binds to a TCR ⁇ V region other than TCR ⁇ V5-5*01 or TCR ⁇ V5- 1*01 (e.g., TCR ⁇ V region as described herein, e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule does not comprise the CDRs of the TM23 murine antibody.
  • the multispecific molecule further comprises a second immune cell engager moiety.
  • the first and/or second immune cell engager binds to and activates an immune cell, e.g., an effector cell.
  • the first and/or second immune cell engager binds to, but does not activate, an immune cell, e.g., an effector cell.
  • the second immune cell engager is chosen from an NK cell engager, a T cell engager, a B cell engager, a dendritic cell engager, or a macrophage cell engager, or a combination thereof.
  • the second immune cell engager comprises a T cell engager which binds to CD3, TCR ⁇ , TCR ⁇ , TCR ⁇ , ICOS, CD28, CD27, HVEM, LIGHT, CD40, 4-1BB, OX40, DR3, GITR, CD30, TIM1, SLAM, CD2, or CD226.
  • a multispecific molecule disclosed herein comprises a tumor targeting moiety.
  • the tumor-targeting moiety comprises an antibody molecule (e.g., Fab or scFv), a receptor molecule (e.g., a receptor, a receptor fragment or functional variant thereof), or a ligand molecule (e.g., a ligand, a ligand fragment or functional variant thereof), or a combination thereof, that binds to a cancer antigen.
  • the tumor-targeting moiety binds to a cancer antigen present on a cancer, e.g., a hematological cancer, a solid tumor, a metastatic cancer, soft tissue tumor, metastatic lesion, or a combination thereof.
  • the tumor-targeting moiety binds to a cancer antigen, e.g., BCMA or FcRH5.
  • the tumor-targeting antibody molecule binds to a conformational or a linear epitope on the tumor antigen.
  • the tumor-targeting moiety is an antigen, e.g., a cancer antigen.
  • the cancer antigen is a tumor antigen or stromal antigen, or a hematological antigen.
  • the tumor-targeting moiety binds to a cancer antigen chosen from: BCMA, FcRH5, CD19, CD20, CD22, CD30, CD33, CD38, CD47, CD99, CD123, FcRH5, CLEC12, CD179A, SLAMF7, or NY-ESO1, PDL1, CD47, gangloside 2 (GD2), prostate stem cell antigen (PSCA), prostate specific membrane antigen (PMSA), prostate-specific antigen (PSA), carcinoembryonic antigen (CEA), Ron Kinase, c-Met, Immature laminin receptor, TAG-72, BING-4, Calcium-activated chloride channel 2, Cyclin-B1, 9D7, Ep-CAM, EphA3, Her2/neu, Telomerase, SAP-1, Survivin, NY-ESO-1/LAGE-1, PRAME, SSX-2, Melan-A/MART-1, Gp100/pmel17, Tyrosin
  • the cancer is a solid tumor including but not limited to: pancreatic (e.g., pancreatic adenocarcinoma) cancer, breast cancer, colorectal cancer, lung cancer (e.g., small or non-small cell lung cancer), skin cancer, ovarian cancer, or liver cancer.
  • pancreatic e.g., pancreatic adenocarcinoma
  • lung cancer e.g., small or non-small cell lung cancer
  • skin cancer ovarian cancer
  • liver cancer e.g., liver cancer.
  • the cancer antigen or tumor antigen is a hematological antigen.
  • the cancer or tumor antigen is chosen from one or more of: BCMA, FcRH5, CD19, CD20, CD22, CD30, CD33, CD38, CD47, CD99, CD123, FcRH5, CLEC12, CD179A, SLAMF7, or NY-ESO1.
  • the tumor-targeting moiety binds to one or both of BCMA or FcRH5.
  • the tumor-targeting moiety binds to BCMA.
  • the tumor-targeting moiety comprises a BCMA targeting moiety.
  • the tumor- targeting moiety comprising a BCMA targeting moiety binds to a BCMA antigen on the surface of a cell, e.g., a cancer or hematopoietic cell.
  • the BCMA antigen can be present on a primary tumor cell, or a metastatic lesion thereof.
  • the cancer is a hematological cancer, e.g., multiple myeloma.
  • the BCMA antigen can be present on a tumor, e.g., a tumor of a class typified by having one or more of: limited tumor perfusion, compressed blood vessels, or fibrotic tumor interstitium.
  • the tumor targeting moiety comprising a BCMA targeting moiety comprises an anti-BCMA antibody or antigen-binding fragment thereof described in US8920776, US9243058, US9340621, US8846042, US7083785, US9545086, US7276241, US9034324, US7799902, US9387237, US8821883, US861745, US20130273055, US20160176973, US20150368351, US20150376287, US20170022284, US20160015749, US20140242077, US20170037128, US20170051068, US20160368988, US20160311915, US20160131654, US20120213768, US20110177093, US20160297885, EP3137500, EP2699259, EP2982694, EP3029068, EP3023437, WO2016090327, WO2017021450, WO2016110584, WO2016118641, WO2016168149, the entire contents of which are
  • the BCMA-targeting moiety includes an antibody molecule (e.g., Fab or scFv) that binds to BCMA.
  • the antibody molecule to BCMA comprises one, two, or three CDRs from any of the heavy chain variable domain sequences of Table 9, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of Table 9.
  • the antibody molecule to BCMA comprises a heavy chain variable domain sequence chosen from any of the amino acid sequences of Table 9, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
  • the tumor-targeting moiety binds to FcRH5.
  • the tumor-targeting moiety comprises a FcRH5targeting moiety.
  • the tumor- targeting moiety comprising a FcRH5targeting moiety binds to a FcRH5antigen on the surface of a cell, e.g., a cancer or hematopoietic cell.
  • the FcRH5antigen can be present on a primary tumor cell, or a metastatic lesion thereof.
  • the cancer is a hematological cancer, e.g., multiple myeloma.
  • the FcRH5antigen can be present on a tumor, e.g., a tumor of a class typified by having one or more of: limited tumor perfusion, compressed blood vessels, or fibrotic tumor interstitium.
  • the tumor targeting moiety comprising a FcRH5targeting moiety comprises an anti- FcRH5antibody or antigen-binding fragment thereof described in US Patent 7,999,077 the entire contents of which are incorporated herein by reference.
  • the cancer is a hematological cancer including, but not limited to: a B-cell or T cell malignancy, e.g., Hodgkin’s lymphoma, Non-Hodgkin’s lymphoma (e.g., B cell lymphoma, diffuse large B cell lymphoma, follicular lymphoma, chronic lymphocytic leukemia, mantle cell lymphoma, marginal zone B-cell lymphoma, Burkitt lymphoma, lymphoplasmacytic lymphoma, hairy cell leukemia), acute myeloid leukemia (AML), chronic myeloid leukemia, myelodysplastic syndrome, multiple myeloma, and acute lymphocytic leukemia.
  • a B-cell or T cell malignancy e.g., Hodgkin’s lymphoma, Non-Hodgkin’s lymphoma (e.g., B cell lymphoma, diffuse large B cell lymphoma,
  • the hematological cancer is multiple myeloma.
  • a multispecific molecule disclosed herein further comprises a cytokine molecule, e.g., one or two cytokine molecules.
  • the cytokine molecule is chosen from interleukin-2 (IL-2), interleukin-7 (IL-7), interleukin-12 (IL-12), interleukin-15 (IL-15), interleukin-18 (IL-18), interleukin-21 (IL-21), or interferon gamma, or a fragment, variant or combination thereof.
  • IL-2 interleukin-2
  • IL-7 interleukin-7
  • IL-12 interleukin-12
  • IL-15 interleukin-15
  • IL-18 interleukin-18
  • interferon gamma or a fragment, variant or combination thereof.
  • the cytokine molecule further comprises a receptor dimerizing domain, e.g., an IL15Ralpha dimerizing domain.
  • a receptor dimerizing domain e.g., an IL15Ralpha dimerizing domain.
  • the cytokine molecule (e.g., IL-15) and the receptor dimerizing domain (e.g., an IL15Ralpha dimerizing domain) are not covalently linked, e.g., are non-covalently associated.
  • a multispecific molecule disclosed herein comprises: (i) an anti-TCR ⁇ V antibody molecule (e.g., an anti-TCR ⁇ V antibody molecule as described herein); and (ii) a tumor-targeting antibody molecule (e.g., an antibody molecule that binds to a hematological antigen as described herein, e.g., chosen from one or more of BCMA, FcRH5, CD19, CD22, CD33, CD123, FcRH5, CD179a, or CLEC12).
  • an anti-TCR ⁇ V antibody molecule e.g., an anti-TCR ⁇ V antibody molecule as described herein
  • a tumor-targeting antibody molecule e.g., an antibody molecule that binds to a hematological antigen as described herein, e.g., chosen from one or more of BCMA, FcRH5, CD19, CD22, CD33, CD123, FcRH5, CD179a, or CLEC12).
  • the multispecific molecule disclosed herein comprises the anti- TCR ⁇ V antibody molecule of (i), the tumor-targeting antibody molecule of (ii) and a cytokine molecule as described herein, e.g., an IL-12 cytokine molecule.
  • the multispecific molecule comprises an anti-TCR ⁇ V antibody molecule as described herein; and a tumor-targeting antibody molecule that binds to one or both of BCMA or FcRH5.
  • the multispecific molecule further comprises an IL-12 cytokine molecule.
  • the multispecific molecule can be used to treat a BCMA- or FcRH5- expressing hematological cancer, e.g., multiple myeloma.
  • the multispecific molecule comprises an anti-TCR ⁇ V antibody molecule as described herein; and a tumor-targeting antibody molecule that binds one or more of CD19, CD22, or CD123.
  • the multispecific molecule further comprises an IL-12 cytokine molecule.
  • the multispecific molecule can be used to treat a CD19-, CD22-, or CD123-expressing hematological cancer, e.g., leukemia or lymphoma.
  • the CD19-, CD22-, or CD123-expressing hematological cancer is chosen from a B-cell or T cell malignancy, e.g., Hodgkin’s lymphoma, Non-Hodgkin’s lymphoma (e.g., B cell lymphoma, diffuse large B cell lymphoma, follicular lymphoma, chronic lymphocytic leukemia, mantle cell lymphoma, marginal zone B-cell lymphoma, Burkitt lymphoma, lymphoplasmacytic lymphoma, hairy cell leukemia), acute myeloid leukemia (AML), chronic myeloid leukemia, myelodysplastic syndrome, multiple myeloma, and acute lymphocytic leukemia.
  • B-cell or T cell malignancy e.g., Hodgkin’s lymphoma, Non-Hodgkin’s lymphoma (e.g., B cell lymphoma, diffuse large B cell lymphom
  • the hematological cancer is multiple myeloma.
  • a multispecific molecule disclosed herein further comprises an immunoglobulin constant region (e.g., Fc region) chosen from the heavy chain constant regions of IgG1, IgG2, and IgG4, more particularly, the heavy chain constant region of human IgG1, IgG2 or IgG4.
  • the immunoglobulin constant region e.g., an Fc region
  • an interface of a first and second immunoglobulin chain constant regions is altered, e.g., mutated, to increase or decrease dimerization, e.g., relative to a non-engineered interface.
  • the dimerization of the immunoglobulin chain constant region is enhanced by providing an Fc interface of a first and a second Fc region with one or more of: a paired cavity-protuberance (“knob-in-a hole”), an electrostatic interaction, or a strand-exchange, such that a greater ratio of heteromultimer:homomultimer forms, e.g., relative to a non-engineered interface.
  • a multispecific molecule disclosed herein further comprises a linker, e.g., a linker described herein, optionally wherein the linker is selected from: a cleavable linker, a non-cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, or a non-helical linker.
  • the multispecific molecule comprises at least two non-contiguous polypeptide chains.
  • the multispecific molecule comprises the following configuration: A, B-[dimerization module]-C, -D wherein: (1) the dimerization module comprises an immunoglobulin constant domain, e.g., a heavy chain constant domain (e.g., a homodimeric or heterodimeric heavy chain constant region, e.g., an Fc region), or a constant domain of an immunoglobulin variable region (e.g., a Fab region); and (2) A, B, C, and D are independently absent; (i) an antigen binding domain that preferentially binds to a first immune cell engager comprising an anti-TCR ⁇ V antibody molecule disclosed herein; (ii) a tumor targeting moiety (e.g., a tumor-targeting antibody molecule as described herein), (iii) a second immune cell engager chosen from a T cell engager, an NK cell engager, a B cell engager, a dendritic cell engager, or a macrophage cell
  • the dimerization module comprises one or more immunoglobulin chain constant regions (e.g., Fc regions) comprising one or more of: a paired cavity- protuberance (“knob-in-a hole”), an electrostatic interaction, or a strand-exchange.
  • the one or more immunoglobulin chain constant regions e.g., Fc regions
  • the one or more immunoglobulin chain constant regions comprise an amino acid substitution at a position chosen from one or more of 347, 349, 350, 351, 366, 368, 370, 392, 394, 395, 397, 398, 399, 405, 407, or 409, e.g., of the Fc region of human IgG1.
  • the one or more immunoglobulin chain constant regions comprise an amino acid substitution chosen from: T366S, L368A, or Y407V (e.g., corresponding to a cavity or hole), or T366W (e.g., corresponding to a protuberance or knob), or a combination thereof.
  • the multispecific molecule further comprises a linker, e.g., a linker between one or more of: the antigen binding domain of an anti-TCR ⁇ V antibody molecule disclosed herein and the tumor targeting moiety; the antigen binding domain of an anti-TCR ⁇ V antibody molecule disclosed herein and the second immune cell engager, the antigen binding domain of an anti-TCR ⁇ V antibody molecule disclosed herein and the cytokine molecule, the antigen binding domain of an anti-TCR ⁇ V antibody molecule disclosed herein and the stromal modifying moiety, the second immune cell engager and the cytokine molecule, the second immune cell engager and the stromal modifying moiety, the cytokine molecule and the stromal modifying moiety, the antigen binding domain of an anti-TCR ⁇ V antibody molecule disclosed herein and the dimerization module, the second immune cell engager and the dimerization module, the cytokine molecule and the dimerization module, the stromal modifying moiety and the dimerization module,
  • the linker is chosen from: a cleavable linker, a non-cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, or a non-helical linker.
  • the linker is a peptide linker.
  • the peptide linker comprises Gly and Ser.
  • the peptide linker comprises an amino acid sequence chosen from SEQ ID NOs: 142-145 or 175- 178.
  • the disease is a cancer chosen from: a hematological cancer, a solid tumor, a metastatic cancer, soft tissue tumor, metastatic lesion, or a combination thereof.
  • the cancer is a solid tumor chosen from: a melanoma, a pancreatic cancer (e.g., pancreatic adenocarcinoma), a breast cancer, a colorectal cancer (CRC), a lung cancer (e.g., small or non-small cell lung cancer), a skin cancer, an ovarian cancer, or a liver cancer.
  • the cancer is melanoma or CRC.
  • the cancer is a hematological cancer chosen from: a B-cell or T cell malignancy, e.g., Hodgkin’s lymphoma, Non-Hodgkin’s lymphoma (e.g., B cell lymphoma, diffuse large B cell lymphoma, follicular lymphoma, chronic lymphocytic leukemia, mantle cell lymphoma, marginal zone B-cell lymphoma, Burkitt lymphoma, lymphoplasmacytic lymphoma, hairy cell leukemia), acute myeloid leukemia (AML), chronic myeloid leukemia, myelodysplastic syndrome, multiple myeloma, or acute lymphocytic leukemia.
  • a B-cell or T cell malignancy e.g., Hodgkin’s lymphoma, Non-Hodgkin’s lymphoma (e.g., B cell lymphoma, diffuse large B cell lymphoma, follicular lymph
  • the hematological cancer is multiple myeloma. In some embodiments, the hematological cancer is CLL or DLBCL.
  • the sample from the subject comprises a blood sample, e.g., a peripheral blood sample, a biopsy, e.g., a tumor biopsy, or a bone marrow sample.
  • the sample comprises a biological sample comprising immune effector cells, e.g., T cells, or NK cells.
  • T cells comprise a CD4 T cell, a CD8 T cell, (e.g., an effector T cell or a memory T cell (e.g., a memory effector T cell (e.g., TEM cell, e.g., TEMRA cell), or a tumor infiltrating lymphocyte (TIL).
  • CD4 T cell e.g., an effector T cell or a memory T cell
  • a memory effector T cell e.g., TEM cell, e.g., TEMRA cell
  • TIL tumor infiltrating lymphocyte
  • FIGs.1A-1B shows the alignment of the Antibody A source mouse VH and VL framework 1, CDR 1, framework 2, CDR 2, framework 3, CDR3, and framework 4 regions with their respective humanized sequences.
  • FIG.1A shows VH sequences for murine Antibody A (SEQ ID NO: 1) and humanized Antibody A-H (SEQ ID NO: 9).
  • FIG.1B shows VL sequences for murine Antibody A (SEQ ID NO: 2) and humanized Antibody A-H (SEQ ID NO: 10 and SEQ ID NO: 11).
  • FIGs.2A-2B shows the alignment of the Antibody B source mouse VH and VL framework 1, CDR 1, framework 2, CDR 2, framework 3, CDR3, and framework 4 regions with their respective humanized sequences.
  • FIG.2A shows the VH sequence for murine Antibody B (SEQ ID NO: 15) and humanized VH sequences B-H.1A to B-H.1C (SEQ ID NOs: 23-25).
  • FIG.2B shows the VL sequence for murine Antibody B (SEQ ID NO: 16) and humanized VL sequences B-H.1D to B-H.1H (SEQ ID NOs: 26-30).
  • FIG.3 depicts the phylogenetic tree of TCRBV gene family and subfamilies with corresponding antibodies mapped.
  • Subfamily identities are as follows: Subfamily A: TCR ⁇ V6; Subfamily B: TCR ⁇ V10; Subfamily C: TCR ⁇ V12; Subfamily D: TCR ⁇ V5; Subfamily E: TCR ⁇ V7; Subfamily F: TCR ⁇ V11; Subfamily G: TCR ⁇ V14; Subfamily H: TCR ⁇ V16; Subfamily I:TCR ⁇ V18; Subfamily J:TCR ⁇ V9; Subfamily K: TCR ⁇ V13; Subfamily L: TCR ⁇ V4; Subfamily M:TCR ⁇ V3; Subfamily N:TCR ⁇ V2; Subfamily O:TCR ⁇ V15; Subfamily P: TCR ⁇ V30; Subfamily Q: TCR ⁇ V19; Subfamily R:TCR ⁇ V27; Subfamily S:TCR ⁇ V28; Subfamily T: TCR ⁇ V24; Subfamily U: TCR ⁇ V20; Subfamily V: TCR ⁇ V25; and Subfamily W:TCR ⁇ V29 subfamily.
  • FIGs.4A-4C show human CD3+ T cells activated by anti-TCR V ⁇ 13.1 antibody (A- H.1) for 6-days.
  • Human CD3+ T cells were isolated using magnetic-bead separation (negative selection) and activated with immobilized (plate-coated) anti-TCR V ⁇ 13.1 (A-H.1) or anti-CD3 ⁇ (OKT3) antibodies at 100 nM for 6 days.
  • FIG.4A shows two scatter plots (left: activated with OKT3; and right: activated with A-H.1) of expanded T cells assessed for TCR V ⁇ 13.1 surface expression using anti-TCR V ⁇ 13.1 (A-H.1) followed by a secondary fluorochrome- conjugated antibody for flow cytometry analysis.
  • FIG.4B shows percentage (%) of TCR V ⁇ 13.1 positive T cells activated by anti-TCR V ⁇ 13.1 (A-H.1) or anti-CD3e (OKT3) plotted against total T cells (CD3+).
  • FIG.4C shows relative cell count acquired by counting the number of events in each T cell subset gate (CD3 or TCR V ⁇ 13.1) for 20 seconds at a constant rate of 60 ⁇ l/min. Data shown as mean value from 3 donors.
  • FIGs.5A-5B show cytolytic activity of human CD3+ T cells activated by anti-TCR V ⁇ 13.1 antibody (A-H.1) against transformed cell line RPMI 8226.
  • FIG.5A depicts target cell lysis of human CD3+ T cells activated with A-H.1or OKT3.
  • Human CD3+ T cells were isolated using magnetic-bead separation (negative selection) and activated with immobilized (plate- coated) A-H.1 or OKT3 at the indicated concentrations for 4 days prior to co-culture with RPMI 8226 cells at a (E:T) ratio of 5:1 for 2 days.
  • FIG.5B shows target cell lysis of human CD3+ T cells activated with A-H.1 or OKT3 incubated with RPMI-8226 at a (E:T) ratio of 5:1 for 6 days followed by cell lysis analysis of RPMI 8226 cells as described above. Percentage (%) target cell lysis was determined by normalizing to basal target cell lysis (i.e. without antibody treatment) using the following formula, [(x - basal) / (100% - basal), where x is cell lysis of sample].
  • FIGs.6A-6B show IFNg production by human PBMCs activated with the indicated antibodies.
  • Human PBMCs were isolated from whole blood from the indicated number of donors, followed by solid-phase (plate-coated) stimulation with the indicated antibodies at 100Nm. Supernatant was collected on Days 1, 2, 3, 5, or 6.
  • FIG.6A is a graph comparing the production of IFNg in human PBMCs activated with the antibodies indicated activated with anti- TCR V ⁇ 13.1 antibodies (A-H.1 or A-H.2) or anti-CD3e antibodies (OKT3 or SP34-2) on Day 1, 2, 3, 5, or 6 post-activation.
  • FIG.6B shows IFNg production in human PBMCs activated with the antibodies indicated activated with the indicated anti-TCR V ⁇ 13.1 antibodies or anti-CD3e antibody (OKT3) on Day 1, 2, 3, 5, or 6 post-activation.
  • FIGs.7A-7B show IL-2 production by human PBMCs activated with the indicated antibodies.
  • FIGs.8A- 8B show IL-6 production by human PBMCs activated with the indicated antibodies.
  • FIGs.9A- 9B show TNF-alpha production by human PBMCs activated with the indicated antibodies.
  • a similar experimental setup as described for FIGs 6A-6B was used.
  • FIGs.10A- 10B show IL-1beta production by human PBMCs activated with the indicated antibodies.
  • FIGs.11A-11B are graphs showing delayed kinetics of IFNg secretion in human PMBCs activated by anti-TCR V ⁇ 13.1 antibody A-H.1 when compared to PBMCs activated by anti-CD3e antibody OKT3.
  • FIG.11A shows IFNg secretion data from 4 donors.
  • FIG.12 depicts increased CD8+ TSCM and Temra T cell subsets in human PBMCs activated by anti-TCR V ⁇ 13.1 antibodies (A-H.1 or A-H.2) compared to PBMCs activated by anti-CD3e antibodies (OKT3 or SP34-2).
  • FIGs.13A-13F show characterization of an anti-TCRVb antibody.
  • FIG.13A is a graph depicting proliferation of T cells activated with anti-CD3 (OKT3) antibody or anti-TCRVb antibody.
  • FIG.13B shows selective expansion of CD45RA+ effector memory CD8+ and CD4+ T cells (TEMRA) cells with anti- TCRVb antibodies.
  • FIG.13C is a graph showing IFN-g secretion by PBMCs stimulated with an anti-TCRVb antibody, or anti-CD3 antibodies.
  • FIG.13D shows target cell lysis by T cells stimulated with an anti-TCRVb antibody, or anti-CD3 antibodies. Cells were stimulated for 4 days followed by 2 days incubation with multiple myeloma target cells for assessment of cell killing.
  • FIG.13E is a graph showing perforin secretion by T cells stimulated with an anti- TCRVb antibody, or an anti-CD3 antibody. Perforin was analyzed by FACS staining in TCRVB-positive and TCRVB-negative T cells in PBMCs after 5 days of stimulation with 100ng/ml plate-bound antibody.
  • FIG.13F is a graph showing Granzyme B by T cells stimulated with an anti-TCRVb antibody, or an anti-CD3 antibody. Granzyme B was analyzed by FACS staining in TCRVB-positive and TCRVB-negative T cells in PBMCs after 5 days of stimulation with 100ng/ml plate-bound antibody.
  • FIGs.14A-14B show production of IL-2 and IL-15 and expansion of human NK cells by stimulation of PBMCs with anti-TCRVb antibody for 6 days at a dose of 100nM.
  • FIG.14A shows secretion of IL-2 or IL-15 in T cells stimulated with an anti-TCRVb antibody, or anti- CD3 antibodies.
  • FIG.14B depicts flow cytometry dot plots showing NKp46 staining vs CD56 antibody staining in cells stimulated with an anti-TCRVb antibody or an anti-CD3 antibody or a control sample.
  • FIGs.15A-15C show secretion of cytokines in PBMCs stimulated with an anti-TCRVb antibody, or anti-CD3 antibodies.
  • FIGs.16A-16B show killing of MM cells by dual targeting BCMA-TCRvb antibody molecules.
  • FIG.16A shows in vitro killing by one of the following dual-targeting antibody molecules: BCMA-TCRVb (Molecule I), BCMA-CD3, or Control-TCRVb; or an isotype control.
  • FIG.16B shows in vivo killing of MM cells by a dual-targeting BCM-TCRVb antibody (Molecule I).
  • FIG.17 shows lysis of MM target cells with a dual targeting antibody (Molecule E) which recognized FcRH5 on one arm and TCRVb on the other arm.
  • FIGs.18A-18B demonstrate cytokine production from human PBMCs activated by anti- TCR V ⁇ 8a antibodies (B-H.1) when compared to those activated by anti-CD3 ⁇ antibodies (OKT3 or SP34-2).
  • FIG.18A shows that human PBMCs activated by anti-TCR V ⁇ 8a antibodies (B-H.1) produce similar or reduced levels of IFN ⁇ .
  • FIG.18B shows human PBMCs activated by anti-TCR V ⁇ 8a antibodies (B-H.1) produce higher levels of IL-2 when compared to those activated by anti-CD3 ⁇ antibodies (OKT3 or SP34-2).
  • FIGs.19A-19C demonstrate cytokine production from human PBMCs activated by anti- TCR V ⁇ 8a antibodies (B-H.1).
  • Human PBMCs activated by anti-TCR V ⁇ 8a antibodies (B-H.1) do not significantly produce IL-6 (FIG.19A), IL1b (FIG.19B), and less TNFa (FIG.19C), when compared to PBMCs activated by anti-CD3 ⁇ antibodies (OKT3 or SP34-2).
  • FIGs.20A-20E demonstrate cytokine production from human PBMCs activated by anti- TCR ⁇ V Antibody D antibody compared to control anti-CD3e antibody (OKT3).
  • FIG.20A shows that human PBMCs activated by anti-TCR ⁇ V Antibody D antibody produce similar or reduced levels of IFN ⁇ .
  • FIG.20B shows human PBMCs activated by anti-TCR ⁇ V Antibody D antibody produce higher levels of IL-2 when compared to those activated by anti-CD3 ⁇ antibodies (OKT3).
  • FIGs.21A-21B demonstrate cytokine production from human PBMCs activated by anti- TCR V ⁇ 5 antibody (Antibody E).
  • FIG.21A shows that human PBMCs activated by anti-TCR V ⁇ 5 antibody produce similar or reduced levels of IFN ⁇ compared to PBMCS activated by anti- CD3 ⁇ antibodies (OKT3 or SP34-2).
  • FIGs.22A-2D demonstrate cytokine production from human PBMCs activated by an anti-TCR V ⁇ 5 antibody (Antibody E).
  • FIGs.23A-23F demonstrate cytokine production from human PBMCs activated by a dual targeting (bispecific molecule) comprising an anti-TCR ⁇ V binding moiety and a BCMA binding moiety.
  • FIG.23A shows that human PBMCs activated by the bispecific molecule produce similar or reduced levels of IFN ⁇ as PBMCS activated by anti-CD3 ⁇ antibodies (OKT3).
  • FIG.23B shows human PBMCs activated by the bispecific molecule produce higher levels of IL-2 when compared to PBMCs activated by anti-CD3 ⁇ antibodies (OKT3).
  • FIGs.24A-24B show the structure and sequence of eight TCR ⁇ V proteins from seven different subfamilies: TCR ⁇ V6 subfamily (TCR ⁇ V6-5 and TCR ⁇ V6-4 are shown), TCR ⁇ V28 subfamily, TCR ⁇ V19 subfamily, TCR ⁇ V9 subfamily, TCR ⁇ V5 subfamily, TCR ⁇ V20 subfamily and TCR ⁇ V12 subfamily.
  • FIG.24A shows the structural alignment of the different TCR ⁇ V proteins. The circled area represents the outward facing region comprising the proposed binding site for the anti-TCR ⁇ V antibodies disclosed herein.
  • FIG.24B shows the amino acid sequence alignment of the proteins shown in FIG.24A (SEQ ID NOS 3449-3456, respectively, in order of appearance).
  • FIG.28 is a graph depicting mean tumor volume in NOD/SCID/IL-2R ⁇ null (NSG) mice engrafted with Raji-luc cells at days 10 to 28.
  • the Star denotes PBMC implantation. Open triangles denote antibody treatment with the indicated antibodies.
  • FIGs.29A-B depicting Mean tumor burden (Total Flux) in NOD/SCID/IL-2R ⁇ null (NSG) mice engrafted with cancer cells and treated with the indicated antibody.
  • NSG mice were implanted with PBMCs on Day 1 followed by injection with cancer cells on Day 7 (Raji-luc in FIG.29A; K562-Luc control in FIG.29B).
  • Antibody treatment with the indicated antibodies began on Day 16.
  • FIG.29A shows mean tumor burden at days 16 to 37 in NOD/SCID/IL- 2R ⁇ null (NSG) mice engrafted with Raji-luc cells.
  • FIG.29B shows mean tumor burden (Total Flux) at days 16 to 30 in animals engrafted with K562-luc cells.
  • FIG.30 is a graph depicting Mean tumor burden (Total Flux) mean tumor volume in NOD/SCID/IL-2R ⁇ null (NSG) mice engrafted with RPMI-8226 cells.
  • the RPMI-8226 cells were engrafted on Day 1.
  • PBMCs were implanted into the mice and antibody treatment began on Day 17.
  • FIGs.31A-31B are graphs showing % target cell lysis at different antibody concentrations.
  • FIG.31A shows data generated using anti-TCR V ⁇ 13.1/anti-CD19 (Molecule F), anti-CD3/anti-CD19, and anti-TCR V ⁇ 13.1 (A-H.1).
  • FIG.31B shows data generated using anti-TCR V ⁇ 13.1/anti-BCMA (Molecule G), anti-CD3/anti-BCMA, and anti-TCR V ⁇ 13.1 (A- H.1).
  • FIGs.32A-32F are graphs showing cytokine secretion stimulated by anti-TCR V ⁇ /anti- BCMA (Molecule H) or anti-CD3 (OKT3) at Days 1, 2, 3, and 5. Cytokines examined include: IFN ⁇ , IL-2, IL-1 ⁇ , IL-6, IL-10, and TNF ⁇ (FIGs.32A-32F, respectively).
  • FIGs.33A-33F are graphs showing cytokine secretion stimulated by anti-TRBC1 (Antibody F) or anti-CD3 (OKT3) at Days 2 and 5. Cytokines examined include: IFN ⁇ , IL-2, IL-1 ⁇ , IL-6, IL-10, and TNF ⁇ (FIGs.33A-33F, respectively).
  • FIG.34 is a FACS plot showing the expansion of TCRvb 6-5+ T cells over 8 days using anti-TCRvb 6-5 v1.
  • FIG.35 is a bar graph showing the expansion of TCRvb 6-5+ CD4+ T cells and TCRvb 6-5+ CD8+ T cells over 8 days using the anti-CD3 ⁇ antibody OKT3 (100nM).
  • FIG.36 is a bar graph showing the expansion of TCRvb 6-5+ CD4+ T cells and TCRvb 6-5+ CD8+ T cells over 8 days using the anti-TCRvb 6-5 v1 antibody (100nM).
  • FIG.37 is a FACS plot showing the showing the expansion of TCRvb 6-5+ T cells over 8 days using anti-TCRvb 6-5 v1 or the anti-CD3 ⁇ antibody OKT3.
  • FIG.38A is a bar graph showing the percentage of TCR ⁇ V 6-5+ T cells in PBMC cultures after 8 days of culture with the indicated antibody. Data for 5 replicates are shown.
  • FIG.38B is a bar graph showing the percentage of TCR ⁇ V 6-5+ T cells in purified T cell cultures after 8 days of culture with the indicated antibody.
  • FIG.39A is a bar graph showing the relative count of TCR ⁇ V 6-5+ T cells in PBMC culture after 8 days of culture with the indicated antibody.
  • FIG.39B is a bar graph showing the relative count of TCR ⁇ V 6-5+ T cells in PBMC culture after 8 days of culture with the indicated antibody.
  • FIG.40A is a bar graph showing the relative count of TCR ⁇ V 6-5+ T cells in a purified T cell culture after 8 days of culture with the indicated antibody.
  • FIG.40B is a bar graph showing the relative count of TCR ⁇ V 6-5+ T cells in a purified T cell culture after 8 days of culture with the indicated antibody.
  • FIG.41 is a line graph showing the total CD3+ T cell count (fold increase) after 8 days of T cell culture with either the anti-CD3 ⁇ antibody OKT3 or the anti-TCRvb 6-5 v1 antibody.
  • FIG.42 is a series of line graphs showing the kinetics of target cells by TCR ⁇ V 6-5 v1 activated T cells or anti-CD3 ⁇ (OKT3) activated T cells. T cells from three different donors were utilized (donor 6769, donor 9880, donor 5411).
  • FIG.43A is a scatter plot showing the percent of target cell lysis by T cells by TCR ⁇ V 6-5 v1 activated T cells or anti-CD3 ⁇ (OKT3) activated T cells without T cell pre activation.
  • FIG.43B is a scatter plot showing the percent of target cell lysis by T cells by TCR ⁇ V 6-5 v1 activated T cells or anti-CD3 ⁇ (OKT3) activated T cells with 4 days of T cell pre activation.
  • the data is presented at day 2 of co-culture between target cells and effector T cells (after 4 days of T cell pre- activation).
  • FIG.44 is a scatter plot showing the percent of target cell lysis by T cells by TCR ⁇ V 6-5 v1 activated T cells or anti-CD3 ⁇ (OKT3) activated T cells with 4 days of T cell pre activation.
  • FIG.45 is a bar graph showing target cell lysis by T cells by TCR ⁇ V 6-5 v1 activated T cells or anti-CD3 ⁇ (OKT3) activated T cells (100nM each antibody). The data includes seven replicates of each experimental condition.
  • FIG.46 is a series of FACS plots that show the cell surface expression of CD3 ⁇ on CD4+ TCR ⁇ V 6-5- or CD4+ TCR ⁇ V 6-5 + T cells activated with either SP34-2 (anti-CD3 ⁇ antibody) or anti-TCR ⁇ V 6-5 v1 (anti- TCR ⁇ V 6-5 antibody) at days 0, 1, 2, 4, 6, or 8 post antibody activation.
  • FIG.47 is a series of FACS plots that show the cell surface expression of CD3 ⁇ on CD8+ TCR ⁇ V 6-5- or CD8+ TCR ⁇ V 6-5 + T cells activated with either SP34-2 (anti-CD3 ⁇ antibody) or anti-TCR ⁇ V 6-5 v1 (anti- TCR ⁇ V 6-5 antibody) at days 0, 1, 2, 4, 6, or 8 post antibody activation.
  • FIG.48 is a series of FACS plots that show the cell surface expression of TCR ⁇ V on CD4+ TCR ⁇ V 6-5- or CD4+ TCR ⁇ V 6-5 + T cells activated with either SP34-2 (anti-CD3 ⁇ antibody) or anti-TCR ⁇ V 6-5 v1 (anti- TCR ⁇ V 6-5 antibody) at days 0, 1, 2, 4, 6, or 8 post antibody activation.
  • FIG.49 is a series of FACS plots that show the cell surface expression of TCR ⁇ V on CD8+ TCR ⁇ V 6-5- or CD8+ TCR ⁇ V 6-5 + T cells activated with either SP34-2 (anti-CD3 ⁇ antibody) or anti-TCR ⁇ V 6-5 v1 (anti- TCR ⁇ V 6-5 antibody) at days 0, 1, 2, 4, 6, or 8 post antibody activation.
  • FIG.50A shows FACS plot of TCR ⁇ V 6-5 + cynomolgus T cell expansion either unstimulated (left) or stimulated with anti-TCR ⁇ V 6-5 v1 (right) 7 days post activation of cynomolgus PBMCs.
  • FIG.50B shows FACS plot of TCR ⁇ V 6-5 + cynomolgus T cell expansion either unstimulated (left) or stimulated with anti-TCR ⁇ V 6-5 v1 (right) 7 days post activation of cynomolgus PBMCs.
  • PBMCs from Donor G709 were used.
  • FIG.51 shows FACS plot and corresponding microscopy images of TCR ⁇ V 6-5 + cynomolgus T cell expansion either unstimulated (left), stimulated with SP34-2 (anti-CD3 ⁇ antibody) (middle); or stimulated with anti-TCR ⁇ V 6-5 v1 (right) post activation of cryopreserved donor DW8N cynomolgus PBMCs.
  • the microscopy images show the cell cluster formation (indicated by circles).
  • FIG.52 shows a schematic of FACS plot showing the FACS gating/staining of PBMCs prior ⁇ T cell purification.
  • FIG.53 shows a schematic of FACS plot showing the FACS gating/staining of purified ⁇ T cell population.
  • FIG.54 show activation of purified ⁇ T cell population with anti-CD3 ⁇ antibody (SP34-2) (left) or anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1) (right).
  • FIG.55A shows the release of IFN ⁇ from purified ⁇ T cell populations activated with anti-CD3 ⁇ antibody (SP34-2), anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), or unstimulated.
  • FIG.55B shows the release of TNF ⁇ from purified ⁇ T cell populations activated with anti- CD3 ⁇ antibody (SP34-2), anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), or unstimulated.
  • FIG.55A shows the release of IFN ⁇ from purified ⁇ T cell populations activated with anti-CD3 ⁇ antibody (SP34-2), anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), or unstimulated.
  • FIG.55B shows the release of TNF ⁇ from purified ⁇ T
  • FIG. 55C shows the release of IL-2 from purified ⁇ T cell populations activated with anti-CD3 ⁇ antibody (SP34-2), anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), or unstimulated.
  • FIG.55D shows the release of IL-17A from purified ⁇ T cell populations activated with anti-CD3 ⁇ antibody (SP34-2), anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), or unstimulated.
  • FIG.55E shows the release of IL-1 ⁇ from purified ⁇ T cell populations activated with anti-CD3 ⁇ antibody (SP34-2), anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), or unstimulated.
  • FIG.55F shows the release of IL-1 ⁇ from purified ⁇ T cell populations activated with anti-CD3 ⁇ antibody (SP34-2), anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), or unstimulated.
  • FIG.55G shows the release of IL-6 from purified ⁇ T cell populations activated with anti-CD3 ⁇ antibody (SP34-2), anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), or unstimulated.
  • FIG.55H shows the release of IL-10 from purified ⁇ T cell populations activated with anti-CD3 ⁇ antibody (SP34- 2), anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), or unstimulated.
  • FIG.56 shows the relative representations of all TCR alpha V segments (TRAV group of genes)and their variants (top), all TCR beta V segment 6-5 variants (TRBV6-5 gene) (bottom left), and all TCR beta V segments and variants excluding 6-5 (bottom right).
  • FIG.57A is a FACS plot showing phenotypic markers of CD4+ T cells expanded with anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1). Defined phenotypes include TEMRA (top left), Na ⁇ ve/TSCM (top right), TEM (bottom left), and TCM (bottom right).
  • FIG.57B is a FACS plot showing phenotypic markers of CD4+ T cells expanded with anti-CD3 ⁇ antibody (OKT3).
  • FIG.58A is a FACS plot showing phenotypic markers of CD8+ T cells expanded with anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1).
  • phenotypes include TEMRA (top left), Na ⁇ ve/TSCM (top right), TEM (bottom left), and TCM (bottom right).
  • FIG.58B is a FACS plot showing phenotypic markers of CD8+ T cells expanded with anti-CD3 ⁇ antibody (OKT3).
  • FIG.59A is a bar graph showing the percentage of PD1 expressing CD4+ T cells from T cell cultures activated with anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), anti-CD3 ⁇ antibody (OKT3), or unstimulated.
  • FIG.59B is a bar graph showing the percentage of PD1 expressing CD8+ T cells from T cell cultures activated with anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), anti-CD3 ⁇ antibody (OKT3), or unstimulated.
  • FIG.60A is a bar graph showing the expression of Ki-67 by CD4+ T cells from T cell cultures activated with anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), anti-CD3 ⁇ antibody (OKT3), or unstimulated.
  • FIG.60B is a bar graph showing the expression of Ki-67 by CD8+ T cells from T cell cultures activated with anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), anti-CD3 ⁇ antibody (OKT3), or unstimulated.
  • FIG.61A is a FACS plot showing the percentage of TEMRA-like CD8+ T cells activated using anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1) that express CD57 (18.7%).
  • FIG. 61B is a FACS plot showing the percentage of TEM-like CD8+ T cells activated using anti- CD3 ⁇ antibody (OKT3) that express CD57 (46.8%) and the percentage of TCM-like CD8+ T cells activated using anti-CD3 ⁇ antibody (OKT3) that express CD57 (18.9%).
  • FIG.62 shows a series of FACS plots showing the expression of expression of CD27 and by CD4+ (top) or CD8+ (bottom) T cells from T cell cultures activated with anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), anti-CD3 ⁇ antibody (OKT3), or unstimulated.
  • FIG.63 shows a series of FACS plots showing the expression of expression of OX40, 41BB, and ICOS by CD4+ (top) or CD8+ (bottom) T cells from T cell cultures activated with anti-TCR ⁇ V antibody (anti-TCR ⁇ V 6-5 v1), anti-CD3 ⁇ antibody (OKT3), or unstimulated.
  • FIG.64 shows a series of FACS plots showing the percentage of CD3+ (CD4 gated) TCR ⁇ V 6-5+ T cells 1, 2, 3, 4, 5, 6, and 8 days port activation with BCMA and the anti-TCR V ⁇ antibody anti-TCR V ⁇ 6-5 v1.
  • FIG.65A shows a series of FACS plots showing the percentage of CD4+ T cells expanded using isotype control (IgG1 N297A), anti-TCR ⁇ V (anti-TCR V ⁇ 6-5 v1), or anti- CD3 ⁇ (OKT3) antibodies on day 0 post activation.
  • FIG.65B shows a series of FACS plots showing the percentage of CD4+ T cells expanded using isotype control (IgG1 N297A), anti- TCR ⁇ V (anti-TCR V ⁇ 6-5 v1), or anti-CD3 ⁇ (OKT3) antibodies on day 1 post activation.
  • FIG. 65C shows a series of FACS plots showing the percentage of CD4+ T cells expanded using isotype control (IgG1 N297A), anti-TCR ⁇ V (anti-TCR V ⁇ 6-5 v1), or anti-CD3 ⁇ (OKT3) antibodies on day 2 post activation.
  • FIG.65D shows a series of FACS plots showing the percentage of CD4+ T cells expanded using isotype control (IgG1 N297A), anti-TCR ⁇ V (anti- TCR V ⁇ 6-5 v1), or anti-CD3 ⁇ (OKT3) antibodies on day 3 post activation.
  • FIG.65E shows a series of FACS plots showing the percentage of CD4+ T cells expanded using isotype control (IgG1 N297A), anti-TCR ⁇ V (anti-TCR V ⁇ 6-5 v1), or anti-CD3 ⁇ (OKT3) antibodies on day 4 post activation.
  • FIG.65F shows a series of FACS plots showing the percentage of CD4+ T cells expanded using isotype control (IgG1 N297A), anti-TCR ⁇ V (anti-TCR V ⁇ 6-5 v1), or anti- CD3 ⁇ (OKT3) antibodies on day 5 post activation.
  • FIG.65G shows a series of FACS plots showing the percentage of CD4+ T cells expanded using isotype control (IgG1 N297A), anti- TCR ⁇ V (anti-TCR V ⁇ 6-5 v1), or anti-CD3 ⁇ (OKT3) antibodies on day 6 post activation.
  • FIG. 65H shows a series of FACS plots showing the percentage of CD4+ T cells expanded using isotype control (IgG1 N297A), anti-TCR ⁇ V (anti-TCR V ⁇ 6-5 v1), or anti-CD3 ⁇ (OKT3) antibodies on day 8 post activation.
  • FIG.66A is a bar graph showing ATP production from glycolysis of T cell cultures activated with the indicated antibodies.
  • FIG.66B is a bar graph showing ATP production from oxidative phosphorylation of T cell cultures activated with the indicated antibodies.
  • FIG.67 is a line graph showing the oxygen consumption rate (OCR) of T cells from about 0 to 75 minutes activated with the indicated antibody.
  • FIG.68A shows the oxygen consumption rate (OCR) of T cells activated with the indicated antibody during basal respiration.
  • FIG.68B shows the oxygen consumption rate (OCR) of T cells activated with the indicated antibody during maximal respiration.
  • FIG.68C shows the oxygen consumption rate (OCR) of T cells activated with the indicated antibody during spare respiratory capacity.
  • FIG.68D is a line graph indicates the areas of basal respiration and maximal respiration as shown in FIG.68A and FIG.68B, respectively.
  • FIG.69A is a bar graph showing ATP production from glycolysis of T cell cultures activated with anti-TCR ⁇ V 6-5 v1 and re-stimulated with the indicated antibody.
  • FIG.69B is a bar graph showing ATP production from oxidative phosphorylation of T cell cultures activated with anti-TCR ⁇ V 6-5 v1 and re-stimulated with the indicated antibody.
  • FIGS.70A-70G are graphs showing expression of IFNg, TNFa, IL-1a, IL-1b, IL-6 (CRS and neurotoxicity associated cytokines) with BHM1710 (anti TCRVB), a reduced affinity anti CD3 antibody (TB) and the SP34 anti CD3e antibody.
  • FIG.71 is a FACS plot showing the percentage of NK cells expanded from T cell cultures activated with the indicated antibody.
  • FIG.72 is a bar graph showing the number of NK cells expanded from T cell cultures activated with the indicated antibody.
  • FIG.73 shows a series of FACS plots showing NK cell proliferation induced by T cell cultures activated with the indicated antibody.
  • FIG.74 is a schematic showing an assay described in Example for determining NK cell mediated lysis of target K562 cells.
  • FIG.75 is a bar graph showing the percent target cell lysis mediated by NK cells activated by PBMCs activated with the indicated antibody.
  • FIG.76 shows a series of FACS plots showing the proliferation of NK cells from PBMC cultures activated/expanded with the indicated antibody (isotype control or OKT3).
  • PBMCs from three donors (D1, D2, and D3) were analyzed.
  • FIG.77 shows a series of FACS plots showing the proliferation of NK cells from PBMC cultures activated/expanded with the indicated antibody (anti-TCRv ⁇ 12-3/4 v1 or anti-TCRv ⁇ 12-3/4 v2).
  • PBMCs from three donors (D1, D2, and D3) were analyzed.
  • FIG.78 shows a series of FACS plots showing the proliferation of NK cells from PBMC cultures activated/expanded with the indicated antibody (anti-TCRv ⁇ 12-3/4 v3 or SP34-2).
  • PBMCs from three donors (D1, D2, and D3) were analyzed.
  • FIG.79 is a bar graph showing the level of secreted IFN ⁇ by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, OKT3, or SP34) and cultured with said antibody for the indicated number of days (1, 3, or 5).
  • FIG.80 is a bar graph showing the level of secreted IL-2 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, OKT3, or SP34) and cultured with said antibody for the indicated number of days (1, 3, or 5).
  • FIG.81 is a bar graph showing the level of secreted IL-15 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, OKT3, or SP34) and cultured with said antibody for the indicated number of days (1, 3, or 5).
  • FIG.82 is a bar graph showing the level of secreted IL-1 ⁇ by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, OKT3, or SP34) and cultured with said antibody for the indicated number of days (1, 3, or 5).
  • FIG.83 is a bar graph showing the level of secreted IL-6 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, OKT3, or SP34) and cultured with said antibody for the indicated number of days (1, 3, or 5).
  • FIG.84 is a bar graph showing the level of secreted IL-10 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, OKT3, or SP34) and cultured with said antibody for the indicated number of days (1, 3, or 5).
  • FIG.85 is a bar graph showing the level of the indicated cytokine secreted by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 or SP34). The data includes use of 17 individual PBMC donors.
  • FIG.86A is a bar graph showing the level of secreted IFN ⁇ by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 or OKT3) and cultured with said antibody for the indicated number of days (1, 2, 3, 5, or 6).
  • FIG.86B is a bar graph showing the level of secreted IL-1 ⁇ by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 or OKT3) and cultured with said antibody for the indicated number of days (1, 2, 3, 5, or 6).
  • FIG.86C is a bar graph showing the level of secreted IL-4 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 or OKT3) and cultured with said antibody for the indicated number of days (1, 2, 3, 5, or 6).
  • FIG.86D is a bar graph showing the level of secreted IL-6 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 or OKT3) and cultured with said antibody for the indicated number of days (1, 2, 3, 5, or 6).
  • FIG.86E is a bar graph showing the level of secreted IL-10 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 or OKT3) and cultured with said antibody for the indicated number of days (1, 2, 3, 5, or 6).
  • FIG.86F is a bar graph showing the level of secreted TNF ⁇ by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 or OKT3) and cultured with said antibody for the indicated number of days (1, 2, 3, 5, or 6).
  • FIG.86G is a bar graph showing the level of secreted IL-2 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 or OKT3) and cultured with said antibody for the indicated number of days (1, 2, 3, 5, or 6).
  • FIG.87A is a bar graph showing the level of secreted IFN ⁇ by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, anti-TCR ⁇ V 6-5 v1, OKT3, SP34-2, or isotype control) and cultured with said antibody for the indicated number of days (1, 2, 3, 5, or 6).
  • FIG.87B is a bar graph showing the level of secreted IL-1 ⁇ by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, anti-TCR ⁇ V 6-5 v1, OKT3, SP34-2, or isotype control) and cultured with said antibody for the indicated number of days (1, 2, 3, 5, or 6).
  • FIG.87C is a bar graph showing the level of secreted IL-4 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, anti-TCR ⁇ V 6-5 v1, OKT3, SP34-2, or isotype control) and cultured with said antibody for the indicated number of days (1, 2, 3, 5, or 6).
  • FIG.87D is a bar graph showing the level of secreted IL-6 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, anti-TCR ⁇ V 6-5 v1, OKT3, SP34-2, or isotype control) and cultured with said antibody for the indicated number of days (1, 2, 3, 5, or 6).
  • FIG.87E is a bar graph showing the level of secreted IL-10 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, anti-TCR ⁇ V 6-5 v1, OKT3, SP34-2, or isotype control) and cultured with said antibody for the indicated number of days (1, 2, 3, 5, or 6).
  • FIG.87F is a bar graph showing the level of secreted TNF ⁇ by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, anti-TCR ⁇ V 6-5 v1, OKT3, SP34-2, or isotype control) and cultured with said antibody for the indicated number of days (1, 2, 3, 5, or 6).
  • FIG.87G is a bar graph showing the level of secreted IL-2 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, anti-TCR ⁇ V 6-5 v1, OKT3, SP34-2, or isotype control) and cultured with said antibody for the indicated number of days (1, 2, 3, 5, or 6).
  • FIG.88A is a bar graph showing the level of secreted IFN ⁇ by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, anti-TCR ⁇ V 6-5 v1, OKT3, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.88B is a bar graph showing the level of secreted IL-1 ⁇ by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, anti-TCR ⁇ V 6-5 v1, OKT3, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.88C is a bar graph showing the level of secreted IL-4 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, anti-TCR ⁇ V 6-5 v1, OKT3, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.88D is a bar graph showing the level of secreted IL-6 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, anti-TCR ⁇ V 6-5 v1, OKT3, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.88E is a bar graph showing the level of secreted IL-10 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, anti-TCR ⁇ V 6-5 v1, OKT3, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.88F is a bar graph showing the level of secreted TNF ⁇ by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, anti-TCR ⁇ V 6-5 v1, OKT3, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.88G is a bar graph showing the level of secreted IL-2 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, anti-TCR ⁇ V 6-5 v1, OKT3, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.89A is a bar graph showing the level of secreted IL-17A by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, OKT3, or SP34-2) and cultured with said antibody for the indicated number of days (2, 5, or 7).
  • FIG.89B is a bar graph showing the level of secreted IL-17A by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, OKT3, or SP34-2) and cultured with said antibody for the indicated number of days (2, 5, or 8).
  • FIG.89C is a bar graph showing the level of secreted IL-17A by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1, OKT3, or SP34-2) and cultured with said antibody for the indicated number of days (2, 5, or 7).
  • FIG.89D is a bar graph showing the level of secreted IL-17A by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 or SP34-2) and cultured with said antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.90A is a bar graph showing the level of secreted IFN ⁇ by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti- BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90B is a bar graph showing the level of secreted IL-1 ⁇ by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti- TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90C is a bar graph showing the level of secreted IL-4 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti- BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90D is a bar graph showing the level of secreted IL-6 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti- TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90E is a bar graph showing the level of secreted IL-10 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti- BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90F is a bar graph showing the level of secreted TNF ⁇ by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti- TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90G is a bar graph showing the level of secreted IL-2 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti- BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90H is a bar graph showing the level of secreted IL-12p70 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90I is a bar graph showing the level of secreted IL-13 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti- BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90J is a bar graph showing the level of secreted IL-8 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti- TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90K is a bar graph showing the level of secreted exotaxin by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti- BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90L is a bar graph showing the level of secreted exotoxin-3 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90M is a bar graph showing the level of secreted IL-8 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90N is a bar graph showing the level of secreted IP-10 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti- TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90O is a bar graph showing the level of secreted MCP-1 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti- BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90P is a bar graph showing the level of secreted MCP-4 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti- TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90Q is a bar graph showing the level of secreted MDC by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti- BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90R is a bar graph showing the level of secreted MIP-1a by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti- TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90S is a bar graph showing the level of secreted MIP-1b by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti- BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90T is a bar graph showing the level of secreted TARC by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti- TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90U is a bar graph showing the level of secreted GMCSF by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti- BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90V is a bar graph showing the level of secreted IL-12-23p40 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90W is a bar graph showing the level of secreted IL-15 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90X is a bar graph showing the level of secreted IL-16 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti- TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90Y is a bar graph showing the level of secreted IL-17a by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti- BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90Z is a bar graph showing the level of secreted IL-1a by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti- TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90AA is a bar graph showing the level of secreted IL-5 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti- BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90BB is a bar graph showing the level of secreted IL-7 by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti- TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90CC is a bar graph showing the level of secreted TNF-B by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti- BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti-TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.90DD is a bar graph showing the level of secreted VEGF by T cells activated/expanded with the indicated antibody (isotype control; anti-TCR ⁇ V 6-5 v1 with anti-BCMA antibody; anti-TCR ⁇ V 6-5 v1; anti- TCR ⁇ V 123/4 v1, or SP34-2) and cultured with said antibody for the indicated number of days (1, 2, 3, 4, 5, 6, or 8).
  • FIG.91 shows a graphical representation of the relation of sequences between different TCRVB clonotype subfamilies.
  • FIG.92A is a bar graph showing the percentage of cytokine release from PBMCs activated/expanded for eight days using the indicated antibody (anti-TCR ⁇ V 12-3/4 v1 or SP34- 2).
  • FIG.92B is a bar graph showing the percentage of cytokine release from PBMCs activated/expanded for eight days using the indicated antibody (anti-TCR ⁇ V 5 or SP34-2).
  • FIG. 92C is a bar graph showing the percentage of cytokine release from PBMCs activated/expanded for eight days using the indicated antibody (anti-TCR ⁇ V 10 or SP34-2).
  • FIG.93A a bar graph showing the level of secreted IFN ⁇ by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG.93B a bar graph showing the level of secreted IL-10 by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG.93C a bar graph showing the level of secreted IL-17A by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG.93D a bar graph showing the level of secreted IL-1 ⁇ by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG. 93E a bar graph showing the level of secreted IL-1 ⁇ by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG.93F a bar graph showing the level of secreted IL-6 by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG.93G a bar graph showing the level of secreted TNF ⁇ by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG. 93H a bar graph showing the level of secreted IL-2 by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG.94 is a bar graph summarizing data from FACS analysis of PBMCs activated/expanded for 6 days using the indicated anti-TCRV ⁇ antibody.
  • FIG.95A a bar graph showing the level of secreted IFN ⁇ by T cells activated/expanded with the indicated antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.95B a bar graph showing the level of secreted IL-10 by T cells activated/expanded with the indicated antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.95C a bar graph showing the level of secreted IL-17A by T cells activated/expanded with the indicated antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.95D a bar graph showing the level of secreted IL- 1 ⁇ by T cells activated/expanded with the indicated antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.95E a bar graph showing the level of secreted IL-1 ⁇ by T cells activated/expanded with the indicated antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.95F a bar graph showing the level of secreted IL-6 by T cells activated/expanded with the indicated antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.95G a bar graph showing the level of secreted IL-4 by T cells activated/expanded with the indicated antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.95H a bar graph showing the level of secreted IL-2 by T cells activated/expanded with the indicated antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.96 is a bar graph summarizing data from FACS analysis of PBMCs activated/expanded for 7 days using the indicated anti-TCRV ⁇ antibody.
  • FIG.97A is a bar graph showing the level of secreted IFN ⁇ by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG. 97B a bar graph showing the level of secreted IL-10 by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG.97C a bar graph showing the level of secreted IL-17A by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG.97D a bar graph showing the level of secreted IL-1 ⁇ by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG.97E a bar graph showing the level of secreted IL-1 ⁇ by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG.97F a bar graph showing the level of secreted IL-6 by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG.97G a bar graph showing the level of secreted IL-4 by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG. 97H a bar graph showing the level of secreted TNF ⁇ by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG.97I a bar graph showing the level of secreted IL-2 by T cells activated/expanded with the indicated antibody for the indicated number of days (3 or 6).
  • FIG.98A is a bar graph showing the level of secreted IFN- ⁇ by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 (plate coated), anti-CD3 ⁇ (plate coated), anti-TCR ⁇ V 6-5 v1 (in solution), or anti-CD3 ⁇ (in solution) and cultured with said antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.98B is a bar graph showing the level of secreted IFN- ⁇ by T cells activated/expanded with the indicated antibody (anti- TCR ⁇ V 6-5 v1 (plate coated), anti-CD3 ⁇ (plate coated), anti-TCR ⁇ V 6-5 v1 (in solution), or anti-CD3 ⁇ (in solution) and cultured with said antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.98C is a bar graph showing the level of secreted IL-1b by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 (plate coated), anti-CD3 ⁇ (plate coated), anti- TCR ⁇ V 6-5 v1 (in solution), or anti-CD3 ⁇ (in solution) and cultured with said antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.98D is a bar graph showing the level of secreted IL-6 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 (plate coated), anti-CD3 ⁇ (plate coated), anti-TCR ⁇ V 6-5 v1 (in solution), or anti-CD3 ⁇ (in solution) and cultured with said antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.98E is a bar graph showing the level of secreted IL-10 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 (plate coated), anti-CD3 ⁇ (plate coated), anti-TCR ⁇ V 6-5 v1 (in solution), or anti-CD3 ⁇ (in solution) and cultured with said antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.98F is a bar graph showing the level of secreted IL-15 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 (plate coated), anti-CD3 ⁇ (plate coated), anti-TCR ⁇ V 6-5 v1 (in solution), or anti-CD3 ⁇ (in solution) and cultured with said antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.98G is a bar graph showing the level of secreted IL-17A by T cells activated/expanded with the indicated antibody (anti- TCR ⁇ V 6-5 v1 (plate coated), anti-CD3 ⁇ (plate coated), anti-TCR ⁇ V 6-5 v1 (in solution), or anti-CD3 ⁇ (in solution) and cultured with said antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.98H is a bar graph showing the level of secreted IL-1a by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 (plate coated), anti-CD3 ⁇ (plate coated), anti- TCR ⁇ V 6-5 v1 (in solution), or anti-CD3 ⁇ (in solution) and cultured with said antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.98I is a bar graph showing the level of secreted IL-1b by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 (plate coated), anti-CD3 ⁇ (plate coated), anti-TCR ⁇ V 6-5 v1 (in solution), or anti-CD3 ⁇ (in solution) and cultured with said antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.98J is a bar graph showing the level of secreted IL-2 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 (plate coated), anti-CD3 ⁇ (plate coated), anti-TCR ⁇ V 6-5 v1 (in solution), or anti-CD3 ⁇ (in solution) and cultured with said antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.98K is a bar graph showing the level of secreted IL-4 by T cells activated/expanded with the indicated antibody (anti-TCR ⁇ V 6-5 v1 (plate coated), anti-CD3 ⁇ (plate coated), anti-TCR ⁇ V 6-5 v1 (in solution), or anti-CD3 ⁇ (in solution) and cultured with said antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.98L is a bar graph showing the level of secreted TNF-a by T cells activated/expanded with the indicated antibody (anti- TCR ⁇ V 6-5 v1 (plate coated), anti-CD3 ⁇ (plate coated), anti-TCR ⁇ V 6-5 v1 (in solution), or anti-CD3 ⁇ (in solution) and cultured with said antibody for the indicated number of days (1, 3, 5, or 7).
  • FIG.99 is a FACS plot showing the showing the ability of MH3-2 to bind PBMCs from one of two donors when the PBMCs are either preincubated with TM23 or not (MH3-2 Alone).
  • FIG.100 is a FACS plot showing the ability of MH3-2 to bind PBMCs from one of two donors when the PBMCs are either preincubated with TM23 or not (MH3-2 Alone).
  • FIG.101A is a bar graph showing the polyfunctional strength index (PSI) of PBMC CD4+ T cells, CD4+ T cells expanded with anti-CD3 antibody, (CD3 Expanded T cells), and CD4+ T cells expanded with anti-TCRV ⁇ 6-5 antibody (Drug Expanded T cells).
  • the Effector mediators are Granzyme B, IFN ⁇ , MIP-1 ⁇ , perforin, TNF ⁇ , and TNF ⁇ .
  • the Stimulatory mediators are IL-5.
  • the Chemoattractive mediators are MIP-1b.
  • FIG.101B is a bar graph showing the polyfunctional strength index (PSI) of PBMC CD8+ T cells, CD8+ T cells expanded with anti-CD3 antibody, (CD3 Expanded T cells), and CD8+ T cells expanded with anti-TCRV ⁇ 6-5 antibody (Drug Expanded T cells).
  • the Effector mediators are Granzyme B, IFN ⁇ , MIP-1 ⁇ , perforin, and TNF ⁇ .
  • the Chemoattractive mediators are MIP-1b and RANTES.
  • FIGs. 102A-102C show binding of a CD19xTCRv ⁇ bispecific molecule to a TCR molecule.
  • FIG. 102A is a schematic of the bispecific molecule used in this study.
  • FIG. 102B is a graph showing the binding of a CD19xTCRv ⁇ bispecific molecule to soluble TCR.
  • FIG.102C is a graph showing binding of a CD19xTCRv ⁇ bispecific molecule to TCR expressed on Jurkat cells.
  • FIGs. 103A-103D show the characterization of a murine CD19xTCRv ⁇ 13-2/3 (2x2) bispecific molecule.
  • FIG. 103A is a schematic of the bispecific molecule used in this study.
  • FIG.103B is a graph showing the binding kinetics of murine CD19xTCRv ⁇ 13-2/3.
  • FIG. 103C are dot plots showing the expansion of TCRVB+ T cells following a 6 day incubation with murine CD19xTCRv ⁇ 13-2/3.
  • FIG. 103D is a graph showing the relative count of splenic B cells after a 6 day in vitro incubation with murine CD19xTCRv ⁇ 13-2/3 bispecific antibody.
  • FIG. 104 are graphs showing the level of B cells in the blood or spleen of animals treated with 0.1 mg per kg or 1 mg per kg of a murine CD19xTCRv ⁇ 13-2/3 bispecific antibody.
  • FIGs. 105A-105B are graphs showing the level of NK cells (FIG. 105A) or T cells (FIG. 105B) in the blood or spleen of animals treated with 0.1 mg per kg or 1 mg per kg of a murine CD19xTCRv ⁇ 13-2/3 bispecific antibody.
  • FIG. 106A-106F show expansion of TCRVB+ T cells and lysis of target cells with a CD19xTCRv ⁇ bispecific molecule.
  • FIG. 106A is a schematic of the bispecific molecule used in this study.
  • FIG. 106B is a graph showing target cell lysis by pre-expanded TCRVB+ T cells or CD3+ expanded pan T cells.
  • FIG. 106C shows depletion of purified B cells by purified T cells treated with a CD19xTCRv ⁇ bispecific molecule.
  • FIG.106D shows depletion of purified B cells by purified T cells treated with a CD19xCD3 bispecific molecule.
  • FIG. 106E shows depletion of B cells in a PBMC preparation treated with a CD19xTCRv ⁇ bispecific molecule.
  • FIG. 106F shows depletion of B cells in a PBMC preparation treated with a CD19xCD3 bispecific molecule.
  • FIGs. 107A-107B are graphs showing the expression of various cytokines from PBMCs treated with a CD19 x CD3 bispecific molecule (FIG.107A) or a CD19xTCRVB 6-5 bispecific molecule (FIG.107B).
  • FIGs. 108A-108C show a CD19 x TCRv ⁇ 6-5 (2x2) pharmacokinetic (PK) profile and dosing strategy.
  • FIG. 108A is a schematic of the experimental design.
  • FIG. 108A is a schematic of the experimental design.
  • FIG. 108B is a graph showing the concentration of CD19 x TCRv ⁇ 6-5 at the indicated timepoints after treatment.
  • FIG.108C shows the detection reagents used to detect CD19 x TCRv ⁇ 6-5.
  • Fab, scFv, VH, etc. antibody fragments
  • mAb monoclonal antibodies
  • anti-CD3e mAbs have been associated with side effects that result from massive T cell activation.
  • the large number of activated T cells secrete substantial amounts of cytokines, the most important of which is Interferon gamma (IFNg).
  • IFNg Interferon gamma
  • This excess amount of IFNg in turn activates macrophages which then overproduce proinflammatory cytokines such as IL-1beta, IL-6, IL-10 and TNF-alpha, causing a “cytokine storm” known as the cytokine release syndrome (CRS) (Shimabukuro- Vornhagen et al., J Immunother Cancer.2018 Jun 15;6(1):56, herein incorporated by reference in its entirety).
  • CRS cytokine release syndrome
  • NT neurotoxicity
  • TCR is a disulfide-linked membrane-anchored heterodimeric protein normally consisting of the highly variable alpha ( ⁇ ) and beta ( ⁇ ) chains expressed as part of a complex with the invariant CD3 chain molecules.
  • TCR on ⁇ T cells is formed by a heterodimer of one alpha chain and one beta chain. Each alpha or beta chain consists of a constant domain and a highly variable domain classified as the Immunoglobulin superfamily (IgSF) fold.
  • IgSF Immunoglobulin superfamily
  • the TCR ⁇ V chains can be further classified into 30 subfamilies (TRBV1-30). Despite their high structural and functional homology, the amino acid sequence homology in the TRBV genes is very low. Only 4 amino acids out of ⁇ 95 are identical while 10 additional amino acids are conserved among all subfamilies (see an alignment of TCRBV amino acid sequences in Table 9). Nevertheless, TCRs formed between alpha and beta chains of highly diverse sequences show a remarkable structural homology (FIGs.24A and 24B) and elicit a similar function, e.g., activation of T cells.
  • anti-TCR ⁇ V antibody molecules disclosed herein which despite having low sequence similarity (e.g., low sequence identity among the different antibody molecules that recognize different TCR ⁇ V subfamilies), recognize a structurally conserved, yet sequence-wise variable, region, e.g., domain, on the TCR ⁇ V protein (as denoted by the circled area in FIG.24A) and have a similar function (e.g., activation of T cells and a similar cytokine profile as described herein).
  • sequence similarity e.g., low sequence identity among the different antibody molecules that recognize different TCR ⁇ V subfamilies
  • sequence-wise variable, region e.g., domain
  • the anti-TCR ⁇ V antibody molecules disclosed herein share a structure-function relationship.
  • the anti-TCR ⁇ V antibody molecules disclosed herein bind to an outward facing epitope of a TCR ⁇ V protein when it is in a complex with a TCRalpha protein, e.g., as denoted by the circled area in FIG.24A.
  • the anti-TCR ⁇ V antibody molecules disclosed herein recognize (e.g., bind to), a domain (e.g., an epitope) on the TCR ⁇ V protein that is: (1) structurally conserved among different TCR ⁇ V subfamilies; and (2) has minimal sequence identity among the different TCR ⁇ V subfamilies.
  • TCR ⁇ V proteins from the different TCRBV subfamilies share minimal sequence similarity.
  • TCR ⁇ V proteins which have minimal sequence similarity share a similar 3D conformation and structure.
  • the anti-TCR ⁇ V antibody molecules disclosed herein do not recognize, e.g., bind to, an interface of a TCR ⁇ V:TCRalpha complex.
  • the anti-TCR ⁇ V antibody molecules disclosed herein do not recognize, e.g., bind to, a constant region of a TCR ⁇ V protein.
  • the anti-TCR ⁇ V antibody molecules disclosed herein do not recognize, e.g., bind to, one or more (e.g., all) of a complementarity determining region (e.g., CDR1, CDR2 and/or CDR3) of a TCR ⁇ V protein.
  • a complementarity determining region e.g., CDR1, CDR2 and/or CDR3
  • This disclosure provides, inter alia, antibody molecules directed to the variable chain of the beta subunit of TCR (TCR ⁇ V) which bind and, e.g., activate a subset of T cells.
  • the anti- TCR ⁇ V antibody molecules disclosed herein result in lesser or no production of cytokines associated with CRS, e.g., IL-6, IL-1beta, IL-10 and TNF alpha; and enhanced and/or delayed production of IL-2 and IFNg.
  • the anti-TCR ⁇ V antibodies disclosed herein have a cytokine profile, e.g., as described herein, which differs from a cytokine profile of a T cell engager that binds to a receptor or molecule other than a TCR ⁇ V region (“a non- TCR ⁇ V-binding T cell engager”).
  • the anti-TCR ⁇ V antibodies disclosed herein result in expansion of TCR ⁇ V+ T cells, e.g., a subset of memory effector T cells known as TEMRA.
  • T EMRA cells can promote tumor cell lysis but not CRS.
  • methods of making said anti-TCR ⁇ V antibody molecules and uses thereof are also disclosed herein.
  • multispecific molecules e.g., bispecific molecules comprising said anti-TCR ⁇ V antibody molecules.
  • compositions comprising anti-TCR ⁇ V antibody molecules of the present disclosure can be used, e.g., to: (1) activate and redirect T cells to promote tumor cell lysis for cancer immunotherapy; and/or (2) expand TCR ⁇ V+ T cells.
  • compositions comprising anti-TCR ⁇ V antibody molecules as disclosed herein limit the harmful side-effects of CRS and/or NT, e.g., CRS and/or NT associated with anti-CD3e targeting.
  • the anti-TCR ⁇ V antibody molecule does not bind to TCR ⁇ V12, or binds to TCR ⁇ V12 with an affinity and/or binding specificity that is less than (e.g., less than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V12 with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to a TCR ⁇ V region other than TCR ⁇ V12 (e.g., TCR ⁇ V region as described herein, e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule does not comprise the CDRs of the Antibody B murine antibody.
  • the anti-TCR ⁇ V antibody molecule does not bind to TCR ⁇ V5- 5*01 or TCR ⁇ V5-1*01, or binds to TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01 with an affinity and/or binding specificity that is less than (e.g., less than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to a TCR ⁇ V region other than TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01 (e.g., TCR ⁇ V region as described herein, e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • TCR ⁇ V region e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity
  • the anti-TCR ⁇ V antibody molecule does not comprise the CDRs of the TM23 murine antibody. Accordingly, provided herein are, inter alia, anti-TCR ⁇ V antibody molecules, multispecific or multifunctional molecules (e.g., multispecific or multifunctional antibody molecules) that comprise anti-TCR ⁇ V antibody molecules, nucleic acids encoding the same, methods of producing the aforesaid molecules, pharmaceutical compositions comprising aforesaid molecules, and methods of treating a disease or disorder, e.g., cancer, using the aforesaid molecules.
  • a disease or disorder e.g., cancer
  • the antibody molecules and pharmaceutical compositions disclosed herein can be used (alone or in combination with other agents or therapeutic modalities) to treat, prevent and/or diagnose disorders and conditions, e.g., cancer, e.g., as described herein.
  • disorders and conditions e.g., cancer, e.g., as described herein.
  • all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains.
  • the term “a” and “an” refers to one or to more than one (i.e., to at least one) of the grammatical object of the article.
  • an element means one element or more than one element.
  • a measurable value such as an amount, a temporal duration, and the like
  • a measurable value such as an amount, a temporal duration, and the like
  • the term “acquire” or “acquiring” as the terms are used herein, refer to obtaining possession of a physical entity (e.g., a sample, a polypeptide, a nucleic acid, or a sequence), or a value, e.g., a numerical value, by “directly acquiring” or “indirectly acquiring” the physical entity or value.
  • Directly acquiring means performing a process (e.g., performing a synthetic or analytical method) to obtain the physical entity or value.
  • “Indirectly acquiring” refers to receiving the physical entity or value from another party or source (e.g., a third party laboratory that directly acquired the physical entity or value).
  • Directly acquiring a physical entity includes performing a process that includes a physical change in a physical substance, e.g., a starting material.
  • Directly acquiring a value includes performing a process that includes a physical change in a sample or another substance, e.g., performing an analytical process which includes a physical change in a substance, e.g., a sample.
  • T cell receptor beta variable chain refers to an extracellular region of the T cell receptor beta chain which comprises the antigen recognition domain of the T cell receptor.
  • TCR ⁇ V includes isoforms, mammalian, e.g., human TCR ⁇ V, species homologs of human and analogs comprising at least one common epitope with TCR ⁇ V.
  • Human TCR ⁇ V comprises a gene family comprising subfamilies including, but not limited to: a TCR ⁇ V6 subfamily, a TCR ⁇ V10 subfamily, a TCR ⁇ V12 subfamily, a TCR ⁇ V5 subfamily, a TCR ⁇ V7 subfamily, a TCR ⁇ V11 subfamily, a TCR ⁇ V14 subfamily, a TCR ⁇ V16 subfamily, a TCR ⁇ V18 subfamily, a TCR ⁇ V9 subfamily, a TCR ⁇ V13 subfamily, a TCR ⁇ V4 subfamily, a TCR ⁇ V3 subfamily, a TCR ⁇ V2 subfamily, a TCR ⁇ V15 subfamily, a TCR ⁇ V30 subfamily, a TCR ⁇ V19 subfamily, a TCR ⁇ V27 subfamily, a TCR ⁇ V28 subfamily, a TCR ⁇ V24 subfamily, a TCR ⁇ V20 subfamily, TCR ⁇ V25 subfamily, a TCR ⁇ V29 subfamily, a T
  • the TCR ⁇ V6 subfamily comprises: TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01.
  • TCR ⁇ V comprises TCR ⁇ V6-5*01, or a variant thereof, e.g., a variant having 85%, 90%, 95%, 99% or more identity the naturally-occurring sequence.
  • TCR ⁇ V6-5*01 is also known as TRBV65; TCRBV6S5; TCRBV13S1, or TCR ⁇ V13.1.
  • the amino acid sequence of TCR ⁇ V6-5*01 e.g., human TCR ⁇ V6-5*01, is known in that art, e.g., as provided by IMGT ID L36092.
  • TCR ⁇ V6-5*01 is encoded by the nucleic acid sequence of SEQ ID NO: 43, or a sequence having 85%, 90%, 95%, 99% or more identity thereof.
  • TCR ⁇ V6-5*01 comprises the amino acid sequence of SEQ ID NO: 44, or a sequence having 85%, 90%, 95%, 99% or more identity thereof.
  • human-like antibody molecule refers to a humanized antibody molecule, human antibody molecule or an antibody molecule having at least 95% identity with a non-murine germline framework region, e.g., FR1, FR2, FR3 and/or FR4.
  • the human-like antibody molecule comprises a framework region having at least 95% identity to a human germline framework region, e.g., a FR1, FR2, FR3 and/or FR4 of a human germline framework region.
  • the human-like antibody molecule is a recombinant antibody.
  • the human-like antibody molecule is a humanized antibody molecule.
  • the human-like antibody molecule is human antibody molecule. In some embodiments, the human-like antibody molecule is a phage display or a yeast display antibody molecule. In some embodiments, the human-like antibody molecule is a chimeric antibody molecule. In some embodiments, the human-like antibody molecule is a CDR grafted antibody molecule.
  • a cytokine profile comprises the level and/or activity of one or more cytokines and/or one or more chemokines (e.g., as described herein). In some embodiments, a cytokine profile comprises the level and/or activity of a naturally occurring cytokine, a fragment or a variant thereof. In some embodiments, a cytokine profile comprises the level and/or activity of a naturally occurring chemokine, a fragment or a variant thereof.
  • a cytokine profile comprises the level and/or activity of one or more of: IL-2 (e.g., full length, a variant, or a fragment thereof); IL-1beta (e.g., full length, a variant, or a fragment thereof); IL-6 (e.g., full length, a variant, or a fragment thereof); TNF ⁇ (e.g., full length, a variant, or a fragment thereof); IFNg (e.g., full length, a variant, or a fragment thereof) IL-10 (e.g., full length, a variant, or a fragment thereof); IL-4 (e.g., full length, a variant, or a fragment thereof); TNF alpha (e.g., full length, a variant, or a fragment thereof);IL-12p70 (e.g., full length, a variant, or a fragment thereof); IL-13 (e.g., full length, a variant, or a fragment thereof); IL-8 (e.
  • a cytokine profile includes secretion of one or more cytokines or chemokines.
  • a cytokine in a cytokine profile can be modulated, e.g., increased or decreased, by an anti-TCRBV antibody molecule described herein.
  • the cytokine profile includes cytokines associated with a cytokine storm or cytokine release syndrome (CRS), e.g., IL-6, IL-1beta, TNFalpha and IL-10.
  • CRS cytokine storm or cytokine release syndrome
  • variant refers to a polypeptide that has a substantially identical amino acid sequence to the naturally-occurring sequence, or are encoded by a substantially identical nucleotide sequence.
  • the variant is a functional variant.
  • a TCR ⁇ V variant can bind to TCR ⁇ and form a TCR ⁇ : ⁇ complex.
  • the term “functional variant” refers to a polypeptide that has a substantially identical amino acid sequence to the naturally-occurring sequence, or are encoded by a substantially identical nucleotide sequence, and are capable of having one or more activities of the naturally- occurring sequence.
  • a “multifunctional” or a “multispecific” molecule refers to molecule, e.g., a polypeptide, that has two or more functionalities, e.g., two or more binding specificities.
  • the functionalities can include one or more immune cell engagers, one or more tumor binding molecules, one or more cytokine molecules, one or more stromal modifiers, and other moieties described herein.
  • the multispecific molecule is a multispecific antibody molecule, e.g., a bispecific antibody molecule.
  • the multispecific molecule includes an anti-TCRVb antibody molecule as described herein.
  • the multifunctional molecule includes an immune cell engager. “An immune cell engager” refers to one or more binding specificities that bind and/or activate an immune cell, e.g., a cell involved in an immune response.
  • the immune cell is chosen from a T cell, an NK cell, a B cell, a dendritic cell, and/or the macrophage cell.
  • the immune cell engager can be an antibody molecule, a receptor molecule (e.g., a full length receptor, receptor fragment, or fusion thereof (e.g., a receptor-Fc fusion)), or a ligand molecule (e.g., a full length ligand, ligand fragment, or fusion thereof (e.g., a ligand-Fc fusion)) that binds to the immune cell antigen (e.g., the T cell, the NK cell antigen, the B cell antigen, the dendritic cell antigen, and/or the macrophage cell antigen).
  • the immune cell antigen e.g., the T cell, the NK cell antigen, the B cell antigen, the dendritic cell antigen, and/or the macrophage cell antigen.
  • the immune cell engager specifically binds to the target immune cell, e.g., binds preferentially to the target immune cell.
  • the immune cell engager is an antibody molecule, it binds to an immune cell antigen (e.g., a T cell antigen, an NK cell antigen, a B cell antigen, a dendritic cell antigen, and/or a macrophage cell antigen) with a dissociation constant of less than about 10 nM.
  • the multifunctional molecule includes a cytokine molecule.
  • a “cytokine molecule” refers to full length, a fragment or a variant of a cytokine; a cytokine further comprising a receptor domain, e.g., a cytokine receptor dimerizing domain; or an agonist of a cytokine receptor, e.g., an antibody molecule (e.g., an agonistic antibody) to a cytokine receptor, that elicits at least one activity of a naturally-occurring cytokine.
  • a receptor domain e.g., a cytokine receptor dimerizing domain
  • an agonist of a cytokine receptor e.g., an antibody molecule (e.g., an agonistic antibody) to a cytokine receptor
  • the cytokine molecule is chosen from interleukin-2 (IL-2), interleukin-7 (IL-7), interleukin-12 (IL-12), interleukin-10 (IL-10), interleukin-15 (IL-15), interleukin-18 (IL-18), interleukin-21 (IL-21), or interferon gamma, or a fragment or variant thereof, or a combination of any of the aforesaid cytokines.
  • the cytokine molecule can be a monomer or a dimer.
  • the cytokine molecule can further include a cytokine receptor dimerizing domain.
  • the cytokine molecule is an agonist of a cytokine receptor, e.g., an antibody molecule (e.g., an agonistic antibody) to a cytokine receptor chosen from an IL-15Ra or IL-21R.
  • a cytokine receptor e.g., an antibody molecule (e.g., an agonistic antibody) to a cytokine receptor chosen from an IL-15Ra or IL-21R.
  • the term “molecule” as used in, e.g., antibody molecule, cytokine molecule, receptor molecule, includes full-length, naturally-occurring molecules, as well as variants, e.g., functional variants (e.g., truncations, fragments, mutated (e.g., substantially similar sequences) or derivatized form thereof), so long as at least one function and/or activity of the unmodified (e.g., naturally-occurring) molecule remains.
  • the multifunctional molecule includes a stromal modifying moiety.
  • a “stromal modifying moiety,” as used herein refers to an agent, e.g., a protein (e.g., an enzyme), that is capable of altering, e.g., degrading a component of, the stroma.
  • the component of the stroma is chosen from, e.g., an ECM component, e.g., a glycosaminoglycan, e.g., hyaluronan (also known as hyaluronic acid or HA), chondroitin sulfate, chondroitin, dermatan sulfate, heparin sulfate, heparin, entactin, tenascin, aggrecan and keratin sulfate; or an extracellular protein, e.g., collagen, laminin, elastin, fibrinogen, fibronectin, and vitronectin.
  • the articles “a” and “an” refer to one or more than one, e.g., to at least one, of the grammatical object of the article.
  • the use of the words “a” or “an” when used in conjunction with the term “comprising” herein may mean “one,” but it is also consistent with the meaning of "one or more,” “at least one,” and “one or more than one.”
  • “about” and “approximately” generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given range of values.
  • Antibody molecule refers to a protein, e.g., an immunoglobulin chain or fragment thereof, comprising at least one immunoglobulin variable domain structure and/or sequence.
  • An antibody molecule encompasses antibodies (e.g., full-length antibodies) and antibody fragments.
  • an antibody molecule comprises an antigen binding or functional fragment of a full length antibody, or a full length immunoglobulin chain.
  • a full-length antibody is an immunoglobulin (Ig) molecule (e.g., an IgG antibody) that is naturally occurring or formed by normal immunoglobulin gene fragment recombinatorial processes).
  • an antibody molecule refers to an immunologically active, antigen- binding portion of an immunoglobulin molecule, such as an antibody fragment.
  • An antibody fragment e.g., functional fragment, is a portion of an antibody, e.g., Fab, Fab′, F(ab′) 2 , F(ab) 2 , variable fragment (Fv), domain antibody (dAb), or single chain variable fragment (scFv).
  • a functional antibody fragment binds to the same antigen as that recognized by the intact (e.g., full-length) antibody.
  • antibody fragment or “functional fragment” also include isolated fragments consisting of the variable regions, such as the “Fv” fragments consisting of the variable regions of the heavy and light chains or recombinant single chain polypeptide molecules in which light and heavy variable regions are connected by a peptide linker (“scFv proteins”).
  • an antibody fragment does not include portions of antibodies without antigen binding activity, such as Fc fragments or single amino acid residues.
  • Exemplary antibody molecules include full length antibodies and antibody fragments, e.g., dAb (domain antibody), single chain, Fab, Fab’, and F(ab’) 2 fragments, and single chain variable fragments (scFvs).
  • the antibody molecule is an antibody mimetic.
  • the antibody molecule is, or comprises, an antibody-like framework or scaffold, such as, fibronectins, ankyrin repeats (e.g., designed ankyrin repeat proteins (DARPins)), avimers, affibody affinity ligands, anticalins, or affilin molecules.
  • an “immunoglobulin variable domain sequence” refers to an amino acid sequence which can form the structure of an immunoglobulin variable domain.
  • the sequence may include all or part of the amino acid sequence of a naturally-occurring variable domain.
  • the sequence may or may not include one, two, or more N- or C-terminal amino acids, or may include other alterations that are compatible with formation of the protein structure.
  • an antibody molecule is monospecific, e.g., it comprises binding specificity for a single epitope.
  • an antibody molecule is multispecific, e.g., it comprises a plurality of immunoglobulin variable domain sequences, where a first immunoglobulin variable domain sequence has binding specificity for a first epitope and a second immunoglobulin variable domain sequence has binding specificity for a second epitope.
  • an antibody molecule is a bispecific antibody molecule. “Bispecific antibody molecule” as used herein refers to an antibody molecule that has specificity for more than one (e.g., two, three, four, or more) epitope and/or antigen.
  • Antigen refers to a molecule that can provoke an immune response, e.g., involving activation of certain immune cells and/or antibody generation. Any macromolecule, including almost all proteins or peptides, can be an antigen. Antigens can also be derived from genomic recombinant or DNA. For example, any DNA comprising a nucleotide sequence or a partial nucleotide sequence that encodes a protein capable of eliciting an immune response encodes an “antigen.” In embodiments, an antigen does not need to be encoded solely by a full length nucleotide sequence of a gene, nor does an antigen need to be encoded by a gene at all.
  • an antigen can be synthesized or can be derived from a biological sample, e.g., a tissue sample, a tumor sample, a cell, or a fluid with other biological components.
  • a biological sample e.g., a tissue sample, a tumor sample, a cell, or a fluid with other biological components.
  • a tumor antigen or interchangeably, a “cancer antigen” includes any molecule present on, or associated with, a cancer, e.g., a cancer cell or a tumor microenvironment that can provoke an immune response.
  • an “immune cell antigen” includes any molecule present on, or associated with, an immune cell that can provoke an immune response.
  • the “antigen-binding site,” or “binding portion” of an antibody molecule refers to the part of an antibody molecule, e.g., an immunoglobulin (Ig) molecule, that participates in antigen binding.
  • the antigen binding site is formed by amino acid residues of the variable (V) regions of the heavy (H) and light (L) chains.
  • V variable regions of the heavy and light chains
  • hypervariable regions Three highly divergent stretches within the variable regions of the heavy and light chains, referred to as hypervariable regions, are disposed between more conserved flanking stretches called “framework regions,” (FRs).
  • FRs are amino acid sequences that are naturally found between, and adjacent to, hypervariable regions in immunoglobulins.
  • the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen-binding surface, which is complementary to the three-dimensional surface of a bound antigen.
  • the three hypervariable regions of each of the heavy and light chains are referred to as “complementarity-determining regions,” or “CDRs.”
  • the framework region and CDRs have been defined and described, e.g., in Kabat, E.A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No.91-3242, and Chothia, C. et al.
  • Each variable chain (e.g., variable heavy chain and variable light chain) is typically made up of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the amino acid order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
  • “Cancer” as used herein can encompass all types of oncogenic processes and/or cancerous growths.
  • cancer includes primary tumors as well as metastatic tissues or malignantly transformed cells, tissues, or organs.
  • cancer encompasses all histopathologies and stages, e.g., stages of invasiveness/severity, of a cancer.
  • cancer includes relapsed and/or resistant cancer.
  • cancer and “tumor” can be used interchangeably. For example, both terms encompass solid and liquid tumors.
  • cancer or “tumor” includes premalignant, as well as malignant cancers and tumors.
  • an “immune cell” refers to any of various cells that function in the immune system, e.g., to protect against agents of infection and foreign matter. In embodiments, this term includes leukocytes, e.g., neutrophils, eosinophils, basophils, lymphocytes, and monocytes.
  • Innate leukocytes include phagocytes (e.g., macrophages, neutrophils, and dendritic cells), mast cells, eosinophils, basophils, and natural killer cells.
  • Innate leukocytes identify and eliminate pathogens, either by attacking larger pathogens through contact or by engulfing and then killing microorganisms, and are mediators in the activation of an adaptive immune response.
  • the cells of the adaptive immune system are special types of leukocytes, called lymphocytes.
  • B cells and T cells are important types of lymphocytes and are derived from hematopoietic stem cells in the bone marrow. B cells are involved in the humoral immune response, whereas T cells are involved in cell-mediated immune response.
  • immune cell includes immune effector cells.
  • Immuno effector cell refers to a cell that is involved in an immune response, e.g., in the promotion of an immune effector response.
  • immune effector cells include, but are not limited to, T cells, e.g., alpha/beta T cells and gamma/delta T cells, B cells, natural killer (NK) cells, natural killer T (NK T) cells, and mast cells.
  • effector function or “effector response” refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
  • compositions and methods of the present invention encompass polypeptides and nucleic acids having the sequences specified, or sequences substantially identical or similar thereto, e.g., sequences at least 80%, 85%, 90%, 95% identical or higher to the sequence specified.
  • substantially identical is used herein to refer to a first amino acid that contains a sufficient or minimum number of amino acid residues that are i) identical to, or ii) conservative substitutions of aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences can have a common structural domain and/or common functional activity.
  • a reference sequence e.g., a sequence provided herein.
  • substantially identical is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity.
  • nucleotide sequences having at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a reference sequence, e.g., a sequence provided herein.
  • variant refers to a polypeptide that has a substantially identical amino acid sequence to a reference amino acid sequence, or is encoded by a substantially identical nucleotide sequence.
  • the variant is a functional variant.
  • the term “functional variant” refers to a polypeptide that has a substantially identical amino acid sequence to a reference amino acid sequence, or is encoded by a substantially identical nucleotide sequence, and is capable of having one or more activities of the reference amino acid sequence.
  • amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
  • a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid "identity” is equivalent to amino acid or nucleic acid "homology”).
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol.48:444-453 ) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
  • the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
  • a particularly preferred set of parameters are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
  • the percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W.
  • nucleic acid and protein sequences described herein can be used as a "query sequence" to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol.215:403-10.
  • Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res.25:3389-3402.
  • the default parameters of the respective programs e.g., XBLAST and NBLAST
  • amino acid is intended to embrace all molecules, whether natural or synthetic, which include both an amino functionality and an acid functionality and capable of being included in a polymer of naturally-occurring amino acids.
  • exemplary amino acids include naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and all stereoisomers of any of any of the foregoing.
  • amino acid includes both the D- or L- optical isomers and peptidomimetics.
  • a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • polypeptide polypeptide
  • peptide protein
  • protein protein
  • the terms “polypeptide”, “peptide” and “protein” (if single chain) are used interchangeably herein to refer to polymers of amino acids of any length.
  • the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non- amino acids.
  • the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
  • the polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.
  • nucleic acid refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
  • the polynucleotide may be either single-stranded or double-stranded, and if single-stranded may be the coding strand or non-coding (antisense) strand.
  • a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
  • the sequence of nucleotides may be interrupted by non-nucleotide components.
  • a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
  • the nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a non-natural arrangement.
  • isolated refers to material that is removed from its original or native environment (e.g., the natural environment if it is naturally occurring).
  • a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated by human intervention from some or all of the co-existing materials in the natural system, is isolated.
  • Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of the environment in which it is found in nature.
  • TCR Human T cell receptor
  • TCR complex T cell receptors
  • TCRs recognize antigens, e.g., peptides, presented on, e.g., bound to, major histocompatibility complex (MHC) molecules on the surface of cells, e.g., antigen-presenting cells.
  • MHC major histocompatibility complex
  • TCRs are heterodimeric molecules and can comprise an alpha chain, a beta chain, a gamma chain or a delta chain.
  • TCRs comprising an alpha chain and a beta chain are also referred to as TCR ⁇ .
  • the TCR beta chain consists of the following regions (also known as segments): variable (V), diversity (D), joining (J) and constant (C) (see Mayer G. and Nyland J.
  • TCR alpha chain consists of V, J and C regions.
  • the rearrangement of the T-cell receptor (TCR) through somatic recombination of V (variable), D (diversity), J (joining), and C (constant) regions is a defining event in the development and maturation of a T cell. TCR gene rearrangement takes place in the thymus.
  • TCRs can comprise a receptor complex, known as the TCR complex, which comprises a TCR heterodimer comprising of an alpha chain and a beta chain, and dimeric signaling molecules, e.g., CD3 co-receptors, e.g., CD3 ⁇ / ⁇ , and/or CD3 ⁇ / ⁇ .
  • TCR beta V (TCR ⁇ V) Diversity in the immune system enables protection against a huge array of pathogens. Since the germline genome is limited in size, diversity is achieved not only by the process of V(D)J recombination but also by junctional (junctions between V-D and D-J segments) deletion of nucleotides and addition of pseudo-random, non-templated nucleotides.
  • the TCR beta gene undergoes gene arrangement to generate diversity.
  • the TCR V beta repertoire varies between individuals and populations because of, e.g., 7 frequently occurring inactivating polymorphisms in functional gene segments and a large insertion/deletion-related polymorphism encompassing 2 V beta gene segments.
  • This disclosure provides, inter alia, antibody molecules and fragments thereof, that bind, e.g., specifically bind, to a human TCR beta V chain (TCR ⁇ V), e.g., a TCR ⁇ V gene family (also referred to as a group), e.g., a TCR ⁇ V subfamily (also referred to as a subgroup), e.g., as described herein.
  • TCR beta V families and subfamilies are known in the art, e.g., as described in Yassai et al., (2009) Immunogenetics 61(7)pp:493-502; Wei S. and Concannon P. (1994) Human Immunology 41(3) pp: 201-206.
  • the antibodies described herein can be recombinant antibodies, e.g., recombinant non-murine antibodies, e.g., recombinant human or humanized antibodies.
  • the terms TCRBV, TCRVB, TRBV, TCR ⁇ V, TCRV ⁇ or TR ⁇ V are used interchangeably herein and refer to a TCR beta V chain, e.g., as described herein.
  • the disclosure provides an anti-TCR ⁇ V antibody molecule that binds to human TCR ⁇ V, e.g., a TCR ⁇ V family, e.g., gene family or a variant thereof.
  • a TCRBV gene family comprises one or more subfamilies, e.g., as described herein, e.g., in FIG.3, Table 8A or Table 8B.
  • the TCR ⁇ V gene family comprises: a TCR ⁇ V6 subfamily, a TCR ⁇ V10 subfamily, a TCR ⁇ V12 subfamily, a TCR ⁇ V5 subfamily, a TCR ⁇ V7 subfamily, a TCR ⁇ V11 subfamily, a TCR ⁇ V14 subfamily, a TCR ⁇ V16 subfamily, a TCR ⁇ V18 subfamily, a TCR ⁇ V9 subfamily, a TCR ⁇ V13 subfamily, a TCR ⁇ V4 subfamily, a TCR ⁇ V3 subfamily, a TCR ⁇ V2 subfamily, a TCR ⁇ V15 subfamily, a TCR ⁇ V30 subfamily, a TCR ⁇ V19 subfamily, a TCR ⁇ V27 subfamily, a TCR ⁇ V28 subfamily, a TCR ⁇ V24 subfamily, a TCR ⁇ V20 subfamily, TCR ⁇ V25 subfamily, a TCR ⁇ V29 subfamily, a TCR ⁇ V1 subfamily, a TCR ⁇ V6
  • TCR ⁇ V6 subfamily is also known as TCR ⁇ V13.1.
  • the TCR ⁇ V6 subfamily comprises: TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6- 9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01, or a variant thereof.
  • TCR ⁇ V6 comprises TCR ⁇ V6-4*01, or a variant thereof.
  • TCR ⁇ V6 comprises TCR ⁇ V6- 4*02, or a variant thereof.
  • TCR ⁇ V6 comprises TCR ⁇ V6-9*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-8*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-5*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-6*02, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-6*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-2*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-3*01, or a variant thereof.
  • TCR ⁇ V6 comprises TCR ⁇ V6-1*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-5*01, or a variant thereof. In some embodiments, TCR ⁇ V6, e.g., TCR ⁇ V6-5*01, is recognized, e.g., bound, by SEQ ID NO: 1 and/or SEQ ID NO: 2. In some embodiments, TCR ⁇ V6, e.g., TCR ⁇ V6-5*01, is recognized, e.g., bound, by SEQ ID NO: 9 and/or SEQ ID NO: 10.
  • TCR ⁇ V6 is recognized, e.g., bound, by SEQ ID NO: 9 and/or SEQ ID NO: 11.
  • TCR ⁇ V10 subfamily is also known as TCR ⁇ V12.
  • the TCR ⁇ V10 subfamily comprises: TCR ⁇ V10-1*01, TCR ⁇ V10-1*02, TCR ⁇ V10-3*01 or TCR ⁇ V10-2*01, or a variant thereof.
  • TCR ⁇ V12 subfamily is also known as TCR ⁇ V8.1.
  • the TCR ⁇ V12 subfamily comprises: TCR ⁇ V12-4*01, TCR ⁇ V12-3*01, or TCR ⁇ V12-5*01, or a variant thereof.
  • TCR ⁇ V12 is recognized, e.g., bound, by SEQ ID NO: 15 and/or SEQ ID NO: 16. In some embodiments, TCR ⁇ V12 is recognized, e.g., bound, by any one of SEQ ID NOs 23-25, and/or any one of SEQ ID NO: 26- 30: In some embodiments, the TCR ⁇ V5 subfamily is chosen from: TCR ⁇ V5-5*01, TCR ⁇ V5-6*01, TCR ⁇ V5-4*01, TCR ⁇ V5-8*01, TCR ⁇ V5-1*01, or a variant thereof.
  • the TCR ⁇ V7 subfamily comprises TCR ⁇ V7-7*01, TCR ⁇ V7- 6*01, TCR ⁇ V7 -8*02, TCR ⁇ V7 -4*01, TCR ⁇ V7-2*02, TCR ⁇ V7-2*03, TCR ⁇ V7-2*01, TCR ⁇ V7-3*01, TCR ⁇ V7-9*03, or TCR ⁇ V7-9*01, or a variant thereof.
  • the TCR ⁇ V11 subfamily comprises: TCR ⁇ V11-1*01, TCR ⁇ V11-2*01 or TCR ⁇ V11-3*01, or a variant thereof.
  • the TCR ⁇ V14 subfamily comprises TCR ⁇ V14*01, or a variant thereof.
  • the TCR ⁇ V16 subfamily comprises TCR ⁇ V16*01, or a variant thereof.
  • the TCR ⁇ V18 subfamily comprises TCR ⁇ V18*01, or a variant thereof.
  • the TCR ⁇ V9 subfamily comprises TCR ⁇ V9*01 or TCR ⁇ V9*02, or a variant thereof.
  • the TCR ⁇ V13 subfamily comprises TCR ⁇ V13*01, or a variant thereof.
  • the TCR ⁇ V4 subfamily comprises TCR ⁇ V4-2*01, TCR ⁇ V4- 3*01, or TCR ⁇ V4-1*01, or a variant thereof.
  • the TCR ⁇ V3 subfamily comprises TCR ⁇ V3-1*01, or a variant thereof.
  • the TCR ⁇ V2 subfamily comprises TCR ⁇ V2*01, or a variant thereof.
  • the TCR ⁇ V15 subfamily comprises TCR ⁇ V15*01, or a variant thereof.
  • the TCR ⁇ V30 subfamily comprises TCR ⁇ V30*01, or TCR ⁇ V30*02, or a variant thereof.
  • the TCR ⁇ V19 subfamily comprises TCR ⁇ V19*01, or TCR ⁇ V19*02, or a variant thereof.
  • the TCR ⁇ V27 subfamily comprises TCR ⁇ V27*01, or a variant thereof.
  • the TCR ⁇ V28 subfamily comprises TCR ⁇ V28*01, or a variant thereof.
  • the TCR ⁇ V24 subfamily comprises TCR ⁇ V24-1*01, or a variant thereof.
  • the TCR ⁇ V20 subfamily comprises TCR ⁇ V20-1*01, or TCR ⁇ V20-1*02, or a variant thereof.
  • the TCR ⁇ V25 subfamily comprises TCR ⁇ V25-1*01, or a variant thereof.
  • the TCR ⁇ V29 subfamily comprises TCR ⁇ V29-1*01, or a variant thereof.
  • Table 8A List of TCR ⁇ V subfamilies and subfamily members
  • Table 8B Additional TCR ⁇ V subfamilies
  • the various TCR ⁇ V subfamilies and/or subfamily members can be expressed at different levels in individuals, e.g., healthy individuals, as disclosed in Kitaura K. et al (2016), BMC Immunology vol 17: 38, the entire contents of which are hereby incorporated by reference.
  • TCR ⁇ V6-5 is represented in approximately 3-6% healthy donors.
  • the representation of various TCRBV subfamilies and/or subfamily members can also be different in cancer cells.
  • TCR ⁇ V is present in about 3-6% of tumor infiltrating T cells irrespective of tumor type (see Li B.
  • TCR ⁇ V6-5 is present at a high frequency in tumor cells.
  • Exemplary amino acid sequences for TCR ⁇ V subfamily members can be found on the ImMunoGeneTics Information System website: http://www.imgt.org/, or in a similar resource.
  • Table 9 Alignment of TCRBV amino acid sequences (SEQ ID NOS 3457-3639, respectively, in order of appearance)
  • TCRBV amino acid sequences in Table 9 underscores the diversity of TCR sequences.
  • TRBV sequences from different subfamilies are considerably different from each other.
  • Anti-TCR ⁇ V antibodies Disclosed herein, is the discovery of a novel class of antibodies, i.e. anti-TCR ⁇ V antibody molecules disclosed herein, which despite having low sequence similarity (e.g., low sequence identity among the different antibody molecules that recognize different TCR ⁇ V subfamilies), recognize a structurally conserved region, e.g., domain, on the TCR ⁇ V protein (e.g., as denoted by the circled area in FIG.24A) and have a similar function (e.g., a similar cytokine profile).
  • the anti-TCR ⁇ V antibody molecules disclosed herein share a structure- function relationship.
  • the anti-TCR ⁇ V antibody molecules disclosed herein bind to an outward facing epitope of a TCR ⁇ V protein when it is in a complex with a TCRalpha protein, e.g., as described by the circled area in FIG.24A.
  • the anti-TCR ⁇ V antibody molecules disclosed herein recognize (e.g., bind to), a structurally conserved domain on the TCR ⁇ V protein (e.g., as denoted by the circled area in FIG.24A).
  • the anti-TCR ⁇ V antibody molecules disclosed herein do not recognize, e.g., bind to, an interface of a TCR ⁇ V:TCRalpha complex. In some embodiments, the anti-TCR ⁇ V antibody molecules disclosed herein do not recognize, e.g., bind to, a constant region of a TCR ⁇ V protein.
  • An exemplary antibody that binds to a constant region of a TCRBV region is JOVI.1 as described in Viney et al., (Hybridoma.1992 Dec;11(6):701-13).
  • the anti-TCR ⁇ V antibody molecules disclosed herein do not recognize, e.g., bind to, one or more (e.g., all) of a complementarity determining region (e.g., CDR1, CDR2 and/or CDR3) of a TCR ⁇ V protein. In some embodiments, the anti-TCR ⁇ V antibody molecules disclosed herein binds (e.g., specifically binds) to a TCR ⁇ V region.
  • a complementarity determining region e.g., CDR1, CDR2 and/or CDR3
  • binding of anti-TCR ⁇ V antibody molecules disclosed herein results in a cytokine profile that differs from a cytokine profile of a T cell engager that binds to a receptor or molecule other than a TCR ⁇ V region (“a non-TCR ⁇ V- binding T cell engager”).
  • the non-TCR ⁇ V-binding T cell engager comprises an antibody that binds to a CD3 molecule (e.g., CD3 epsilon (CD3e) molecule); or a TCR alpha (TCR ⁇ ) molecule.
  • the non-TCR ⁇ V-binding T cell engager is an OKT3 antibody or an SP34-2 antibody.
  • the disclosure provides an anti-TCR ⁇ V antibody molecule that binds to human TCR ⁇ V, e.g., a TCR ⁇ V gene family, e.g., one or more of a TCR ⁇ V subfamily, e.g., as described herein, e.g., in FIG.3, Table 8A, or Table 8B.
  • a TCR ⁇ V gene family e.g., one or more of a TCR ⁇ V subfamily, e.g., as described herein, e.g., in FIG.3, Table 8A, or Table 8B.
  • the anti-TCR ⁇ V antibody molecule binds to one or more TCR ⁇ V subfamilies chosen from: a TCR ⁇ V6 subfamily, a TCR ⁇ V10 subfamily, a TCR ⁇ V12 subfamily, a TCR ⁇ V5 subfamily, a TCR ⁇ V7 subfamily, a TCR ⁇ V11 subfamily, a TCR ⁇ V14 subfamily, a TCR ⁇ V16 subfamily, a TCR ⁇ V18 subfamily, a TCR ⁇ V9 subfamily, a TCR ⁇ V13 subfamily, a TCR ⁇ V4 subfamily, a TCR ⁇ V3 subfamily, a TCR ⁇ V2 subfamily, a TCR ⁇ V15 subfamily, a TCR ⁇ V30 subfamily, a TCR ⁇ V19 subfamily, a TCR ⁇ V27 subfamily, a TCR ⁇ V28 subfamily, a TCR ⁇ V24 subfamily, a TCR ⁇ V20 subfamily, TCR ⁇ V25 subfamily, a TCR
  • the anti-TCR ⁇ V antibody molecule binds to a TCR ⁇ V6 subfamily comprising: TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01, or a variant thereof.
  • the TCR ⁇ V6 subfamily comprises TCR ⁇ V6-5*01, or a variant thereof.
  • TCR ⁇ V6 comprises TCR ⁇ V6-4*01, or a variant thereof.
  • TCR ⁇ V6 comprises TCR ⁇ V6-4*02, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-9*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-8*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-5*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-6*02, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-6*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6- 2*01, or a variant thereof.
  • TCR ⁇ V6 comprises TCR ⁇ V6-3*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-1*01, or a variant thereof. In some embodiments, the anti-TCR ⁇ V antibody molecule binds to a TCR ⁇ V10 subfamily comprising: TCR ⁇ V10-1*01, TCR ⁇ V10-1*02, TCR ⁇ V10-3*01 or TCR ⁇ V10- 2*01, or a variant thereof. In some embodiments, the anti-TCR ⁇ V antibody molecule binds to a TCR ⁇ V12 subfamily comprising: TCR ⁇ V12-4*01, TCR ⁇ V12-3*01 or TCR ⁇ V12-5*01, or a variant thereof.
  • the anti-TCR ⁇ V antibody molecule binds to a TCR ⁇ V5 subfamily comprising: TCR ⁇ V5-5*01, TCR ⁇ V5-6*01, TCR ⁇ V5-4*01, TCR ⁇ V5-8*01, TCR ⁇ V5-1*01, or a variant thereof.
  • TCR ⁇ V5 subfamily comprising: TCR ⁇ V5-5*01, TCR ⁇ V5-6*01, TCR ⁇ V5-4*01, TCR ⁇ V5-8*01, TCR ⁇ V5-1*01, or a variant thereof.
  • Exemplary anti-TCR ⁇ V antibody molecules and the corresponding TCR ⁇ V subfamily recognized by said anti-TCR ⁇ V antibody molecules is disclosed in Table 10A.
  • Table 10A Exemplary anti-TCR ⁇ V antibody molecules
  • the anti-TCR ⁇ V antibody molecule does not bind to TCR ⁇ V12, or binds to TCR ⁇ V12 with an affinity and/or binding specificity that is less than (e.g., less than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V12 with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to a TCR ⁇ V region other than TCR ⁇ V12 (e.g., TCR ⁇ V region as described herein, e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the 16G8 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • TCR ⁇ V region e.g., TCR ⁇ V region as described herein, e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10-
  • the anti-TCR ⁇ V antibody molecule does not bind to TCR ⁇ V5- 5*01 or TCR ⁇ V5-1*01, or binds to TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01 with an affinity and/or binding specificity that is less than (e.g., less than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • the anti-TCR ⁇ V antibody molecule binds to a TCR ⁇ V region other than TCR ⁇ V5-5*01 or TCR ⁇ V5-1*01 (e.g., TCR ⁇ V region as described herein, e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity and/or binding specificity of the TM23 murine antibody or a humanized version thereof as described in US Patent 5,861,155.
  • TCR ⁇ V region e.g., TCR ⁇ V6 subfamily (e.g., TCR ⁇ V6-5*01) with an affinity and/or binding specificity that is greater than (e.g., greater than about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or about 2-, 5-, or 10- fold) the affinity
  • the disclosure provides an anti-TCR ⁇ V antibody molecule that binds to human TCR ⁇ V6, e.g., a TCR ⁇ V6 subfamily comprising: TCR ⁇ V6-4*01, TCR ⁇ V6-4*02, TCR ⁇ V6-9*01, TCR ⁇ V6-8*01, TCR ⁇ V6-5*01, TCR ⁇ V6-6*02, TCR ⁇ V6-6*01, TCR ⁇ V6-2*01, TCR ⁇ V6-3*01 or TCR ⁇ V6-1*01.
  • the TCR ⁇ V6 subfamily comprises TCR ⁇ V6-5*01 or a variant thereof.
  • TCR ⁇ V6 comprises TCR ⁇ V6-4*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-4*02, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6- 9*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-8*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-5*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-6*02, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-6*01, or a variant thereof.
  • TCR ⁇ V6 comprises TCR ⁇ V6-2*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-3*01, or a variant thereof. In some embodiments, TCR ⁇ V6 comprises TCR ⁇ V6-1*01, or a variant thereof. In some embodiments, TCR ⁇ V6-5*01 is encoded by the nucleic acid sequence of SEQ ID NO: 43, or a sequence having 85%, 90%, 95%, 99% or more identity thereof. SEQ ID NO: 43 In some embodiments, TCR ⁇ V6-5*01 comprises the amino acid sequence of SEQ ID NO: 44, or an amino acid sequence having 85%, 90%, 95%, 99% or more identity thereof.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule is a non-murine antibody molecule, e.g., a human or humanized antibody molecule.
  • the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule is a human antibody molecule.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule is a humanized antibody molecule.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, is isolated or recombinant.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • an antibody described herein e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule comprises a heavy chain variable region (VH) having a consensus sequence of SEQ ID NO: 231 or 3290.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises at least one or two light chain variable regions from an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
  • the anti-TCR ⁇ V antibody molecule comprises a light chain variable region (VL) having a consensus sequence of SEQ ID NO: 230 or 3289.
  • VL light chain variable region
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises a heavy chain constant region for an IgG4, e.g., a human IgG4.
  • the anti-TCR ⁇ V antibody molecule e.g., anti- TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule includes a heavy chain constant region for an IgG1, e.g., a human IgG1.
  • the heavy chain constant region comprises an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule includes a kappa light chain constant region, e.g., a human kappa light chain constant region.
  • the light chain constant region comprises an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region (VH) of an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A- H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
  • CDRs complementarity determining regions
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, includes at least one, two, or three CDRs (or collectively all of the CDRs) from a heavy chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
  • CDRs complementarity determining regions
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, molecule includes all six CDRs from an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1, or closely related CDRs, e.g., CDRs which are identical or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions).
  • an antibody described herein e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule includes at least one, two, or three CDRs according to Kabat et al.
  • an antibody described herein e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Kabat et al.
  • substitutions, deletions, or insertions e.g., conservative substitutions
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule includes at least one, two, or three CDRs according to Kabat et al.
  • an antibody described herein e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Kabat et al.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, includes at least one, two, three, four, five, or six CDRs according to Kabat et al.
  • an antibody described herein e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, three, four, five, or six CDRs according to Kabat et al.
  • substitutions, deletions, or insertions e.g., conservative substitutions
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, includes all six CDRs according to Kabat et al.
  • an antibody described herein e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to all six CDRs according to Kabat et al.
  • an antibody chosen from any one of A-H.1 to A-H.85 e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleot
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule includes at least one, two, or three CDRs according to Chothia et al.
  • an antibody e.g., at least one, two, or three CDRs according to the Chothia definition as set out in Table 1
  • a heavy chain variable region of an antibody described herein e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or as described in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Chothia et al.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule includes at least one, two, or three CDRs according to Chothia et al.
  • an antibody described herein e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Chothia et al.
  • an antibody chosen from any one of A-H.1 to A-H.85 e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or a sequence substantially identical (e.g., at least 80%, 85%, 90%
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, includes at least one, two, three, four, five, or six CDRs according to Chothia et al.
  • an antibody described herein e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by the nucleotide sequence in Table 1; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, three, four, five, or six CDRs according to Chothia et al.
  • an antibody chosen from any one of A-H.1 to A-H.85 e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1,
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, includes all six CDRs according to Chothia et al.
  • an antibody described herein e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleotide sequence in Table 1; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to all six CDRs according to Chothia et al.
  • an antibody chosen from any one of A-H.1 to A-H.85 e.g., A-H.1, A-H.2 or A-H.68, or an antibody described in Table 1, or encoded by a nucleo
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, molecule includes a combination of CDRs or hypervariable loops defined according to Kabat et al., Chothia et al., or as described in Table 1.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • a combined CDR as set out in Table 1 is a CDR that comprises a Kabat CDR and a Chothia CDR.
  • the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, molecule includes a combination of CDRs or hypervariable loops identified as combined CDRs in Table 1.
  • the anti- TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • can contain any combination of CDRs or hypervariable loops according the “combined” CDRs are described in Table 1.
  • the antibody molecule is a monospecific antibody molecule, a bispecific antibody molecule, a bivalent antibody molecule, a biparatopic antibody molecule, or an antibody molecule that comprises an antigen binding fragment of an antibody, e.g., a half antibody or antigen binding fragment of a half antibody.
  • the antibody molecule comprises a multispecific molecule, e.g., a bispecific molecule, e.g., as described herein.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti- TCR ⁇ V6-5*01) antibody molecule includes: (i) one, two or all of a light chain complementarity determining region 1 (LC CDR1), a light chain complementarity determining region 2 (LC CDR2), and a light chain complementarity determining region 3 (LC CDR3) of SEQ ID NO: 2, SEQ ID NO: 10 or SEQ ID NO: 11, and/or (ii) one, two or all of a heavy chain complementarity determining region 1 (HC CDR1), heavy chain complementarity determining region 2 (HC CDR2), and a heavy chain complementarity determining region 3 (HC CDR3) of SEQ ID NO: 1 or SEQ ID NO: 9.
  • LC CDR1 light chain complementarity determining region 1
  • LC CDR2 light chain complementarity determining region 2
  • LC CDR3 light chain complementarity determining region 3
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule comprises a LC CDR1, LC CDR2, and LC CDR3 of SEQ ID NO: 2, and a HC CDR1, HC CDR2, and HC CDR3 of SEQ ID NO: 1.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti- TCR ⁇ V6-5*01) antibody molecule comprises a LC CDR1, LC CDR2, and LC CDR3 of SEQ ID NO: 10, and a HC CDR1, HC CDR2, and HC CDR3 of SEQ ID NO: 9.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule comprises a LC CDR1, LC CDR2, and LC CDR3 of SEQ ID NO: 11, and a HC CDR1, HC CDR2, and HC CDR3 of SEQ ID NO: 9.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti- TCR ⁇ V6-5*01) antibody molecule comprises: (i) a LC CDR1 amino acid sequence of SEQ ID NO: 6, a LC CDR2 amino acid sequence of SEQ ID NO: 7, or a LC CDR3 amino acid sequence of SEQ ID NO: 8; and/or (ii) a HC CDR1 amino acid sequence of SEQ ID NO: 3, a HC CDR2 amino acid sequence of SEQ ID NO: 4, or a HC CDR3 amino acid sequence of SEQ ID NO: 5.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule comprises: (i) a light chain variable region (VL) comprising a LC CDR1 amino acid sequence of SEQ ID NO: 6, a LC CDR2 amino acid sequence of SEQ ID NO: 7, or a LC CDR3 amino acid sequence of SEQ ID NO: 8; and/or (ii) a heavy chain variable region (VH) comprising a HC CDR1 amino acid sequence of SEQ ID NO: 3, a HC CDR2 amino acid sequence of SEQ ID NO: 4, or a HC CDR3 amino acid sequence of SEQ ID NO: 5.
  • VL light chain variable region
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti- TCR ⁇ V6-5*01) antibody molecule comprises: (i) a LC CDR1 amino acid sequence of SEQ ID NO: 51, a LC CDR2 amino acid sequence of SEQ ID NO: 52, or a LC CDR3 amino acid sequence of SEQ ID NO: 53; and/or (ii) a HC CDR1 amino acid sequence of SEQ ID NO: 45, a HC CDR2 amino acid sequence of SEQ ID NO: 46, or a HC CDR3 amino acid sequence of SEQ ID NO: 47.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule comprises: (i) a light chain variable region (VL) comprising a LC CDR1 amino acid sequence of SEQ ID NO: 51, a LC CDR2 amino acid sequence of SEQ ID NO: 52, or a LC CDR3 amino acid sequence of SEQ ID NO: 53; and/or (ii) a heavy chain variable region (VH) comprising a HC CDR1 amino acid sequence of SEQ ID NO: 45, a HC CDR2 amino acid sequence of SEQ ID NO: 46, or a HC CDR3 amino acid sequence of SEQ ID NO: 47.
  • VL light chain variable region
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti- TCR ⁇ V6-5*01) antibody molecule comprises: (i) a LC CDR1 amino acid sequence of SEQ ID NO: 54, a LC CDR2 amino acid sequence of SEQ ID NO: 55, or a LC CDR3 amino acid sequence of SEQ ID NO: 56; and/or (ii) a HC CDR1 amino acid sequence of SEQ ID NO: 48, a HC CDR2 amino acid sequence of SEQ ID NO: 49, or a HC CDR3 amino acid sequence of SEQ ID NO: 50.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule comprises: (i) a light chain variable region (VL) comprising a LC CDR1 amino acid sequence of SEQ ID NO: 54, a LC CDR2 amino acid sequence of SEQ ID NO: 55, or a LC CDR3 amino acid sequence of SEQ ID NO: 56; and/or (ii) a heavy chain variable region (VH) comprising a HC CDR1 amino acid sequence of SEQ ID NO: 48, a HC CDR2 amino acid sequence of SEQ ID NO: 49, or a HC CDR3 amino acid sequence of SEQ ID NO: 50.
  • VL light chain variable region
  • VH heavy chain variable region
  • the light or the heavy chain variable framework (e.g., the region encompassing at least FR1, FR2, FR3, and optionally FR4) of the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule can be chosen from: (a) a light or heavy chain variable framework including at least 80%, 85%, 87% 90%, 92%, 93%, 95%, 97%, 98%, or 100% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, or a human consensus sequence; (b) a light or heavy chain variable framework including from 20% to 80%, 40% to 60%, 60% to 90%, or 70% to 95% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a
  • the light or heavy chain variable framework region (particularly FR1, FR2 and/or FR3) includes a light or heavy chain variable framework sequence at least 70, 75, 80, 85, 87, 88, 90, 92, 94, 95, 96, 97, 98, 99% identical or identical to the frameworks of a VL or VH segment of a human germline gene.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule includes one, two, three, or four heavy chain framework regions shown in FIG.1A, or a sequence substantially identical thereto.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, includes one, two, three, or four light chain framework regions shown in FIG.1B, or a sequence substantially identical thereto.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule comprises the light chain framework region 1 of A-H.1 or A-H.2, e.g., as shown in FIG.1B.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises the light chain framework region 2 of A-H.1 or A-H.2, e.g., as shown in FIG.1B.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule comprises the light chain framework region 3 of A-H.1 or A-H.2, e.g., as shown in FIG.1B.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises the light chain framework region 4 of A-H.1 or A-H.2, e.g., as shown in FIG.1B.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the FR1 comprises a Phenylalanine at position 10, e.g., a Serine to Phenyalanine substitution.
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • FR2 comprises a Histidine at position 36, e.g., a substitution at position 36 according to Kabat numbering, e.g., a Tyrosine to Histidine substitution.
  • FR2 comprises an Alanine at position 46, e.g., a substitution at position 46 according to Kabat numbering, e.g., an Arginine to Alanine substitution.
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises a light chain variable domain comprising a framework region, e.g., framework region 3 (FR3), comprising a change, e.g., a substitution (e.g., a conservative substitution) at a position disclosed herein according to Kabat numbering.
  • FR3 framework region 3
  • FR3 comprises a Phenyalanine at position 87, e.g., a substitution at position 87 according to Kabat numbering, e.g., a Tyrosine to Phenyalanine substitution.
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • FR1
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises a light chain variable domain comprising: (a) a framework region 2 (FR2) comprising a Histidine at position 36, e.g., a substitution at position 36 according to Kabat numbering, e.g., a Tyrosine to Histidine substitution, and a Alanine at position 46, e.g., a substitution at position 46 according to Kabat numbering, e.g., a Arginine to Alanine substitution; and (b) a framework region 3 (FR3) comprising a Phenylalanine at position 87, e.g., a substitution at position 87 according to Kabat numbering, e.g., a Tyrosine to Phenyalanine substitution, e.g
  • FR3 framework region 3
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises a light chain variable domain comprising: (a) a framework region 1 (FR1) comprising a change, e.g., a substitution (e.g., a conservative substitution) at one or more (e.g., all) positions disclosed herein according to Kabat numbering, ; (b) a framework region 2 (FR2) comprising a change, e.g., a substitution (e.g., a conservative substitution) at one or more (e.g., all) position disclosed herein according to Kabat numbering and (c) a framework region 3 (FR3) comprising a change, e.g., a substitution (e.g., a conservative substitution) at one or more (e.g., all) position disclosed here
  • FR3 framework region 3
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises the heavy chain framework region 1 of A- H.1 or A-H.2, e.g., as shown in FIG.1A.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule comprises the heavy chain framework region 2 of A- H.1 or A-H.2, e.g., as shown in FIG.1A
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises the heavy chain framework region 3 of A- H.1 or A-H.2, e.g., as shown in FIG.1A.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises the heavy chain framework region 4 of A- H.1 or A-H.2, e.g., as shown in FIG.1A.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • FR3 comprises a Threonine at position 73, e.g., a substitution at position 73 according to Kabat numbering, e.g., a Glutamic Acid to Threonine substitution.
  • FR3 comprises a Glycine at position 94, e.g., a substitution at position 94 according to Kabat numbering, e.g., an Arginine to Glycine substitution.
  • the substitution is relative to a human germline heavy chain framework region sequence.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • FR3 framework region 3
  • Threonine at position 73 e.g., a substitution at position 73 according to Kabat numbering, e.g., a Glutamic Acid to Threonine substitution
  • a Glycine at position 94 e.g.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule comprises the heavy chain framework regions 1-4 of A-H.1 or A-H.2, e.g., SEQ ID NO: 9, or as shown in FIGs.1A and 1B.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises the light chain framework regions 1-4 of A- H.1, e.g., SEQ ID NO: 10, or as shown in FIGs.1A and 1B.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises the light chain framework regions 1-4 of A- H.2, e.g., SEQ ID NO: 11, or as shown in FIGs.1A and 1B.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule comprises the heavy chain framework regions 1-4 of A-H.1, e.g., SEQ ID NO: 9; and the light chain framework regions 1-4 of A-H.1, e.g., SEQ ID NO: 10, or as shown in FIGs.1A and 1B.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises the heavy chain framework regions 1-4 of A-H.2, e.g., SEQ ID NO: 9; and the light chain framework regions 1-4 of A-H.2, e.g., SEQ ID NO: 11, or as shown in FIGs.1A and 1B.
  • the heavy or light chain variable domain, or both, of the anti- TCR ⁇ V antibody molecule includes an amino acid sequence, which is substantially identical to an amino acid disclosed herein, e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical to a variable region of an antibody described herein, e.g., an antibody chosen from any one of A-H.1 to A-H.85, e.g., A-H.1, A-H.2 or A-H.68, or as described in Table 1, or encoded by the nucleotide sequence in Table 1; or which differs at least 1 or 5 residues, but less than 40, 30, 20, or 10 residues, from a variable region of an antibody described herein.
  • an antibody chosen from any one of A-H.1 to A-H.85 e.g., A-H.1, A-H.2 or A-H.68, or as described in Table 1, or encoded by the nucleotide sequence in Table 1;
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule includes a VH and/or VL domain encoded by a nucleic acid having a nucleotide sequence as set forth in Table 1, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 3, 6, 15, 30, or 45 nucleotides from the sequences shown in Table 1.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 9, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence of SEQ ID NO: 9, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 9; and/or a VL domain comprising the amino acid sequence of SEQ ID NO: 10, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence of SEQ ID NO: 10, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 10.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 9, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence of SEQ ID NO: 9, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 9; and/or a VL domain comprising the amino acid sequence of SEQ ID NO: 11, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence of SEQ ID NO: 11, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 11.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule is a full antibody or fragment thereof (e.g., a Fab, F(ab')2, Fv, or a single chain Fv fragment (scFv)).
  • the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule is a monoclonal antibody or an antibody with single specificity.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6- 5*01) antibody molecule, is a humanized antibody molecule.
  • the heavy and light chains of the anti-TCR ⁇ V antibody molecule can be full-length (e.g., an antibody can include at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains) or can include an antigen-binding fragment (e.g., a Fab, F(ab')2, Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific antibody or fragment thereof, a single domain variant thereof, or a camelid antibody).
  • an antibody can include at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains
  • an antigen-binding fragment e.g., a Fab, F(ab')2, Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific antibody or fragment thereof, a single domain variant thereof, or a camelid antibody.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the anti-TCR ⁇ V antibody molecule is in the form of a multispecific molecule, e.g., a bispecific molecule, e.g., as described herein.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule
  • the Fc region is chosen from the heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4.
  • the Fc region is chosen from the heavy chain constant region of IgG1 or IgG2 (e.g., human IgG1, or IgG2).
  • the heavy chain constant region is human IgG1.
  • the Fc region comprises a Fc region variant, e.g., as described herein.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule, has a light chain constant region chosen from, e.g., the light chain constant regions of kappa or lambda, preferably kappa (e.g., human kappa).
  • the constant region is altered, e.g., mutated, to modify the properties of the anti- TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
  • the constant region is mutated at positions 296 (M to Y), 298 (S to T), 300 (T to E), 477 (H to K) and 478 (N to F) to alter Fc receptor binding (e.g., the mutated positions correspond to positions 132 (M to Y), 134 (S to T), 136 (T to E), 313 (H to K) and 314 (N to F) of SEQ ID NOs: 212 or 214; or positions 135 (M to Y), 137 (S to T), 139 (T to E), 316 (H to K) and 317 (N to F) of SEQ ID NOs: 215, 216, 217 or 218), e.g., relative to human IgG1.
  • the mutated positions correspond to positions 132 (M to Y), 134 (S to T), 136 (T to E), 313 (H to K) and 314 (N to F) of SEQ ID NOs: 212 or 214; or positions 135 (M to Y
  • Antibody A-H.1 comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 3278 and a light chain comprising the amino acid sequence of SEQ ID NO: 72.
  • Antibody A-H.2 comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 3278 and a light chain comprising the amino acid sequence of SEQ ID NO: 3279.
  • Antibody A- H.68 comprises the amino acid sequence of SEQ ID NO: 1337, or a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
  • Antibody A-H.69 comprises the amino acid sequence of SEQ ID NO: 1500, or a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. Additional exemplary humanized anti-TCRB V6 antibodies are provided in Table 1.
  • the anti-TCR ⁇ V6 is antibody A, e.g., humanized antibody A (antibody A- H), as provided in Table 1.
  • the anti-TCR ⁇ V antibody comprises one or more (e.g., all three) of a LC CDR1, LC CDR2, and LC CDR3 provided in Table 1; and/or one or more (e.g., all three) of a HC CDR1, HC CDR2, and HC CDR3 provided in Table 1, or a sequence with at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
  • antibody A comprises a variable heavy chain (VH) and/or a variable light chain (VL) provided in Table 1, or a sequence with at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule comprises a VH of A-H.1, A-H.2, A-H.3, A-H.4, A- H.5, A-H.6, A-H.7, A-H.8, A-H.9, A-H.10, A-H.11, A-H.12, A-H.13, A-H.14, A-H.15, A-H.16, A-H.17, A-H.18, A-H.19, A-H.20, A-H.21, A-H.22, A-H.23, A-H.24, A-H.25, A-H.26, A-H.27, A-H.28, A-H.29, A-H.30, A-H.31, A-H.32, A-H.33, A-H.34, A-H.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule comprises a VL of A-H.1, A-H.2, A-H.3, A-H.4, A- H.5, A-H.6, A-H.7, A-H.8, A-H.9, A-H.10, A-H.11, A-H.12, A-H.13, A-H.14, A-H.15, A-H.16, A-H.17, A-H.18, A-H.19, A-H.20, A-H.21, A-H.22, A-H.23, A-H.24, A-H.25, A-H.26, A-H.27, A-H.28, A-H.29, A-H.30, A-H.31, A-H.32, A-H.33, A-H.34, A-H.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule comprises a VH of A-H.1, A-H.2, A-H.3, A-H.4, A- H.5, A-H.6, A-H.7, A-H.8, A-H.9, A-H.10, A-H.11, A-H.12, A-H.13, A-H.14, A-H.15, A-H.16, A-H.17, A-H.18, A-H.19, A-H.20, A-H.21, A-H.22, A-H.23, A-H.24, A-H.25, A-H.26, A-H.27, A-H.28, A-H.29, A-H.30, A-H.31, A-H.32, A-H.33, A-H.34, A-H.
  • Table 1 Amino acid and nucleotide sequences for murine, chimeric and humanized antibody molecules which bind to TCRVB 6, e.g., TCRVB 6-5.
  • the antibody molecules include murine mAb Antibody A, and humanized mAb Antibody A-H Clones A-H.1 to A-H.85.
  • the amino acid the heavy and light chain CDRs, and the amino acid and nucleotide sequences of the heavy and light chain variable regions, and the heavy and light chains are shown.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule comprises a VH and/or a VL of an antibody described in Table 1, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule comprises a VH and a VL of an antibody described in Table 1, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto.
  • Consensus VL SEQ ID NO: 230 DIQMTQSPSFLSASVGDRVTITCKASQNV G/E/A/D N/D R/K VAW Y/H QQKPGKAPKALIYSSSHRY K/S GVPSRFSGSGSGTEFTLTISSLQPEDFATYFCQQFKSYPLTFGQGTKLEIK
  • Consensus VL SEQ ID NO: 3289 DIQMTQSPSFLSASVGDRVTITCKASQNVX1X2X3VAWX4QQKPGKAPKALIYSSSHRYX5 GVPSRFSGSGSGTEFTLTISSLQPEDFATYFCQQFKSYPLTFGQGTKLEIK, wherein X1 is G, E, A or D; X2 is N or D; X3 is R or K; X4 is Y or
  • an anti-TCRVb antibody disclosed herein has an antigen binding domain having a VL having a consensus sequence of SEQ ID NO: 230, wherein position 30 is G, E, A or D; position 31 is N or D; position 32 is R or K; position 36 is Y or H; and/or position 56 is K or S.
  • an anti-TCRVb antibody disclosed herein has an antigen binding domain having a VH having a consensus sequence of SEQ ID NO: 231, wherein: position 27 is H or T or G or Y; position 28 is D or T or S; position 30 is H or R or D or K or T; position 31 is L or D or K or T or N; position 32 is W or F or T or I or Y or G; position 49 is R or W; position 50 is V or I or F; position 51 is F or S or Y; position 52 is A or P; position 56 is N or S; position 57 is T or V or Y or I; position 58 is K or R; position 97 is G or V; position 99 is Y or I; position 102 is Y or A; and/or position 103 is D or G.
  • the disclosure provides an anti-TCR ⁇ V antibody molecule that binds to human TCR ⁇ V12, e.g., a TCR ⁇ V12 subfamily comprising: TCR ⁇ V12-4*01, TCR ⁇ V12-3*01 or TCR ⁇ V12-5*01.
  • the TCR ⁇ V12 subfamily comprises TCR ⁇ V12-4*01.
  • the TCR ⁇ V12 subfamily comprises TCR ⁇ V12-3*01.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule
  • is a non-murine antibody molecule e.g., a human or humanized antibody molecule.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule is a human antibody molecule. In some embodiments, the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V12 antibody molecule is a humanized antibody molecule. In some embodiments, the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V12 antibody molecule, is isolated or recombinant.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule, comprises at least one or two heavy chain variable regions from an antibody described herein, e.g., an antibody as described in Table 2, or encoded by a nucleotide sequence in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule
  • the anti-TCR ⁇ V antibody molecule includes a heavy chain constant region for an IgG1, e.g., a human IgG1.
  • the heavy chain constant region comprises an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule
  • includes a kappa light chain constant region e.g., a human kappa light chain constant region.
  • the light chain constant region comprises an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule, includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
  • CDRs complementarity determining regions
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule, includes at least one, two, or three CDRs (or collectively all of the CDRs) from a heavy chain variable region comprising an amino acid sequence shown in Table 2, or encoded by a nucleotide sequence shown in Table 2.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 2, or encoded by a nucleotide sequence shown in Table 2.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule
  • the anti-TCR ⁇ V antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a light chain variable region of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
  • CDRs complementarity determining regions
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule, includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Table 2, or encoded by a nucleotide sequence shown in Table 2.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 2, or encoded by a nucleotide sequence shown in Table 2.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule, includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 2, or encoded by a nucleotide sequence shown in Table 2.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 2, or encoded by a nucleotide sequence shown in Table 2.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule, molecule includes all six CDRs from an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2, or closely related CDRs, e.g., CDRs which are identical or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions).
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule, may include any CDR described herein.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes at least one, two, or three CDRs according to Kabat et al. (e.g., at least one, two, or three CDRs according to the Kabat definition as set out in Table 2) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen as described in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Kabat et al.
  • substitutions, deletions, or insertions e.g., conservative substitutions
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes at least one, two, or three CDRs according to Kabat et al. (e.g., at least one, two, or three CDRs according to the Kabat definition as set out in Table 2) from a light chain variable region of an antibody described herein, e.g., an antibody as described in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Kabat et al.
  • substitutions, deletions, or insertions e.g., conservative substitutions
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes at least one, two, three, four, five, or six CDRs according to Kabat et al. (e.g., at least one, two, three, four, five, or six CDRs according to the Kabat definition as set out in Table 2) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, three, four, five,
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes all six CDRs according to Kabat et al. (e.g., all six CDRs according to the Kabat definition as set out in Table 2) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2; or encoded by the nucleotide sequence in Table 2; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to all six CDRs according to Kabat et al.
  • substitutions, deletions, or insertions e
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule may include any CDR described herein.
  • the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V12 antibody molecule includes at least one, two, or three hypervariable loops that have the same canonical structures as the corresponding hypervariable loop of an antibody described herein, e.g., an antibody described in Table 2, e.g., the same canonical structures as at least loop 1 and/or loop 2 of the heavy and/or light chain variable domains of an antibody described herein. See, e.g., Chothia et al., (1992) J. Mol.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes at least one, two, or three CDRs according to Chothia et al.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes at least one, two, or three CDRs according to Chothia et al. (e.g., at least one, two, or three CDRs according to the Chothia definition as set out in Table 2) from a light chain variable region of an antibody described herein, e.g., an antibody as described in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to Chothia et al.
  • Chothia et al. e.g., at least one, two, or three CDR
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes at least one, two, three, four, five, or six CDRs according to Chothia et al.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes all six CDRs according to Chothia et al. (e.g., all six CDRs according to the Chothia definition as set out in Table 2) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2; or encoded by the nucleotide sequence in Table 2; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to all six CDRs according to Chothia et al.
  • alterations e.g., substitution
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule may include any CDR described herein.
  • the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V12 antibody molecule includes at least one, two, or three CDRs according to a combined CDR (e.g., at least one, two, or three CDRs according to the combined CDR definition as set out in Table 2) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen as described in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes at least one, two, or three CDRs according to a combined CDR (e.g., at least one, two, or three CDRs according to the combined CDR definition as set out in Table 2) from a light chain variable region of an antibody described herein, e.g., an antibody as described in Table 2, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, or three CDRs according to a combined CDR shown in Table 2.
  • a combined CDR e.g., at least one, two, or three CDRs according to the combined
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes at least one, two, three, four, five, or six CDRs according to a combined CDR. (e.g., at least one, two, three, four, five, or six CDRs according to the combined CDR definition as set out in Table 2) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to one, two, three, four, five, or six CDR
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes all six CDRs according to a combined CDR (e.g., all six CDRs according to the combined CDR definition as set out in Table 2) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2; or encoded by the nucleotide sequence in Table 2; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences; or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) relative to all six CDRs according to a combined CDR shown in Table 2.
  • a combined CDR e.g.,
  • the anti-TCR ⁇ V antibody molecule e.g., anti- TCR ⁇ V12 antibody molecule may include any CDR described herein.
  • a combined CDR as set out in Table 1 is a CDR that comprises a Kabat CDR and a Chothia CDR.
  • the anti-TCR ⁇ V antibody molecule, e e.g., anti-TCR ⁇ V12 antibody molecule, molecule includes a combination of CDRs or hypervariable loops identified as combined CDRs in Table 1.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule
  • the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V12 antibody molecule includes a combination of CDRs or hypervariable loops defined according to the Kabat et al.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule can contain any combination of CDRs or hypervariable loops according to the Kabat and Chothia definitions.
  • the antibody molecule is a monospecific antibody molecule, a bispecific antibody molecule, a bivalent antibody molecule, a biparatopic antibody molecule, or an antibody molecule that comprises an antigen binding fragment of an antibody, e.g., a half antibody or antigen binding fragment of a half antibody.
  • the antibody molecule comprises a multispecific molecule, e.g., a bispecific molecule, e.g., as described herein.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes: (i) one, two or all of a light chain complementarity determining region 1 (LC CDR1), a light chain complementarity determining region 2 (LC CDR2), and a light chain complementarity determining region 3 (LC CDR3) of SEQ ID NO: 16, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 or SEQ ID NO: 30, and/or (ii) one, two or all of a heavy chain complementarity determining region 1 (HC CDR1), heavy chain complementarity determining region 2 (HC CDR2), and a heavy chain complementarity determining region 3 (HC CDR3) of SEQ ID NO: 15, SEQ ID NO: 23, SEQ ID NO: 24 or SEQ ID NO: 25.
  • LC CDR1 light chain complementarity determining region 1
  • LC CDR2 light chain complementarity determining region 2
  • LC CDR3
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises: (i) a LC CDR1 amino acid sequence of SEQ ID NO: 20, a LC CDR2 amino acid sequence of SEQ ID NO: 21, or a LC CDR3 amino acid sequence of SEQ ID NO: 22; and/or (ii) a HC CDR1 amino acid sequence of SEQ ID NO: 17, a HC CDR2 amino acid sequence of SEQ ID NO: 18, or a HC CDR3 amino acid sequence of SEQ ID NO: 19.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises: (i) a light chain variable region (VL) comprising a LC CDR1 amino acid sequence of SEQ ID NO: 20, a LC CDR2 amino acid sequence of SEQ ID NO: 21, and a LC CDR3 amino acid sequence of SEQ ID NO: 2; and/or (ii) a heavy chain variable region (VH) comprising a HC CDR1 amino acid sequence of SEQ ID NO: 17, a HC CDR2 amino acid sequence of SEQ ID NO: 18, and a HC CDR3 amino acid sequence of SEQ ID NO: 19.
  • VL light chain variable region
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises: (i) a LC CDR1 amino acid sequence of SEQ ID NO: 63, a LC CDR2 amino acid sequence of SEQ ID NO: 64, or a LC CDR3 amino acid sequence of SEQ ID NO: 65; and/or (ii) a HC CDR1 amino acid sequence of SEQ ID NO: 57, a HC CDR2 amino acid sequence of SEQ ID NO: 58, or a HC CDR3 amino acid sequence of SEQ ID NO: 59.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises: (i) a light chain variable region (VL) comprising a LC CDR1 amino acid sequence of SEQ ID NO: 63, a LC CDR2 amino acid sequence of SEQ ID NO: 64, or a LC CDR3 amino acid sequence of SEQ ID NO: 65; and/or (ii) a heavy chain variable region (VH) comprising a HC CDR1 amino acid sequence of SEQ ID NO: 57, a HC CDR2 amino acid sequence of SEQ ID NO: 58, or a HC CDR3 amino acid sequence of SEQ ID NO: 59.
  • VL light chain variable region
  • VH heavy chain variable region
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises: (i) a LC CDR1 amino acid sequence of SEQ ID NO: 66, a LC CDR2 amino acid sequence of SEQ ID NO: 67, or a LC CDR3 amino acid sequence of SEQ ID NO: 68; and/or (ii) a HC CDR1 amino acid sequence of SEQ ID NO: 60, a HC CDR2 amino acid sequence of SEQ ID NO: 61, or a HC CDR3 amino acid sequence of SEQ ID NO: 62.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises: (i) a light chain variable region (VL) comprising a LC CDR1 amino acid sequence of SEQ ID NO: 63, a LC CDR2 amino acid sequence of SEQ ID NO: 64, or a LC CDR3 amino acid sequence of SEQ ID NO: 65; and/or (ii) a heavy chain variable region (VH) comprising a HC CDR1 amino acid sequence of SEQ ID NO: 57, a HC CDR2 amino acid sequence of SEQ ID NO: 58, or a HC CDR3 amino acid sequence of SEQ ID NO: 59.
  • VL light chain variable region
  • VH heavy chain variable region
  • the light or the heavy chain variable framework (e.g., the region encompassing at least FR1, FR2, FR3, and optionally FR4) of the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V12 antibody molecule can be chosen from: (a) a light or heavy chain variable framework including at least 80%, 85%, 87% 90%, 92%, 93%, 95%, 97%, 98%, or 100% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, or a human consensus sequence; (b) a light or heavy chain variable framework including from 20% to 80%, 40% to 60%, 60% to 90%, or 70% to 95% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, or a human consensus sequence; (c) a light or heavy
  • the light or heavy chain variable framework region (particularly FR1, FR2 and/or FR3) includes a light or heavy chain variable framework sequence at least 70, 75, 80, 85, 87, 88, 90, 92, 94, 95, 96, 97, 98, 99% identical or identical to the frameworks of a VL or VH segment of a human germline gene.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain variable domain having at least one, two, three, four, five, six, seven, ten, fifteen, twenty or more amino acid changes, e.g., amino acid substitutions or deletions, from an amino acid sequence of an antibody described herein .e.g., the amino acid sequence of the FR region in the entire variable region, e.g., shown in FIGs.2A and 2B, or in SEQ ID NOs: 26-30.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes one, two, three, or four heavy chain framework regions shown in FIG.2A, or a sequence substantially identical thereto.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes one, two, three, or four light chain framework regions shown in FIG.2B, or a sequence substantially identical thereto.
  • the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V12 antibody molecule comprises the light chain framework region 1 e.g., as shown in FIG.2B.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises the light chain framework region 2 e.g., as shown in FIG.2B.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises the light chain framework region 3, e.g., as shown in FIG.2B.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises the light chain framework region 4, e.g., as shown in FIG.2B.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 1 (FR1), comprising a change, e.g., a substitution (e.g., a conservative substitution) at one or more, e.g., all, position disclosed herein according to Kabat numbering.
  • FR1 comprises an Aspartic Acid at position 1, e.g., a substitution at position 1 according to Kabat numbering, e.g., an Alanine to Aspartic Acid substitution.
  • FR1 comprises an Asparagine at position 2, e.g., a substitution at position 2 according to Kabat numbering, e.g., an Isoleucine to Asparagine substitution, Serine to Asparagine substitution or Tyrosine to Asparagine substitution.
  • FR1 comprises a Leucine at position 4, e.g., a substitution at position 4 according to Kabat numbering, e.g., a Methionine to Leucine substitution.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 1 (FR1), comprising a substitution at position 1 according to Kabat numbering, e.g., an Alanine to Aspartic Acid substitution, a substitution at position 2 according to Kabat numbering, e.g., an Isoleucine to Asparagine substitution, Serine to Asparagine substitution or Tyrosine to Asparagine substitution, and a substitution at position 4 according to Kabat numbering, e.g., a Methionine to Leucine substitution.
  • FR1 framework region 1
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 1 (FR1), comprising a substitution at position 1 according to Kabat numbering, e.g., an Alanine to Aspartic Acid substitution, and a substitution at position 2 according to Kabat numbering, e.g., an Isoleucine to Asparagine substitution, Serine to Asparagine substitution or Tyrosine to Asparagine substitution.
  • FR1 framework region 1
  • the anti- TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 1 (FR1), comprising a substitution at position 1 according to Kabat numbering, e.g., an Alanine to Aspartic Acid substitution, and a substitution at position 4 according to Kabat numbering, e.g., a Methionine to Leucine substitution.
  • FR1 framework region 1
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 1 (FR1), comprising a substitution at position 2 according to Kabat numbering, e.g., an Isoleucine to Asparagine substitution, Serine to Asparagine substitution or Tyrosine to Asparagine substitution, and a substitution at position 4 according to Kabat numbering, e.g., a Methionine to Leucine substitution.
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 3 (FR3), comprising a change, e.g., a substitution (e.g., a conservative substitution) at one or more, e.g., all, position disclosed herein according to Kabat numbering.
  • FR3 comprises a Glycine at position 66, e.g., a substitution at position 66 according to Kabat numbering, e.g., a Lysine to Glycine substitution, or a Serine to Glycine substitution.
  • FR3 comprises an Asparagine at position 69, e.g., a substitution at position 69 according to Kabat numbering, e.g., a Tyrosine to Asparagine substitution.
  • FR3 comprises a Tyrosine at position 71, e.g., a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to Tyrosine substitution, or an Alanine to Tyrosine substitution.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 3 (FR3), comprising a substitution at position 66 according to Kabat numbering, e.g., a Lysine to Glycine substitution, or a Serine to Glycine substitution, and a substitution at position 69 according to Kabat numbering, e.g., a Tyrosine to Asparagine substitution.
  • FR3 framework region 3
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 3 (FR3), comprising a substitution at position 66 according to Kabat numbering, e.g., Lysine to Glycine substitution, or a Serine to Glycine substitution, and a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to Tyrosine substitution, or an Alanine to Tyrosine substitution.
  • FR3 framework region 3
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 3 (FR3), comprising a substitution at position 69 according to Kabat numbering, e.g., a Tyrosine to Asparagine substitution and a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to Tyrosine substitution, or an Alanine to Tyrosine substitution.
  • FR3 framework region 3
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising a framework region, e.g., framework region 3 (FR3), comprising a substitution at position 66 according to Kabat numbering, e.g., a Lysine to Glycine substitution, or a Serine to Glycine substitution, a substitution at position 69 according to Kabat numbering, e.g., a Tyrosine to Asparagine substitution and a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to Tyrosine substitution, or an Alanine to Tyrosine substitution.
  • FR3 framework region 3
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising: a framework region 1 (FR1) comprising a substitution at position 2 according to Kabat numbering, e.g., a Isoleucine to Asparagine substitution; and a framework region 3 (FR3), comprising a substitution at position 69 according to Kabat numbering, e.g., a Threonine to Asparagine substitution and a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to Tyrosine substitution, e.g., as shown in the amino acid sequence of SEQ ID NO: 26.
  • FR1 framework region 1
  • FR3 framework region 3
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising: (a) a framework region 1 (FR1) comprising a substitution at position 1 according to Kabat numbering, e.g., a Alanine to Aspartic Acid substitution, and a substitution at position 2 according to Kabat numbering, e.g., a Isoleucine to Asparagine substitution; and (b) a framework region 3 (FR3), comprising a substitution at position 69 according to Kabat numbering, e.g., a Threonine to Asparagine substitution and a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to Tyrosine substitution, e.g., as shown in the amino acid sequence of SEQ ID NO: 27
  • the substitution is relative to a human germline light
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising: (a) a framework region 1 (FR1) comprising a substitution at position 2 according to Kabat numbering, e.g., a Serine to Asparagine substitution; and a substitution at position 4 according to Kabat numbering, e.g., a Methionine to Leucine substitution; and (b) a framework region 3 (FR3), comprising a substitution at position 69 according to Kabat numbering, e.g., a Threonine to Asparagine substitution and a substitution at position 71 according to Kabat numbering, e.g., a Phenylalanine to Tyrosine substitution, e.g., as shown in the amino acid sequence of SEQ ID NO: 28
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising: (a) a framework region 1 (FR1) comprising a substitution at position 2 according to Kabat numbering, e.g., a Serine to Asparagine substitution; and (b) a framework region 3 (FR3) comprising a substitution at position 66 according to Kabat numbering, e.g., a Lysine to Glycine substitution; a substitution at position 69 according to Kabat numbering, e.g., a Threonine to Asparagine substitution; and a substitution at position 71 according to Kabat numbering, e.g., a Alanine to Tyrosine substitution, e.g., as shown in the amino acid sequence of SEQ ID NO: 29.
  • FR1 framework region 1
  • FR3 framework region 3
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain comprising: (a) a framework region 1 (FR1) comprising a substitution at position 2 according to Kabat numbering, e.g., a Tyrosine to Asparagine substitution; and (b) a framework region 3 (FR3) comprising a substitution at position 66 according to Kabat numbering, e.g., a Serine to Glycine substitution; a substitution at position 69 according to Kabat numbering, e.g., a Threonine to Asparagine substitution; and a substitution at position 71 according to Kabat numbering, e.g., a Alanine to Tyrosine substitution, e.g., as shown in the amino acid sequence of SEQ ID NO: 29.
  • FR1 framework region 1
  • FR3 framework region 3
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises a light chain variable domain comprising: (a) a framework region 1 (FR1) comprising a change, e.g., a substitution (e.g., a conservative substitution) at one or more (e.g., all) positions disclosed herein according to Kabat numbering, and (b) a framework region 3 (FR3) comprising a change, e.g., a substitution (e.g., a conservative substitution) at one or more (e.g., all) position disclosed herein according to Kabat numbering.
  • FR1 framework region 1
  • FR3 framework region 3
  • the substitution is relative to a human germline light chain framework region sequence.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises the heavy chain framework region 1, e.g., as shown in FIG.2A.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises the heavy chain framework region 2, e.g., as shown in FIG.2A.
  • the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V12 antibody molecule comprises the heavy chain framework region 3, e.g., as shown in FIG.2A.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises the heavy chain framework region 4, e.g., as shown in FIG.2A.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises the heavy chain framework regions 1-4, e.g., SEQ ID NOS: 20-23, or as shown in FIG.2A.
  • the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V12 antibody molecule comprises the light chain framework regions 1-4, e.g., SEQ ID NOs: 26-30, or as shown in FIG.2B.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises the heavy chain framework regions 1-4, e.g., SEQ ID NOs: 23-25; and the light chain framework regions 1-4, e.g., SEQ ID NOs: 26-30, or as shown in FIGs.2A and 2B.
  • the heavy or light chain variable domain, or both, of , the anti- TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes an amino acid sequence, which is substantially identical to an amino acid disclosed herein, e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical to a variable region of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence in Table 2; or which differs at least 1 or 5 residues, but less than 40, 30, 20, or 10 residues, from a variable region of an antibody described herein.
  • an amino acid sequence which is substantially identical to an amino acid disclosed herein, e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical to a variable region of an antibody described herein, e.g., an antibody as described in Table 2, or encoded by the nucleotide sequence
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises at least one, two, three, or four antigen-binding regions, e.g., variable regions, having an amino acid sequence as set forth in Table 2, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the sequences shown in Table 2.
  • antigen-binding regions e.g., variable regions, having an amino acid sequence as set forth in Table 2, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the sequences shown in Table 2.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule includes a VH and/or VL domain encoded by a nucleic acid having a nucleotide sequence as set forth in Table 2, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 3, 6, 15, 30, or 45 nucleotides from the sequences shown in Table 2.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 23, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 23, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 23; and a VL domain comprising the amino acid sequence of SEQ ID NO: 26, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 26, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 26.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 23, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 23, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 23; and a VL domain comprising the amino acid sequence of SEQ ID NO: 28, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 28, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 28.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule comprises: a VH domain comprising the amino acid sequence of SEQ ID NO: 23, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 23, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 23; and a VL domain comprising the amino acid sequence of SEQ ID NO: 30, an amino acid sequence at least about 85%, 90%, 95%, 99% or more identical to the amino acid sequence SEQ ID NO: 30, or an amino acid sequence which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the amino acid sequence of SEQ ID NO: 30.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule is a full antibody or fragment thereof (e.g., a Fab, F(ab') 2 , Fv, or a single chain Fv fragment (scFv)).
  • the anti-TCR ⁇ V antibody molecule e.g., anti- TCR ⁇ V6 (e.g., anti-TCR ⁇ V6-5*01) antibody molecule is a monoclonal antibody or an antibody with single specificity.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule
  • the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V12 antibody molecule is a humanized antibody molecule.
  • the heavy and light chains of the anti-TCR ⁇ V antibody molecule can be full-length (e.g., an antibody can include at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains) or can include an antigen- binding fragment (e.g., a Fab, F(ab')2, Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific antibody or fragment thereof, a single domain variant thereof, or a camelid antibody).
  • an antibody can include at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains
  • an antigen- binding fragment e.g., a Fab, F(ab')2, Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific antibody or fragment thereof, a single domain variant thereof, or a camelid antibody.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule is in the form of a multispecific molecule, e.g., a bispecific molecule, e.g., as described herein.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule has a heavy chain constant region (Fc) chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE.
  • Fc heavy chain constant region
  • the Fc region is chosen from the heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4. In some embodiments, the Fc region is chosen from the heavy chain constant region of IgG1 or IgG2 (e.g., human IgG1, or IgG2). In some embodiments, the heavy chain constant region is human IgG1.
  • the anti-TCR ⁇ V antibody molecule e.g., anti-TCR ⁇ V12 antibody molecule has a light chain constant region chosen from, e.g., the light chain constant regions of kappa or lambda, preferably kappa (e.g., human kappa).
  • the constant region is altered, e.g., mutated, to modify the properties of the anti-TCR ⁇ V antibody molecule, e.g., anti-TCR ⁇ V12 antibody molecule (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
  • the constant region is mutated at positions 296 (M to Y), 298 (S to T), 300 (T to E), 477 (H to K) and 478 (N to F) to alter Fc receptor binding (e.g., the mutated positions correspond to positions 132 (M to Y), 134 (S to T), 136 (T to E), 313 (H to K) and 314 (N to F) of SEQ ID NOs: 212 or 214; or positions 135 (M to Y), 137 (S to T), 139 (T to E), 316 (H to K) and 317 (N to F) of SEQ ID NOs: 215, 216, 217 or 218).
  • the mutated positions correspond to positions 132 (M to Y), 134 (S to T), 136 (T to E), 313 (H to K) and 314 (N to F) of SEQ ID NOs: 212 or 214; or positions 135 (M to Y), 137 (S to T), 139 (T to
  • Antibody B-H.1 comprises a first chain comprising the amino acid sequence of SEQ ID NO: 3280 and a second chain comprising the amino acid sequence of SEQ ID NO: 3281. Additional exemplary anti-TCR ⁇ V12 antibodies of the disclosure are provided in Table 2.
  • the anti-TCR ⁇ V12 is antibody B, e.g., humanized antibody B (antibody B-H), as provided in Table 2.
  • the anti-TCR ⁇ V antibody comprises one or more (e.g., all three) of a LC CDR1, LC CDR2, and LC CDR3 provided in Table 2; and/or one or more (e.g., all three) of a HC CDR1, HC CDR2, and HC CDR3 provided in Table 2, or a sequence with at least 95% identity thereto.
  • antibody B comprises a variable heavy chain (VH) and/or a variable light chain (VL) provided in Table 2, or a sequence with at least 95% identity thereto.
  • the anti-TCRVB 12 antibody molecule (e.g., anti-TCRVB 12-3 or anti-TCRVB 12-4 antibody molecule) comprises a VH of B-H.1A, B-H.1B, B-H.1C, B-H.1D, B-H.1E, B-H.1F, B-H.1G, B-H.1H, B-H.1, B-H.2, B-H.3, B-H.4, B-H.5, or B-H.6, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto.
  • the anti-TCRVB 12 antibody molecule (e.g., anti-TCRVB 12-3 or anti-TCRVB 12-4 antibody molecule) comprises a VL of B-H.1A, B-H.1B, B-H.1C, B-H.1D, B-H.1E, B-H.1F, B-H.1G, B-H.1H, B-H.1, B-H.2, B-H.3, B-H.4, B-H.5, or B-H.6, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto.
  • the anti-TCRVB 12 antibody molecule (e.g., anti-TCRVB 12-3 or anti-TCRVB 12-4 antibody molecule) comprises a VH of B-H.1A, B-H.1B, B-H.1C, B-H.1D, B-H.1E, B-H.1F, B-H.1G, B-H.1H, B-H.1, B-H.2, B-H.3, B-H.4, B-H.5, or B-H.6, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto; and a VL of B-H.1A, B-H.1B, B-H.1C, B-H.1D, B-H.1E, B-H.1F, B-H.1G, B-H.1H, B-H.1, B- H.2, B-H.3, B-H.4, B-H.5,
  • Table 2 Amino acid and nucleotide sequences for murine and humanized antibody molecules which bind to TCRVB 12, e.g., TCRVB 12-3 or TCRVB 12-4.
  • the antibody molecules include murine mAb Antibody B and humanized mAb Antibody B-H.1 to B-H.6.
  • the amino acid the heavy and light chain CDRs, and the amino acid and nucleotide sequences of the heavy and light chain variable regions, and the heavy and light chains are shown.
  • the disclosure provides an anti-TCR ⁇ V antibody molecule that binds to human TCR ⁇ V5.
  • the TCR ⁇ V5 subfamily comprises TCR ⁇ V5-5*01, TCR ⁇ V5-6*01, TCR ⁇ V5-4*01, TCR ⁇ V5-8*01, TCR ⁇ V5-1*01, or a variant thereof.
  • Exemplary anti-TCR ⁇ V5 antibodies of the disclosure are provided in Table 10.
  • the anti-TCR ⁇ V5 is antibody C, e.g., humanized antibody C (antibody C-H), as provided in Table 10.
  • the anti-TCR ⁇ V antibody comprises one or more (e.g., all three) of a LC CDR1, LC CDR2, and LC CDR3 provided in Table 10; and/or one or more (e.g., all three) of a HC CDR1, HC CDR2, and HC CDR3 provided in Table 10, or a sequence with at least 95% identity thereto.
  • antibody C comprises a variable heavy chain (VH) and/or a variable light chain (VL) provided in Table 10, or a sequence with at least 95% identity thereto.
  • Table 10 Amino acid sequences for anti TCR ⁇ V5 antibodies Amino acid and nucleotide sequences for murine and humanized antibody molecules which bind to TCRVB 5 (e.g., TCRVB 5-5 or TCRVB 5-6). The amino acid the heavy and light chain CDRs, and the amino acid and nucleotide sequences of the heavy and light chain variable regions, and the heavy and light chains are shown. Exemplary anti-TCR ⁇ V5 antibodies of the disclosure are provided in Table 11. In some embodiments, the anti-TCR ⁇ V5 is antibody E, e.g., humanized antibody E (antibody E-H), as provided in Table 11.
  • antibody E e.g., humanized antibody E (antibody E-H)
  • the anti-TCR ⁇ V antibody comprises one or more (e.g., all three) of a LC CDR1, LC CDR2, and LC CDR3 provided in Table 11; and/or one or more (e.g., all three) of a HC CDR1, HC CDR2, and HC CDR3 provided in Table 11, or a sequence with at least 95% identity thereto.
  • antibody E comprises a variable heavy chain (VH) and/or a variable light chain (VL) provided in Table 11, or a sequence with at least 95% identity thereto.
  • antibody E comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 3284 and/or a light chain comprising the amino acid sequence of SEQ ID NO: 3285, or a sequence with at least 95% identity thereto.
  • Table 11 Amino acid sequences for anti TCR ⁇ V5 antibodies Amino acid and nucleotide sequences for murine and humanized antibody molecules which bind to TCRVB 5 (e.g., TCRVB 5-5 or TCRVB 5-6). The amino acid the heavy and light chain CDRs, and the amino acid and nucleotide sequences of the heavy and light chain variable regions, and the heavy and light chains are shown.
  • the anti-TCR ⁇ V5 antibody molecule comprises a VH and/or a VL of an antibody described in Table 10, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto. In some embodiments, the anti-TCR ⁇ V5 antibody molecule comprises a VH and a VL of an antibody described in Table 10, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto.
  • the anti-TCR ⁇ V5 antibody molecule comprises a VH and/or a VL of an antibody described in Table 11, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto. In some embodiments, the anti-TCR ⁇ V5 antibody molecule comprises a VH and a VL of an antibody described in Table 11, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto.
  • Anti-TCR ⁇ V10 antibodies Accordingly, in one aspect, the disclosure provides an anti-TCR ⁇ V antibody molecule that binds to a human TCR ⁇ V10 subfamily member.
  • TCR ⁇ V10 subfamily is also known as TCR ⁇ V12.
  • the TCR ⁇ V10 subfamily comprises: TCR ⁇ V10-1*01, TCR ⁇ V10-1*02, TCR ⁇ V10-3*01 or TCR ⁇ V10-2*01, or a variant thereof.
  • Exemplary anti-TCR ⁇ V10 antibodies of the disclosure are provided in Table 12.
  • the anti-TCR ⁇ V10 is antibody D, e.g., humanized antibody D (antibody D- H), as provided in Table 12.
  • antibody D comprises one or more (e.g., three) light chain CDRs and/or one or more (e.g., three) heavy chain CDRs provided in Table 12, or a sequence with at least 95% identity thereto.
  • antibody D comprises a variable heavy chain (VH) and/or a variable light chain (VL) provided in Table 12, or a sequence with at least 95% identity thereto.
  • Table 12 Amino acid sequences for anti TCR ⁇ V10 antibodies Amino acid and nucleotide sequences for murine and humanized antibody molecules which bind to TCRBV 10 (e.g., TCRBV 10-1, TCRBV 10-2 or TCRBV 10-3). The amino acid the heavy and light chain CDRs, and the amino acid and nucleotide sequences of the heavy and light chain variable regions, and the heavy and light chains are shown.
  • the anti-TCR ⁇ V10 antibody molecule comprises a VH or a VL of an antibody described in Table 12, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto. In some embodiments, the anti-TCR ⁇ V10 antibody molecule comprises a VH and a VL of an antibody described in Table 12, or a sequence with at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity thereto. Additional anti-TCRV ⁇ antibodies Additional exemplary anti-TCR ⁇ V antibodies of the disclosure are provided in Table 13.
  • the anti-TCR ⁇ V antibody is a humanized antibody, e.g., as provided in Table 13.
  • the anti-TCR ⁇ V antibody comprises one or more (e.g., all three) of a LC CDR1, LC CDR2, and LC CDR3 provided in Table 13; and/or one or more (e.g., all three) of a HC CDR1, HC CDR2, and HC CDR3 provided in Table 13, or a sequence with at least 95% identity thereto.
  • the anti-TCR ⁇ V antibody comprises a variable heavy chain (VH) and/or a variable light chain (VL) provided in Table 13, or a sequence with at least 95% identity thereto.
  • Table 13 Amino acid sequences for additional anti-TCR ⁇ V antibodies
  • Amino acid and nucleotide sequences for murine and humanized antibody molecules which bind to various TCRVB families are disclosed.
  • the amino acid the heavy and light chain CDRs, and the amino acid and nucleotide sequences of the heavy and light chain variable regions, and the heavy and light chains are shown.
  • Antibodies disclosed in the table include, MPB2D5, CAS1.1.3, IMMU222, REA1062, and JOVI-3.
  • MPB2D5 binds human TCR ⁇ V 20-1 (TCR ⁇ V2 per old nomenclature).
  • CAS1.1.3 binds human TCR ⁇ V 27 (TCR ⁇ V14 per old nomenclature).
  • IMMU 222 binds human TCR ⁇ V 6-5, TCR ⁇ V 6-6, or TCR ⁇ V 6-9 (TCR ⁇ V13.1 per old nomenclature).
  • REA1062 binds human TCR ⁇ V 5-1).
  • JOVI-3 binds human TCR ⁇ V 28 (TCR ⁇ V3.1 per old nomenclature).
  • IMMU546 binds human TCR ⁇ V 2.
  • an anti-TCRV ⁇ antibody disclosed herein comprises an Fc region, e.g., as described herein.
  • the Fc region is a wildtype Fc region, e.g., a wildtype human Fc region.
  • the Fc region comprises a variant, e.g., an Fc region comprising an addition, substitution, or deletion of at least one amino acid residue in the Fc region which results in, e.g., reduced or ablated affinity for at least one Fc receptor.
  • the Fc region of an antibody interacts with a number of receptors or ligands including Fc Receptors (e.g., Fc ⁇ RI, Fc ⁇ RIIA, Fc ⁇ RIIIA), the complement protein CIq, and other molecules such as proteins A and G. These interactions are essential for a variety of effector functions and downstream signaling events including: antibody dependent cell-mediated cytotoxicity (ADCC), Antibody-dependent cellular phagocytosis (ADCP) and complement dependent cytotoxicity (CDC).
  • ADCC antibody dependent cell-mediated cytotoxicity
  • ADCP Antibody-dependent cellular phagocytosis
  • CDC complement dependent cytotoxicity
  • an anti-TCRV ⁇ antibody comprising a variant Fc region has reduced, e.g., ablated, affinity for an Fc receptor, e.g., an Fc receptor described herein.
  • the reduced affinity is compared to an otherwise similar antibody with a wildtype Fc region.
  • an anti-TCRV ⁇ antibody comprising a variant Fc region has one or more of the following properties: (1) reduced effector function (e.g., reduced ADCC, ADCP and/or CDC); (2) reduced binding to one or more Fc receptors; and/or (3) reduced binding to C1q complement.
  • the reduction in any one, or all of properties (1)-(3) is compared to an otherwise similar antibody with a wildtype Fc region.
  • an anti-TCRV ⁇ antibody comprising a variant Fc region has reduced affinity to a human Fc receptor, e.g., Fc ⁇ R I, Fc ⁇ R II and/or Fc ⁇ R III.
  • the anti-TCRV ⁇ antibody comprising a variant Fc region comprises a human IgG1 region or a human IgG4 region.
  • an anti-TCRV ⁇ antibody comprising a variant Fc region activates and/or expands T cells, e.g., as described herein.
  • an anti-TCRV ⁇ antibody comprising a variant Fc region has a cytokine profile described herein, e.g., a cytokine profile that differs from a cytokine profile of a T cell engager that binds to a receptor or molecule other than a TCR ⁇ V region (“a non-TCR ⁇ V-binding T cell engager”).
  • the non-TCR ⁇ V-binding T cell engager comprises an antibody that binds to a CD3 molecule (e.g., CD3 epsilon (CD3e) molecule); or a TCR alpha (TCR ⁇ ) molecule.
  • an anti-TCRV ⁇ antibody disclosed herein comprises any one or all, or any combination of Fc region variants disclosed in Table 21.
  • an anti-TCRV ⁇ antibody disclosed herein comprises any one or all, or any combination of Fc region variants, e.g., mutations, disclosed in Table 21.
  • an anti-TCRV ⁇ antibody disclosed herein comprise an Asn297Ala (N297A) mutation.
  • an anti-TCRV ⁇ antibody disclosed herein comprise a Leu234Ala/Leu235Ala (LALA) mutation.
  • Table 21 Exemplary Fc modifications Antibody Molecules
  • the antibody molecule binds to a cancer antigen, e.g., a tumor antigen or a stromal antigen.
  • the cancer antigen is, e.g., a mammalian, e.g., a human, cancer antigen.
  • the antibody molecule binds to an immune cell antigen, e.g., a mammalian, e.g., a human, immune cell antigen.
  • the antibody molecule binds specifically to an epitope, e.g., linear or conformational epitope, on the cancer antigen or the immune cell antigen.
  • an antibody molecule is a monospecific antibody molecule and binds a single epitope.
  • a monospecific antibody molecule having a plurality of immunoglobulin variable domain sequences, each of which binds the same epitope.
  • an antibody molecule is a multispecific or multifunctional antibody molecule, e.g., it comprises a plurality of immunoglobulin variable domains sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
  • the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein).
  • the first and second epitopes overlap. In an embodiment the first and second epitopes do not overlap.
  • first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein).
  • a multispecific antibody molecule comprises a third, fourth or fifth immunoglobulin variable domain.
  • a multispecific antibody molecule is a bispecific antibody molecule, a trispecific antibody molecule, or a tetraspecific antibody molecule.
  • a multispecific antibody molecule is a bispecific antibody molecule.
  • a bispecific antibody has specificity for no more than two antigens.
  • a bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope.
  • the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein).
  • the first and second epitopes overlap.
  • the first and second epitopes do not overlap.
  • the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein).
  • a bispecific antibody molecule comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope.
  • a bispecific antibody molecule comprises a half antibody having binding specificity for a first epitope and a half antibody having binding specificity for a second epitope.
  • a bispecific antibody molecule comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope.
  • a bispecific antibody molecule comprises a scFv or a Fab, or fragment thereof, have binding specificity for a first epitope and a scFv or a Fab, or fragment thereof, have binding specificity for a second epitope.
  • an antibody molecule comprises a diabody, and a single-chain molecule, as well as an antigen-binding fragment of an antibody (e.g., Fab, F(ab’) 2 , and Fv).
  • an antibody molecule can include a heavy (H) chain variable domain sequence (abbreviated herein as VH), and a light (L) chain variable domain sequence (abbreviated herein as VL).
  • an antibody molecule comprises or consists of a heavy chain and a light chain (referred to herein as a half antibody.
  • an antibody molecule includes two heavy (H) chain variable domain sequences and two light (L) chain variable domain sequence, thereby forming two antigen binding sites, such as Fab, Fab’, F(ab’)2, Fc, Fd, Fd’, Fv, single chain antibodies (scFv for example), single variable domain antibodies, diabodies (Dab) (bivalent and bispecific), and chimeric (e.g., humanized) antibodies, which may be produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies.
  • Antibodies and antibody fragments can be from any class of antibodies including, but not limited to, IgG, IgA, IgM, IgD, and IgE, and from any subclass (e.g., IgG1, IgG2, IgG3, and IgG4) of antibodies.
  • the a preparation of antibody molecules can be monoclonal or polyclonal.
  • An antibody molecule can also be a human, humanized, CDR-grafted, or in vitro generated antibody.
  • the antibody can have a heavy chain constant region chosen from, e.g., IgG1, IgG2, IgG3, or IgG4.
  • the antibody can also have a light chain chosen from, e.g., kappa or lambda.
  • immunoglobulin Ig
  • antibody immunoglobulin
  • antigen-binding fragments of an antibody molecule include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv), see e.g.,
  • antibody molecules include intact molecules as well as functional fragments thereof. Constant regions of the antibody molecules can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function). Antibody molecules can also be single domain antibodies.
  • Single domain antibodies can include antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies. Single domain antibodies may be any of the art, or any future single domain antibodies. Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, fish, shark, goat, rabbit, and bovine. According to another aspect of the invention, a single domain antibody is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 9404678, for example.
  • variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins.
  • a VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention.
  • the VH and VL regions can be subdivided into regions of hypervariability, termed “complementarity determining regions" (CDR), interspersed with regions that are more conserved, termed "framework regions" (FR or FW).
  • CDR complementarity determining regions
  • CDR complementarity determining region
  • HCDR1, HCDR2, HCDR3 three CDRs in each heavy chain variable region
  • LCDR1, LCDR2, LCDR3 three CDRs in each light chain variable region
  • the precise amino acid sequence boundaries of a given CDR can be determined using any of a number of known schemes, including those described by Kabat et al. (1991), “Sequences of Proteins of Immunological Interest,” 5th Ed.
  • the CDRs defined according the “Chothia” number scheme are also sometimes referred to as “hypervariable loops.”
  • the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3).
  • each VH and VL typically includes three CDRs and four FRs, arranged from amino- terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the antibody molecule can be a polyclonal or a monoclonal antibody.
  • a monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
  • a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
  • a monoclonal antibody can be made by hybridoma technology or by methods that do not use hybridoma technology (e.g., recombinant methods).
  • the antibody can be recombinantly produced, e.g., produced by phage display or by combinatorial methods, or by yeast display. Phage display and combinatorial methods for generating antibodies are known in the art (as described in, e.g., Ladner et al. U.S.
  • yeast display method for generating or identifying antibodies is known in the art, e.g., as described in Chao et al. (2006) Nature Protocols 1(2):755-68, the entire contents of which is incorporated by reference herein.
  • the antibody is a fully human antibody (e.g., an antibody made in a mouse which has been genetically engineered to produce an antibody from a human immunoglobulin sequence), or a non-human antibody, e.g., a rodent (mouse or rat), goat, primate (e.g., monkey), camel antibody.
  • a rodent mouse or rat
  • the non-human antibody is a rodent (mouse or rat antibody).
  • Methods of producing rodent antibodies are known in the art. Human monoclonal antibodies can be generated using transgenic mice carrying the human immunoglobulin genes rather than the mouse system.
  • Splenocytes from these transgenic mice immunized with the antigen of interest are used to produce hybridomas that secrete human mAbs with specific affinities for epitopes from a human protein (see, e.g., Wood et al. International Application WO 91/00906, Kucherlapati et al. PCT publication WO 91/10741; Lonberg et al. International Application WO 92/03918; Kay et al. International Application 92/03917; Lonberg, N. et al.1994 Nature 368:856-859; Green, L.L. et al.1994 Nature Genet. 7:13-21; Morrison, S.L. et al.1994 Proc.
  • An antibody molecule can be one in which the variable region, or a portion thereof, e.g., the CDRs, are generated in a non-human organism, e.g., a rat or mouse. Chimeric, CDR- grafted, and humanized antibodies are within the invention.
  • Antibody molecules generated in a non-human organism, e.g., a rat or mouse, and then modified, e.g., in the variable framework or constant region, to decrease antigenicity in a human are within the invention.
  • An “effectively human” protein is a protein that does substantially not evoke a neutralizing antibody response, e.g., the human anti-murine antibody (HAMA) response.
  • HAMA can be problematic in a number of circumstances, e.g., if the antibody molecule is administered repeatedly, e.g., in treatment of a chronic or recurrent disease condition.
  • a HAMA response can make repeated antibody administration potentially ineffective because of an increased antibody clearance from the serum (see, e.g., Saleh et al., Cancer Immunol.
  • Chimeric antibodies can be produced by recombinant DNA techniques known in the art (see Robinson et al., International Patent Publication PCT/US86/02269; Akira, et al., European Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al., European Patent Application 173,494; Neuberger et al., International Application WO 86/01533; Cabilly et al. U.S.
  • Patent No.4,816,567 Cabilly et al., European Patent Application 125,023; Better et al. (1988 Science 240:1041-1043); Liu et al. (1987) PNAS 84:3439-3443; Liu et al., 1987, J. Immunol.139:3521-3526; Sun et al. (1987) PNAS 84:214-218; Nishimura et al., 1987, Canc. Res.47:999-1005; Wood et al. (1985) Nature 314:446-449; and Shaw et al., 1988, J. Natl Cancer Inst.80:1553-1559).
  • a humanized or CDR-grafted antibody will have at least one or two but generally all three recipient CDRs (of heavy and or light immuoglobulin chains) replaced with a donor CDR.
  • the antibody may be replaced with at least a portion of a non-human CDR or only some of the CDRs may be replaced with non-human CDRs. It is only necessary to replace the number of CDRs required for binding to the antigen.
  • the donor will be a rodent antibody, e.g., a rat or mouse antibody
  • the recipient will be a human framework or a human consensus framework.
  • the immunoglobulin providing the CDRs is called the "donor” and the immunoglobulin providing the framework is called the “acceptor.”
  • the donor immunoglobulin is a non-human (e.g., rodent).
  • the acceptor framework is a naturally- occurring (e.g., a human) framework or a consensus framework, or a sequence about 85% or higher, preferably 90%, 95%, 99% or higher identical thereto.
  • the term "consensus sequence” refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related sequences (See e.g., Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987).
  • each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence.
  • a "consensus framework” refers to the framework region in the consensus immunoglobulin sequence.
  • An antibody molecule can be humanized by methods known in the art (see e.g., Morrison, S. L., 1985, Science 229:1202-1207, by Oi et al., 1986, BioTechniques 4:214, and by Queen et al. US 5,585,089, US 5,693,761 and US 5,693,762, the contents of all of which are hereby incorporated by reference).
  • Humanized or CDR-grafted antibody molecules can be produced by CDR-grafting or CDR substitution, wherein one, two, or all CDRs of an immunoglobulin chain can be replaced. See e.g., U.S. Patent 5,225,539; Jones et al.1986 Nature 321:552-525; Verhoeyan et al.1988 Science 239:1534; Beidler et al.1988 J. Immunol.141:4053-4060; Winter US 5,225,539, the contents of all of which are hereby expressly incorporated by reference.
  • the antibody molecule can be a single chain antibody.
  • a single-chain antibody (scFV) may be engineered (see, for example, Colcher, D. et al. (1999) Ann N Y Acad Sci 880:263-80; and Reiter, Y. (1996) Clin Cancer Res 2:245-52).
  • the single chain antibody can be dimerized or multimerized to generate multivalent antibodies having specificities for different epitopes of the same target protein.
  • the antibody molecule has a heavy chain constant region chosen from, e.g., the heavy chain constant regions of IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE; particularly, chosen from, e.g., the (e.g., human) heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4.
  • the antibody molecule has a light chain constant region chosen from, e.g., the (e.g., human) light chain constant regions of kappa or lambda.
  • the constant region can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function).
  • the antibody has: effector function; and can fix complement.
  • the antibody does not; recruit effector cells; or fix complement.
  • the antibody has reduced or no ability to bind an Fc receptor.
  • it is a isotype or subtype, fragment or other mutant, which does not support binding to an Fc receptor, e.g., it has a mutagenized or deleted Fc receptor binding region.
  • Antibodies with altered function e.g. altered affinity for an effector ligand, such as FcR on a cell, or the C1 component of complement can be produced by replacing at least one amino acid residue in the constant portion of the antibody with a different residue (see e.g., EP 388,151 A1, U.S. Pat. No. 5,624,821 and U.S. Pat. No.5,648,260, the contents of all of which are hereby incorporated by reference). Similar type of alterations could be described which if applied to the murine, or other species immunoglobulin would reduce or eliminate these functions.
  • An antibody molecule can be derivatized or linked to another functional molecule (e.g., another peptide or protein).
  • a "derivatized" antibody molecule is one that has been modified.
  • Methods of derivatization include but are not limited to the addition of a fluorescent moiety, a radionucleotide, a toxin, an enzyme or an affinity ligand such as biotin.
  • the antibody molecules of the invention are intended to include derivatized and otherwise modified forms of the antibodies described herein, including immunoadhesion molecules.
  • an antibody molecule can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bispecific antibody or a diabody), a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
  • another antibody e.g., a bispecific antibody or a diabody
  • detectable agent e.g., a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
  • a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region
  • Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate). Such linkers are available from Pierce Chemical Company, Rockford, Ill. Multispecific or multifunctional antibody molecules Exemplary structures of multispecific and multifunctional molecules defined herein are described throughout. Exemplary structures are further described in: Weidle U et al. (2013) The Intriguing Options of Multispecific Antibody Formats for Treatment of Cancer. Cancer Genomics & Proteomics 10: 1-18 (2013); and Spiess C et al.
  • multispecific antibody molecules can comprise more than one antigen- binding site, where different sites are specific for different antigens. In embodiments, multispecific antibody molecules can bind more than one (e.g., two or more) epitopes on the same antigen. In embodiments, multispecific antibody molecules comprise an antigen-binding site specific for a target cell (e.g., cancer cell) and a different antigen-binding site specific for an immune effector cell. In one embodiment, the multispecific antibody molecule is a bispecific antibody molecule.
  • Bispecific antibody molecules can be classified into five different structural groups: (i) bispecific immunoglobulin G (BsIgG); (ii) IgG appended with an additional antigen- binding moiety; (iii) bispecific antibody fragments; (iv) bispecific fusion proteins; and (v) bispecific antibody conjugates.
  • BsIgG is a format that is monovalent for each antigen.
  • Exemplary BsIgG formats include but are not limited to crossMab, DAF (two-in-one), DAF (four-in-one), DutaMab, DT- IgG, knobs-in-holes common LC, knobs-in-holes assembly, charge pair, Fab-arm exchange, SEEDbody, triomab, LUZ-Y, Fcab, ⁇ ⁇ -body, orthogonal Fab. See Spiess et al. Mol. Immunol. 67(2015):95-106.
  • BsIgGs include catumaxomab (Fresenius Biotech, Trion Pharma, Neopharm), which contains an anti-CD3 arm and an anti-EpCAM arm; and ertumaxomab (Neovii Biotech, Fresenius Biotech), which targets CD3 and HER2.
  • BsIgG comprises heavy chains that are engineered for heterodimerization.
  • heavy chains can be engineered for heterodimerization using a “knobs-into-holes” strategy, a SEED platform, a common heavy chain (e.g., in ⁇ ⁇ -bodies), and use of heterodimeric Fc regions. See Spiess et al. Mol.
  • BsIgG can be produced by separate expression of the component antibodies in different host cells and subsequent purification/assembly into a BsIgG.
  • BsIgG can also be produced by expression of the component antibodies in a single host cell.
  • BsIgG can be purified using affinity chromatography, e.g., using protein A and sequential pH elution. IgG appended with an additional antigen-binding moiety is another format of bispecific antibody molecules.
  • monospecific IgG can be engineered to have bispecificity by appending an additional antigen-binding unit onto the monospecific IgG, e.g., at the N- or C- terminus of either the heavy or light chain.
  • additional antigen-binding units include single domain antibodies (e.g., variable heavy chain or variable light chain), engineered protein scaffolds, and paired antibody variable domains (e.g., single chain variable fragments or variable fragments). See Id.
  • Examples of appended IgG formats include dual variable domain IgG (DVD-Ig), IgG(H)-scFv, scFv-(H)IgG, IgG(L)-scFv, scFv-(L)IgG, IgG(L,H)-Fv, IgG(H)-V, V(H)-IgG, IgG(L)-V, V(L)-IgG, KIH IgG-scFab, 2scFv-IgG, IgG-2scFv, scFv4-Ig, zybody, and DVI-IgG (four-in-one). See Spiess et al. Mol.
  • bispecific antibody fragments are a format of bispecific antibody molecules that lack some or all of the antibody constant domains. For example, some BsAb lack an Fc region.
  • bispecific antibody fragments include heavy and light chain regions that are connected by a peptide linker that permits efficient expression of the BsAb in a single host cell.
  • Exemplary bispecific antibody fragments include but are not limited to nanobody, nanobody- HAS, BiTE, Diabody, DART, TandAb, scDiabody, scDiabody-CH3, Diabody-CH3, triple body, miniantibody, minibody, TriBi minibody, scFv-CH3 KIH, Fab-scFv, scFv-CH-CL-scFv, F(ab’)2, F(ab’)2-scFv2, scFv-KIH, Fab-scFv-Fc, tetravalent HCAb, scDiabody-Fc, Diabody-Fc, tandem scFv-Fc, and intrabody. See Id.
  • the BiTE format comprises tandem scFvs, where the component scFvs bind to CD3 on T cells and a surface antigen on cancer cells
  • Bispecific fusion proteins include antibody fragments linked to other proteins, e.g., to add additional specificity and/or functionality.
  • An example of a bispecific fusion protein is an immTAC, which comprises an anti-CD3 scFv linked to an affinity-matured T-cell receptor that recognizes HLA-presented peptides.
  • the dock-and-lock (DNL) method can be used to generate bispecific antibody molecules with higher valency.
  • fusions to albumin binding proteins or human serum albumin can be extend the serum half-life of antibody fragments. See Id.
  • chemical conjugation e.g., chemical conjugation of antibodies and/or antibody fragments
  • An exemplary bispecific antibody conjugate includes the CovX-body format, in which a low molecular weight drug is conjugated site-specifically to a single reactive lysine in each Fab arm or an antibody or fragment thereof.
  • the conjugation improves the serum half-life of the low molecular weight drug.
  • An exemplary CovX-body is CVX-241 (NCT01004822), which comprises an antibody conjugated to two short peptides inhibiting either VEGF or Ang2. See Id.
  • the antibody molecules can be produced by recombinant expression, e.g., of at least one or more component, in a host system.
  • host systems include eukaryotic cells (e.g., mammalian cells, e.g., CHO cells, or insect cells, e.g., SF9 or S2 cells) and prokaryotic cells (e.g., E. coli).
  • Bispecific antibody molecules can be produced by separate expression of the components in different host cells and subsequent purification/assembly. Alternatively, the antibody molecules can be produced by expression of the components in a single host cell. Purification of bispecific antibody molecules can be performed by various methods such as affinity chromatography, e.g., using protein A and sequential pH elution.
  • affinity tags can be used for purification, e.g., histidine-containing tag, myc tag, or streptavidin tag.
  • exemplary bispecific molecules a multispecific molecule disclosed herein comprises a sequence disclosed herein, e.g., a sequence chosen from SEQ ID NOs: 1004-1007, 3275-3277, 3286, or 3287, or a sequence with at least 85%, 90%, 955, 96%, 97%, 98%, 99% or more identity thereto.
  • a multispecific molecule disclosed herein comprises a leader sequence comprising the amino acid sequence of SEQ ID NO: 3288.
  • a multispecific molecule disclosed herein does not comprise a leader sequence comprising the amino acid sequence of SEQ ID NO: 3288.
  • Molecule F: aCD19 x aVb6.5 Molecule F comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 1004 and a light chain comprising the amino acid sequence of SEQ ID NO: 1005.
  • Molecule F.1 SEQ ID NO: 1004 (heavy chain) (Tcrvbeta6_5 scFv/anti-CD19 heavy chain)
  • Molecule F.2 SEQ ID NO: 1005 (light chain) (anti-CD19 light chain)
  • a multispecific molecule disclosed herein comprises SEQ ID NO: 1004 and/or SEQ ID NO: 1005 or a sequence with at least 85%, 90%, 955, 96%, 97%, 98%, 99% or more identity thereto.
  • Molecule G comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 1006 and a light chain comprising the amino acid sequence of SEQ ID NO: 1007.
  • a multispecific molecule disclosed herein comprises SEQ ID NO: 1006 and/or SEQ ID NO: 1007 or a sequence with at least 85%, 90%, 955, 96%, 97%, 98%, 99% or more identity thereto.
  • Molecule H: aBCMA x aTCRvbeta6_5 Molecule H comprises a first heavy chain comprising the amino acid sequence of SEQ ID NO: 3275, a light chain comprising the amino acid sequence of SEQ ID NO: 3277, and a second heavy chain comprising the amino acid sequence of SEQ ID NO: 3276.
  • a multispecific molecule disclosed herein comprises SEQ ID NO: 3275, SEQ ID NO: 3276, and/or SEQ ID NO: 3277 or a sequence with at least 85%, 90%, 955, 96%, 97%, 98%, 99% or more identity thereto.
  • Molecule I half arm BCMA Fab with c-terminal scFv TCRvbeta Molecule I comprises a first heavy chain comprising the amino acid sequence of SEQ ID NO: 3286, a light chain comprising the amino acid sequence of SEQ ID NO: 3277, and a second heavy chain comprising the amino acid sequence of SEQ ID NO: 3287.
  • a multispecific molecule disclosed herein comprises SEQ ID NO: 3286, SEQ ID NO: 3277, and/or SEQ ID NO: 3287 or a sequence with at least 85%, 90%, 955, 96%, 97%, 98%, 99% or more identity thereto.
  • Antibody-like Frameworks or Scaffolds A wide variety of antibody/ immunoglobulin frameworks or scaffolds can be employed in the anti-TCRvb antibody molecules disclosed herein or multifunctional formats thereof so long as the resulting polypeptide includes at least one binding region which specifically binds to the target antigen, e.g., a TCRvb, a tumor antigen, among others.
  • Such frameworks or scaffolds include the 5 main idiotypes of human immunoglobulins, or fragments thereof, and include immunoglobulins of other animal species, preferably having humanized aspects. Novel frameworks, scaffolds and fragments continue to be discovered and developed by those skilled in the art.
  • the anti-TCRvb antibody molecules disclosed herein or multifunctional formats thereof include non-immunoglobulin based antibodies using non- immunoglobulin scaffolds onto which CDRs can be grafted.
  • Any non-immunoglobulin frameworks and scaffolds may be employed, as long as they comprise a binding region specific for the target antigen (e.g., TCRvb or a tumor antigen).
  • non-immunoglobulin frameworks or scaffolds include, but are not limited to, fibronectin (Compound Therapeutics, Inc., Waltham, MA), ankyrin (Molecular Partners AG, Zurich, Switzerland), domain antibodies (Domantis, Ltd., Cambridge, MA, and Ablynx nv, Zwijnaarde, Belgium), lipocalin (Pieris Proteolab AG, Freising, Germany), small modular immuno-pharmaceuticals (Trubion Pharmaceuticals Inc., Seattle, WA), maxybodies (Avidia, Inc., Mountain View, CA), Protein A (Affibody AG, Sweden), and affilin (gamma-crystallin or ubiquitin) (Scil Proteins GmbH, Halle, Germany).
  • fibronectin Compound Therapeutics, Inc., Waltham, MA
  • ankyrin Molecular Partners AG, Zurich, Switzerland
  • domain antibodies Domantis, Ltd., Cambridge, MA, and Ablynx nv, Zwijnaard
  • Fibronectin scaffolds are typically based on fibronectin type III domain (e.g., the tenth module of the fibronectin type III (10 Fn3 domain)).
  • the fibronectin type III domain has 7 or 8 beta strands which are distributed between two beta sheets, which themselves pack against each other to form the core of the protein, and further containing loops (analogous to CDRs) which connect the beta strands to each other and are solvent exposed. There are at least three such loops at each edge of the beta sheet sandwich, where the edge is the boundary of the protein perpendicular to the direction of the beta strands (see US 6,818,418).
  • the non-immunoglobulin antibody mimics antigen binding properties that are similar in nature and affinity to those of antibodies.
  • These scaffolds can be used in a loop randomization and shuffling strategy in vitro that is similar to the process of affinity maturation of antibodies in vivo.
  • These fibronectin-based molecules can be used as scaffolds where the loop regions of the molecule can be replaced with CDRs of the invention using standard cloning techniques.
  • the ankyrin technology is based on using proteins with ankyrin derived repeat modules as scaffolds for bearing variable regions which can be used for binding to different targets.
  • the ankyrin repeat module typically is a about 33 amino acid polypeptide consisting of two anti- parallel ⁇ -helices and a ⁇ -turn.
  • Binding of the variable regions can be optimized by using ribosome display.
  • Avimers are used by nature for protein-protein interactions and in human over 250 proteins are structurally based on A-domains. Avimers consist of a number of different “A- domain” monomers (2-10) linked via amino acid linkers. Avimers can be created that can bind to the target antigen using the methodology described in, for example, U.S. Patent Application Publication Nos.20040175756; 20050053973; 20050048512; and 20060008844.
  • Affibody affinity ligands are small, simple proteins composed of a three-helix bundle based on the scaffold of one of the IgG-binding domains of Protein A.
  • Protein A is a surface protein from the bacterium Staphylococcus aureus. This scaffold domain consists of 58 amino acids, 13 of which are randomized to generate affibody libraries with a large number of ligand variants (See e.g., US 5,831,012). Affibody molecules mimic antibodies, they have a molecular weight of 6 kDa, compared to the molecular weight of antibodies, which is 150 kDa. In spite of its small size, the binding site of affibody molecules is similar to that of an antibody. Anticalins are known commercially, e.g., Pieris ProteoLab AG.
  • lipocalins are derived from lipocalins, a widespread group of small and robust proteins that are usually involved in the physiological transport or storage of chemically sensitive or insoluble compounds.
  • lipocalins occur in human tissues or body liquids.
  • the protein architecture is reminiscent of immunoglobulins, with hypervariable loops on top of a rigid framework.
  • lipocalins are composed of a single polypeptide chain with 160 to 180 amino acid residues, being just marginally bigger than a single immunoglobulin domain.
  • the set of four loops, which makes up the binding pocket, shows pronounced structural plasticity and tolerates a variety of side chains.
  • the binding site can thus be reshaped in a proprietary process in order to recognize prescribed target molecules of different shape with high affinity and specificity.
  • One protein of lipocalin family the bilin- binding protein (BBP) of Pieris Brassicae has been used to develop anticalins by mutagenizing the set of four loops.
  • BBP bilin- binding protein
  • Affilin molecules are small non-immunoglobulin proteins which are designed for specific affinities towards proteins and small molecules. New affilin molecules can be very quickly selected from two libraries, each of which is based on a different human derived scaffold protein. Affilin molecules do not show any structural homology to immunoglobulin proteins.
  • Domain antibodies can be used in the anti-TCRvb antibody molecules disclosed herein or multifunctional formats thereof are small functional binding fragments of antibodies, corresponding to the variable regions of either the heavy or light chains of antibodies. Domain antibodies are well expressed in bacterial, yeast, and mammalian cell systems. Further details of domain antibodies and methods of production thereof are known in the art (see, for example, U.S. Pat. Nos.6,291,158; 6,582,915; 6,593,081; 6,172,197; 6,696,245; European Patents 0368684 & 0616640; WO05/035572, WO04/101790, WO04/081026, WO04/058821, WO04/003019 and WO03/002609.
  • Nanobodies are derived from the heavy chains of an antibody.
  • a nanobody typically comprises a single variable domain and two constant domains (CH2 and CH3) and retains antigen-binding capacity of the original antibody.
  • Nanobodies can be prepared by methods known in the art (See e.g., U.S. Pat. No.6,765,087, U.S. Pat. No. 6,838,254, WO 06/079372).
  • Unibodies consist of one light chain and one heavy chain of an IgG4 antibody. Unibodies may be made by the removal of the hinge region of IgG4 antibodies. Further details of unibodies and methods of preparing them may be found in WO2007/059782.
  • Tumor antigen moiety in an aspect, provided herein is a multispecific molecule, e.g., a bispecific molecule, comprising: (i) a first moiety (e.g., a first immune cell engager) comprising the anti-TCR ⁇ V antibody molecule described herein; and (ii) a second moiety comprising one or more of: a tumor-targeting moiety; a second immune cell engager; a cytokine molecule or a stromal modifying moiety.
  • the tumor-targeting moiety is an antigen, e.g., a cancer antigen.
  • the cancer antigen is a tumor antigen or stromal antigen, or a hematological antigen.
  • the tumor-targeting moiety e.g., cancer antigen
  • the tumor-targeting moiety is chosen from: BCMA, FcRH5, CD19, CD20, CD22, CD30, CD33, CD38, CD47, CD99, CD123, FcRH5, CLEC12, CD179A, SLAMF7, or NY-ESO1, PDL1, CD47, gangloside 2 (GD2), prostate stem cell antigen (PSCA), prostate specific membrane antigen (PMSA), prostate-specific antigen (PSA), carcinoembryonic antigen (CEA), Ron Kinase, c-Met, Immature laminin receptor, TAG-72, BING-4, Calcium-activated chloride channel 2, Cyclin-B1, 9D7, Ep-CAM, EphA3, Her2/neu, Telomerase, SAP-1, Survivin, NY-ES
  • the tumor-targeting moiety e.g., cancer antigen
  • BCMA BCMA.
  • the tumor-targeting moiety, e.g., cancer antigen is FcRH5.
  • the tumor-targeting moiety, e.g., cancer antigen is chosen from: CD19, CD123, CD22, CD30, CD171, CS-1, C-type lectin-like molecule-1, CD33, epidermal growth factor receptor variant III (EGFRvIII), ganglioside G2 (GD2), ganglioside GD3, TNF receptor family member B cell maturation (BCMA), Tn antigen ((Tn Ag) or (GalNAc ⁇ -Ser/Thr)), prostate-specific membrane antigen (PSMA), Receptor tyrosine kinase-like orphan receptor 1 (ROR1), Fms-Like Tyrosine Kinase 3 (FLT3), Tumor-associated
  • the multispecific molecules disclosed herein include a targeting moiety that binds to FcRH5 (e.g., a FcRH5 targeting moiety).
  • the FcRH5 targeting moiety can be chosen from an antibody molecule (e.g., an antigen binding domain as described herein), a receptor or a receptor fragment, or a ligand or a ligand fragment, or a combination thereof.
  • the FcRH5 targeting moiety associates with, e.g., binds to, a cancer or hematopoietic cell (e.g., a molecule, e.g., antigen, present on the surface of the cancer or hematopoietic cell).
  • a cancer or hematopoietic cell e.g., a molecule, e.g., antigen, present on the surface of the cancer or hematopoietic cell.
  • the FcRH5 targeting moiety targets, e.g., directs the multispecific molecules disclosed herein to a cancer or hematopoietic cell.
  • the cancer is a hematological cancer, e.g., multiple myeloma.
  • the multispecific molecule e.g., the FcRH5 targeting moiety, binds to a FcRH5 antigen on the surface of a cell, e.g., a cancer or hematopoietic cell.
  • the FcRH5 antigen can be present on a primary tumor cell, or a metastatic lesion thereof.
  • the cancer is a hematological cancer, e.g., multiple myeloma.
  • the FcRH5 antigen can be present on a tumor, e.g., a tumor of a class typified by having one or more of: limited tumor perfusion, compressed blood vessels, or fibrotic tumor interstitium.
  • the multispecific molecules described herein includes a FcRH5 targeting moiety that comprises an anti-FcRH5 antibody or antigen-binding fragment thereof described in US Patent 7,999,077, US20150098900, US8299220, US7105149, US8362213, US8466260, US8617559, US20160368985, US20150166661, and US20080247944, the entire contents of any of the aforesaid publications are herein incorporated by reference.
  • the multispecific molecules described herein includes a FcRH5 targeting moiety that comprises an anti-FcRH5 antibody or antigen-binding fragment thereof described in US Patent 7,999,077, the entire contents of which are herein incorporated by reference.
  • the multispecific molecules disclosed herein include a targeting moiety that binds to BCMA (e.g., a BCMA targeting moiety).
  • the BCMA targeting moiety can be chosen from an antibody molecule (e.g., an antigen binding domain as described herein), a receptor or a receptor fragment, or a ligand or a ligand fragment, or a combination thereof.
  • the BCMA targeting moiety associates with, e.g., binds to, a cancer or hematopoietic cell (e.g., a molecule, e.g., antigen, present on the surface of the cancer or hematopoietic cell).
  • the BCMA targeting moiety targets, e.g., directs the multispecific molecules disclosed herein to a cancer or hematopoietic cell.
  • the cancer is a hematological cancer, e.g., multiple myeloma.
  • the multispecific molecule, e.g., the BCMA targeting moiety binds to a BCMA antigen on the surface of a cell, e.g., a cancer or hematopoietic cell.
  • the BCMA antigen can be present on a primary tumor cell, or a metastatic lesion thereof.
  • the cancer is a hematological cancer, e.g., multiple myeloma.
  • the BCMA antigen can be present on a tumor, e.g., a tumor of a class typified by having one or more of: limited tumor perfusion, compressed blood vessels, or fibrotic tumor interstitium.
  • exemplary BCMA targeting moieties The multispecific molecules described herein can include a BCMA targeting moiety that comprises an anti-BCMA antibody or antigen-binding fragment thereof described in US8920776, US9243058, US9340621, US8846042, US7083785, US9545086, US7276241, US9034324, US7799902, US9387237, US8821883, US861745, US20130273055, US20160176973, US20150368351, US20150376287, US20170022284, US20160015749, US20140242077, US20170037128, US20170051068, US20160368988, US20160311915, US20160131654, US20120213768, US20110177093, US20160297885, EP31
  • the BCMA-targeting moiety includes an antibody molecule (e.g., Fab or scFv) that binds to BCMA.
  • the antibody molecule to BCMA comprises one, two, or three CDRs from any of the heavy chain variable domain sequences of Table 1, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of Table 9.
  • the antibody molecule to BCMA comprises a heavy chain variable domain sequence chosen from any of the amino acid sequences of Table 9, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
  • the antibody molecule to BCMA comprises one, two, or three CDRs from any of the light chain variable domain sequences of Table 9, or a closely related CDR, e.g., CDRs which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) from any of the CDR sequences of Table 9.
  • the antibody molecule to BCMA comprises a light chain variable domain sequence chosen from any of the amino acid sequences of Table 9, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
  • Table 9 Amino acid sequences of exemplary variable regions of anti-BCMA antibodies.
  • CDR-grafted scaffolds In embodiments, the antibody molecule is a CDR-grafted scaffold domain. In embodiments, the scaffold domain is based on a fibronectin domain, e.g., fibronectin type III domain.
  • the overall fold of the fibronectin type III (Fn3) domain is closely related to that of the smallest functional antibody fragment, the variable domain of the antibody heavy chain.
  • Fn3 does not have disulfide bonds; and therefore Fn3 is stable under reducing conditions, unlike antibodies and their fragments (see, e.g., WO 98/56915; WO 01/64942; WO 00/34784).
  • An Fn3 domain can be modified (e.g., using CDRs or hypervariable loops described herein) or varied, e.g., to select domains that bind to an antigen/marker/cell described herein.
  • a scaffold domain e.g., a folded domain
  • an antibody e.g., a “minibody” scaffold created by deleting three beta strands from a heavy chain variable domain of a monoclonal antibody (see, e.g., Tramontano et al., 1994, J Mol. Recognit.7:9; and Martin et al., 1994, EMBO J.13:5303-5309).
  • the “minibody” can be used to present two hypervariable loops.
  • the scaffold domain is a V-like domain (see, e.g., Coia et al. WO 99/45110) or a domain derived from tendamistatin, which is a 74 residue, six-strand beta sheet sandwich held together by two disulfide bonds (see, e.g., McConnell and Hoess, 1995, J Mol. Biol.250:460).
  • the loops of tendamistatin can be modified (e.g., using CDRs or hypervariable loops) or varied, e.g., to select domains that bind to a marker/antigen/cell described herein.
  • Another exemplary scaffold domain is a beta-sandwich structure derived from the extracellular domain of CTLA-4 (see, e.g., WO 00/60070).
  • Other exemplary scaffold domains include but are not limited to T-cell receptors; MHC proteins; extracellular domains (e.g., fibronectin Type III repeats, EGF repeats); protease inhibitors (e.g., Kunitz domains, ecotin, BPTI, and so forth); TPR repeats; trifoil structures; zinc finger domains; DNA-binding proteins; particularly monomeric DNA binding proteins; RNA binding proteins; enzymes, e.g., proteases (particularly inactivated proteases), RNase; chaperones, e.g., thioredoxin, and heat shock proteins; and intracellular signaling domains (such as SH2 and SH3 domains).
  • a scaffold domain is evaluated and chosen, e.g., by one or more of the following criteria: (1) amino acid sequence, (2) sequences of several homologous domains, (3) 3-dimensional structure, and/or (4) stability data over a range of pH, temperature, salinity, organic solvent, oxidant concentration.
  • the scaffold domain is a small, stable protein domain, e.g., a protein of less than 100, 70, 50, 40 or 30 amino acids.
  • the domain may include one or more disulfide bonds or may chelate a metal, e.g., zinc.
  • Antibody-Based Fusions A variety of formats can be generated which contain additional binding entities attached to the N or C terminus of antibodies. These fusions with single chain or disulfide stabilized Fvs or Fabs result in the generation of tetravalent molecules with bivalent binding specificity for each antigen. Combinations of scFvs and scFabs with IgGs enable the production of molecules which can recognize three or more different antigens.
  • Antibody-Fab Fusion Antibody-Fab fusions are bispecific antibodies comprising a traditional antibody to a first target and a Fab to a second target fused to the C terminus of the antibody heavy chain. Commonly the antibody and the Fab will have a common light chain.
  • Antibody fusions can be produced by (1) engineering the DNA sequence of the target fusion, and (2) transfecting the target DNA into a suitable host cell to express the fusion protein. It seems like the antibody- scFv fusion may be linked by a (Gly)-Ser linker between the C-terminus of the CH3 domain and the N-terminus of the scFv, as described by Coloma, J. et al. (1997) Nature Biotech 15:159.
  • Antibody-scFv Fusion Antibody-scFv Fusions are bispecific antibodies comprising a traditional antibody and a scFv of unique specificity fused to the C terminus of the antibody heavy chain.
  • the scFv can be fused to the C terminus through the Heavy Chain of the scFv either directly or through a linker peptide.
  • Antibody fusions can be produced by (1) engineering the DNA sequence of the target fusion, and (2) transfecting the target DNA into a suitable host cell to express the fusion protein. It seems like the antibody-scFv fusion may be linked by a (Gly)-Ser linker between the C- terminus of the CH3 domain and the N-terminus of the scFv, as described by Coloma, J. et al. (1997) Nature Biotech 15:159.
  • Variable Domain Immunoglobulin DVD A related format is the dual variable domain immunoglobulin (DVD), which are composed of VH and VL domains of a second specificity place upon the N termini of the V domains by shorter linker sequences.
  • Other exemplary multispecific antibody formats include, e.g., those described in the following US20160114057A1, US20130243775A1, US20140051833, US20130022601, US20150017187A1, US20120201746A1, US20150133638A1, US20130266568A1, US20160145340A1, WO2015127158A1, US20150203591A1, US20140322221A1, US20130303396A1, US20110293613, US20130017200A1, US20160102135A1, WO2015197598A2, WO2015197582A1, US9359437, US20150018529, WO2016115274A1, WO2016087416A1, US20080069820A1, US9145588
  • Exemplary multispecific molecules utilizing a full antibody-Fab/scFab format include those described in the following, US9382323B2, US20140072581A1, US20140308285A1, US20130165638A1, US20130267686A1, US20140377269A1, US7741446B2, and WO1995009917A1.
  • Exemplary multispecific molecules utilizing a domain exchange format include those described in the following, US20150315296A1, WO2016087650A1, US20160075785A1, WO2016016299A1, US20160130347A1, US20150166670, US8703132B2, US20100316645, US8227577B2, US20130078249.
  • Fc-containing entities also known as mini-antibodies
  • Fc-containing entities can be generated by fusing scFv to the C-termini of constant heavy region domain 3 (CH3-scFv) and/or to the hinge region (scFv- hinge-Fc) of an antibody with a different specificity.
  • Trivalent entities can also be made which have disulfide stabilized variable domains (without peptide linker) fused to the C-terminus of CH3 domains of IgGs.
  • Fc-containing multispecific molecules includes an immunoglobulin constant region (e.g., an Fc region).
  • Exemplary Fc regions can be chosen from the heavy chain constant regions of IgG1, IgG2, IgG3 or IgG4; more particularly, the heavy chain constant region of human IgG1, IgG2, IgG3, or IgG4.
  • the immunoglobulin chain constant region e.g., the Fc region
  • an interface of a first and second immunoglobulin chain constant regions is altered, e.g., mutated, to increase or decrease dimerization, e.g., relative to a non-engineered interface, e.g., a naturally-occurring interface.
  • dimerization of the immunoglobulin chain constant region can be enhanced by providing an Fc interface of a first and a second Fc region with one or more of: a paired protuberance-cavity (“knob-in-a hole”), an electrostatic interaction, or a strand- exchange, such that a greater ratio of heteromultimer to homomultimer forms, e.g., relative to a non-engineered interface.
  • a paired protuberance-cavity (“knob-in-a hole”)
  • electrostatic interaction or a strand- exchange
  • the multispecific molecules include a paired amino acid substitution at a position chosen from one or more of 347, 349, 350, 351, 366, 368, 370, 392, 394, 395, 397, 398, 399, 405, 407, or 409, e.g., of the Fc region of human IgG1
  • the immunoglobulin chain constant region e.g., Fc region
  • the immunoglobulin chain constant region can include a paired an amino acid substitution chosen from: T366S, L368A, or Y407V (e.g., corresponding to a cavity or hole), and T366W (e.g., corresponding to a protuberance or knob).
  • the multifunctional molecule includes a half-life extender, e.g., a human serum albumin or an antibody molecule to human serum albumin.
  • a half-life extender e.g., a human serum albumin or an antibody molecule to human serum albumin.
  • Heterodimerized Antibody Molecules & Methods of Making Various methods of producing multispecific antibodies have been disclosed to address the problem of incorrect heavy chain pairing. Exemplary methods are described below. Exemplary multispecific antibody formats and methods of making said multispecific antibodies are also disclosed in e.g., Speiss et al. Molecular Immunology 67 (2015) 95–106; and Klein et al mAbs 4:6, 653–663; November/December 2012; the entire contents of each of which are incorporated by reference herein.
  • Heterodimerized bispecific antibodies are based on the natural IgG structure, wherein the two binding arms recognize different antigens.
  • IgG derived formats that enable defined monovalent (and simultaneous) antigen binding are generated by forced heavy chain heterodimerization, combined with technologies that minimize light chain mispairing (e.g., common light chain). Forced heavy chain heterodimerization can be obtained using, e.g., knob- in-hole OR strand exchange engineered domains (SEED).
  • SEED knob- in-hole OR strand exchange engineered domains
  • Engineering 9(7): 617-621 broadly involves: (1) mutating the CH3 domain of one or both antibodies to promote heterodimerization; and (2) combining the mutated antibodies under conditions that promote heterodimerization.
  • “Knobs” or “protuberances” are typically created by replacing a small amino acid in a parental antibody with a larger amino acid (e.g., T366Y or T366W); “Holes” or “cavities” are created by replacing a larger residue in a parental antibody with a smaller amino acid (e.g., Y407T, T366S, L368A and/or Y407V).
  • Exemplary KiH mutations include S354C, T366W in the “knob” heavy chain and Y349C, T366S, L368A, Y407V in the “hole” heavy chain.
  • Other exemplary KiH mutations are provided in Table 4, with additional optional stabilizing Fc cysteine mutations.
  • Table 4 Exemplary Fc KiH mutations and optional Cysteine mutations
  • Other Fc mutations are provided by Igawa and Tsunoda who identified 3 negatively charged residues in the CH3 domain of one chain that pair with three positively charged residues in the CH3 domain of the other chain. These specific charged residue pairs are: E356-K439, E357-K370, D399-K409 and vice versa.
  • Xencor defined 41 variant pairs based on combining structural calculations and sequence information that were subsequently screened for maximal heterodimerization, defining the combination of S364H, F405A (HA) on chain A and Y349T, T394F on chain B (TF) (Moore GL et al.
  • a novel bispecific antibody format enables simultaneous bivalent and monovalent co-engagement of distinct target antigens.
  • Fc mutations to promote heterodimerization of multispecific antibodies include those described in the following references, the contents of each of which is incorporated by reference herein, WO2016071377A1, US20140079689A1, US20160194389A1, US20160257763, WO2016071376A2, WO2015107026A1, WO2015107025A1, WO2015107015A1, US20150353636A1, US20140199294A1, US7750128B2, US20160229915A1, US20150344570A1, US8003774A1, US20150337049A1, US20150175707A1, US20140242075A1, US20130195849A1, US20120149876A1, US20140200331A1, US9309311B2, US8586713, US20140037621A1, US20130178605A1, US20140363426A1, US20140051835A1 and US20110054151A1.
  • Stabilizing cysteine mutations have also been used in combination with KiH and other Fc heterodimerization promoting variants, see e.g., US7183076.
  • Other exemplary cysteine modifications include, e.g., those disclosed in US20140348839A1, US7855275B2, and US9000130B2.
  • Strand Exchange Engineered Domains (SEED) Heterodimeric Fc platform that support the design of bispecific and asymmetric fusion proteins by devising strand-exchange engineered domain (SEED) C(H)3 heterodimers are known.
  • SEEDbody (Sb) fusion proteins consist of [IgG1 hinge]-C(H)2-[SEED C(H)3], that may be genetically linked to one or more fusion partners (see e.g., Davis JH et al.
  • SEEDbodies fusion proteins based on strand exchange engineered domain (SEED) CH3 heterodimers in an Fc analogue platform for asymmetric binders or immunofusions and bispecific antibodies. Protein Eng Des Sel 2010; 23:195-202; PMID:20299542 and US8871912. The contents of each of which are incorporated by reference herein).
  • Duobody “Duobody” technology to produce bispecific antibodies with correct heavy chain pairing are known. The DuoBody technology involves three basic steps to generate stable bispecific human IgG1antibodies in a post-production exchange reaction. In a first step, two IgG1s, each containing single matched mutations in the third constant (CH3) domain, are produced separately using standard mammalian recombinant cell lines.
  • these IgG1 antibodies are purified according to standard processes for recovery and purification. After production and purification (post-production), the two antibodies are recombined under tailored laboratory conditions resulting in a bispecific antibody product with a very high yield (typically >95%) (see e.g., Labrijn et al, PNAS 2013;110(13):5145-5150 and Labrijn et al. Nature Protocols 2014;9(10):2450-63, the contents of each of which are incorporated by reference herein). Electrostatic Interactions Methods of making multispecific antibodies using CH3 amino acid changes with charged amino acids such that homodimer formation is electrostatically unfavorable are disclosed.
  • EP1870459 and WO 2009089004 describe other strategies for favoring heterodimer formation upon co-expression of different antibody domains in a host cell.
  • one or more residues that make up the heavy chain constant domain 3 (CH3), CH3-CH3 interfaces in both CH3 domains are replaced with a charged amino acid such that homodimer formation is electrostatically unfavorable and heterodimerization is electrostatically favorable.
  • Additional methods of making multispecific molecules using electrostatic interactions are described in the following references, the contents of each of which is incorporated by reference herein, include US20100015133, US8592562B2, US9200060B2, US20140154254A1, and US9358286A1.
  • Common Light Chain Light chain mispairing needs to be avoided to generate homogenous preparations of bispecific IgGs.
  • One way to achieve this is through the use of the common light chain principle, i.e. combining two binders that share one light chain but still have separate specificities.
  • An exemplary method of enhancing the formation of a desired bispecific antibody from a mixture of monomers is by providing a common variable light chain to interact with each of the heteromeric variable heavy chain regions of the bispecific antibody.
  • Compositions and methods of producing bispecific antibodies with a common light chain as disclosed in, e.g., US7183076B2, US20110177073A1, EP2847231A1, WO2016079081A1, and EP3055329A1, the contents of each of which is incorporated by reference herein.
  • CrossMab Another option to reduce light chain mispairing is the CrossMab technology which avoids non-specific L chain mispairing by exchanging CH1 and CL domains in the Fab of one half of the bispecific antibody. Such crossover variants retain binding specificity and affinity, but make the two arms so different that L chain mispairing is prevented.
  • the CrossMab technology (as reviewed in Klein et al. Supra) involves domain swapping between heavy and light chains so as to promote the formation of the correct pairings. Briefly, to construct a bispecific IgG-like CrossMab antibody that could bind to two antigens by using two distinct light chain–heavy chain pairs, a two-step modification process is applied.
  • a dimerization interface is engineered into the C-terminus of each heavy chain using a heterodimerization approach, e.g., Knob-into-hole (KiH) technology, to ensure that only a heterodimer of two distinct heavy chains from one antibody (e.g., Antibody A) and a second antibody (e.g., Antibody B) is efficiently formed.
  • a heterodimerization approach e.g., Knob-into-hole (KiH) technology
  • compositions and methods of producing bispecific antibodies with a common heavy chain are disclosed in, e.g., US20120184716, US20130317200, and US20160264685A1, the contents of each of which is incorporated by reference herein.
  • Amino Acid Modifications Alternative compositions and methods of producing multispecific antibodies with correct light chain pairing include various amino acid modifications.
  • Zymeworks describes heterodimers with one or more amino acid modifications in the CH1 and/or CL domains, one or more amino acid modifications in the VH and/or VL domains, or a combination thereof, which are part of the interface between the light chain and heavy chain and create preferential pairing between each heavy chain and a desired light chain such that when the two heavy chains and two light chains of the heterodimer pair are co-expressed in a cell, the heavy chain of the first heterodimer preferentially pairs with one of the light chains rather than the other (see e.g., WO2015181805).
  • Multispecific molecules e.g., multispecific antibody molecules
  • Methods for generating bispecific antibody molecules comprising the lambda light chain polypeptide and a kappa light chain polypeptides are disclosed in PCT/US17/53053 filed on September 22, 2017 and designated publication number WO 2018/057955, incorporated herein by reference in its entirety.
  • the multispecific molecule includes a multispecific antibody molecule, e.g., an antibody molecule comprising two binding specificities, e.g., a bispecific antibody molecule.
  • the multispecific antibody molecule includes: a lambda light chain polypeptide 1 (LLCP1) specific for a first epitope; a heavy chain polypeptide 1 (HCP1) specific for the first epitope; a kappa light chain polypeptide 2 (KLCP2) specific for a second epitope; and a heavy chain polypeptide 2 (HCP2) specific for the second epitope.
  • LLCP1 lambda light chain polypeptide 1
  • HCP1 heavy chain polypeptide 1
  • KLCP2 kappa light chain polypeptide 2
  • HCP2 heavy chain polypeptide 2
  • LLC1 “Lambda light chain polypeptide 1 (LLCP1)”, as that term is used herein, refers to a polypeptide comprising sufficient light chain (LC) sequence, such that when combined with a cognate heavy chain variable region, can mediate specific binding to its epitope and complex with an HCP1. In an embodiment it comprises all or a fragment of a CH1 region. In an embodiment, an LLCP1 comprises LC-CDR1, LC-CDR2, LC-CDR3, FR1, FR2, FR3, FR4, and CH1, or sufficient sequence therefrom to mediate specific binding of its epitope and complex with an HCP1.
  • LC light chain polypeptide 1
  • LLCP1 together with its HCP1, provide specificity for a first epitope (while KLCP2, together with its HCP2, provide specificity for a second epitope). As described elsewhere herein, LLCP1 has a higher affinity for HCP1 than for HCP2.
  • KLCP2 Kappa light chain polypeptide 2
  • LC sufficient light chain
  • it comprises all or a fragment of a CH1 region.
  • a KLCP2 comprises LC-CDR1, LC-CDR2, LC-CDR3, FR1, FR2, FR3, FR4, and CH1, or sufficient sequence therefrom to mediate specific binding of its epitope and complex with an HCP2.
  • KLCP2, together with its HCP2 provide specificity for a second epitope (while LLCP1, together with its HCP1, provide specificity for a first epitope).
  • “Heavy chain polypeptide 1 (HCP1)” refers to a polypeptide comprising sufficient heavy chain (HC) sequence, e.g., HC variable region sequence, such that when combined with a cognate LLCP1, can mediate specific binding to its epitope and complex with an HCP1.
  • an HCP1 comprises HC-CDR1, HC-CDR2, HC-CDR3, FR1, FR2, FR3, FR4, CH1, CH2, and CH3, or sufficient sequence therefrom to: (i) mediate specific binding of its epitope and complex with an LLCP1, (ii) to complex preferentially, as described herein to LLCP1 as opposed to KLCP2; and (iii) to complex preferentially, as described herein, to an HCP2, as opposed to another molecule of HCP1.
  • HCP1 together with its LLCP1 provide specificity for a first epitope (while KLCP2, together with its HCP2, provide specificity for a second epitope).
  • “Heavy chain polypeptide 2 (HCP2)” refers to a polypeptide comprising sufficient heavy chain (HC) sequence, e.g., HC variable region sequence, such that when combined with a cognate LLCP1, can mediate specific binding to its epitope and complex with an HCP1.
  • HC sufficient heavy chain
  • it comprises all or a fragment of a CH1region.
  • it comprises all or a fragment of a CH2 and/or CH3 region.
  • an HCP1 comprises HC-CDR1, HC-CDR2, HC-CDR3, FR1, FR2, FR3, FR4, CH1, CH2, and CH3, or sufficient sequence therefrom to: (i) mediate specific binding of its epitope and complex with an KLCP2, (ii) to complex preferentially, as described herein to KLCP2 as opposed to LLCP1; and (iii) to complex preferentially, as described herein, to an HCP1, as opposed to another molecule of HCP2.
  • HCP2, together with its KLCP2 provide specificity for a second epitope (while LLCP1, together with its HCP1, provide specificity for a first epitope).
  • LLCP1 has a higher affinity for HCP1 than for HCP2; and/or KLCP2 has a higher affinity for HCP2 than for HCP1.
  • the affinity of LLCP1 for HCP1 is sufficiently greater than its affinity for HCP2, such that under preselected conditions, e.g., in aqueous buffer, e.g., at pH 7, in saline, e.g., at pH 7, or under physiological conditions, at least 75, 80, 90, 95, 98, 99, 99.5, or 99.9 % of the multispecific antibody molecule molecules have a LLCP1complexed, or interfaced with, a HCP1.
  • the HCP1 has a greater affinity for HCP2, than for a second molecule of HCP1; and/or the HCP2 has a greater affinity for HCP1, than for a second molecule of HCP2.
  • the affinity of HCP1 for HCP2 is sufficiently greater than its affinity for a second molecule of HCP1, such that under preselected conditions, e.g., in aqueous buffer, e.g., at pH 7, in saline, e.g., at pH 7, or under physiological conditions, at least 75%, 80, 90, 95, 98, 9999.5 or 99.9 % of the multispecific antibody molecule molecules have a HCP1complexed, or interfaced with, a HCP2.
  • a method for making, or producing, a multispecific antibody molecule is e.g., in aqueous buffer, e.g., at pH 7, in saline, e.g., at pH 7, or under physiological conditions.
  • the method includes: (i) providing a first heavy chain polypeptide (e.g., a heavy chain polypeptide comprising one, two, three or all of a first heavy chain variable region (first VH), a first CH1, a first heavy chain constant region (e.g., a first CH2, a first CH3, or both)); (ii) providing a second heavy chain polypeptide (e.g., a heavy chain polypeptide comprising one, two, three or all of a second heavy chain variable region (second VH), a second CH1, a second heavy chain constant region (e.g., a second CH2, a second CH3, or both)); (iii) providing a lambda chain polypeptide (e.g., a lambda light variable region (VL ⁇ ), a lambda light constant chain (VL ⁇ ), or both) that preferentially associates with the first heavy chain polypeptide (e.g., the first VH); and (iv) providing a kappa chain polypeptide
  • the first and second heavy chain polypeptides form an Fc interface that enhances heterodimerization.
  • (i)-(iv) e.g., nucleic acid encoding (i)-(iv)
  • a single cell e.g., a single mammalian cell, e.g., a CHO cell.
  • (i)-(iv) are expressed in the cell.
  • (i)-(iv) e.g., nucleic acid encoding (i)-(iv)
  • are introduced in different cells e.g., different mammalian cells, e.g., two or more CHO cell.
  • the method further comprises purifying a cell-expressed antibody molecule, e.g., using a lambda- and/or- kappa-specific purification, e.g., affinity chromatography.
  • the method further comprises evaluating the cell-expressed multispecific antibody molecule.
  • the purified cell-expressed multispecific antibody molecule can be analyzed by techniques known in the art, include mass spectrometry.
  • the purified cell-expressed antibody molecule is cleaved, e.g., digested with papain to yield the Fab moieties and evaluated using mass spectrometry.
  • the method produces correctly paired kappa/lambda multispecific, e.g., bispecific, antibody molecules in a high yield, e.g., at least 75%, 80, 90, 95, 98, 9999.5 or 99.9 %.
  • the multispecific, e.g., a bispecific, antibody molecule that includes: (i) a first heavy chain polypeptide (HCP1) (e.g., a heavy chain polypeptide comprising one, two, three or all of a first heavy chain variable region (first VH), a first CH1, a first heavy chain constant region (e.g., a first CH2, a first CH3, or both)), e.g., wherein the HCP1 binds to a first epitope; (ii) a second heavy chain polypeptide (HCP2) (e.g., a heavy chain polypeptide comprising one, two, three or all of a second heavy chain variable region (second VH), a second CH1, a second heavy chain constant region (e.g., a second CH2, a second CH3, or both)), e.g., wherein the HCP2 binds to a second epitope; (iii) a lambda light chain polypeptide (LLCP1) (HCP
  • the first and second heavy chain polypeptides form an Fc interface that enhances heterodimerization.
  • the multispecific antibody molecule has a first binding specificity that includes a hybrid VLl-CLl heterodimerized to a first heavy chain variable region connected to the Fc constant, CH2-CH3 domain (having a knob modification) and a second binding specificity that includes a hybrid VLk-CLk heterodimerized to a second heavy chain variable region connected to the Fc constant, CH2-CH3 domain (having a hole modification).
  • Cytokine Molecules Cytokines are generally polypeptides that influence cellular activity, for example, through signal transduction pathways.
  • a cytokine of the multispecific or multifunctional polypeptide is useful and can be associated with receptor-mediated signaling that transmits a signal from outside the cell membrane to modulate a response within the cell.
  • Cytokines are proteinaceous signaling compounds that are mediators of the immune response. They control many different cellular functions including proliferation, differentiation and cell survival/apoptosis; cytokines are also involved in several pathophysiological processes including viral infections and autoimmune diseases. Cytokines are synthesized under various stimuli by a variety of cells of both the innate (monocytes, macrophages, dendritic cells) and adaptive (T- and B-cells) immune systems. Cytokines can be classified into two groups: pro- and anti- inflammatory.
  • Pro-inflammatory cytokines including IFN ⁇ , IL-1, IL-6 and TNF-alpha, are predominantly derived from the innate immune cells and Th1 cells.
  • Anti-inflammatory cytokines including IL-10, IL-4, IL-13 and IL-5, are synthesized from Th2 immune cells.
  • the present disclosure provides, inter alia, multispecific (e.g., bi-, tri-, quad- specific) or multifunctional molecules, that include, e.g., are engineered to contain, one or more cytokine molecules, e.g., immunomodulatory (e.g., proinflammatory) cytokines and variants, e.g., functional variants, thereof.
  • the cytokine molecule is an interleukin or a variant, e.g., a functional variant thereof.
  • the interleukin is a proinflammatory interleukin.
  • the interleukin is chosen from interleukin-2 (IL-2), interleukin-12 (IL-12), interleukin-15 (IL-15), interleukin-18 (IL-18), interleukin-21 (IL-21), interleukin-7 (IL-7), or interferon gamma.
  • the cytokine molecule is a proinflammatory cytokine.
  • the cytokine is a single chain cytokine.
  • the cytokine is a multichain cytokine (e.g., the cytokine comprises 2 or more (e.g., 2) polypeptide chains.
  • An exemplary multichain cytokine is IL-12.
  • useful cytokines include, but are not limited to, GM-CSF, IL-1 ⁇ , IL-1 ⁇ , IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-10, IL-12, IL-21, IFN- ⁇ , IFN- ⁇ , IFN- ⁇ , MIP-1 ⁇ , MIP-1 ⁇ , TGF- ⁇ , TNF- ⁇ , and TNF ⁇ .
  • the cytokine of the multispecific or multifunctional polypeptide is a cytokine selected from the group of GM-CSF, IL-2, IL-7, IL-8, IL-10, IL-12, IL-15, IL-21, IFN- ⁇ , IFN- ⁇ , MIP-1 ⁇ , MIP-1 ⁇ and TGF- ⁇ .
  • the cytokine of the i the multispecific or multifunctional polypeptide is a cytokine selected from the group of IL-2, IL-7, IL-10, IL-12, IL-15, IFN- ⁇ , and IFN- ⁇ .
  • the cytokine is mutated to remove N- and/or O-glycosylation sites.
  • the cytokine of the multispecific or multifunctional polypeptide is IL- 2.
  • the IL-2 cytokine can elicit one or more of the cellular responses selected from the group consisting of: proliferation in an activated T lymphocyte cell, differentiation in an activated T lymphocyte cell, cytotoxic T cell (CTL) activity, proliferation in an activated B cell, differentiation in an activated B cell, proliferation in a natural killer (NK) cell, differentiation in a NK cell, cytokine secretion by an activated T cell or an NK cell, and NK/lymphocyte activated killer (LAK) antitumor cytotoxicity.
  • CTL cytotoxic T cell
  • NK natural killer
  • LAK NK/lymphocyte activated killer
  • the IL-2 cytokine is a mutant IL-2 cytokine having reduced binding affinity to the .alpha.- subunit of the IL-2 receptor.
  • the .alpha.-subunit also known as CD122 and CD132, respectively
  • the .alpha.-subunit also known as CD25
  • the intermediate-affinity IL-2 receptor forms the heterotrimeric high-affinity IL-2 receptor, while the dimeric receptor consisting only of the ⁇ - and ⁇ -subunits is termed the intermediate-affinity IL-2 receptor.
  • a mutant IL-2 polypeptide with reduced binding to the .alpha.-subunit of the IL-2 receptor has a reduced ability to induce IL-2 signaling in regulatory T cells, induces less activation-induced cell death (AICD) in T cells, and has a reduced toxicity profile in vivo, compared to a wild-type IL-2 polypeptide.
  • AICD activation-induced cell death
  • the use of such an cytokine with reduced toxicity is particularly advantageous in a multispecific or multifunctional polypeptide according to the invention, having a long serum half-life due to the presence of an Fc domain.
  • the mutant IL-2 cytokine of the multispecific or multifunctional polypeptide according to the invention comprises at least one amino acid mutation that reduces or abolishes the affinity of the mutant IL-2 cytokine to the .alpha.-subunit of the IL-2 receptor (CD25) but preserves the affinity of the mutant IL-2 cytokine to the intermediate-affinity IL-2 receptor (consisting of the ⁇ and ⁇ subunits of the IL-2 receptor), compared to the non-mutated IL-2 cytokine.
  • the one or more amino acid mutations are amino acid substitutions.
  • the mutant IL-2 cytokine comprises one, two or three amino acid substitutions at one, two or three position(s) selected from the positions corresponding to residue 42, 45, and 72 of human IL-2. In a more specific embodiment, the mutant IL-2 cytokine comprises three amino acid substitutions at the positions corresponding to residue 42, 45 and 72 of human IL-2. In an even more specific embodiment, the mutant IL-2 cytokine is human IL-2 comprising the amino acid substitutions F42A, Y45A and L72G. In one embodiment the mutant IL-2 cytokine additionally comprises an amino acid mutation at a position corresponding to position 3 of human IL-2, which eliminates the O-glycosylation site of IL-2.
  • said additional amino acid mutation is an amino acid substitution replacing a threonine residue by an alanine residue.
  • a particular mutant IL-2 cytokine useful in the invention comprises four amino acid substitutions at positions corresponding to residues 3, 42, 45 and 72 of human IL-2. Specific amino acid substitutions are T3A, F42A, Y45A and L72G.
  • said quadruple mutant IL-2 polypeptide exhibits no detectable binding to CD25, reduced ability to induce apoptosis in T cells, reduced ability to induce IL-2 signaling in T.sub.reg cells, and a reduced toxicity profile in vivo.
  • the IL-2 or mutant IL-2 cytokine according to any of the above embodiments may comprise additional mutations that provide further advantages such as increased expression or stability.
  • the cysteine at position 125 may be replaced with a neutral amino acid such as alanine, to avoid the formation of disulfide-bridged IL-2 dimers.
  • the IL-2 or mutant IL-2 cytokine of the multispecific or multifunctional polypeptide according to the invention comprises an additional amino acid mutation at a position corresponding to residue 125 of human IL-2.
  • said additional amino acid mutation is the amino acid substitution C125A.
  • the IL-2 cytokine of the multispecific or multifunctional polypeptide comprises the polypeptide sequence of SEQ ID NO: 2270 Q ]
  • the IL-2 cytokine of the multispecific or multifunctional polypeptide comprises the polypeptide sequence of SEQ ID NO: 2280 [APASSSTKKT
  • the cytokine of the multispecific or multifunctional polypeptide is IL-12.
  • said IL-12 cytokine is a single chain IL-12 cytokine.
  • the single chain IL-12 cytokine comprises the polypeptide sequence of SEQ ID NO: 2290 embodiment, the IL-12 cytokine can elicit one or more of the cellular responses selected from the group consisting of: proliferation in a NK cell, differentiation in a NK cell, proliferation in a T cell, and differentiation in a T cell.
  • the cytokine of the multispecific or multifunctional polypeptide is IL-10.
  • said IL-10 cytokine is a single chain IL-10 cytokine.
  • the single chain IL-10 cytokine comprises the polypeptide sequence of SEQ ID NO: 2300
  • the IL-10 cytokine is a monomeric IL-10 cytokine.
  • the monomeric IL-10 cytokine comprises the polypeptide sequence of SEQ ID NO: 2310 GGSGGKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN]
  • the IL-10 cytokine can elicit one or more of the cellular responses selected from the group consisting of: inhibition of cytokine secretion, inhibition of antigen presentation by antigen presenting cells, reduction of oxygen radical release, and inhibition of T cell proliferation.
  • a multispecific or multifunctional polypeptide according to the invention wherein the cytokine is IL-10 is particularly useful for downregulation of inflammation, e.g. in the treatment of an inflammatory disorder.
  • the cytokine of the multispecific or multifunctional polypeptide is IL-15.
  • said IL-15 cytokine is a mutant IL-15 cytokine having reduced binding affinity to the ⁇ -subunit of the IL-15 receptor.
  • a mutant IL-15 polypeptide with reduced binding to the .alpha.-subunit of the IL-15 receptor has a reduced ability to bind to fibroblasts throughout the body, resulting in improved pharmacokinetics and toxicity profile, compared to a wild-type IL-15 polypeptide.
  • the use of an cytokine with reduced toxicity, such as the described mutant IL-2 and mutant IL-15 effector moieties, is particularly advantageous in a multispecific or multifunctional polypeptide according to the invention, having a long serum half-life due to the presence of an Fc domain.
  • the mutant IL-15 cytokine of the multispecific or multifunctional polypeptide according to the invention comprises at least one amino acid mutation that reduces or abolishes the affinity of the mutant IL-15 cytokine to the .alpha.-subunit of the IL-15 receptor but preserves the affinity of the mutant IL-15 cytokine to the intermediate-affinity IL-15/IL-2 receptor (consisting of the .beta.- and .gamma.-subunits of the IL-15/IL-2 receptor), compared to the non-mutated IL-15 cytokine.
  • the amino acid mutation is an amino acid substitution.
  • the mutant IL-15 cytokine comprises an amino acid substitution at the position corresponding to residue 53 of human IL-15.
  • the mutant IL-15 cytokine is human IL-15 comprising the amino acid substitution E53A.
  • the mutant IL-15 cytokine additionally comprises an amino acid mutation at a position corresponding to position 79 of human IL-15, which eliminates the N- glycosylation site of IL-15.
  • said additional amino acid mutation is an amino acid substitution replacing an asparagine residue by an alanine residue.
  • the IL-15 cytokine comprises the polypeptide sequence of SEQ ID NO: 2320 [NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLASGDASI
  • the IL-15 cytokine can elicit one or more of the cellular responses selected from the group consisting of: proliferation in an activated T lymphocyte cell, differentiation in an activated T lymphocyte cell, cytotoxic T cell (CTL) activity, proliferation in an activated B cell, differentiation in an activated B cell, proliferation in a natural killer (NK) cell, differentiation in a NK cell, cytokine secretion by an activated T cell or an NK cell, and NK/lymphocyte activated killer (LAK) antitumor cytotoxicity.
  • CTL cytotoxic T cell
  • NK natural killer
  • LAK NK/lymphocyte activated killer
  • Mutant cytokine molecules useful as effector moieties in the multispecific or multifunctional polypeptide can be prepared by deletion, substitution, insertion or modification using genetic or chemical methods well known in the art. Genetic methods may include site- specific mutagenesis of the encoding DNA sequence, PCR, gene synthesis, and the like. The correct nucleotide changes can be verified for example by sequencing. Substitution or insertion may involve natural as well as non-natural amino acid residues. Amino acid modification includes well known methods of chemical modification such as the addition or removal of glycosylation sites or carbohydrate attachments, and the like.
  • the cytokine, particularly a single-chain cytokine, of the multispecific or multifunctional polypeptide is GM-CSF.
  • the GM-CSF cytokine can elicit proliferation and/or differentiation in a granulocyte, a monocyte or a dendritic cell.
  • the cytokine, particularly a single-chain cytokine, of the multispecific or multifunctional polypeptide is IFN- ⁇ .
  • the IFN- ⁇ cytokine can elicit one or more of the cellular responses selected from the group consisting of: inhibiting viral replication in a virus-infected cell, and upregulating the expression of major histocompatibility complex I (MHC I).
  • MHC I major histocompatibility complex I
  • the IFN- ⁇ cytokine can inhibit proliferation in a tumor cell.
  • the cytokine, particularly a single-chain cytokine, of the multispecific or multifunctional polypeptide is IFN ⁇ .
  • the IFN- ⁇ cytokine can elicit one or more of the cellular responses selected from the group of: increased macrophage activity, increased expression of MHC molecules, and increased NK cell activity.
  • the cytokine, particularly a single-chain cytokine, of the multispecific or multifunctional polypeptide is IL-7.
  • the IL-7 cytokine can elicit proliferation of T and/or B lymphocytes.
  • the cytokine, particularly a single-chain cytokine, of the multispecific or multifunctional polypeptide is IL-8.
  • the IL-8 cytokine can elicit chemotaxis in neutrophils.
  • the cytokine, particularly a single-chain cytokine, of the multispecific or multifunctional polypeptide is MIP-1 ⁇ .
  • the MIP-1 ⁇ cytokine can elicit chemotaxis in monocytes and T lymphocyte cells.
  • the cytokine, particularly a single-chain cytokine, of the multispecific or multifunctional polypeptide is MIP-1 ⁇ .
  • the MIP-1 ⁇ cytokine can elicit chemotaxis in monocytes and T lymphocyte cells.
  • the cytokine, particularly a single-chain cytokine, of the multispecific or multifunctional polypeptide is TGF- ⁇ .
  • the TGF- ⁇ cytokine can elicit one or more of the cellular responses selected from the group consisting of: chemotaxis in monocytes, chemotaxis in macrophages, upregulation of IL-1 expression in activated macrophages, and upregulation of IgA expression in activated B cells.
  • the multispecific or multifunctional polypeptide of the invention binds to an cytokine receptor with a dissociation constant (KD) that is at least about 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5 or 10 times greater than that for a control cytokine.
  • KD dissociation constant
  • the multispecific or multifunctional polypeptide binds to an cytokine receptor with a KD that is at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 times greater than that for a corresponding multispecific or multifunctional polypeptide comprising two or more effector moieties.
  • the multispecific or multifunctional polypeptide binds to an cytokine receptor with a dissociation constant KD that is about 10 times greater than that for a corresponding the multispecific or multifunctional polypeptide comprising two or more cytokines.
  • the multispecific molecules disclosed herein include a cytokine molecule.
  • the cytokine molecule includes a full length, a fragment or a variant of a cytokine; a cytokine receptor domain, e.g., a cytokine receptor dimerizing domain; or an agonist of a cytokine receptor, e.g., an antibody molecule (e.g., an agonistic antibody) to a cytokine receptor.
  • the cytokine molecule is chosen from IL-2, IL-12, IL-15, IL-18, IL-7, IL-21, or interferon gamma, or a fragment or variant thereof, or a combination of any of the aforesaid cytokines.
  • the cytokine molecule can be a monomer or a dimer.
  • the cytokine molecule can further include a cytokine receptor dimerizing domain.
  • the cytokine molecule is an agonist of a cytokine receptor, e.g., an antibody molecule (e.g., an agonistic antibody) to a cytokine receptor chosen from an IL-15Ra or IL-21R.
  • the cytokine molecule is IL-15, e.g., human IL-15 (e.g., comprising the amino acid sequence: NO: 2170), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 2170.
  • the cytokine molecule comprises a receptor dimerizing domain, e.g., an IL15Ralpha dimerizing domain.
  • the IL15Ralpha dimerizing domain comprises the amino acid sequence: (SEQ ID NO: 2180), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 2180.
  • the cytokine molecule (e.g., IL-15) and the receptor dimerizing domain (e.g., an IL15Ralpha dimerizing domain) of the multispecific molecule are covalently linked, e.g., via a linker (e.g., a Gly-Ser linker, e.g., a linker comprising the amino acid sequence
  • a linker e.g., a Gly-Ser linker, e.g., a linker comprising the amino acid sequence
  • the cytokine molecule (e.g., IL-15) and the receptor dimerizing domain (e.g., an IL15Ralpha dimerizing domain) of the multispecific molecule are not covalently linked, e.g., are non-covalently associated.
  • the cytokine molecule is IL-2, e.g., human IL-2 (e.g., comprising the amino acid sequence: WITFCQSIISTLT (SEQ ID NO: 2191), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO:2191).
  • human IL-2 e.g., comprising the amino acid sequence: WITFCQSIISTLT (SEQ ID NO: 2191), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g
  • the cytokine molecule is IL-18, e.g., human IL-18 (e.g., comprising the amino acid sequence: (SEQ ID NO: 2192), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 2192).
  • human IL-18 e.g., comprising the amino acid sequence: (SEQ ID NO: 2192), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO
  • the cytokine molecule is IL-21, e.g., human IL-21 (e.g., comprising the amino acid sequence: (SEQ ID NO: 2193), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 2193).
  • human IL-21 e.g., comprising the amino acid sequence: (SEQ ID NO: 2193), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO
  • the cytokine molecule is interferon gamma, e.g., human interferon gamma (e.g., comprising the amino acid sequence: MAELSPAAKTGKRKRSQMLFRG (SEQ ID NO: 2194), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 2194).
  • human interferon gamma e.g., comprising the amino acid sequence: MAELSPAAKTGKRKRSQMLFRG (SEQ ID NO: 2194), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen
  • the immune cell engagers e.g., first and/or second immune cell engager, of the multispecific or multifunctional molecules disclosed herein can mediate binding to, and/or activation of, an immune cell, e.g., an immune effector cell.
  • the immune cell is chosen from a T cell, an NK cell, a B cell, a dendritic cell, or a macrophage cell engager, or a combination thereof.
  • the immune cell engager is chosen from one, two, three, or all of a T cell engager, NK cell engager, a B cell engager, a dendritic cell engager, or a macrophage cell engager, or a combination thereof.
  • the immune cell engager can be an agonist of the immune system.
  • the immune cell engager can be an antibody molecule, a ligand molecule (e.g., a ligand that further comprises an immunoglobulin constant region, e.g., an Fc region), a small molecule, a nucleotide molecule.
  • a ligand molecule e.g., a ligand that further comprises an immunoglobulin constant region, e.g., an Fc region
  • NK Natural Killer Cell Engagers Natural Killer (NK) cells recognize and destroy tumors and virus-infected cells in an antibody-independent manner. The regulation of NK cells is mediated by activating and inhibiting receptors on the NK cell surface.
  • One family of activating receptors is the natural cytotoxicity receptors (NCRs) which include NKp30, NKp44 and NKp46.
  • NCRs initiate tumor targeting by recognition of heparan sulfate on cancer cells.
  • NKG2D is a receptor that provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity.
  • DNAM1 is a receptor involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T- lymphocyte (CTL) and NK cell.
  • CTL cytotoxic T- lymphocyte
  • DAP10 (also known as HCST) is a transmembrane adapter protein which associates with KLRK1 to form an activation receptor KLRK1-HCST in lymphoid and myeloid cells; this receptor plays a major role in triggering cytotoxicity against target cells expressing cell surface ligands such as MHC class I chain-related MICA and MICB, and U(optionally L1)6-binding proteins (ULBPs); it KLRK1-HCST receptor plays a role in immune surveillance against tumors and is required for cytolysis of tumors cells; indeed, melanoma cells that do not express KLRK1 ligands escape from immune surveillance mediated by NK cells.
  • CD16 is a receptor for the Fc region of IgG, which binds complexed or aggregated IgG and also monomeric IgG and thereby mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
  • the NK cell engager is a viral hemagglutinin (HA), HA is a glycoprotein found on the surface of influenza viruses. It is responsible for binding the virus to cells with sialic acid on the membranes, such as cells in the upper respiratory tract or erythrocytes. HA has at least 18 different antigens. These subtypes are named H1 through H18. NCRs can recognize viral proteins.
  • NKp46 has been shown to be able to interact with the HA of influenza and the HA-NA of Paramyxovirus, including Sendai virus and Newcastle disease virus. Besides NKp46, NKp44 can also functionally interact with HA of different influenza subtypes.
  • the present disclosure provides, inter alia, multispecific (e.g., bi-, tri-, quad- specific) or multifunctional molecules, that are engineered to contain one or more NK cell engagers that mediate binding to and/or activation of an NK cell.
  • the NK cell engager is selected from an antigen binding domain or ligand that binds to (e.g., activates): NKp30, NKp40, NKp44, NKp46, NKG2D, DNAM1, DAP10, CD16 (e.g., CD16a, CD16b, or both), CRTAM, CD27, PSGL1, CD96, CD100 (SEMA4D), NKp80, CD244 (also known as SLAMF4 or 2B4), SLAMF6, SLAMF7, KIR2DS2, KIR2DS4, KIR3DS1, KIR2DS3, KIR2DS5, KIR2DS1, CD94, NKG2C, NKG2E, or CD160.
  • an antigen binding domain or ligand that binds to (e.g., activates): NKp30, NKp40, NKp44, NKp46, NKG2D, DNAM1, DAP10, CD16 (e.g., CD16a, CD16
  • the NK cell engager is a ligand of NKp30 is a B7-6, e.g., comprises the amino acid sequence of: S (SEQ ID NO: 3291), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3291.
  • the NK cell engager is a ligand of NKp44 or NKp46, which is a viral HA.
  • Viral hemagglutinins are glyco proteins which are on the surface of viruses. HA proteins allow viruses to bind to the membrane of cells via sialic acid sugar moieties which contributes to the fusion of viral membranes with the cell membranes (see e.g., Eur J Immunol. 2001 Sep;31(9):2680-9 “Recognition of viral hemagglutinins by NKp44 but not by NKp30”; and Nature.2001 Feb 22;409(6823):1055-60 “Recognition of haemagglutinins on virus-infected cells by NKp46 activates lysis by human NK cells” the contents of each of which are incorporated by reference herein).
  • the NK cell engager is a ligand of NKG2D chosen from MICA, MICB, or ULBP1, e.g., wherein: (i) MICA comprises the amino acid sequence: (SEQ ID NO: 3292), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3292; (ii) MICB comprises the amino acid sequence: (SEQ ID NO: 3293), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g.,
  • the NK cell engager is a ligand of DNAM1 chosen from NECTIN2 or NECL5, e.g., wherein: (i) NECTIN2 comprises the amino acid sequence: Q Q (SEQ ID NO: 3295), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3295; or (ii) NECL5 comprises the amino acid sequence: VTNALGARQAELTVQVKEGPPSEHSGISRN (SEQ ID NO: 3296), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g.,
  • the NK cell engager is a ligand of DAP10, which is an adapter for NKG2D (see e.g., Proc Natl Acad Sci U S A.2005 May 24; 102(21): 7641–7646; and Blood, 15 September 2011 Volume 118, Number 11, the full contents of each of which is incorporated by reference herein).
  • the NK cell engager is a ligand of CD16, which is a CD16a/b ligand, e.g., a CD16a/b ligand further comprising an antibody Fc region (see e.g., Front Immunol.2013; 4: 76 discusses how antibodies use the Fc to trigger NK cells through CD16,the full contents of which are incorporated herein).
  • the NK cell engager is a ligand of CRTAM, which is NECL2, e.g., wherein NECL2 comprises the amino acid sequence: PPTTTTTTTTTTTTTILTIITDSRAGEEGSIRAVDH (SEQ ID NO: 3297), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3297.
  • PPTTTTTTTTTTTTTTTILTIITDSRAGEEGSIRAVDH SEQ ID NO: 3297
  • amino acid sequence substantially identical thereto e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions
  • the NK cell engager is a ligand of CD27, which is CD70, e.g., wherein CD70 comprises the amino acid sequence: (SEQ ID NO: 3298), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3298.
  • CD70 comprises the amino acid sequence: (SEQ ID NO: 3298), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3298.
  • the NK cell engager is a ligand of PSGL1, which is L-selectin (CD62L), e.g., wherein L-selectin comprises the amino acid sequence: (SEQ ID NO: 3299), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3299.
  • L-selectin comprises the amino acid sequence: (SEQ ID NO: 3299), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to
  • the NK cell engager is a ligand of CD96, which is NECL5, e.g., wherein NECL5 comprises the amino acid sequence: (SEQ ID NO: 3296), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3296.
  • NECL5 comprises the amino acid sequence: (SEQ ID NO: 3296), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 32
  • the NK cell engager is a ligand of CD100 (SEMA4D), which is CD72, e.g., wherein CD72 comprises the amino acid sequence: ICEMTAFRFPD (SEQ ID NO 3300) a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3300.
  • SEMA4D ligand of CD100
  • CD72 comprises the amino acid sequence: ICEMTAFRFPD (SEQ ID NO 3300) a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions,
  • the NK cell engager is a ligand of NKp80, which is CLEC2B (AICL), e.g., wherein CLEC2B (AICL) comprises the amino acid sequence: , a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3301.
  • CLEC2B AICL
  • amino acid sequence substantially identical thereto e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3301.
  • the NK cell engager is a ligand of CD244, which is CD48, e.g., wherein CD48 comprises the amino acid sequence: (SEQ ID NO: 3302), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3302.
  • CD48 comprises the amino acid sequence: (SEQ ID NO: 3302), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3302.
  • T Cell Engagers The present disclosure provides, inter alia, multispecific (e.g., bi-, tri-, quad- specific) or multifunctional molecules, that are engineered to contain one or more T cell engager that mediate binding to and/or activation of a T cell.
  • the T cell engager is an antigen binding domain that binds to, e.g., activates TCR ⁇ , e.g., a TCR ⁇ V region, as described herein.
  • the T cell engager is selected from an antigen binding domain or ligand that binds to (e.g., and in some embodiments activates) one or more of CD3, TCR ⁇ , TCR ⁇ , TCR ⁇ , ICOS, CD28, CD27, HVEM, LIGHT, CD40, 4-1BB, OX40, DR3, GITR, CD30, TIM1, SLAM, CD2, or CD226.
  • an antigen binding domain or ligand that binds to (e.g., and in some embodiments activates) one or more of CD3, TCR ⁇ , TCR ⁇ , TCR ⁇ , ICOS, CD28, CD27, HVEM, LIGHT, CD40, 4-1BB, OX40, DR3, GITR, CD30, TIM1, SLAM, CD2, or CD226.
  • the T cell engager is selected from an antigen binding domain or ligand that binds to and does not activate one or more of CD3, TCR ⁇ , ,TCR ⁇ , TCR ⁇ , ICOS, CD28, CD27, HVEM, LIGHT, CD40, 4-1BB, OX40, DR3, GITR, CD30, TIM1, SLAM, CD2, or CD226.
  • B Cell, Macrophage & Dendritic Cell Engagers Broadly, B cells, also known as B lymphocytes, are a type of white blood cell of the lymphocyte subtype. They function in the humoral immunity component of the adaptive immune system by secreting antibodies.
  • B cells present antigen (they are also classified as professional antigen-presenting cells (APCs)) and secrete cytokines.
  • Macrophages are a type of white blood cell that engulfs and digests cellular debris, foreign substances, microbes, cancer cells via phagocytosis. Besides phagocytosis, they play important roles in nonspecific defense (innate immunity) and also help initiate specific defense mechanisms (adaptive immunity) by recruiting other immune cells such as lymphocytes. For example, they are important as antigen presenters to T cells. Beyond increasing inflammation and stimulating the immune system, macrophages also play an important anti-inflammatory role and can decrease immune reactions through the release of cytokines.
  • APCs professional antigen-presenting cells
  • Dendritic cells are antigen- presenting cells that function in processing antigen material and present it on the cell surface to the T cells of the immune system.
  • the present disclosure provides, inter alia, multispecific (e.g., bi-, tri-, quad- specific) or multifunctional molecules, that include, e.g., are engineered to contain, one or more B cell, macrophage, and/or dendritic cell engager that mediate binding to and/ or activation of a B cell, macrophage, and/or dendritic cell.
  • the immune cell engager comprises a B cell, macrophage, and/or dendritic cell engager chosen from one or more of CD40 ligand (CD40L) or a CD70 ligand; an antibody molecule that binds to CD40 or CD70; an antibody molecule to OX40; an OX40 ligand (OX40L); an agonist of a Toll-like receptor (e.g., as described herein, e.g., a TLR4, e.g., a constitutively active TLR4 (caTLR4), or a TLR9 agonists); a 41BB; a CD2; a CD47; or a STING agonist, or a combination thereof.
  • CD40L CD40 ligand
  • OX40L OX40L
  • an agonist of a Toll-like receptor e.g., as described herein, e.g., a TLR4, e.g., a constitutively active TLR4 (caTLR
  • the B cell engager is a CD40L, an OX40L, or a CD70 ligand, or an antibody molecule that binds to OX40, CD40 or CD70.
  • the macrophage engager is a CD2 agonist.
  • the macrophage engager is an antigen binding domain that binds to: CD40L or antigen binding domain or ligand that binds CD40, a Toll like receptor (TLR) agonist (e.g., as described herein), e.g., a TLR9 or TLR4 (e.g., caTLR4 (constitutively active TLR4), CD47, or a STING agonist.
  • TLR Toll like receptor
  • the STING agonist is a cyclic dinucleotide, e.g., cyclic di-GMP (cdGMP) or cyclic di-AMP (cdAMP).
  • the STING agonist is biotinylated.
  • the dendritic cell engager is a CD2 agonist.
  • the dendritic cell engager is a ligand, a receptor agonist, or an antibody molecule that binds to one or more of: OX40L, 41BB, a TLR agonist (e.g., as described herein) (e.g., TLR9 agonist, TLR4 (e.g., caTLR4 (constitutively active TLR4)), CD47, or and a STING agonist.
  • the STING agonist is a cyclic dinucleotide, e.g., cyclic di-GMP (cdGMP) or cyclic di-AMP (cdAMP).
  • the STING agonist is biotinylated.
  • the immune cell engager mediates binding to, or activation of, one or more of a B cell, a macrophage, and/or a dendritic cell.
  • B cell, macrophage, and/or dendritic cell engagers can be chosen from one or more of CD40 ligand (CD40L) or a CD70 ligand; an antibody molecule that binds to CD40 or CD70; an antibody molecule to OX40; an OX40 ligand (OX40L); a Toll-like receptor agonist (e.g., a TLR4, e.g., a constitutively active TLR4 (caTLR4) or a TLR9 agonist); a 41BB agonist; a CD2; a CD47; or a STING agonist, or a combination thereof.
  • CD40L CD40 ligand
  • OX40L OX40L
  • TLR4 e.g., a constitutively active TLR4 (caTLR4) or a T
  • the B cell engager is chosen from one or more of a CD40L, an OX40L, or a CD70 ligand, or an antibody molecule that binds to OX40, CD40 or CD70.
  • the macrophage cell engager is chosen from one or more of a CD2 agonist; a CD40L; an OX40L; an antibody molecule that binds to OX40, CD40 or CD70; a Toll-like receptor agonist or a fragment thereof (e.g., a TLR4, e.g., a constitutively active TLR4 (caTLR4)); a CD47 agonist; or a STING agonist.
  • the dendritic cell engager is chosen from one or more of a CD2 agonist, an OX40 antibody, an OX40L, 41BB agonist, a Toll-like receptor agonist or a fragment thereof (e.g., a TLR4, e.g., a constitutively active TLR4 (caTLR4)), CD47 agonist, or a STING agonist.
  • a CD2 agonist an OX40 antibody, an OX40L, 41BB agonist, a Toll-like receptor agonist or a fragment thereof (e.g., a TLR4, e.g., a constitutively active TLR4 (caTLR4)), CD47 agonist, or a STING agonist.
  • the OX40L comprises the amino acid sequence: (SEQ ID NO: 3303), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3303.
  • the CD40L comprises the amino acid sequence: (SEQ ID NO: 3304), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3304.
  • the STING agonist comprises a cyclic dinucleotide, e.g., a cyclic di-GMP (cdGMP), a cyclic di-AMP (cdAMP), or a combination thereof, optionally with 2’,5’ or 3’,5’ phosphate linkages.
  • a cyclic dinucleotide e.g., a cyclic di-GMP (cdGMP), a cyclic di-AMP (cdAMP), or a combination thereof, optionally with 2’,5’ or 3’,5’ phosphate linkages.
  • the immune cell engager includes 41BB ligand, e.g., comprising the amino acid sequence: HAWQLTQGATVLGLFRVTPEIPAGLPSPRSE (SEQ ID NO: 3305), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3305.
  • 41BB ligand e.g., comprising the amino acid sequence: HAWQLTQGATVLGLFRVTPEIPAGLPSPRSE (SEQ ID NO: 3305), a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions,
  • Toll-Like Receptors are evolutionarily conserved receptors are homologues of the Drosophila Toll protein, and recognize highly conserved structural motifs known as pathogen-associated microbial patterns (PAMPs), which are exclusively expressed by microbial pathogens, or danger-associated molecular patterns (DAMPs) that are endogenous molecules released from necrotic or dying cells.
  • PAMPs include various bacterial cell wall components such as lipopolysaccharide (LPS), peptidoglycan (PGN) and lipopeptides, as well as flagellin, bacterial DNA and viral double-stranded RNA.
  • LPS lipopolysaccharide
  • PPN peptidoglycan
  • lipopeptides as well as flagellin, bacterial DNA and viral double-stranded RNA.
  • DAMPs include intracellular proteins such as heat shock proteins as well as protein fragments from the extracellular matrix. Stimulation of TLRs by the corresponding PAMPs or DAMPs initiates signaling cascades leading to the activation of transcription factors, such as AP-1, NF- ⁇ B and interferon regulatory factors (IRFs). Signaling by TLRs results in a variety of cellular responses, including the production of interferons (IFNs), pro-inflammatory cytokines and effector cytokines that direct the adaptive immune response. TLRs are implicated in a number of inflammatory and immune disorders and play a role in cancer (Rakoff-Nahoum S. & Medzhitov R., 2009. Toll-like receptors and cancer.
  • IFNs interferons
  • TLRs are type I transmembrane proteins characterized by an extracellular domain containing leucine-rich repeats (LRRs) and a cytoplasmic tail that contains a conserved region called the Toll/IL-1 receptor (TIR) domain.
  • LRRs leucine-rich repeats
  • TIR Toll/IL-1 receptor
  • TLR1 to TLR10 in humans and twelve murine TLRs have been characterized, TLR1 to TLR10 in humans, and TLR1 to TLR9, TLR11, TLR12 and TLR13 in mice, the homolog of TLR10 being a pseudogene.
  • TLR2 is essential for the recognition of a variety of PAMPs from Gram-positive bacteria, including bacterial lipoproteins, lipomannans and lipoteichoic acids.
  • TLR3 is implicated in virus-derived double-stranded RNA.
  • TLR4 is predominantly activated by lipopolysaccharide.
  • TLR5 detects bacterial flagellin and TLR9 is required for response to unmethylated CpG DNA.
  • TLR7 and TLR8 recognize small synthetic antiviral molecules, and single-stranded RNA was reported to be their natural ligand.
  • TLR11 has been reported to recognize uropathogenic E.coli and a profilin-like protein from Toxoplasma gondii. The repertoire of specificities of the TLRs is apparently extended by the ability of TLRs to heterodimerize with one another.
  • TLR2 and TLR6 are required for responses to diacylated lipoproteins while TLR2 and TLR1 interact to recognize triacylated lipoproteins.
  • Specificities of the TLRs are also influenced by various adapter and accessory molecules, such as MD-2 and CD14 that form a complex with TLR4 in response to LPS.
  • TLR signaling consists of at least two distinct pathways: a MyD88-dependent pathway that leads to the production of inflammatory cytokines, and a MyD88-independent pathway associated with the stimulation of IFN- ⁇ and the maturation of dendritic cells.
  • the MyD88- dependent pathway is common to all TLRs, except TLR3 (Adachi O. et al., 1998.
  • TLRs Upon activation by PAMPs or DAMPs, TLRs hetero- or homodimerize inducing the recruitment of adaptor proteins via the cytoplasmic TIR domain. Individual TLRs induce different signaling responses by usage of the different adaptor molecules. TLR4 and TLR2 signaling requires the adaptor TIRAP/Mal, which is involved in the MyD88-dependent pathway. TLR3 triggers the production of IFN- ⁇ in response to double-stranded RNA, in a MyD88- independent manner, through the adaptor TRIF/TICAM-1.
  • TRAM/TICAM-2 is another adaptor molecule involved in the MyD88-independent pathway which function is restricted to the TLR4 pathway.
  • TLR3, TLR7, TLR8 and TLR9 recognize viral nucleic acids and induce type I IFNs.
  • the signaling mechanisms leading to the induction of type I IFNs differ depending on the TLR activated. They involve the interferon regulatory factors, IRFs, a family of transcription factors known to play a critical role in antiviral defense, cell growth and immune regulation.
  • IRFs interferon regulatory factors
  • Three IRFs function as direct transducers of virus-mediated TLR signaling.
  • TLR3 and TLR4 activate IRF3 and IRF7
  • TLR7 and TLR8 activate IRF5 and IRF7 (Doyle S.
  • TLR9 TLR9 ligand CpG-A
  • PI(3)K and mTOR Costa-Mattioli M. & Sonenberg N.2008. RAPping production of type I interferon in pDCs through mTOR. Nature Immunol.9: 1097-1099.
  • TLR-9 TLR9 recognizes unmethylated CpG sequences in DNA molecules. CpG sites are relatively rare ( ⁇ 1%) on vertebrate genomes in comparison to bacterial genomes or viral DNA.
  • TLR9 is expressed by numerous cells of the immune system such as B lymphocytes, monocytes, natural killer (NK) cells, and plasmacytoid dendritic cells. TLR9 is expressed intracellularly, within the endosomal compartments and functions to alert the immune system of viral and bacterial infections by binding to DNA rich in CpG motifs. TLR9 signals leads to activation of the cells initiating pro-inflammatory reactions that result in the production of cytokines such as type-I interferon and IL-12.
  • TLR Agonists A TLR agonist can agonize one or more TLR, e.g., one or more of human TLR- 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, an adjunctive agent described herein is a TLR agonist.
  • the TLR agonist specifically agonizes human TLR-9.
  • the TLR-9 agonist is a CpG moiety.
  • a CpG moiety is a linear dinucleotide having the sequence: 5'—C—phosphate—G—3', that is, cytosine and guanine separated by only one phosphate.
  • the CpG moiety comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or more CpG dinucleotides.
  • the CpG moiety consists of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 CpG dinucleotides. In some embodiments, the CpG moiety has 1-5, 1-10, 1-20, 1-30, 1-40, 1-50, 5-10, 5-20, 5-30, 10- 20, 10-30, 10-40, or 10-50 CpG dinucleotides.
  • the TLR-9 agonist is a synthetic ODN (oligodeoxynucleotides). CpG ODNs are short synthetic single-stranded DNA molecules containing unmethylated CpG dinucleotides in particular sequence contexts (CpG motifs).
  • CpG ODNs possess a partially or completely phosphorothioated (PS) backbone, as opposed to the natural phosphodiester (PO) backbone found in genomic bacterial DNA.
  • PS phosphorothioated
  • PO phosphodiester
  • CpG ODNs possess a partially or completely phosphorothioated (PS) backbone, as opposed to the natural phosphodiester (PO) backbone found in genomic bacterial DNA.
  • CpG-A ODNs are characterized by a PO central CpG-containing palindromic motif and a PS-modified 3’ poly-G string. They induce high IFN- ⁇ production from pDCs but are weak stimulators of TLR9-dependent NF- ⁇ B signaling and pro-inflammatory cytokine (e.g. IL-6) production.
  • CpG-B ODNs contain a full PS backbone with one or more CpG dinucleotides. They strongly activate B cells and TLR9- dependent NF- ⁇ B signaling but weakly stimulate IFN- ⁇ secretion.
  • CpG-C ODNs combine features of both classes A and B. They contain a complete PS backbone and a CpG-containing palindromic motif.
  • C-Class CpG ODNs induce strong IFN- ⁇ production from pDC as well as B cell stimulation.
  • Tumor-Targeting Moieties The present disclosure provides, inter alia, multispecific (e.g., bi-, tri-, tetra- specific) molecules, that include, e.g., are engineered to contain, one or more tumor specific targeting moieties that direct the molecule to a tumor cell.
  • the multispecific molecules disclosed herein include a tumor- targeting moiety.
  • the tumor targeting moiety can be chosen from an antibody molecule (e.g., an antigen binding domain as described herein), a receptor or a receptor fragment, or a ligand or a ligand fragment, or a combination thereof.
  • the tumor targeting moiety associates with, e.g., binds to, a tumor cell (e.g., a molecule, e.g., antigen, present on the surface of the tumor cell).
  • a tumor cell e.g., a molecule, e.g., antigen, present on the surface of the tumor cell.
  • the tumor targeting moiety targets, e.g., directs the multispecific molecules disclosed herein to a cancer (e.g., a cancer or tumor cells).
  • the cancer is chosen from a hematological cancer, a solid cancer, a metastatic cancer, or a combination thereof.
  • the multispecific molecule, e.g., the tumor-targeting moiety binds to a solid tumor antigen or a stromal antigen.
  • the solid tumor antigen or stromal antigen can be present on a solid tumor, or a metastatic lesion thereof.
  • the solid tumor is chosen from one or more of pancreatic (e.g., pancreatic adenocarcinoma), breast, colorectal, lung (e.g., small or non-small cell lung cancer), skin, ovarian, or liver cancer.
  • the solid tumor is a fibrotic or desmoplastic solid tumor.
  • the solid tumor antigen or stromal antigen can be present on a tumor, e.g., a tumor of a class typified by having one or more of: limited tumor perfusion, compressed blood vessels, or fibrotic tumor interstitium.
  • the solid tumor antigen is chosen from one or more of: PDL1, CD47, gangloside 2 (GD2), prostate stem cell antigen (PSCA), prostate specific membrane antigen (PMSA), prostate-specific antigen (PSA), carcinoembryonic antigen (CEA), Ron Kinase, c-Met, Immature laminin receptor, TAG-72, BING-4, Calcium-activated chloride channel 2, Cyclin-B1, 9D7, Ep-CAM, EphA3, Her2/neu, Telomerase, SAP-1, Survivin, NY-ESO-1/LAGE-1, PRAME, SSX-2, Melan-A/MART-1, Gp100/pmel17, Tyrosinase, TRP-1/-2, MC1R, ⁇ -catenin, BRCA1/2, CDK4, CML66, Fibronectin, p53, Ras, TGF- ⁇ receptor, AFP, ETA, MAGE, MUC-1, CA-125, BAGE, GAGE, NY-ES
  • the multispecific molecule e.g., the tumor-targeting moiety
  • a hematological cancer e.g., a leukemia or a lymphoma.
  • the hematological cancer is a B-cell or T cell malignancy.
  • the hematological cancer is chosen from one or more of a Hodgkin’s lymphoma, Non-Hodgkin’s lymphoma (e.g., B cell lymphoma, diffuse large B cell lymphoma, follicular lymphoma, chronic lymphocytic leukemia, mantle cell lymphoma, marginal zone B- cell lymphoma, Burkitt lymphoma, lymphoplasmacytic lymphoma, hairy cell leukemia), acute myeloid leukemia (AML), chronic myeloid leukemia, myelodysplastic syndrome (MDS), multiple myeloma, or acute lymphocytic leukemia.
  • a Hodgkin’s lymphoma e.g., B cell lymphoma, diffuse large B cell lymphoma, follicular lymphoma, chronic lymphocytic leukemia, mantle cell lymphoma, marginal zone B- cell lymphoma, Burkitt lymphoma,
  • the cancer is other than acute myeloid leukemia (AML) or myelodysplastic syndrome (MDS).
  • the hematological antigen is chosen from CD47, CD99, CD30, CD38, SLAMF7, or NY-ESO1.
  • the hematological antigen is chosen from is chosen from one or more of: BCMA, CD19, CD20, CD22, CD33, CD123, FcRH5, CLEC12, or CD179A.
  • Stromal Modifying Moieties Solid tumors have a distinct structure that mimics that of normal tissues and comprises two distinct but interdependent compartments: the parenchyma (neoplastic cells) and the stroma that the neoplastic cells induce and in which they are dispersed.
  • stroma includes a variety of cell types, including fibroblasts/myofibroblasts, glial, epithelial, fat, vascular, smooth muscle, and immune cells along with extracellular matrix (ECM) and extracellular molecules (Li Hanchen et al.
  • ECM extracellular matrix
  • Stromal modifying moieties described herein include moieties (e.g., proteins, e.g., enzymes) capable of degrading a component of the stroma, e.g., an ECM component, e.g., a glycosaminoglycan, e.g., hyaluronan (also known as hyaluronic acid or HA), chondroitin sulfate, chondroitin, dermatan sulfate, heparin sulfate, heparin, entactin, tenascin, aggrecan and keratin sulfate; or an extracellular protein, e.g., collagen, laminin, elastin, fibrinogen, fibronectin, and vitronectin.
  • an extracellular protein e.g., collagen, laminin, elastin, fibrinogen, fibronectin, and vitronectin.
  • the stromal modifying moiety is an enzyme.
  • the stromal modifying moiety can include, but is not limited to a hyaluronidase, a collagenase, a chondroitinase, a matrix metalloproteinase (e.g., macrophage metalloelastase).
  • Hyaluronidases Hyaluronidases are a group of neutral- and acid-active enzymes found throughout the animal kingdom. Hyaluronidases vary with respect to substrate specificity, and mechanism of action.
  • hyaluronidases There are three general classes of hyaluronidases: (1) Mammalian-type hyaluronidases, (EC 3.2.1.35) which are endo-beta-N-acetylhexosaminidases with tetrasaccharides and hexasaccharides as the major end products. They have both hydrolytic and transglycosidase activities, and can degrade hyaluronan and chondroitin sulfates; (2) Bacterial hyaluronidases (EC 4.2.99.1) degrade hyaluronan and, and to various extents, chondroitin sulfate and dermatan sulfate.
  • Mammalian-type hyaluronidases (EC 3.2.1.35) which are endo-beta-N-acetylhexosaminidases with tetrasaccharides and hexa
  • Hyaluronidases (EC 3.2.1.36) from leeches, other parasites, and crustaceans are endo-beta-glucuronidases that generate tetrasaccharide and hexasaccharide end products through hydrolysis of the beta 1-3 linkage.
  • Mammalian hyaluronidases can be further divided into two groups: (1) neutral active and (2) acid active enzymes.
  • HYALP1 is a pseudogene
  • HYAL3 has not been shown to possess enzyme activity toward any known substrates.
  • HYAL4 is a chondroitinase and lacks activity towards hyaluronan.
  • HYAL1 is the prototypical acid-active enzyme and PH20 is the prototypical neutral-active enzyme.
  • Acid active hyaluronidases, such as HYAL1 and HYAL2 lack catalytic activity at neutral pH.
  • HYAL1 has no catalytic activity in vitro over pH 4.5 (Frost and Stern, "A Microtiter-Based Assay for Hyaluronidase Activity Not Requiring Specialized Reagents", Analytical Biochemistry, vol.251, pp.263-269 (1997).
  • HYAL2 is an acid active enzyme with a very low specific activity in vitro.
  • the hyaluronidase is a mammalian hyaluronidase.
  • the hyaluronidase is a recombinant human hyaluronidase.
  • the hyaluronidase is a neutral active hyaluronidase.
  • the hyaluronidase is a neutral active soluble hyaluronidase. In some embodiments, the hyaluronidase is a recombinant PH20 neutral-active enzyme. In some embodiments, the hyaluronidase is a recombinant PH20 neutral-active soluble enzyme. In some embodiments the hyaluronidase is glycosylated. In some embodiments, the hyaluronidase possesses at least one N-linked glycan.
  • a recombinant hyaluronidase can be produced using conventional methods known to those of skill in the art, e.g., US7767429, the entire contents of which are incorporated by reference herein.
  • the hyaluronidase is rHuPH20 (also referred to as Hylenex®; presently manufactured by Halozyme; approved by the FDA in 2005 (see e.g., Scodeller P (2014) Hyaluronidase and other Extracellular Matrix Degrading Enzymes for Cancer Therapy: New Uses and Nano- Formulations.
  • rHuPH20 is produced by genetically engineered CHO cells containing a DNA plasmid encoding for a soluble fragment of human hyaluronidase PH20.
  • the hyaluronidase is glycosylated.
  • the hyaluronidase possesses at least one N-linked glycan.
  • rHuPH20 has a sequence at least 95% (e.g., at least 96%, 97%, 98%, 99%, 100%) identical to the amino acid sequence of
  • the anti-hyaluronan agent can be an agent that degrades hyaluronan or can be an agent that inhibits the synthesis of hyaluronan.
  • the anti-hyaluronan agent can be a hyaluronan degrading enzyme.
  • the anti- hyaluronan agent or is an agent that inhibits hyaluronan synthesis.
  • the anti- hyaluronan agent is an agent that inhibits hyaluronan synthesis such as a sense or antisense nucleic acid molecule against an HA synthase or is a small molecule drug.
  • an anti- hyaluronan agent is 4- methylumbelliferone (MU) or a derivative thereof, or leflunomide or a derivative thereof.
  • MU 4-methylumbelliferone
  • MU 4-methylumbelliferone
  • leflunomide or a derivative thereof Such derivatives include, for example, a derivative of 4-methylumbelliferone (MU) that is 6,7-dihydroxy-4-methyl coumarin or 5,7-dihydroxy-4-methyl coumarin.
  • the hyaluronan degrading enzyme is a hyaluronidase.
  • the hyaluronan-degrading enzyme is a PH20 hyaluronidase or truncated form thereof to lacking a C-terminal glycosylphosphatidylinositol (GPI) attachment site or a portion of the GPI attachment site.
  • the hyaluronidase is a PH20 selected from a human, monkey, bovine, ovine, rat, mouse or guinea pig PH20.
  • the hyaluronan- degrading enzyme is a human PH20 hyaluronidase that is neutral active and N- glycosylated and is selected from among (a) a hyaluronidase polypeptide that is a full- length PH20 or is a C-terminal truncated form of the PH20, wherein the truncated form includes at least amino acid residues 36-464 of SEQ ID NO: 139, such as 36-481 , 36-482, 36-483, where the full-length PH20 has the sequence of amino acids set forth in SEQ ID NO: 139; or (b) a hyaluronidase polypeptide comprising a sequence of amino acids having at least 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98
  • the hyaluronan- degrading enzyme is a PH20 that comprises a composition designated rHuPH20.
  • the anti-hyaluronan agent is a hyaluronan degrading enzyme that is modified by conjugation to a polymer.
  • the polymer can be a PEG and the anti-hyaluronan agent a PEGylated hyaluronan degrading enzyme.
  • the hyaluronan-degrading enzyme is modified by conjugation to a polymer.
  • the hyaluronan-degrading enzyme is conjugated to a PEG, thus the hyaluronan degrading enzyme is PEGylated.
  • the hyaluronan-degrading enzyme is a PEGylated PH20 enzyme (PEGPH20).
  • the corticosteroid can be a glucocorticoid that is selected from among cortisones, dexamethasones, hydrocortisones, methylprednisolones, prednisolones and prednisones.
  • Chondroitinases are enzymes found throughout the animal kingdom which degrade glycosaminoglycans, specifically chondroitins and chondroitin sulfates, through an endoglycosidase reaction.
  • the chondroitinase is a mammalian chondroitinase.
  • the chondroitinase is a recombinant human chondroitinase.
  • the chondroitinase is HYAL4.
  • Other exemplary chondroitinases include chondroitinase ABC (derived from Proteus vulgaris; Japanese Patent Application Laid-open No 6-153947, T. Yamagata et al. J.
  • Matrix Metalloproteinases are zinc-dependent endopeptidases that are the major proteases involved in extracellular matrix (ECM) degradation. MMPs are capable of degrading a wide range of extracellular molecules and a number of bioactive molecules.
  • MMP genes Twenty-four MMP genes have been identified in humans, which can be organized into six groups based on domain organization and substrate preference: Collagenases (MMP-1, -8 and -13), Gelatinases (MMP-2 and MMP-9), Stromelysins (MMP-3, -10 and -11), Matrilysin (MMP-7 and MMP-26), Membrane-type (MT)-MMPs (MMP-14, -15, -16, -17, -24 and -25) and others (MMP-12, -19, - 20, -21, -23, -27 and -28).
  • MMP-1, -8 and -13 Collagenases
  • Gelatinases MMP-2 and MMP-9
  • Stromelysins MMP-3, -10 and -11
  • Matrilysin MMP-7 and MMP-26
  • MMP-7 and MMP-26 Membrane-type (MT)-MMPs (MMP-14, -15, -16, -17, -24 and -25) and
  • the stromal modifying moiety is a human recombinant MMP (e.g., MMP -1, -2, -3, -4, -5, -6, -7, -8, -9, 10, -11, -12, -13, -14, 15, -15, -17, -18, -19, 20, -21, -22, -23, or -24).
  • MMP human recombinant MMP
  • the three mammalian collagenases (MMP-1, -8, and -13) are the principal secreted endopeptidases capable of cleaving collagenous extracellular matrix. In addition to fibrillar collagens, collagenases can cleave several other matrix and non-matrix proteins including growth factors.
  • Collagenases are synthesized as inactive pro-forms, and once activated, their activity is inhibited by specific tissue inhibitors of metalloproteinases, TIMPs, as well as by non-specific proteinase inhibitors (Ala-aho R et al. Biochimie. Collagenases in cancer.2005 Mar- Apr;87(3-4):273-86).
  • the stromal modifying moiety is a collagenase.
  • the collagenase is a human recombinant collagenase.
  • the collagenase is MMP-1.
  • the collagenase is MMP-8.
  • the collagenase is MMP-13.
  • Macrophage metalloelastase also known as MMP-12, is a member of the stromelysin subgroup of MMPs and catalyzes the hydrolysis of soluble and insoluble elastin and a broad selection of matrix and nonmatrix substrates including type IV collagen, fibronectin, laminin, vitronectin, entactin, heparan, and chondroitin sulfates (Erja Kerkelä et al. Journal of Investigative Dermatology (2000) 114, 1113–1119; doi:10.1046/j.1523-1747.2000.00993).
  • the stromal modifying moiety is a MME.
  • the MME is a human recombinant MME. In some embodiments, the MME is MMP-12. Additional stromal modifying moieties In some embodiments, the stromal modifying moiety causes one or more of: decreases the level or production of a stromal or extracellular matrix (ECM) component; decreases tumor fibrosis; increases interstitial tumor transport; improves tumor perfusion; expands the tumor microvasculature; decreases interstitial fluid pressure (IFP) in a tumor; or decreases or enhances penetration or diffusion of an agent, e.g., a cancer therapeutic or a cellular therapy, into a tumor or tumor vasculature.
  • ECM stromal or extracellular matrix
  • IFP interstitial fluid pressure
  • the stromal or ECM component decreased is chosen from a glycosaminoglycan or an extracellular protein, or a combination thereof.
  • the glycosaminoglycan is chosen from hyaluronan (also known as hyaluronic acid or HA), chondroitin sulfate, chondroitin, dermatan sulfate, heparin, heparin sulfate, entactin, tenascin, aggrecan and keratin sulfate.
  • the extracellular protein is chosen from collagen, laminin, elastin, fibrinogen, fibronectin, or vitronectin.
  • the stromal modifying moiety includes an enzyme molecule that degrades a tumor stroma or extracellular matrix (ECM).
  • the enzyme molecule is chosen from a hyaluronidase molecule, a collagenase molecule, a chondroitinase molecule, a matrix metalloproteinase molecule (e.g., macrophage metalloelastase), or a variant (e.g., a fragment) of any of the aforesaid.
  • the term “enzyme molecule” includes a full length, a fragment or a variant of the enzyme, e.g., an enzyme variant that retains at least one functional property of the naturally-occurring enzyme.
  • the stromal modifying moiety decreases the level or production of hyaluronic acid.
  • the stromal modifying moiety comprises a hyaluronan degrading enzyme, an agent that inhibits hyaluronan synthesis, or an antibody molecule against hyaluronic acid.
  • the hyaluronan degrading enzyme is a hyaluronidase molecule, e.g., a full length or a variant (e.g., fragment thereof) thereof.
  • the hyaluronan degrading enzyme is active in neutral or acidic pH, e.g., pH of about 4-5.
  • the hyaluronidase molecule is a mammalian hyaluronidase molecule, e.g., a recombinant human hyaluronidase molecule, e.g., a full length or a variant (e.g., fragment thereof, e.g., a truncated form) thereof.
  • the hyaluronidase molecule is chosen from HYAL1, HYAL2, or PH-20/SPAM1, or a variant thereof (e.g., a truncated form thereof).
  • the truncated form lacks a C-terminal glycosylphosphatidylinositol (GPI) attachment site or a portion of the GPI attachment site.
  • the hyaluronidase molecule is glycosylated, e.g., comprises at least one N- linked glycan.
  • the hyaluronidase molecule comprises the amino acid sequence: LNFRAPPVIPNVPFLWAWNAPSEFCLGKFDEPLDMSLFSFIGSPRINATGQGVTIFYVDR (SEQ ID NO:3311), or a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3311.
  • the hyaluronidase molecule comprises: (i) the amino acid sequence of 36-464 of SEQ ID NO: 3311; (ii) the amino acid sequence of 36-481, 36-482, or 36-483 of PH20, wherein PH20 has the sequence of amino acids set forth in SEQ ID NO: 3311; or (iii) an amino acid sequence having at least 95% to 100 % sequence identity to the polypeptide or truncated form of sequence of amino acids set forth in SEQ ID NO: 3311; or (iv) an amino acid sequence having 30, 20, 10, 5 or fewer amino acid substitutions to the amino acid sequence set forth in SEQ ID NO: 3311.
  • the hyaluronidase molecule comprises an amino acid sequence at least 95% (e.g., at least 95%, 96%, 97%, 98%, 99%, 100%) identical to the amino acid sequence of SEQ ID NO: 3311.
  • the hyaluronidase molecule is encoded by a nucleotide sequence at least 95% (e.g., at least 96%, 97%, 98%, 99%, 100%) identical to the nucleotide sequence of SEQ ID NO: 3311.
  • the hyaluronidase molecule is PH20, e.g., rHuPH20.
  • the hyaluronidase molecule is HYAL1 and comprises the amino acid sequence: (SEQ ID NO: 3312), or a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3312.
  • the hyaluronan degrading enzyme e.g., the hyaluronidase molecule, further comprises a polymer, e.g., is conjugated to a polymer, e.g., PEG.
  • the hyaluronan-degrading enzyme is a PEGylated PH20 enzyme (PEGPH20).
  • the hyaluronan degrading enzyme e.g., the hyaluronidase molecule
  • further comprises an immunoglobulin chain constant region e.g., Fc region
  • the immunoglobulin constant region e.g., the Fc region
  • the immunoglobulin constant region is linked, e.g., covalently linked to, the hyaluronan degrading enzyme, e.g., the hyaluronidase molecule.
  • the immunoglobulin chain constant region (e.g., Fc region) is altered, e.g., mutated, to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function.
  • the hyaluronan degrading enzyme e.g., the hyaluronidase molecule forms a dimer.
  • the stromal modifying moiety comprises an inhibitor of the synthesis of hyaluronan, e.g., an HA synthase.
  • the inhibitor comprises a sense or an antisense nucleic acid molecule against an HA synthase or is a small molecule drug.
  • the inhibitor is 4- methylumbelliferone (MU) or a derivative thereof (e.g., 6,7-dihydroxy-4-methyl coumarin or 5,7-dihydroxy-4-methyl coumarin), or leflunomide or a derivative thereof.
  • the stromal modifying moiety comprises antibody molecule against hyaluronic acid.
  • the stromal modifying moiety comprises a collagenase molecule, e.g., a mammalian collagenase molecule, or a variant (e.g., fragment) thereof.
  • the collagenase molecule is collagenase molecule IV, e.g., comprising the amino acid sequence of: Q C (SEQ ID NO: 3313), or a fragment thereof, or an amino acid sequence substantially identical thereto (e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3313.
  • Q C SEQ ID NO: 3313
  • amino acid sequence substantially identical thereto e.g., 95% to 99.9% identical thereto, or having at least one amino acid alteration, but not more than five, ten or fifteen alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions) to the amino acid sequence of SEQ ID NO: 3313.
  • the multispecific or multifunctional molecule disclosed herein can further include a linker, e.g., a linker between one or more of: the antigen binding domain and the cytokine molecule, the antigen binding domain and the immune cell engager, the antigen binding domain and the stromal modifying moiety, the cytokine molecule and the immune cell engager, the cytokine molecule and the stromal modifying moiety, the immune cell engager and the stromal modifying moiety, the antigen binding domain and the immunoglobulin chain constant region, the cytokine molecule and the immunoglobulin chain constant region, the immune cell engager and the immunoglobulin chain constant region, or the stromal modifying moiety and the immunoglobulin chain constant region.
  • a linker e.g., a linker between one or more of: the antigen binding domain and the cytokine molecule, the antigen binding domain and the immune cell engager, the antigen binding domain and the stromal modifying moiety, the cyto
  • the linker is chosen from: a cleavable linker, a non-cleavable linker, a peptide linker, a flexible linker, a rigid linker, a helical linker, or a non-helical linker, or a combination thereof.
  • the multispecific molecule can include one, two, three or four linkers, e.g., a peptide linker.
  • the peptide linker includes Gly and Ser.
  • the peptide linker is selected from GGGGS (SEQ ID NO: 3307); GGGGSGGGGS (SEQ ID NO: 3308); GGGGSGGGGSGGGGS (SEQ ID NO: 3309); and DVPSGPGGGGGSGGGGS (SEQ ID NO: 3310).
  • the peptide linker is a A(EAAAK)nA (SEQ ID NO: 3437) family of linkers (e.g., as described in Protein Eng. (2001) 14 (8): 529-532). These are stiff helical linkers with n ranging from 2 – 5.
  • the peptide linker is selected from AEAAAKEAAAKAAA (SEQ ID NO: 3314); Nucleic Acids Nucleic acids encoding the aforementioned antibody molecules, e.g., anti-TCR ⁇ V antibody molecules, multispecific or multifunctional molecules are also disclosed.
  • the invention features nucleic acids comprising nucleotide sequences that encode heavy and light chain variable regions and CDRs or hypervariable loops of the antibody molecules, as described herein.
  • the invention features a first and second nucleic acid encoding heavy and light chain variable regions, respectively, of an antibody molecule chosen from one or more of the antibody molecules disclosed herein.
  • the nucleic acid can comprise a nucleotide sequence as set forth in the tables herein, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 3, 6, 15, 30, or 45 nucleotides from the sequences shown in the tables herein.
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, or three CDRs or hypervariable loops from a heavy chain variable region having an amino acid sequence as set forth in the tables herein, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one or more substitutions, e.g., conserved substitutions).
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, or three CDRs or hypervariable loops from a light chain variable region having an amino acid sequence as set forth in the tables herein, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one or more substitutions, e.g., conserved substitutions).
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, three, four, five, or six CDRs or hypervariable loops from heavy and light chain variable regions having an amino acid sequence as set forth in the tables herein, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one or more substitutions, e.g., conserved substitutions).
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, or three CDRs or hypervariable loops from a heavy chain variable region having the nucleotide sequence as set forth in the tables herein, a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, or three CDRs or hypervariable loops from a light chain variable region having the nucleotide sequence as set forth in the tables herein, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, three, four, five, or six CDRs or hypervariable loops from heavy and light chain variable regions having the nucleotide sequence as set forth in the tables herein, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or capable of hybridizing under the stringency conditions described herein).
  • the nucleic acid can comprise a nucleotide sequence encoding a cytokine molecule, an immune cell engager, or a stromal modifying moiety disclosed herein.
  • the application features host cells and vectors containing the nucleic acids described herein.
  • the nucleic acids may be present in a single vector or separate vectors present in the same host cell or separate host cell, as described in more detail hereinbelow.
  • Vectors Further provided herein are vectors comprising the nucleotide sequences encoding antibody molecules, e.g., anti-TCR ⁇ V antibody molecules, or a multispecific or multifunctional molecule described herein.
  • the vectors comprise nucleic acid sequences encoding antibody molecules, e.g., anti-TCR ⁇ V antibody molecules, or multispecific or multifunctional molecule described herein.
  • the vectors comprise the nucleotide sequences described herein.
  • the vectors include, but are not limited to, a virus, plasmid, cosmid, lambda phage or a yeast artificial chromosome (YAC).
  • YAC yeast artificial chromosome
  • Numerous vector systems can be employed.
  • one class of vectors utilizes DNA elements which are derived from animal viruses such as, for example, bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (Rous Sarcoma Virus, MMTV or MOMLV) or SV40 virus.
  • Another class of vectors utilizes RNA elements derived from RNA viruses such as Semliki Forest virus, Eastern Equine Encephalitis virus and Flaviviruses.
  • cells which have stably integrated the DNA into their chromosomes may be selected by introducing one or more markers which allow for the selection of transfected host cells.
  • the marker may provide, for example, prototropy to an auxotrophic host, biocide resistance (e.g., antibiotics), or resistance to heavy metals such as copper, or the like.
  • the selectable marker gene can be either directly linked to the DNA sequences to be expressed, or introduced into the same cell by cotransformation. Additional elements may also be needed for optimal synthesis of mRNA. These elements may include splice signals, as well as transcriptional promoters, enhancers, and termination signals.
  • the expression vectors may be transfected or introduced into an appropriate host cell.
  • Various techniques may be employed to achieve this, such as, for example, protoplast fusion, calcium phosphate precipitation, electroporation, retroviral transduction, viral transfection, gene gun, lipid based transfection or other conventional techniques.
  • protoplast fusion the cells are grown in media and screened for the appropriate activity. Methods and conditions for culturing the resulting transfected cells and for recovering the antibody molecule produced are known to those skilled in the art, and may be varied or optimized depending upon the specific expression vector and mammalian host cell employed, based upon the present description.
  • the application features host cells and vectors containing the nucleic acids described herein.
  • the nucleic acids may be present in a single vector or separate vectors present in the same host cell or separate host cell.
  • the host cell can be a eukaryotic cell, e.g., a mammalian cell, an insect cell, a yeast cell, or a prokaryotic cell, e.g., E. coli.
  • the mammalian cell can be a cultured cell or a cell line.
  • Exemplary mammalian cells include lymphocytic cell lines (e.g., NSO), Chinese hamster ovary cells (CHO), COS cells, oocyte cells, and cells from a transgenic animal, e.g., mammary epithelial cell.
  • the invention also provides host cells comprising a nucleic acid encoding an antibody molecule as described herein.
  • the host cells are genetically engineered to comprise nucleic acids encoding the antibody molecule.
  • the host cells are genetically engineered by using an expression cassette.
  • expression cassette refers to nucleotide sequences, which are capable of affecting expression of a gene in hosts compatible with such sequences.
  • Such cassettes may include a promoter, an open reading frame with or without introns, and a termination signal. Additional factors necessary or helpful in effecting expression may also be used, such as, for example, an inducible promoter.
  • the invention also provides host cells comprising the vectors described herein.
  • the cell can be, but is not limited to, a eukaryotic cell, a bacterial cell, an insect cell, or a human cell.
  • Suitable eukaryotic cells include, but are not limited to, Vero cells, HeLa cells, COS cells, CHO cells, HEK293 cells, BHK cells and MDCKII cells.
  • Suitable insect cells include, but are not limited to, Sf9 cells.
  • An immune cell includes an immune cell derived from a hematopoietic stem cell or an immune cell derived from a non-hematopoietic stem cell, e.g., by differentiation or de-differentiation.
  • An immune cell includes a hematopoietic stem cell, progeny thereof and/or cells that have differentiated from said HSC, e.g., lymphoid cells or myeloid cells.
  • An immune cell can be an adaptive immune cell or an innate immune cell.
  • an immune cell is a T cell.
  • a T cell includes a CD4+ T cell, a CD8+ T cell, a TCR alpha-beta T cell, a TCR gamma-delta T cell.
  • a T cell comprises a memory T cell (e.g., a central memory T cell, or an effector memory T cell (e.g., a TEMRA) or an effector T cell.
  • a T cell comprises a tumor infiltrating lymphocyte (TIL).
  • an immune cell is an NK cell.
  • an immune cell is a TIL.
  • TILs are immune cells (e.g., T cells, B cells or NK cells) that can be found in a tumor or around a tumor (e.g., in the stroma or tumor microenvironment of a tumor), e.g., a solid tumor, e.g., as described herein.
  • TILs can be obtained from a sample from a subject having cancer, e.g., a biopsy or a surgical sample.
  • TILs can be expanded using a method disclosed herein.
  • a population of expanded TILs e.g., expanded using a method disclosed herein, can be administered to a subject to treat a disease, e.g., a cancer.
  • immune cells e.g., T cells (e.g., TILs)
  • TILs can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as FicollTM separation.
  • cells from the circulating blood of an individual are obtained by apheresis.
  • the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
  • the cells collected by apheresis may be washed to remove the plasma fraction and, optionally, to place the cells in an appropriate buffer or media for subsequent processing steps.
  • the cells are washed with phosphate buffered saline (PBS).
  • the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations.
  • the methods described herein can include more than one selection step, e.g., more than one depletion step.
  • the methods of the application can utilize culture media conditions comprising DMEM, DMEM F12, RPMI 1640, and/or AIM V media.
  • the media can be supplemented with glutamine, HEPES buffer (e.g., 10mM), serum (e.g., heat-inactivated serum, e.g., 10%), and/or beta mercaptoethanol (e.g., 55uM).
  • the culture conditions disclosed herein comprise one or more supplements, cytokines, growth factors, or hormones.
  • the culture condition comprises one or more of IL-2, IL-15, , or IL-7, or a combination thereof.
  • Immune effector cells such as T cells may be activated and expanded generally using methods as described, for example, in U.S. Patents 6,352,694; 6,534,055; or 6,905,680.
  • a population of immune cells may be expanded by contact with an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a costimulatory molecule on the surface of the T cells; and/or by contact with a cytokine, e.g., IL-2, IL-15 or IL- 7.
  • a cytokine e.g., IL-2, IL-15 or IL- 7.
  • T cell expansion protocols can also include stimulation, such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore.
  • a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
  • an anti-CD3 antibody and an anti-CD28 antibody can be used.
  • an anti-CD28 antibody examples include 9.3, B-T3, XR-CD28 (Diaclone, Besançon, France) can be used as can other methods commonly known in the art (Berg et al., Transplant Proc.30(8):3975-3977, 1998; Haanen et al., J. Exp. Med.190(9):13191328, 1999; Garland et al., J. Immunol Meth.227(1-2):53-63, 1999).
  • a TIL population can also be expanded by methods known in the art. For example, a population of TILs can be expanded as described in Hall et al., Journal for ImmunoTherapy of Cancer (2016) 4:61, the entire contents of which are hereby incorporated by reference.

Landscapes

  • Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2020/067543 2020-01-03 2020-12-30 Anti-tcr antibody molecules and uses thereof Ceased WO2021138474A2 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
JP2022541232A JP2023509708A (ja) 2020-01-03 2020-12-30 抗tcr抗体分子およびその使用
AU2020416273A AU2020416273A1 (en) 2020-01-03 2020-12-30 Anti-TCR antibody molecules and uses thereof
GB2210131.5A GB2609554B (en) 2020-01-03 2020-12-30 Anti-TCR antibody molecules and uses thereof
CA3166629A CA3166629A1 (en) 2020-01-03 2020-12-30 Anti-tcr antibody molecules and uses thereof
EP20910571.7A EP4084823A4 (en) 2020-01-03 2020-12-30 ANTI-TCR ANTIBODY MOLECULES AND THEIR USES
CN202080098701.7A CN116234829A (zh) 2020-01-03 2020-12-30 抗tcr抗体分子及其用途
US17/855,332 US20230227552A1 (en) 2020-01-03 2022-06-30 Anti-tcr antibody molecules and uses thereof
US18/341,688 US12486326B2 (en) 2020-01-03 2023-06-26 Anti-TCR antibody molecules and uses thereof
US19/339,740 US20260022173A1 (en) 2020-01-03 2025-09-25 Anti-tcr antibody molecules and uses thereof
JP2025168426A JP2026027226A (ja) 2020-01-03 2025-10-06 抗tcr抗体分子およびその使用

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202062957024P 2020-01-03 2020-01-03
US62/957,024 2020-01-03
US202063070596P 2020-08-26 2020-08-26
US63/070,596 2020-08-26

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/855,332 Continuation US20230227552A1 (en) 2020-01-03 2022-06-30 Anti-tcr antibody molecules and uses thereof

Publications (2)

Publication Number Publication Date
WO2021138474A2 true WO2021138474A2 (en) 2021-07-08
WO2021138474A3 WO2021138474A3 (en) 2021-09-02

Family

ID=76687461

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/067543 Ceased WO2021138474A2 (en) 2020-01-03 2020-12-30 Anti-tcr antibody molecules and uses thereof

Country Status (8)

Country Link
US (3) US20230227552A1 (https=)
EP (1) EP4084823A4 (https=)
JP (2) JP2023509708A (https=)
CN (1) CN116234829A (https=)
AU (1) AU2020416273A1 (https=)
CA (1) CA3166629A1 (https=)
GB (1) GB2609554B (https=)
WO (1) WO2021138474A2 (https=)

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023081412A3 (en) * 2021-11-05 2023-08-03 Marengo Therapeutics, Inc. Immune cell populations and uses thereof
WO2023122206A3 (en) * 2021-12-22 2023-08-31 Marengo Therapeutics, Inc. Multifuntional molecules binding to tcr and uses thereof
US11965025B2 (en) 2018-07-03 2024-04-23 Marengo Therapeutics, Inc. Method of treating solid cancers with bispecific interleukin-anti-TCRß molecules
WO2024197082A3 (en) * 2023-03-21 2024-11-07 Marengo Therapeutics, Inc. Tcr targeting molecules and uses thereof
US12152073B2 (en) 2018-03-14 2024-11-26 Marengo Therapeutics, Inc. Multifunctional molecules that bind to calreticulin and uses thereof
WO2024226532A3 (en) * 2023-04-24 2025-01-16 Marengo Therapeutics, Inc. Multifunctional molecules binding to tcr and uses thereof
US12247060B2 (en) 2018-01-09 2025-03-11 Marengo Therapeutics, Inc. Calreticulin binding constructs and engineered T cells for the treatment of diseases
WO2025051339A1 (en) * 2023-09-05 2025-03-13 Tiber Biotech Srl SINGLE-CHAIN VARIABLE FRAGMENT AND MOLECULES DERIVING THEREFROM THAT BIND FRAGMENT TRVB5-1 OF THE β CHAIN OF HUMAN T-CELL RECEPTOR
US12358982B2 (en) 2019-02-21 2025-07-15 Marengo Therapeutics, Inc. Multifunctional molecules that bind to T cell related cancer cells and uses thereof
US12384842B2 (en) 2019-02-21 2025-08-12 Marengo Therapeutics, Inc. Antibody molecules that bind to NKP30 and uses thereof
US12486326B2 (en) 2020-01-03 2025-12-02 Marengo Therapeutics, Inc. Anti-TCR antibody molecules and uses thereof

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP7590430B2 (ja) * 2019-11-14 2024-11-26 マレンゴ・セラピューティクス,インコーポレーテッド 抗tcr抗体分子およびその使用
CA3214757A1 (en) * 2021-04-08 2022-10-13 Andreas Loew Multifuntional molecules binding to tcr and uses thereof
AU2024240821A1 (en) 2023-03-23 2025-11-06 Bodhi Bio Llc Compositions and methods for antigen-specific therapy

Family Cites Families (667)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US861745A (en) 1906-11-21 1907-07-30 Jefferson D Maxwell Hydraulic dredging apparatus.
US4475196A (en) 1981-03-06 1984-10-02 Zor Clair G Instrument for locating faults in aircraft passenger reading light and attendant call control system
US4447233A (en) 1981-04-10 1984-05-08 Parker-Hannifin Corporation Medication infusion pump
US4433059A (en) 1981-09-08 1984-02-21 Ortho Diagnostic Systems Inc. Double antibody conjugate
US4444878A (en) 1981-12-21 1984-04-24 Boston Biomedical Research Institute, Inc. Bispecific antibody determinants
US4439196A (en) 1982-03-18 1984-03-27 Merck & Co., Inc. Osmotic drug delivery system
US4522811A (en) 1982-07-08 1985-06-11 Syntex (U.S.A.) Inc. Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides
US4447224A (en) 1982-09-20 1984-05-08 Infusaid Corporation Variable flow implantable infusion apparatus
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4486194A (en) 1983-06-08 1984-12-04 James Ferrara Therapeutic device for administering medicaments through the skin
WO1985000817A1 (en) 1983-08-10 1985-02-28 Amgen Microbial expression of interleukin ii
JPS6147500A (ja) 1984-08-15 1986-03-07 Res Dev Corp Of Japan キメラモノクロ−ナル抗体及びその製造法
EP0173494A3 (en) 1984-08-27 1987-11-25 The Board Of Trustees Of The Leland Stanford Junior University Chimeric receptors by dna splicing and expression
GB8422238D0 (en) 1984-09-03 1984-10-10 Neuberger M S Chimeric proteins
JPS61134325A (ja) 1984-12-04 1986-06-21 Teijin Ltd ハイブリツド抗体遺伝子の発現方法
US4596556A (en) 1985-03-25 1986-06-24 Bioject, Inc. Hypodermic injection apparatus
US4737456A (en) 1985-05-09 1988-04-12 Syntex (U.S.A.) Inc. Reducing interference in ligand-receptor binding assays
US5374548A (en) 1986-05-02 1994-12-20 Genentech, Inc. Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor
MX9203291A (es) 1985-06-26 1992-08-01 Liposome Co Inc Metodo para acoplamiento de liposomas.
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
JPS63501765A (ja) 1985-11-01 1988-07-21 インタ−ナショナル、ジェネティック、エンジニアリング インコ−ポレ−テッド 抗体遺伝子のモジュ−ル組立体、それにより産生された抗体及び用途
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US6548640B1 (en) 1986-03-27 2003-04-15 Btg International Limited Altered antibodies
GB8607679D0 (en) 1986-03-27 1986-04-30 Winter G P Recombinant dna product
US5869620A (en) 1986-09-02 1999-02-09 Enzon, Inc. Multivalent antigen-binding proteins
IL85035A0 (en) 1987-01-08 1988-06-30 Int Genetic Eng Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same
WO1988007089A1 (en) 1987-03-18 1988-09-22 Medical Research Council Altered antibodies
US4941880A (en) 1987-06-19 1990-07-17 Bioject, Inc. Pre-filled ampule and non-invasive hypodermic injection device assembly
US4790824A (en) 1987-06-19 1988-12-13 Bioject, Inc. Non-invasive hypodermic injection device
US5770701A (en) 1987-10-30 1998-06-23 American Cyanamid Company Process for preparing targeted forms of methyltrithio antitumor agents
US5606040A (en) 1987-10-30 1997-02-25 American Cyanamid Company Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methyl-trithio group
US5057423A (en) 1987-12-18 1991-10-15 University Of Pittsburgh Method for the preparation of pure LAK-active lymphocytes
US5731116A (en) 1989-05-17 1998-03-24 Dai Nippon Printing Co., Ltd. Electrostatic information recording medium and electrostatic information recording and reproducing method
JPH021556A (ja) 1988-06-09 1990-01-05 Snow Brand Milk Prod Co Ltd ハイブリッド抗体及びその作製方法
EP0436597B1 (en) 1988-09-02 1997-04-02 Protein Engineering Corporation Generation and selection of recombinant varied binding proteins
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
EP0368684B2 (en) 1988-11-11 2004-09-29 Medical Research Council Cloning immunoglobulin variable domain sequences.
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US5223426A (en) 1988-12-15 1993-06-29 T Cell Sciences, Inc. Monoclonal antibodies reactive with defined regions of the t-cell antigen receptor
US5766947A (en) 1988-12-14 1998-06-16 Astra Ab Monoclonal antibodies reactive with an epitope of a Vβ3.1 variable region of a T cell receptor
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5116615A (en) 1989-01-27 1992-05-26 Immunolytics, Inc. Method for treating benign prostatic hypertrophy
GB8905669D0 (en) 1989-03-13 1989-04-26 Celltech Ltd Modified antibodies
US5108921A (en) 1989-04-03 1992-04-28 Purdue Research Foundation Method for enhanced transmembrane transport of exogenous molecules
US6291158B1 (en) 1989-05-16 2001-09-18 Scripps Research Institute Method for tapping the immunological repertoire
CA2018248A1 (en) 1989-06-07 1990-12-07 Clyde W. Shearman Monoclonal antibodies against the human alpha/beta t-cell receptor, their production and use
DE3920358A1 (de) 1989-06-22 1991-01-17 Behringwerke Ag Bispezifische und oligospezifische, mono- und oligovalente antikoerperkonstrukte, ihre herstellung und verwendung
WO1991000906A1 (en) 1989-07-12 1991-01-24 Genetics Institute, Inc. Chimeric and transgenic animals capable of producing human antibodies
US5776459A (en) 1989-07-19 1998-07-07 Connetics Corporation TCR V beta 5 peptides
AU6290090A (en) 1989-08-29 1991-04-08 University Of Southampton Bi-or trispecific (fab)3 or (fab)4 conjugates
CA2026147C (en) 1989-10-25 2006-02-07 Ravi J. Chari Cytotoxic agents comprising maytansinoids and their therapeutic use
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US5064413A (en) 1989-11-09 1991-11-12 Bioject, Inc. Needleless hypodermic injection device
US5312335A (en) 1989-11-09 1994-05-17 Bioject Inc. Needleless hypodermic injection device
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
EP1690934A3 (en) 1990-01-12 2008-07-30 Abgenix, Inc. Generation of xenogeneic antibodies
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5273743A (en) 1990-03-09 1993-12-28 Hybritech Incorporated Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent
US5427908A (en) 1990-05-01 1995-06-27 Affymax Technologies N.V. Recombinant library screening methods
GB9012995D0 (en) 1990-06-11 1990-08-01 Celltech Ltd Multivalent antigen-binding proteins
GB9015198D0 (en) 1990-07-10 1990-08-29 Brien Caroline J O Binding substance
EP0585287B1 (en) 1990-07-10 1999-10-13 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
ATE352612T1 (de) 1990-08-29 2007-02-15 Pharming Intellectual Pty Bv Homologe rekombination in säugetier-zellen
ATE300615T1 (de) 1990-08-29 2005-08-15 Genpharm Int Transgene mäuse fähig zur produktion heterologer antikörper
GB9022788D0 (en) 1990-10-19 1990-12-05 Cortecs Ltd Pharmaceutical formulations
CA2405246A1 (en) 1990-12-03 1992-06-11 Genentech, Inc. Enrichment method for variant proteins with alterred binding properties
US5582996A (en) 1990-12-04 1996-12-10 The Wistar Institute Of Anatomy & Biology Bifunctional antibodies and method of preparing same
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
EP0575485A1 (en) 1991-03-01 1993-12-29 Dyax Corp. Process for the development of binding mini-proteins
DK0580737T3 (da) 1991-04-10 2004-11-01 Scripps Research Inst Heterodimere receptorbiblioteker ved anvendelse af phagemider
EP0519596B1 (en) 1991-05-17 2005-02-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
DE4118120A1 (de) 1991-06-03 1992-12-10 Behringwerke Ag Tetravalente bispezifische rezeptoren, ihre herstellung und verwendung
US6511663B1 (en) 1991-06-11 2003-01-28 Celltech R&D Limited Tri- and tetra-valent monospecific antigen-binding proteins
EP1400536A1 (en) 1991-06-14 2004-03-24 Genentech Inc. Method for making humanized antibodies
US5637481A (en) 1993-02-01 1997-06-10 Bristol-Myers Squibb Company Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell
DE4122599C2 (de) 1991-07-08 1993-11-11 Deutsches Krebsforsch Phagemid zum Screenen von Antikörpern
GB9114948D0 (en) 1991-07-11 1991-08-28 Pfizer Ltd Process for preparing sertraline intermediates
US5747036A (en) 1991-08-28 1998-05-05 Brigham & Women's Hospital Methods and compositions for detecting and treating a subset of human patients having an autoimmune disease
WO1993006217A1 (en) 1991-09-19 1993-04-01 Genentech, Inc. EXPRESSION IN E. COLI OF ANTIBODY FRAGMENTS HAVING AT LEAST A CYSTEINE PRESENT AS A FREE THIOL, USE FOR THE PRODUCTION OF BIFUNCTIONAL F(ab')2 ANTIBODIES
FI941572L (fi) 1991-10-07 1994-05-27 Oncologix Inc Anti-erbB-2-monoklonaalisten vasta-aineiden yhdistelmä ja käyttömenetelmä
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
DE69232137T2 (de) 1991-11-25 2002-05-29 Enzon Inc Multivalente antigen-bindende proteine
US5932448A (en) 1991-11-29 1999-08-03 Protein Design Labs., Inc. Bispecific antibody heterodimers
DE69233408T2 (de) 1991-12-02 2005-09-22 Cambridge Antibody Technology Ltd., Melbourn Herstellung von Antikörpern auf Phagenoberflächen ausgehend von Antikörpersegmentbibliotheken.
ES2341666T3 (es) 1991-12-02 2010-06-24 Medimmune Limited Produccion de autoanticuerpos de repertorios de segmentos de anticue rpos expresados en la superficie de fagos.
GB9125768D0 (en) 1991-12-04 1992-02-05 Hale Geoffrey Therapeutic method
HU215180B (hu) 1992-01-23 1998-10-28 Merck Patent Gmbh. Eljárás monomer és dimer antitest-fragment fúziós fehérjék előállítására
AU675929B2 (en) 1992-02-06 1997-02-27 Curis, Inc. Biosynthetic binding protein for cancer marker
AU675223B2 (en) 1992-05-08 1997-01-30 Creative Biomolecules, Inc. Chimeric multivalent protein analogues and methods of use thereof
US5383851A (en) 1992-07-24 1995-01-24 Bioject Inc. Needleless hypodermic injection device
US6765087B1 (en) 1992-08-21 2004-07-20 Vrije Universiteit Brussel Immunoglobulins devoid of light chains
US6005079A (en) 1992-08-21 1999-12-21 Vrije Universiteit Brussels Immunoglobulins devoid of light chains
AU701578B2 (en) 1992-08-21 1999-02-04 Vrije Universiteit Brussel Immunoglobulins devoid of light chains
EP0669987B1 (en) 1992-09-25 2008-08-13 Aventis Pharma S.A. Adenovirus vectors for the transfer of foreign genes into cells of the central nervous system, particularly in brain
SG41929A1 (en) 1992-09-25 1997-08-15 Commw Scient Ind Res Org Target binding polypeptide
GB9221657D0 (en) 1992-10-15 1992-11-25 Scotgen Ltd Recombinant bispecific antibodies
US5837821A (en) 1992-11-04 1998-11-17 City Of Hope Antibody construct
MD1367C2 (ro) 1992-11-13 2000-11-30 Idec Pharmaceuticals Corporation Metode de tratament al limfomului celulelor B, anticorpi anti-CD20, hibridom.
GB9323648D0 (en) 1992-11-23 1994-01-05 Zeneca Ltd Proteins
US5635483A (en) 1992-12-03 1997-06-03 Arizona Board Of Regents Acting On Behalf Of Arizona State University Tumor inhibiting tetrapeptide bearing modified phenethyl amides
ATE199392T1 (de) 1992-12-04 2001-03-15 Medical Res Council Multivalente und multispezifische bindungsproteine, deren herstellung und verwendung
US5780588A (en) 1993-01-26 1998-07-14 Arizona Board Of Regents Elucidation and synthesis of selected pentapeptides
WO1994025591A1 (en) 1993-04-29 1994-11-10 Unilever N.V. PRODUCTION OF ANTIBODIES OR (FUNCTIONALIZED) FRAGMENTS THEREOF DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF $i(CAMELIDAE)
JPH0787994A (ja) 1993-04-30 1995-04-04 Sumitomo Electric Ind Ltd T細胞抗原受容体Vβ22に対するモノクローナル抗体及びその製造方法
AU691811B2 (en) 1993-06-16 1998-05-28 Celltech Therapeutics Limited Antibodies
US6476198B1 (en) 1993-07-13 2002-11-05 The Scripps Research Institute Multispecific and multivalent antigen-binding polypeptide molecules
DE69420024T2 (de) 1993-08-10 2000-02-24 W.L. Gore & Associates, Inc. Zelleinkapselungsvorrichtung
US5635602A (en) 1993-08-13 1997-06-03 The Regents Of The University Of California Design and synthesis of bispecific DNA-antibody conjugates
WO1995009917A1 (en) 1993-10-07 1995-04-13 The Regents Of The University Of California Genetically engineered bispecific tetravalent antibodies
GB9325182D0 (en) 1993-12-08 1994-02-09 T Cell Sciences Inc Humanized antibodies or binding proteins thereof specific for t cell subpopulations exhibiting select beta chain variable regions
SE9400088D0 (sv) 1994-01-14 1994-01-14 Kabi Pharmacia Ab Bacterial receptor structures
US5773001A (en) 1994-06-03 1998-06-30 American Cyanamid Company Conjugates of methyltrithio antitumor agents and intermediates for their synthesis
US5968753A (en) 1994-06-14 1999-10-19 Nexell Therapeutics, Inc. Positive and positive/negative cell selection mediated by peptide release
JP3659261B2 (ja) 1994-10-20 2005-06-15 モルフォシス・アクチェンゲゼルシャフト 組換体タンパク質の多機能性複合体への標的化ヘテロ結合
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
FR2727867B1 (fr) 1994-12-13 1997-01-31 Rhone Poulenc Rorer Sa Transfert de genes dans les motoneurones medullaires au moyen de vecteurs adenoviraux
AU712441B2 (en) 1994-12-14 1999-11-04 Scripps Research Institute, The In vivo activation of tumor-specific cytotoxic T cells
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
CA2222055A1 (en) 1995-05-23 1996-11-28 Morphosys Gesellschaft Fur Proteinoptimierung Mbh Multimeric proteins
US5712374A (en) 1995-06-07 1998-01-27 American Cyanamid Company Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates
US5626561A (en) 1995-06-07 1997-05-06 Gore Hybrid Technologies, Inc. Implantable containment apparatus for a therapeutical device and method for loading and reloading the device therein
WO1996039993A1 (en) 1995-06-07 1996-12-19 Gore Hybrid Technologies, Inc. An implantable containment apparatus for a therapeutical device and method for loading and reloading the device therein
US5714586A (en) 1995-06-07 1998-02-03 American Cyanamid Company Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates
US5811097A (en) 1995-07-25 1998-09-22 The Regents Of The University Of California Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling
US6267958B1 (en) 1995-07-27 2001-07-31 Genentech, Inc. Protein formulation
AU6854696A (en) 1995-09-22 1997-04-09 Gore Hybrid Technologies, Inc. Improved cell encapsulation device
US5989830A (en) 1995-10-16 1999-11-23 Unilever Patent Holdings Bv Bifunctional or bivalent antibody fragment analogue
GB9603256D0 (en) 1996-02-16 1996-04-17 Wellcome Found Antibodies
US5849589A (en) 1996-03-11 1998-12-15 Duke University Culturing monocytes with IL-4, TNF-α and GM-CSF TO induce differentiation to dendric cells
ES2225961T3 (es) 1996-04-04 2005-03-16 Unilever N.V. Proteina de union a antigeno multivalente y multiespecifica.
WO1998014206A1 (en) 1996-10-04 1998-04-09 Thomas Jefferson University T cells mediating an immune response and methods of use
EP0981548A4 (en) 1997-04-30 2005-11-23 Enzon Inc GLYCOSYLATABLE SINGLE CHAIN ANTIGEN-BINDING PROTEINS, MANUFACTURE AND USE THEREOF
US20030207346A1 (en) 1997-05-02 2003-11-06 William R. Arathoon Method for making multispecific antibodies having heteromultimeric and common components
US20020062010A1 (en) 1997-05-02 2002-05-23 Genentech, Inc. Method for making multispecific antibodies having heteromultimeric and common components
AU736707B2 (en) 1997-06-11 2001-08-02 Anaphore, Inc. Trimerising module
EP1958962A3 (en) 1997-06-12 2013-05-01 Novartis International Pharmaceutical Ltd. Artificial antibody polypeptides
US6171586B1 (en) 1997-06-13 2001-01-09 Genentech, Inc. Antibody formulation
ATE296315T1 (de) 1997-06-24 2005-06-15 Genentech Inc Galactosylierte glykoproteine enthaltende zusammensetzungen und verfahren zur deren herstellung
DE69837706T2 (de) 1997-07-21 2008-01-10 Active Biotech Ab Zytolyse der geeigneten zielzellen mit superantigen konjugate mittels der induktion von t-zell aktivierung
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
DE19742706B4 (de) 1997-09-26 2013-07-25 Pieris Proteolab Ag Lipocalinmuteine
GB9722131D0 (en) 1997-10-20 1997-12-17 Medical Res Council Method
BR9813276A (pt) 1997-10-27 2000-08-22 Unilever Nv Proteìna multivalente de ligação de antìgeno, sequências de nucleotìdeos, vetor de expressão, célula hospedeira, processo para preparação de proteìna multivalente de ligação de antìgeno, e, uso da mesma
WO1999022764A1 (en) 1997-10-31 1999-05-14 Genentech, Inc. Methods and compositions comprising glycoprotein glycoforms
US6610833B1 (en) 1997-11-24 2003-08-26 The Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
ES2375931T3 (es) 1997-12-05 2012-03-07 The Scripps Research Institute Humanización de anticuerpo murino.
ES2234241T3 (es) 1998-01-23 2005-06-16 Vlaams Interuniversitair Instituut Voor Biotechnologie Derivados de anticuerpo de multiples fines.
AUPP221098A0 (en) 1998-03-06 1998-04-02 Diatech Pty Ltd V-like domain binding molecules
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
ES2292236T3 (es) 1998-04-02 2008-03-01 Genentech, Inc. Variantes de anticuerpos y sus fragmentos.
HUP9900956A2 (hu) 1998-04-09 2002-04-29 Aventis Pharma Deutschland Gmbh. Egyláncú, több antigéntkötőhely kialakítására képes molekulák, előállításuk és alkalmazásuk
ES2434961T5 (es) 1998-04-20 2018-01-18 Roche Glycart Ag Ingeniería de glicosilación de anticuerpos para mejorar la citotoxicidad celular dependiente del anticuerpo
DE19819846B4 (de) 1998-05-05 2016-11-24 Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts Multivalente Antikörper-Konstrukte
GB9812545D0 (en) 1998-06-10 1998-08-05 Celltech Therapeutics Ltd Biological products
EP1100830B1 (en) 1998-07-28 2003-10-01 Micromet AG Heterominibodies
AU5245399A (en) 1998-07-29 2000-02-21 Heska Corporation T cell receptor proteins, nucleic acid molecules, and uses thereof
US6333396B1 (en) 1998-10-20 2001-12-25 Enzon, Inc. Method for targeted delivery of nucleic acids
US6818418B1 (en) 1998-12-10 2004-11-16 Compound Therapeutics, Inc. Protein scaffolds for antibody mimics and other binding proteins
DE69941267D1 (de) 1998-12-10 2009-09-24 Bristol Myers Squibb Co Proteingerüste für antikörper-nachahmer und andere bindende proteine
HU230769B1 (hu) 1999-01-15 2018-03-28 Genentech Inc. Módosított effektor-funkciójú polipeptid-változatok
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US20030095967A1 (en) 1999-01-25 2003-05-22 Mackay Fabienne BAFF, inhibitors thereof and their use in the modulation of B-cell response and treatment of autoimmune disorders
WO2000060070A1 (en) 1999-04-01 2000-10-12 Innogenetics N.V. A polypeptide structure for use as a scaffold
EP1176195B1 (en) 1999-04-09 2013-05-22 Kyowa Hakko Kirin Co., Ltd. Method for controlling the activity of immunologically functional molecule
US7527787B2 (en) 2005-10-19 2009-05-05 Ibc Pharmaceuticals, Inc. Multivalent immunoglobulin-based bioactive assemblies
US7534866B2 (en) 2005-10-19 2009-05-19 Ibc Pharmaceuticals, Inc. Methods and compositions for generating bioactive assemblies of increased complexity and uses
DE19932688B4 (de) 1999-07-13 2009-10-08 Scil Proteins Gmbh Design von Beta-Faltblatt-Proteinen des gamma-II-kristallins antikörperähnlichen
UA75049C2 (uk) 1999-08-17 2006-03-15 Байоджен Айдек Ма Інк. Фармацевтична композиція, що містить поліпептид, який являє собою білковий фактор дозрівання в-клітин (всма), що зв'язується з фактором активації в-клітин (baff), спосіб інгібування росту в-клітин, спосіб лікування аутоімунного захворювання, спосіб лікування гіпертонії, спосіб інгібування запалення та спосіб модулювання імунної відповіді у ссавця за допомогою всма
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
CN100427603C (zh) 1999-10-04 2008-10-22 麦迪卡格公司 调控外源基因转录的方法
UA74798C2 (uk) 1999-10-06 2006-02-15 Байоджен Айдек Ма Інк. Спосіб лікування раку у ссавця за допомогою поліпептиду, що протидіє взаємодії april з його рецепторами
CA2388245C (en) 1999-10-19 2012-01-10 Kyowa Kirin Co., Ltd. The use of serum-free adapted rat cells for producing heterologous polypeptides
US6979546B2 (en) 1999-11-15 2005-12-27 Universita Di Genova Triggering receptor involved in natural cytotoxicity mediated by human natural killer cells and antibodies that identify the same
ATE423848T1 (de) 1999-11-15 2009-03-15 Innate Pharma Auslösender rezeptor der an der natürlichen cytotoxizität der menschlichen natürlichen killerzellen (natural killer cells) beteiligt ist und antikörper die diesen rezeptor identifizieren
US7105149B1 (en) 1999-11-29 2006-09-12 The Trustees Of Columbia University In The City Of New York Isolation of five novel genes coding for new Fc receptors-type melanoma involved in the pathogenesis of lymphoma/myeloma
AU784983B2 (en) 1999-12-15 2006-08-17 Genentech Inc. Shotgun scanning, a combinatorial method for mapping functional protein epitopes
ATE344801T1 (de) 1999-12-29 2006-11-15 Immunogen Inc Doxorubicin- und daunorubicin-enthaltende, zytotoxische mittel und deren therapeutische anwendung
AU2001227966A1 (en) 2000-01-20 2001-07-31 Chiron Corporation Methods for treating tumors
US20040002068A1 (en) 2000-03-01 2004-01-01 Corixa Corporation Compositions and methods for the detection, diagnosis and therapy of hematological malignancies
CN101289511A (zh) 2000-04-11 2008-10-22 杰南技术公司 多价抗体及其应用
EP1299419A2 (en) 2000-05-24 2003-04-09 Imclone Systems, Inc. Bispecific immunoglobulin-like antigen binding proteins and method of production
DK2336187T3 (en) 2000-06-19 2016-08-22 Beth Israel Deaconess Medical Ct Inc Compositions and Methods of monoclonal and polyclonal antibodies which are specific for T-cell subpopulations
CA2410551A1 (en) 2000-06-30 2002-01-10 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw (Vib) Heterodimeric fusion proteins
IL137419A0 (en) 2000-07-20 2001-07-24 Yissum Res Dev Co Nk cells activating receptors and their therapeutic and diagnostic uses
JP2004523205A (ja) 2000-07-25 2004-08-05 イムノメディクス, インコーポレイテッド 多価標的結合タンパク質
US7064191B2 (en) 2000-10-06 2006-06-20 Kyowa Hakko Kogyo Co., Ltd. Process for purifying antibody
US6946292B2 (en) 2000-10-06 2005-09-20 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions with increased antibody dependent cytotoxic activity
ES2639222T5 (es) 2000-10-06 2023-11-24 Kyowa Kirin Co Ltd Células que producen unas composiciones de anticuerpo
EP2351838A1 (en) 2000-10-20 2011-08-03 Chugai Seiyaku Kabushiki Kaisha Crosslinking agonistic antibodies
US6596541B2 (en) 2000-10-31 2003-07-22 Regeneron Pharmaceuticals, Inc. Methods of modifying eukaryotic cells
CN1487996B (zh) 2000-11-30 2010-06-16 米德列斯公司 用于生产人类抗体的转基因转染色体啮齿动物
US7829084B2 (en) 2001-01-17 2010-11-09 Trubion Pharmaceuticals, Inc. Binding constructs and methods for use thereof
ES2365602T3 (es) 2001-03-05 2011-10-07 Yissum Research Development Company Of The Hebrew University Of Jerusalem Proteínas oligoméricas tipo chaperona, estables a desnaturalizantes y/o resistentes a proteasa, polinucleótidos que codifican las mismas y sus usos.
WO2002072635A2 (en) 2001-03-13 2002-09-19 University College London Specific binding members
US20050048512A1 (en) 2001-04-26 2005-03-03 Avidia Research Institute Combinatorial libraries of monomer domains
US20040175756A1 (en) 2001-04-26 2004-09-09 Avidia Research Institute Methods for using combinatorial libraries of monomer domains
US20050053973A1 (en) 2001-04-26 2005-03-10 Avidia Research Institute Novel proteins with targeted binding
ES2437875T3 (es) 2001-04-30 2014-01-14 Eli Lilly And Company Anticuerpos humanizados que reconocen el péptido beta-amiloide
DK1399484T3 (da) 2001-06-28 2010-11-08 Domantis Ltd Dobbelt-specifik ligand og anvendelse af denne
US6833441B2 (en) 2001-08-01 2004-12-21 Abmaxis, Inc. Compositions and methods for generating chimeric heteromultimers
EP2180044A1 (en) 2001-08-03 2010-04-28 GlycArt Biotechnology AG Antibody glycosylation variants having increased anti-body-dependent cellular cytotoxicity
CA2763913C (en) 2001-08-10 2014-10-28 Aberdeen University Antigen binding domains
DE60124912T2 (de) 2001-09-14 2007-06-14 Affimed Therapeutics Ag Multimerische, einzelkettige, Tandem-Fv-Antikörper
US7084257B2 (en) 2001-10-05 2006-08-01 Amgen Inc. Fully human antibody Fab fragments with human interferon-gamma neutralizing activity
HUP0600342A3 (en) 2001-10-25 2011-03-28 Genentech Inc Glycoprotein compositions
PT1454138E (pt) 2001-12-04 2012-03-28 Merck Patent Gmbh Imunocitoquinas com seletividade modulada
US20030211078A1 (en) 2001-12-07 2003-11-13 Heavner George A. Pseudo-antibody constructs
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
JP4820055B2 (ja) 2001-12-27 2011-11-24 グライコフィ, インコーポレイテッド 哺乳動物型糖質構造を操作するための方法
AU2003209272A1 (en) 2002-01-16 2003-09-02 Zyomyx, Inc. Engineered binding proteins
AU2003221256A1 (en) 2002-02-21 2003-09-09 Biogen Idec Ma Inc. Use of bcma as an immunoregulatory agent
CA2478011C (en) 2002-03-01 2013-05-21 Immunomedics, Inc. Bispecific antibody point mutations for enhancing rate of clearance
JP4832719B2 (ja) 2002-04-09 2011-12-07 協和発酵キリン株式会社 FcγRIIIa多型患者に適応する抗体組成物含有医薬
US20040259150A1 (en) 2002-04-09 2004-12-23 Kyowa Hakko Kogyo Co., Ltd. Method of enhancing of binding activity of antibody composition to Fcgamma receptor IIIa
ATE503829T1 (de) 2002-04-09 2011-04-15 Kyowa Hakko Kirin Co Ltd Zelle mit erniedrigter oder deletierter aktivität eines am gdp-fucosetransport beteiligten proteins
CA2481920A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Antibody composition-containing medicament
EA200401325A1 (ru) 2002-04-09 2005-04-28 Киова Хакко Когио Ко., Лтд. Клетки с модифицированным геномом
US20040132140A1 (en) 2002-04-09 2004-07-08 Kyowa Hakko Kogyo Co., Ltd. Production process for antibody composition
EP1500665B1 (en) 2002-04-15 2011-06-15 Chugai Seiyaku Kabushiki Kaisha METHODS FOR CONSTRUCTING scDb LIBRARIES
JP2006506954A (ja) 2002-04-29 2006-03-02 ゲンパト77 ファーマコジェネティクス エージー Tcr及びtirc7に結合する新規な抗体、並びに治療及び診断におけるその使用
US7829289B2 (en) 2002-05-14 2010-11-09 Institut National De La Sante Et De Recherche Medicale T cell subpopulation regulating gut immunity
EP1513879B1 (en) 2002-06-03 2018-08-22 Genentech, Inc. Synthetic antibody phage libraries
US7906118B2 (en) 2005-04-06 2011-03-15 Ibc Pharmaceuticals, Inc. Modular method to prepare tetrameric cytokines with improved pharmacokinetics by the dock-and-lock (DNL) technology
ES2263984T3 (es) 2002-06-28 2006-12-16 Domantis Limited Ligandos doble-especificos con una vida media serica aumentada.
NZ537277A (en) 2002-07-18 2008-04-30 Crucell Holland Bv Recombinant production of mixtures of antibodies
DE60333201D1 (de) 2002-09-12 2010-08-12 Greenovation Biotech Gmbh Verfahren zur herstellung von proteinen
AU2003271904B2 (en) 2002-10-09 2009-03-05 Adaptimmune Limited Single chain recombinant T cell receptors
US7361740B2 (en) 2002-10-15 2008-04-22 Pdl Biopharma, Inc. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US8039218B2 (en) * 2002-11-14 2011-10-18 John Wayne Cancer Institute Detection of cancer cells in body fluids
WO2004053054A2 (en) 2002-12-09 2004-06-24 Natspears Ltd. Nk cell receptor conjugates for treating malignancies
EP3263596A1 (en) 2002-12-16 2018-01-03 Genentech, Inc. Immunoglobulin variants and uses thereof
US7781197B2 (en) 2002-12-20 2010-08-24 Greenovation Biotech Gmbh Transformed bryophyte cell having disrupted endogenous alpha 1,3-fucosyl and beta 1,2-xylosyl transferase encoding nucleotide sequences for the production of heterologous glycosylated proteins
DE10261223A1 (de) 2002-12-20 2004-07-08 MedInnova Gesellschaft für medizinische Innovationen aus akademischer Forschung mbH Steigerung der Immunantwort durch Substanzen, welche die Funktion von Natürlichen Killerzellen beeinflussen
CN1753912B (zh) 2002-12-23 2011-11-02 惠氏公司 抗pd-1抗体及其用途
WO2004056392A1 (en) 2002-12-23 2004-07-08 Innate Pharma Pharmaceutical compositions having an effect on the proliferation of nk cells and a method using the same
AU2003290330A1 (en) 2002-12-27 2004-07-22 Domantis Limited Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand
GB0230203D0 (en) 2002-12-27 2003-02-05 Domantis Ltd Fc fusion
JP2006524039A (ja) 2003-01-09 2006-10-26 マクロジェニクス,インコーポレーテッド 変異型Fc領域を含む抗体の同定および作製ならびにその利用法
CA2510003A1 (en) 2003-01-16 2004-08-05 Genentech, Inc. Synthetic antibody phage libraries
CN103540600B (zh) 2003-01-22 2017-12-01 罗氏格黎卡特股份公司 融合构建体及其用来生产Fc受体结合亲和性和效应子功能提高的抗体的用途
US7871607B2 (en) 2003-03-05 2011-01-18 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases
ES2532399T3 (es) 2003-03-05 2015-03-26 Halozyme, Inc. Glicoproteína hialuronidasa soluble (sHASEGP), proceso para prepararla, usos y composiciones farmacéuticas que la comprenden
US20060104968A1 (en) 2003-03-05 2006-05-18 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases
GB0305702D0 (en) 2003-03-12 2003-04-16 Univ Birmingham Bispecific antibodies
WO2004094620A2 (en) 2003-03-28 2004-11-04 Biogen Idec Ma Inc. Truncated baff receptors
US20050003403A1 (en) 2003-04-22 2005-01-06 Rossi Edmund A. Polyvalent protein complex
WO2005028517A2 (en) 2003-05-09 2005-03-31 The General Hospital Corporation SOLUBLE TGF-β TYPE III RECEPTOR FUSION PROTEINS
CA2525251C (en) 2003-05-09 2015-10-27 Duke University Cd20-specific antibodies and methods employing same
US20090005257A1 (en) 2003-05-14 2009-01-01 Jespers Laurent S Process for Recovering Polypeptides that Unfold Reversibly from a Polypeptide Repertoire
US20070105105A1 (en) 2003-05-23 2007-05-10 Mount Sinai School Of Medicine Of New York University Surrogate cell gene expression signatures for evaluating the physical state of a subject
DE10324447A1 (de) 2003-05-28 2004-12-30 Scil Proteins Gmbh Generierung künstlicher Bindungsproteine auf der Grundlage von Ubiquitin
ES2408582T3 (es) 2003-05-30 2013-06-21 Merus B.V. Biblioteca de Fab para la preparación de una mezcla de anticuerpos
CA2529945A1 (en) 2003-06-27 2005-01-06 Biogen Idec Ma Inc. Use of hydrophobic-interaction-chromatography or hinge-region modifications for the production of homogeneous antibody-solutions
CN1845938B (zh) 2003-06-30 2010-05-26 杜门蒂斯有限公司 多肽
KR20060041205A (ko) 2003-07-01 2006-05-11 이뮤노메딕스, 인코오포레이티드 양특이성 항체들의 다가 담체들
US7803376B2 (en) 2003-07-24 2010-09-28 Innate Pharma S.A. Methods and compositions for increasing the efficiency of therapeutic antibodies using NK cell potentiating compounds
US7696322B2 (en) 2003-07-28 2010-04-13 Catalent Pharma Solutions, Inc. Fusion antibodies
US20080241884A1 (en) 2003-10-08 2008-10-02 Kenya Shitara Fused Protein Composition
JPWO2005035778A1 (ja) 2003-10-09 2006-12-21 協和醗酵工業株式会社 α1,6−フコシルトランスフェラーゼの機能を抑制するRNAを用いた抗体組成物の製造法
AU2004285455A1 (en) 2003-10-20 2005-05-12 Biogen Idec Ma Inc. Therapeutic regimens for BAFF antagonists
ES2672640T3 (es) 2003-11-05 2018-06-15 Roche Glycart Ag Moléculas de unión a antígeno con afinidad de unión a receptores Fc y función efectora incrementadas
US7498298B2 (en) 2003-11-06 2009-03-03 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
WO2005053742A1 (ja) 2003-12-04 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. 抗体組成物を含有する医薬
GB0328363D0 (en) 2003-12-06 2004-01-14 Imp College Innovations Ltd Therapeutically useful molecules
US20050136051A1 (en) 2003-12-22 2005-06-23 Bernard Scallon Methods for generating multimeric molecules
GB0329825D0 (en) 2003-12-23 2004-01-28 Celltech R&D Ltd Biological products
US20050266425A1 (en) 2003-12-31 2005-12-01 Vaccinex, Inc. Methods for producing and identifying multispecific antibodies
US8383575B2 (en) 2004-01-30 2013-02-26 Paul Scherrer Institut (DI)barnase-barstar complexes
AU2005227322A1 (en) 2004-03-23 2005-10-06 Biogen Idec Ma Inc. Receptor coupling agents and therapeutic uses thereof
CN1961003B (zh) 2004-03-31 2013-03-27 健泰科生物技术公司 人源化抗TGF-β抗体
US7785903B2 (en) 2004-04-09 2010-08-31 Genentech, Inc. Variable domain library and uses
KR100891620B1 (ko) 2004-04-13 2009-04-02 에프. 호프만-라 로슈 아게 항-p-셀렉틴 항체
WO2005105848A1 (en) 2004-04-30 2005-11-10 Innate Pharma Compositions and methods for enhancing nk cell activity
WO2005105849A1 (en) 2004-04-30 2005-11-10 Innate Pharma Compositions and methods for treating proliferative disorders such as nk-type ldgl
US7501121B2 (en) 2004-06-17 2009-03-10 Wyeth IL-13 binding agents
US20060008844A1 (en) 2004-06-17 2006-01-12 Avidia Research Institute c-Met kinase binding proteins
US8361794B2 (en) 2004-06-29 2013-01-29 Immunocore Limited Cells expressing a modified T cell receptor
JP2008512352A (ja) 2004-07-17 2008-04-24 イムクローン システムズ インコーポレイティド 新規な四価の二重特異性抗体
EP1773885B1 (en) 2004-08-05 2010-04-21 Genentech, Inc. Humanized anti-cmet antagonists
EP1789446A2 (en) 2004-09-02 2007-05-30 Genentech, Inc. Heteromultimeric molecules
TWI309240B (en) 2004-09-17 2009-05-01 Hoffmann La Roche Anti-ox40l antibodies
KR101270829B1 (ko) 2004-09-23 2013-06-07 제넨테크, 인크. 시스테인 유전자조작 항체 및 접합체
EA011879B1 (ru) 2004-09-24 2009-06-30 Эмджин Инк. МОЛЕКУЛЫ С МОДИФИЦИРОВАННЫМ Fc ФРАГМЕНТОМ
WO2006039238A2 (en) 2004-09-30 2006-04-13 The Goverment Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Irta2 antibodies and methods of use
JO3000B1 (ar) 2004-10-20 2016-09-05 Genentech Inc مركبات أجسام مضادة .
CN101072793B (zh) 2004-12-09 2012-06-20 默克专利有限公司 具有降低的免疫原性的il-7变体
US20080247944A1 (en) 2005-01-12 2008-10-09 Robert Graziano Irta-2 Antibodies and Their Uses
AU2006207987B2 (en) 2005-01-27 2011-09-15 Novartis Vaccines And Diagnostics Inc. Methods for treating renal cell carcinoma
AU2005325801A1 (en) 2005-01-31 2006-08-03 Ablynx N.V. Method for generating variable domain sequences of heavy chain antibodies
US7431380B1 (en) 2005-02-24 2008-10-07 Theodore Allen Buresh Louver kit
EP3050963B1 (en) 2005-03-31 2019-09-18 Chugai Seiyaku Kabushiki Kaisha Process for production of polypeptide by regulation of assembly
EP1874824A4 (en) 2005-04-06 2009-12-30 Ibc Pharmaceuticals Inc METHODS OF GENERATING STABLE COMPOUND RELATED COMPLEXES OF HOMODIMERS, HOMOTRATEERS OR DIMER SIZES AND USES THEREOF
EP3479844B1 (en) 2005-04-15 2023-11-22 MacroGenics, Inc. Covalent diabodies and uses thereof
AU2006237329B2 (en) 2005-04-18 2012-04-12 Novo Nordisk A/S IL-21 variants
WO2006113747A2 (en) * 2005-04-19 2006-10-26 Prediction Sciences Llc Diagnostic markers of breast cancer treatment and progression and methods of use thereof
RU2494107C2 (ru) 2005-05-09 2013-09-27 Оно Фармасьютикал Ко., Лтд. Моноклональные антитела человека к белку программируемой смерти 1 (pd-1) и способы лечения рака с использованием анти-pd-1-антител самостоятельно или в комбинации с другими иммунотерапевтическими средствами
US20060263367A1 (en) 2005-05-23 2006-11-23 Fey Georg H Bispecific antibody devoid of Fc region and method of treatment using same
WO2006135886A2 (en) 2005-06-13 2006-12-21 The Regents Of The University Of Michigan Compositions and methods for treating and diagnosing cancer
JP2006345852A (ja) 2005-06-16 2006-12-28 Virxsys Corp 抗体複合体
CN103145839A (zh) 2005-06-30 2013-06-12 Abbvie公司 Il-12/p40结合蛋白
CN104356236B (zh) 2005-07-01 2020-07-03 E.R.施贵宝&圣斯有限责任公司 抗程序性死亡配体1(pd-l1)的人单克隆抗体
ES2401706T3 (es) 2005-07-27 2013-04-23 Eli Lilly And Company Un método de tratar células cancerosas para crear una célula cancerosa modificada que provoca una respuesta inmunogénica
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
ATE452913T1 (de) 2005-08-26 2010-01-15 Pls Design Gmbh Bivalente igy antikörperkonstrukte für diagnostische und therapeutische anwendungen
EP3190125A1 (en) 2005-08-31 2017-07-12 Merck Sharp & Dohme Corp. Engineered anti-il-23 antibodies
EP1929302A2 (en) 2005-09-23 2008-06-11 Novo Nordisk A/S Methods of identifying antibodies to ligands of orphan receptors
WO2007042809A2 (en) 2005-10-11 2007-04-19 Domantis Limited Antibody polypeptide library screening and selected antibody polypeptides
WO2007044887A2 (en) 2005-10-11 2007-04-19 Transtarget, Inc. Method for producing a population of homogenous tetravalent bispecific antibodies
WO2007047335A2 (en) 2005-10-13 2007-04-26 Biogen Idec Ma Inc. Methods for use with baff antagonists
AU2006301163B2 (en) 2005-10-14 2012-02-23 Innate Pharma Compositions and methods for treating proliferative disorders
WO2007048849A1 (en) 2005-10-28 2007-05-03 Novo Nordisk A/S Fusion proteins that bind effector lymphocytes and target cells
EP1957531B1 (en) 2005-11-07 2016-04-13 Genentech, Inc. Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US10155816B2 (en) 2005-11-28 2018-12-18 Genmab A/S Recombinant monovalent antibodies and methods for production thereof
WO2007062466A1 (en) 2005-11-29 2007-06-07 The University Of Sydney Demibodies: dimerisation-activated therapeutic agents
WO2007064919A2 (en) 2005-12-02 2007-06-07 Genentech, Inc. Binding polypeptides with restricted diversity sequences
WO2007095338A2 (en) 2006-02-15 2007-08-23 Imclone Systems Incorporated Functional antibodies
EP1991679A2 (fr) 2006-03-08 2008-11-19 Biomethodes Variants de l'interferon- gamma humain (ifngamma)
KR101516823B1 (ko) 2006-03-17 2015-05-07 바이오겐 아이덱 엠에이 인코포레이티드 안정화된 폴리펩티드 조성물
US8946391B2 (en) 2006-03-24 2015-02-03 The Regents Of The University Of California Construction of a multivalent scFv through alkyne-azide 1,3-dipolar cycloaddition
US8871912B2 (en) 2006-03-24 2014-10-28 Merck Patent Gmbh Engineered heterodimeric protein domains
US9670269B2 (en) 2006-03-31 2017-06-06 Chugai Seiyaku Kabushiki Kaisha Methods of modifying antibodies for purification of bispecific antibodies
JP2009536527A (ja) 2006-05-09 2009-10-15 ジェネンテック・インコーポレーテッド 最適化されたスキャフォールドを備えた結合ポリペプチド
JP5189082B2 (ja) 2006-05-25 2013-04-24 バイエル・ファルマ・アクチェンゲゼルシャフト 二量体分子複合体
US20070274985A1 (en) 2006-05-26 2007-11-29 Stefan Dubel Antibody
WO2007146968A2 (en) 2006-06-12 2007-12-21 Trubion Pharmaceuticals, Inc. Single-chain multivalent binding proteins with effector function
WO2008017859A2 (en) 2006-08-10 2008-02-14 Isis Innovation Limited Ligand for the g6b receptor on blood platelets
WO2008073160A2 (en) 2006-08-17 2008-06-19 The Trustees Of Columbia University In The City Of New York Methods for converting or inducing protective immunity
WO2008022349A2 (en) 2006-08-18 2008-02-21 Armagen Technologies, Inc. Agents for blood-brain barrier delivery
WO2008027236A2 (en) 2006-08-30 2008-03-06 Genentech, Inc. Multispecific antibodies
ES2566502T3 (es) 2006-09-13 2016-04-13 The Trustees Of Columbia University In The City Of New York Agentes y métodos para provocar una respuesta inmune antitumoral
CA2668208C (en) 2006-11-02 2017-09-12 Daniel J. Capon Hybrid immunoglobulins with moving parts
US20080226635A1 (en) 2006-12-22 2008-09-18 Hans Koll Antibodies against insulin-like growth factor I receptor and uses thereof
WO2008087219A1 (en) 2007-01-19 2008-07-24 INSERM (Institut National de la Santé et de la Recherche Médicale) Compositions and methods for regulating t cell activity
WO2008119353A1 (en) 2007-03-29 2008-10-09 Genmab A/S Bispecific antibodies and methods for production thereof
EP2144930A1 (en) 2007-04-18 2010-01-20 ZymoGenetics, Inc. Single chain fc, methods of making and methods of treatment
DK2160401T3 (da) 2007-05-11 2014-10-20 Altor Bioscience Corp Fusionsmolekyler og il-15-varianter
TW201531484A (zh) 2007-05-21 2015-08-16 Alder Biopharmaceuticals Inc 抗TNF-α之抗體及其用途
CN100592373C (zh) 2007-05-25 2010-02-24 群康科技(深圳)有限公司 液晶显示面板驱动装置及其驱动方法
HRP20131167T1 (hr) 2007-06-18 2014-01-03 Merck Sharp & Dohme B.V. Antitijela za humani receptor programirane smrti pd-1
EP2014680A1 (en) 2007-07-10 2009-01-14 Friedrich-Alexander-Universität Erlangen-Nürnberg Recombinant, single-chain, trivalent tri-specific or bi-specific antibody derivatives
KR20100058509A (ko) 2007-07-31 2010-06-03 메디뮨 엘엘씨 다중특이적 에피토프 결합 단백질 및 이의 용도
WO2009021754A2 (en) 2007-08-15 2009-02-19 Bayer Schering Pharma Aktiengesellschaft Monospecific and multispecific antibodies and method of use
AU2008304748C1 (en) 2007-09-26 2014-06-12 Chugai Seiyaku Kabushiki Kaisha Modified antibody constant region
KR101662622B1 (ko) 2007-10-04 2016-10-05 지모제넥틱스, 인코포레이티드 B7 패밀리 구성원 zB7H6 및 관련된 조성물 및 방법
UA104132C2 (en) 2007-11-13 2014-01-10 Тева Биофармасьютикалз Юесей, Инк. Humanized antibodies against tl1a
EP2220120A2 (en) 2007-11-27 2010-08-25 Ablynx N.V. Amino acid sequences directed against heterodimeric cytokines and/or their receptors and polypeptides comprising the same
AU2008328726B2 (en) 2007-11-30 2014-06-12 Glaxo Group Limited Antigen-binding constructs
RU2570559C2 (ru) 2007-12-17 2015-12-10 Пфайзер Лимитед Лечение интерстициального цистита
US8242247B2 (en) 2007-12-21 2012-08-14 Hoffmann-La Roche Inc. Bivalent, bispecific antibodies
US8227577B2 (en) 2007-12-21 2012-07-24 Hoffman-La Roche Inc. Bivalent, bispecific antibodies
US9266967B2 (en) 2007-12-21 2016-02-23 Hoffmann-La Roche, Inc. Bivalent, bispecific antibodies
US20090162359A1 (en) 2007-12-21 2009-06-25 Christian Klein Bivalent, bispecific antibodies
ES2563027T3 (es) 2008-01-07 2016-03-10 Amgen Inc. Método para fabricación de moléculas heterodímeras Fc de anticuerpos utilizando efectos de conducción electrostática
PT2242773T (pt) 2008-02-11 2017-09-15 Cure Tech Ltd Anticorpos monoclonais para o tratamento de tumores
CA2712474A1 (en) 2008-02-21 2009-08-27 Baxter Healthcare S.A. Procedure for the generation of a high producer cell line for the expression of a recombinant anti-cd34 antibody
WO2009114335A2 (en) 2008-03-12 2009-09-17 Merck & Co., Inc. Pd-1 binding proteins
KR102057826B1 (ko) 2008-04-11 2019-12-20 추가이 세이야쿠 가부시키가이샤 복수 분자의 항원에 반복 결합하는 항원 결합 분자
US9593376B2 (en) 2008-06-02 2017-03-14 Institut Gustave Roussy Natural killer p30 (NKp30) dysfunction and the biological applications thereof
AR072999A1 (es) 2008-08-11 2010-10-06 Medarex Inc Anticuerpos humanos que se unen al gen 3 de activacion linfocitaria (lag-3) y los usos de estos
CN102203132A (zh) 2008-08-25 2011-09-28 安普利穆尼股份有限公司 Pd-1拮抗剂的组合物和使用方法
WO2010098788A2 (en) 2008-08-25 2010-09-02 Amplimmune, Inc. Pd-i antagonists and methods for treating infectious disease
AU2009288354A1 (en) 2008-08-26 2010-03-11 Macrogenics Inc. T-cell receptor antibodies and methods of use thereof
TWI516501B (zh) 2008-09-12 2016-01-11 禮納特神經系統科學公司 Pcsk9拮抗劑類
EP2326670A4 (en) 2008-09-17 2014-04-16 Nat Res Council Canada HETERO MULTIVALENT BINDING AGENT FOR ELEMENTS OF THE TGF-BETA SUPERFAMILY
AU2009333580B2 (en) 2008-12-09 2016-07-07 Genentech, Inc. Anti-PD-L1 antibodies and their use to enhance T-cell function
US8580267B2 (en) 2008-12-19 2013-11-12 Philogen S.P.A. Immunocytokines for tumour therapy with chemotherapeutic agents
WO2010089411A2 (en) 2009-02-09 2010-08-12 Universite De La Mediterranee Pd-1 antibodies and pd-l1 antibodies and uses thereof
EP2406284B9 (en) 2009-03-10 2017-03-01 Biogen MA Inc. Anti-bcma antibodies
WO2010120561A1 (en) 2009-04-01 2010-10-21 Genentech, Inc. Anti-fcrh5 antibodies and immunoconjugates and methods of use
MX2011010265A (es) 2009-04-01 2011-10-11 Genentech Inc Anticuerpos anti-fcrh5 e inmunoconjugados y metodos de uso.
PE20120591A1 (es) 2009-04-02 2012-05-23 Roche Glycart Ag Anticuerpos multiespecificos que comprenden anticuerpos de longitud completa y fragmentos fab de cadena sencilla
JP5616428B2 (ja) 2009-04-07 2014-10-29 ロシュ グリクアート アクチェンゲゼルシャフト 三価の二重特異性抗体
JP2012525149A (ja) 2009-04-27 2012-10-22 オンコメッド ファーマシューティカルズ インコーポレイテッド ヘテロ多量体分子を作製するための方法
US9676845B2 (en) 2009-06-16 2017-06-13 Hoffmann-La Roche, Inc. Bispecific antigen binding proteins
US8703132B2 (en) 2009-06-18 2014-04-22 Hoffmann-La Roche, Inc. Bispecific, tetravalent antigen binding proteins
JP5816170B2 (ja) 2009-06-26 2015-11-18 リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. 天然の免疫グロブリン形式を有する容易に単離される二重特異性抗体
US8497071B2 (en) 2009-06-29 2013-07-30 California Institute Of Technology Isolation of unknown rearranged T-cell receptors from single cells
ES2534085T3 (es) 2009-08-17 2015-04-17 Roche Glycart Ag Inmunoconjugados dirigidos
KR20120060877A (ko) 2009-09-01 2012-06-12 아보트 러보러터리즈 이원 가변 도메인 면역글로불린 및 이의 용도
US9493578B2 (en) 2009-09-02 2016-11-15 Xencor, Inc. Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens
ES2688978T3 (es) 2009-11-23 2018-11-07 Amgen Inc. Anticuerpo monomérico Fc
WO2011066342A2 (en) 2009-11-24 2011-06-03 Amplimmune, Inc. Simultaneous inhibition of pd-l1/pd-l2
EP2507381A4 (en) 2009-12-04 2016-07-20 Hoffmann La Roche MULTISPECIFIC ANTIBODIES, ANTIBODY ANALOGS, COMPOSITIONS AND METHODS
EP2510011B2 (en) 2009-12-09 2021-03-31 Institut National de la Santé et de la Recherche Médicale Monoclonal antibodies that bind b7h6 and uses thereof
US20130129723A1 (en) 2009-12-29 2013-05-23 Emergent Product Development Seattle, Llc Heterodimer Binding Proteins and Uses Thereof
CN102958942A (zh) 2009-12-29 2013-03-06 新兴产品开发西雅图有限公司 异二聚体结合蛋白及其应用
WO2011085178A1 (en) 2010-01-11 2011-07-14 Trustees Of Dartmouth College Monomeric bi-specific fusion protein
EP3907242A1 (en) 2010-01-29 2021-11-10 Chugai Seiyaku Kabushiki Kaisha Anti-dll3 antibody
CA3083324A1 (en) 2010-03-05 2011-09-09 The Johns Hopkins University Compositions and methods for targeted immunomodulatory antibodies and fusion proteins
TW201138821A (en) 2010-03-26 2011-11-16 Roche Glycart Ag Bispecific antibodies
DK2560993T3 (da) 2010-04-20 2024-10-14 Genmab As Heterodimeric antibody fc-containing proteins and methods for production thereof
BR112012030311A2 (pt) 2010-06-08 2017-01-24 Genentech Inc anticorpo
WO2011155607A1 (ja) 2010-06-11 2011-12-15 協和発酵キリン株式会社 抗tim-3抗体
US9018006B2 (en) 2010-07-23 2015-04-28 The University Of Toledo Stable Tregs and related materials and methods
PL2606064T3 (pl) 2010-08-16 2015-07-31 Novimmune Sa Sposoby wytwarzania wieloswoistych i wielowartościowych przeciwciał
WO2012025530A1 (en) 2010-08-24 2012-03-01 F. Hoffmann-La Roche Ag Bispecific antibodies comprising a disulfide stabilized - fv fragment
MX340556B (es) 2010-08-24 2016-07-14 Roche Glycart Ag Anticuerpos biespecificos activables.
CN101985476B (zh) 2010-10-29 2012-11-21 中国科学技术大学 抗人NKp30单克隆抗体的制备、鉴定及应用
PL2635607T3 (pl) 2010-11-05 2020-05-18 Zymeworks Inc. Projekt stabilnego przeciwciała heterodimerowego z mutacjami w domenie FC
EP3974453A3 (en) 2010-11-16 2022-08-03 Amgen Inc. Agents and methods for treating diseases that correlate with bcma expression
PH12013501201A1 (en) 2010-12-09 2013-07-29 Univ Pennsylvania Use of chimeric antigen receptor-modified t cells to treat cancer
WO2012088309A1 (en) 2010-12-21 2012-06-28 The Board Of Trustees Of The Leland Stanford Junior University Therapeutic and diagnostic methods for manipulating phagocytosis through calreticulin and low density lipoprotein-related receptor
WO2012088302A2 (en) 2010-12-22 2012-06-28 Abbott Laboratories Half immunoglobulin binding proteins and uses thereof
US10689447B2 (en) 2011-02-04 2020-06-23 Genentech, Inc. Fc variants and methods for their production
HUE029139T2 (hu) 2011-02-10 2017-02-28 Roche Glycart Ag Mutáns interleukin-2 polipeptidek
WO2012118622A1 (en) 2011-02-19 2012-09-07 Baylor Research Institute Diagnostic and therapeutic uses for b cell maturation antigen
EP2681242B1 (en) 2011-03-01 2018-01-24 Amgen Inc. Sclerostin and dkk-1 bispecific binding agents
US9683052B2 (en) 2011-03-25 2017-06-20 Glenmark Pharmaceuticals S.A. Hetero-dimeric immunoglobulins
EP2694549B1 (en) 2011-04-08 2018-08-15 The United States of America, as represented by The Secretary, Department of Health and Human Services Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer
US20130101599A1 (en) 2011-04-21 2013-04-25 Boehringer Ingelheim International Gmbh Bcma-based stratification and therapy for multiple myeloma patients
EA201892619A1 (ru) 2011-04-29 2019-04-30 Роше Гликарт Аг Иммуноконъюгаты, содержащие мутантные полипептиды интерлейкина-2
WO2012158818A2 (en) 2011-05-16 2012-11-22 Fabion Pharmaceuticals, Inc. Multi-specific fab fusion proteins and methods of use
US9574002B2 (en) 2011-06-06 2017-02-21 Amgen Inc. Human antigen binding proteins that bind to a complex comprising β-Klotho and an FGF receptor
JP2014520123A (ja) 2011-06-17 2014-08-21 アムジエン・インコーポレーテツド Clec−2を使用して代謝性障害を治療または改善させる方法
EP2723380B1 (en) 2011-06-24 2019-08-21 Stephen D. Gillies Light chain immunoglobulin fusion proteins and methods of use thereof
CN109517059B (zh) 2011-06-30 2023-03-28 中外制药株式会社 异源二聚化多肽
UA117901C2 (uk) 2011-07-06 2018-10-25 Ґенмаб Б.В. Спосіб посилення ефекторної функції вихідного поліпептиду, його варіанти та їх застосування
EP3549611B1 (en) 2011-07-29 2021-06-30 The Trustees of the University of Pennsylvania Switch costimulatory receptors
MY169358A (en) 2011-08-23 2019-03-26 Roche Glycart Ag Bispecific t cell activating antigen binding molecules
US9833476B2 (en) 2011-08-31 2017-12-05 The Trustees Of Dartmouth College NKP30 receptor targeted therapeutics
UY34317A (es) * 2011-09-12 2013-02-28 Genzyme Corp Anticuerpo antireceptor de célula T (alfa)/ß
CA2791109C (en) 2011-09-26 2021-02-16 Merus B.V. Generation of binding molecules
EP2768857B1 (en) 2011-10-19 2020-01-01 NovImmune SA Methods of purifying antibodies
SG10201604104PA (en) 2011-10-25 2016-07-28 Prothena Therapeutics Ltd Antibody formulations and methods
US10344050B2 (en) 2011-10-27 2019-07-09 Genmab A/S Production of heterodimeric proteins
US20130273089A1 (en) 2011-11-03 2013-10-17 Tolera Therapeutics, Inc. Antibody and methods for selective inhibition of t-cell responses
CA2854233C (en) 2011-11-04 2020-05-12 Zymeworks Inc. Stable heterodimeric antibody design with mutations in the fc domain
TWI679212B (zh) 2011-11-15 2019-12-11 美商安進股份有限公司 針對bcma之e3以及cd3的結合分子
HRP20201595T1 (hr) 2011-11-28 2020-12-11 Merck Patent Gmbh Anti-pd-l1 protutijela i njihova uporaba
LT2794658T (lt) 2011-12-19 2017-05-10 Synimmune Gmbh Bispecifinė antikūno molekulė
LT2794905T (lt) 2011-12-20 2020-07-10 Medimmune, Llc Modifikuoti polipeptidai, skirti bispecifinių antikūnų karkasams
US20130165638A1 (en) 2011-12-27 2013-06-27 Development Center For Biotechnology Light chain-bridged bispecific antibody
JP6153947B2 (ja) 2012-01-05 2017-06-28 ヴィザ インターナショナル サーヴィス アソシエイション 取引映像キャプチャ装置、方法およびシステム
WO2013119966A2 (en) 2012-02-10 2013-08-15 Genentech, Inc. Single-chain antibodies and other heteromultimers
GB201203051D0 (en) 2012-02-22 2012-04-04 Ucb Pharma Sa Biological products
PE20190658A1 (es) 2012-02-24 2019-05-08 Abbvie Stemcentrx Llc Moduladores y metodos de empleo novedosos
PT2825559T (pt) 2012-03-13 2019-06-07 Novimmune Sa Anticorpos biespecíficos prontamente isolados com formato de imunoglobulina nativo
MX361875B (es) 2012-03-14 2018-12-18 Regeneron Pharma Moléculas de unión de antígeno multiespecifícas y usos de las mismas.
SI2838917T1 (sl) 2012-04-20 2019-11-29 Merus Nv Postopki in sredstva za produkcijo heterodimernih IG-podobnih molekul
DK2847231T3 (da) 2012-05-10 2019-10-14 Bioatla Llc Multispecifikke monoklonale antistoffer
WO2013166594A1 (en) 2012-05-10 2013-11-14 Zymeworks Inc. Heteromultimer constructs of immunoglobulin heavy chains with mutations in the fc domain
EP2855531A1 (en) 2012-05-24 2015-04-08 F. Hoffmann-La Roche AG Multispecific antibodies
WO2014004586A1 (en) 2012-06-25 2014-01-03 Zymeworks Inc. Process and methods for efficient manufacturing of highly pure asymmetric antibodies in mammalian cells
CA2871386A1 (en) 2012-06-27 2014-01-03 F. Hoffmann-La Roche Ag Method for the selection and production of tailor-made, selective and multi-specific therapeutic molecules comprising at least two different targeting entities and uses thereof
AR091649A1 (es) 2012-07-02 2015-02-18 Bristol Myers Squibb Co Optimizacion de anticuerpos que se fijan al gen de activacion de linfocitos 3 (lag-3) y sus usos
BR112015000167B1 (pt) 2012-07-06 2021-11-23 Genmab B.V. Proteína dimérica, proteína, composição, kit de partes e seus usos, bem como método para aumentar a oligomerização em solução de uma proteína dimérica compreendendo um primeiro e segundo polipeptídeo, cada um compreendendo pelo menos as regiões ch2 e ch3 de uma cadeia pesada de igg1 humana e proteína dimérica variante
US20140072581A1 (en) 2012-07-23 2014-03-13 Zymeworks Inc. Immunoglobulin Constructs Comprising Selective Pairing of the Light and Heavy Chains
CN104684928A (zh) 2012-08-02 2015-06-03 Jn生物科学有限责任公司 通过半胱氨酸突变和μ尾端多聚化的抗体或融合蛋白
US20150203591A1 (en) 2012-08-02 2015-07-23 Regeneron Pharmaceuticals, Inc. Mutivalent antigen-binding proteins
AR092044A1 (es) 2012-08-07 2015-03-18 Roche Glycart Ag Inmunoterapia mejorada
US20140044675A1 (en) 2012-08-10 2014-02-13 Roche Glycart Ag Interleukin-2 fusion proteins and uses thereof
US9682143B2 (en) 2012-08-14 2017-06-20 Ibc Pharmaceuticals, Inc. Combination therapy for inducing immune response to disease
CN104769103B (zh) 2012-09-04 2018-06-08 塞勒克提斯公司 多链嵌合抗原受体和其用途
US20140079691A1 (en) 2012-09-20 2014-03-20 Anaptysbio, Inc. Thermostable antibody framework regions
CN105121630B (zh) 2012-10-03 2018-09-25 酵活有限公司 定量重链和轻链多肽对的方法
EP2904016B1 (en) 2012-10-08 2018-11-14 Roche Glycart AG Fc-free antibodies comprising two fab-fragments and methods of use
UY35148A (es) 2012-11-21 2014-05-30 Amgen Inc Immunoglobulinas heterodiméricas
US9914785B2 (en) 2012-11-28 2018-03-13 Zymeworks Inc. Engineered immunoglobulin heavy chain-light chain pairs and uses thereof
US9243058B2 (en) 2012-12-07 2016-01-26 Amgen, Inc. BCMA antigen binding proteins
WO2014100490A1 (en) 2012-12-19 2014-06-26 Adimab, Llc Multivalent antibody analogs, and methods of their preparation and use
AU2013204922B2 (en) 2012-12-20 2015-05-14 Celgene Corporation Chimeric antigen receptors
MX2015008117A (es) 2012-12-21 2016-03-31 Amplimmune Inc Anticuerpos anti-h7cr.
US10766960B2 (en) 2012-12-27 2020-09-08 Chugai Seiyaku Kabushiki Kaisha Heterodimerized polypeptide
KR20200024345A (ko) 2013-01-10 2020-03-06 젠맵 비. 브이 인간 IgG1 Fc 영역 변이체 및 그의 용도
EP2948475A2 (en) 2013-01-23 2015-12-02 AbbVie Inc. Methods and compositions for modulating an immune response
TWI682941B (zh) 2013-02-01 2020-01-21 美商再生元醫藥公司 含嵌合恆定區之抗體
US9989524B2 (en) 2013-02-05 2018-06-05 Sanofi Immuno imaging agent for use with antibody-drug conjugate therapy
JP6636803B2 (ja) 2013-02-05 2020-01-29 エンクマフ エスアーエールエル Bcmaに対する抗体の選択のための方法
US10047163B2 (en) 2013-02-08 2018-08-14 Abbvie Stemcentrx Llc Multispecific constructs
CA2900529A1 (en) 2013-02-08 2014-08-14 Institute For Myeloma & Bone Cancer Research Improved diagnostic, prognostic, and monitoring methods for multiple myeloma, chronic lymphocytic leukemia, and b-cell non-hodgkin lymphoma
GB201302447D0 (en) 2013-02-12 2013-03-27 Oxford Biotherapeutics Ltd Therapeutic and diagnostic target
TW201446794A (zh) 2013-02-20 2014-12-16 Novartis Ag 利用抗-cd123嵌合抗原受體工程化t細胞之初級人類白血病有效靶向
BR112015019909A2 (pt) 2013-02-22 2017-08-29 Abbvie Stemcentrx Llc Conjugados anticorpo-fármaco, composição farmacêutica, usos dos mesmos, e kit
CN105143270B (zh) 2013-02-26 2019-11-12 罗切格利卡特公司 双特异性t细胞活化抗原结合分子
EP3447072A3 (en) 2013-03-05 2019-05-22 Baylor College of Medicine Engager cells comprising cd3 scfv and an antigen recognition domain that binds a tumor antigen for immunotherapy
JP6676521B2 (ja) 2013-03-14 2020-04-08 マクロジェニクス,インコーポレーテッド 二重特異性分子、薬学的組成物及びそれらの使用
US20140302037A1 (en) 2013-03-15 2014-10-09 Amgen Inc. BISPECIFIC-Fc MOLECULES
US20140308285A1 (en) 2013-03-15 2014-10-16 Amgen Inc. Heterodimeric bispecific antibodies
NZ710929A (en) 2013-03-15 2018-02-23 Novartis Ag Antibody drug conjugates
US10858417B2 (en) 2013-03-15 2020-12-08 Xencor, Inc. Heterodimeric proteins
AR095374A1 (es) 2013-03-15 2015-10-14 Amgen Res Munich Gmbh Moléculas de unión para bcma y cd3
US10047167B2 (en) 2013-03-15 2018-08-14 Eli Lilly And Company Methods for producing fabs and bi-specific antibodies
RU2687043C2 (ru) 2013-04-29 2019-05-06 Ф. Хоффманн-Ля Рош Аг МОДИФИЦИРОВАННЫЕ АСИММЕТРИЧНЫЕ АНТИТЕЛА, СВЯЗЫВАЮЩИЕ Fc-РЕЦЕПТОР, И СПОСОБЫ ИХ ПРИМЕНЕНИЯ
WO2014186905A1 (en) 2013-05-24 2014-11-27 Zymeworks Inc. Modular protein drug conjugate therapeutic
WO2014190441A1 (en) 2013-05-31 2014-12-04 Zymeworks Inc. Heteromultimers with reduced or silenced effector function
TWI725931B (zh) 2013-06-24 2021-05-01 美商建南德克公司 抗fcrh5抗體
ES2865473T3 (es) 2013-07-10 2021-10-15 Sutro Biopharma Inc Anticuerpos que comprenden múltiples residuos de aminoácidos no naturales sitio-específicos, métodos para su preparación y métodos de uso
CA2921805C (en) 2013-08-22 2023-03-07 Acceleron Pharma, Inc. Tgf-beta receptor type ii variants and uses thereof
PT2808338E (pt) 2013-09-16 2016-06-15 Cemm - Forschungszentrum Für Molekulare Medizin Gmbh Calreticulina mutante para o diagnóstico de malignidades mieloides
JP6534615B2 (ja) 2013-09-27 2019-06-26 中外製薬株式会社 ポリペプチド異種多量体の製造方法
GB201317928D0 (en) 2013-10-10 2013-11-27 Ucl Business Plc Molecule
KR20160044060A (ko) 2013-10-11 2016-04-22 에프. 호프만-라 로슈 아게 다중특이적 도메인 교환된 통상의 가변 경쇄 항체
SG11201603193PA (en) 2013-10-30 2016-05-30 Genzyme Corp Methods for enhancing immunosuppressive therapy by multiple administration of alpha beta tcr-binding polypeptide
UA129760C2 (uk) 2013-12-17 2025-07-30 Дженентек, Інк. Анти-cd3 антитіло та спосіб його застосування
EP3082853A2 (en) 2013-12-20 2016-10-26 The Broad Institute, Inc. Combination therapy with neoantigen vaccine
EP3094649A1 (en) 2014-01-15 2016-11-23 F. Hoffmann-La Roche AG Fc-region variants with modified fcrn-binding properties
RU2727639C2 (ru) 2014-01-15 2020-07-22 Ф.Хоффманн-Ля Рош Аг Варианты fc-области с модифицированной способностью связываться с fcrn и с сохраненной способностью связываться с белком а
RU2698969C2 (ru) 2014-01-15 2019-09-02 Ф.Хоффманн-Ля Рош Аг Варианты fc-области с улучшенной способностью связываться с белком а
KR102042246B1 (ko) 2014-02-06 2019-11-28 에프. 호프만-라 로슈 아게 인터류킨-2 융합 단백질 및 이의 용도
US9676863B2 (en) 2014-02-10 2017-06-13 Merck Patent Gmbh Targeted TGFβ inhibitors
DK3105252T3 (da) 2014-02-12 2019-10-14 Michael Uhlin Bispecifikke antistoffer til anvendelse ved stamcelletransplantation
PE20161209A1 (es) 2014-02-21 2016-11-10 Abbvie Stemcentrx Llc Conjugados de anticuerpos anti-drosophila similar a delta 3 (anti-dll3) y medicamentos para usarse en el tratamiento contra melanoma
EP3107565A4 (en) 2014-02-21 2017-08-23 Regeneron Pharmaceuticals, Inc. Methods, compositions and kits for cell specific modulation of target antigens
CN112094347A (zh) 2014-03-05 2020-12-18 奥托路斯有限公司 具有针对T细胞受体beta恒定区的抗原结合域的嵌合抗原受体(CAR)
US11385233B2 (en) 2015-03-05 2022-07-12 Autolus Limited Methods of depleting malignant T-cells
MX373460B (es) 2014-03-11 2020-04-07 Cellectis Metodo para generar celulas t compatibles para el trasplante alogenico.
EP3593812A3 (en) 2014-03-15 2020-05-27 Novartis AG Treatment of cancer using chimeric antigen receptor
EP3122779B1 (en) 2014-03-24 2019-05-22 Cancer Research Technology Limited Modified antibodies containing modified igg2 domains which elicit agonist or antagonistic properties and use thereof
UA117289C2 (uk) 2014-04-02 2018-07-10 Ф. Хоффманн-Ля Рош Аг Мультиспецифічне антитіло
EP2930188A1 (en) 2014-04-13 2015-10-14 Affimed Therapeutics AG Trifunctional antigen-binding molecule
WO2015164815A1 (en) 2014-04-24 2015-10-29 The Board Of Trustees Of The Leland Stanford Junior University Superagonists, partial agonists and antagonists of interleukin-2
KR102632731B1 (ko) 2014-04-30 2024-02-01 막스-델부뤽-센트럼 퓌어 몰레쿨라레 메디친 인 데어 헬름홀츠-게마인샤프트 Cd269에 대한 인간화 항체
RU2729467C2 (ru) 2014-05-28 2020-08-06 Займворкс Инк. Модифицированные антигенсвязывающие полипептидные конструкции и их применение
IL290655B2 (en) 2014-05-29 2024-05-01 Us Health Anti-human papillomavirus 16 E7 T-cell chelates
EP3152235B1 (en) 2014-05-29 2021-08-25 MacroGenics, Inc. Tri-specific binding molecules and methods of use thereof
CA2952532A1 (en) 2014-06-27 2015-12-30 Innate Pharma Multispecific antigen binding proteins
WO2015197582A1 (en) 2014-06-27 2015-12-30 Innate Pharma Monomeric multispecific antigen binding proteins
JP6822849B2 (ja) 2014-06-27 2021-01-27 イナート・ファルマ・ソシエテ・アノニムInnate Pharma Pharma S.A. 多重特異的NKp46結合タンパク質
WO2016016299A1 (en) 2014-07-29 2016-02-04 F. Hoffmann-La Roche Ag Multispecific antibodies
EP2982692A1 (en) 2014-08-04 2016-02-10 EngMab AG Bispecific antibodies against CD3epsilon and BCMA
JP6464255B2 (ja) 2014-08-04 2019-02-06 エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト 二重特異性t細胞活性化抗原結合分子
WO2016019969A1 (en) 2014-08-08 2016-02-11 Ludwig-Maximilians-Universität München Subcutaneously administered bispecific antibodies for use in the treatment of cancer
GB201414823D0 (en) 2014-08-20 2014-10-01 Argen X Bv Multispecific antibodies
HRP20190881T1 (hr) 2014-08-28 2019-07-12 Halozyme, Inc. Kombinacijska terapija s hijaluronan-razgrađujućim enzimom i inhibitorom imunološke kontrolne točke
BR112017004270B1 (pt) 2014-09-04 2023-03-07 Stemcell Technologies Inc Método de ativação de células t ou células nk
MA40764A (fr) 2014-09-26 2017-08-01 Chugai Pharmaceutical Co Ltd Agent thérapeutique induisant une cytotoxicité
WO2016051205A1 (en) 2014-10-03 2016-04-07 Isis Innovation Limited Analysis of t-cell monotypia
WO2016069282A1 (en) 2014-10-31 2016-05-06 The Trustees Of The University Of Pennsylvania Altering gene expression in modified t cells and uses thereof
BR112017006591A2 (pt) 2014-11-06 2018-01-16 Hoffmann La Roche polipeptídeo heterodimérico, formulação farmacêutica e uso de um polipeptídeo heterodimérico
RS59340B1 (sr) 2014-11-06 2019-10-31 Hoffmann La Roche Varijante fc regiona sa modifikovanim vezivanjem za fcrn i metode upotrebe
EP3023437A1 (en) 2014-11-20 2016-05-25 EngMab AG Bispecific antibodies against CD3epsilon and BCMA
SI3221357T1 (sl) 2014-11-20 2020-09-30 F. Hoffmann-La Roche Ag Pogoste lahke verige in načini uporabe
US20170269092A1 (en) 2014-12-02 2017-09-21 Cemm - Forschungszentrum Fuer Molekulare Medizin Gmbh Anti-mutant calreticulin antibodies and their use in the diagnosis and therapy of myeloid malignancies
EP3029068A1 (en) 2014-12-03 2016-06-08 EngMab AG Bispecific antibodies against CD3epsilon and BCMA for use in the treatment of diseases
CN107001482B (zh) 2014-12-03 2021-06-15 豪夫迈·罗氏有限公司 多特异性抗体
KR20240135036A (ko) 2014-12-05 2024-09-10 메모리얼 슬로안 케터링 캔서 센터 B-세포 성숙화 항원을 표적화하는 항체 및 사용 방법
ES2935274T3 (es) 2014-12-05 2023-03-03 Merck Patent Gmbh Anticuerpo con intercambio de dominios
WO2016090337A1 (en) 2014-12-05 2016-06-09 Memorial Sloan-Kettering Cancer Center Chimeric antigen receptors targeting fc receptor-like 5 and uses thereof
US9767555B2 (en) 2015-01-05 2017-09-19 Case Western Reserve University Disease characterization from fused pathology and radiology data
EP3623386B1 (en) 2015-01-08 2022-04-13 BioNTech SE Agonistic tnf receptor binding agents
WO2016115274A1 (en) 2015-01-14 2016-07-21 Compass Therapeutics Llc Multispecific immunomodulatory antigen-binding constructs
PT3247728T (pt) 2015-01-20 2020-07-16 Igm Biosciences Inc Moléculas de ligação do recetor da superfamília do fator de necrose tumoral (fnt) e utilização das mesmas
US20170151281A1 (en) 2015-02-19 2017-06-01 Batu Biologics, Inc. Chimeric antigen receptor dendritic cell (car-dc) for treatment of cancer
WO2016146594A1 (en) 2015-03-13 2016-09-22 Novimmune Sa Methods of purifying bispecific antibodies
PL3988117T3 (pl) 2015-04-13 2025-03-10 Pfizer Inc. Przeciwciała terapeutyczne i ich zastosowania
BR112017020952A2 (pt) 2015-04-13 2018-07-10 Five Prime Therapeutics Inc método de tratamento de câncer, composição e uso da composição
WO2016176756A1 (en) 2015-05-05 2016-11-10 University Health Network Nk cells and antibodies for cancer treatment
PT3294768T (pt) 2015-05-13 2019-11-05 Ablynx Nv Polipétidos de recrutamento de células t com base na reatividade do tcr alfa/beta
WO2016193300A1 (en) 2015-06-01 2016-12-08 Medigene Immunotherapies Gmbh Method for generating antibodies against t cell receptor
WO2016193301A1 (en) * 2015-06-01 2016-12-08 Medigene Immunotherapies Gmbh T-cell receptor specific antibodies
TWI731861B (zh) 2015-06-16 2021-07-01 美商建南德克公司 FcRH5之人源化及親和力成熟抗體及使用方法
SI3115376T1 (sl) 2015-07-10 2018-12-31 Merus N.V. Humana protitelesa, ki vežejo CD3
AU2016297249B2 (en) 2015-07-23 2020-11-12 Inhibrx Biosciences, Inc. Multivalent and multispecific GITR-binding fusion proteins
TWI793062B (zh) 2015-07-31 2023-02-21 德商安美基研究(慕尼黑)公司 Dll3及cd3抗體構築體
EA039859B1 (ru) 2015-07-31 2022-03-21 Эмджен Рисерч (Мюник) Гмбх Биспецифические конструкты антител, связывающие egfrviii и cd3
US10683369B2 (en) 2015-08-03 2020-06-16 Engmab Sàrl Monoclonal antibodies against BCMA
US10072088B2 (en) 2015-08-17 2018-09-11 Janssen Pharmaceutica, Nv Anti-BCMA antibodies and uses thereof
US20200231652A1 (en) 2015-08-31 2020-07-23 National Research Council Of Canada Tgf-b-receptor ectodomain fusion molecules and uses thereof
JP6905163B2 (ja) 2015-09-03 2021-07-21 ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア サイトカイン放出症候群を予測するバイオマーカー
US20170096485A1 (en) 2015-10-02 2017-04-06 Hoffmann-La Roche Inc. Bispecific t cell activating antigen binding molecules
MX389194B (es) 2015-10-06 2025-03-20 Univ Minnesota Compuestos terapéuticos y métodos.
AU2016334063B2 (en) 2015-10-08 2023-05-25 Zymeworks Bc Inc. Antigen-binding polypeptide constructs comprising kappa and lambda light chains and uses thereof
US11702477B2 (en) 2015-11-06 2023-07-18 Orionis Biosciences BV Bi-functional chimeric proteins and uses thereof
WO2017165464A1 (en) 2016-03-21 2017-09-28 Elstar Therapeutics, Inc. Multispecific and multifunctional molecules and uses thereof
WO2017167350A1 (en) 2016-03-30 2017-10-05 Horst Lindhofer Multispecific antibodies for use in the treatment of a neoplasm of the urinary tract
IL262241B2 (en) 2016-04-13 2024-05-01 Sanofi Sa Trispecific and/or trivalent binding proteins with a crossover dual variable domain arm and a traditional antibody fab arm, pharmaceutical composition comprising said binding proteins and their uses in preventing and/or treating cancer or inflammatory diseases
CA2937157A1 (en) 2016-07-25 2018-01-25 Ucl Business Ltd Protein-based t-cell receptor knockdown
CN109906232B (zh) 2016-09-23 2023-11-07 马伦戈治疗公司 包含λ轻链和κ轻链的多特异性抗体分子
EP3523331A1 (en) 2016-10-07 2019-08-14 Novartis AG Chimeric antigen receptors for the treatment of cancer
US11851491B2 (en) 2016-11-22 2023-12-26 TCR2 Therapeutics Inc. Compositions and methods for TCR reprogramming using fusion proteins
CA3051866A1 (en) 2017-02-01 2018-08-09 Nant Holdings Ip, Llc Calreticulin-mediated cancer treatment
WO2018151820A1 (en) 2017-02-16 2018-08-23 Elstar Therapeutics, Inc. Multifunctional molecules comprising a trimeric ligand and uses thereof
US12134654B2 (en) 2017-04-19 2024-11-05 Marengo Therapeutics, Inc. Multispecific molecules and uses thereof
WO2018193103A1 (en) 2017-04-20 2018-10-25 Adc Therapeutics Sa Combination therapy with an anti-psma antibody-drug conjugate
CA3059769A1 (en) 2017-04-28 2018-11-01 Elstar Therapeutics, Inc. Multispecific molecules comprising a non-immunoglobulin heterodimerization domain and uses thereof
JP2020521452A (ja) 2017-05-24 2020-07-27 パンディオン・セラピューティクス・インコーポレイテッド 標的化免疫寛容
JP2020522254A (ja) 2017-05-31 2020-07-30 エルスター セラピューティクス, インコーポレイテッド 骨髄増殖性白血病(mpl)タンパク質に結合する多特異性分子およびその使用
GB201709203D0 (en) 2017-06-09 2017-07-26 Autolus Ltd Antigen-binding domain
US12195529B2 (en) 2017-06-21 2025-01-14 Gsbio, Llc Heterodimeric bispecific antibodies
TWI828625B (zh) 2017-06-25 2024-01-11 美商西雅圖免疫公司 引導及導航控制蛋白質以及彼之製造及使用方法
US20210017247A1 (en) 2017-07-03 2021-01-21 Torque Therapeutics, Inc. Fusion Molecules Targeting Immune Regulatory Cells and Uses Thereof
EP3654991A1 (en) 2017-07-19 2020-05-27 Rubius Therapeutics, Inc. Compositions and methods related to multimodal therapeutic cell systems for infectious disease
IL316357A (en) 2017-07-31 2024-12-01 Trishula Therapeutics Inc Anti-cd39 antibodies, compositions comprising anti-cd39 antibodies and methods of using anti-cd39 antibodies
WO2019028419A1 (en) 2017-08-03 2019-02-07 Synthorx, Inc. CYTOKINE CONJUGATES FOR THE TREATMENT OF PROLIFERATIVE AND INFECTIOUS DISEASES
WO2019035938A1 (en) 2017-08-16 2019-02-21 Elstar Therapeutics, Inc. MULTISPECIFIC MOLECULES BINDING TO BCMA AND USES THEREOF
US10578740B2 (en) 2017-08-23 2020-03-03 Mezmeriz Inc. Coherent optical distance measurement apparatus and method
EP3672990A1 (en) 2017-08-25 2020-07-01 Five Prime Therapeutics, Inc. B7-h4 antibodies and methods of use thereof
SG11202002298PA (en) 2017-09-14 2020-04-29 Dragonfly Therapeutics Inc Proteins binding nkg2d, cd16, and c-type lectin-like molecule-1 (cll-1)
MX2020004185A (es) 2017-09-27 2021-01-08 Univ Southern California Nuevas plataformas para coestimulacion, nuevos diseños car y otras mejoras para terapia celular adoptiva.
GB201718088D0 (en) 2017-11-01 2017-12-13 Autolus Ltd Vectors
US20200299349A1 (en) 2017-11-21 2020-09-24 The Board Of Trustees Of The Leland Stanford Junior University Partial agonists of interleukin-2
AU2018371114A1 (en) 2017-11-21 2020-05-07 Innate Pharma Multispecific antigen binding proteins
JP7348899B2 (ja) 2017-12-08 2023-09-21 マレンゴ・セラピューティクス,インコーポレーテッド 多重特異性分子及びその使用
RU2694412C9 (ru) 2017-12-25 2019-09-18 Федеральное государственное бюджетное образовательное учреждение высшего образования "Российский национальный исследовательский медицинский университет им. Н.И. Пирогова" Министерства здравоохранения Российской Федерации (ФГБОУ ВО РНИМУ им. Н.И. Пирогова Минздрава России) Моноклональные антитела и способы их применения
CN111527109B (zh) 2017-12-26 2024-11-01 南京金斯瑞生物科技有限公司 以抗体Fc区为骨架的融合蛋白二聚体及其应用
US11667713B2 (en) 2017-12-28 2023-06-06 Chugai Seiyaku Kabushiki Kaisha Cytotoxicity-inducing therapeutic agent
EP3737692A4 (en) 2018-01-09 2021-09-29 Elstar Therapeutics, Inc. CALRETICULIN AND MODIFIED T-LYMPHOCYTES BINDING CONSTRUCTIONS FOR THE TREATMENT OF DISEASES
GB201800298D0 (en) 2018-01-09 2018-02-21 Autolus Ltd Method
WO2019158764A1 (en) 2018-02-16 2019-08-22 Iltoo Pharma Use of interleukin 2 for treating sjögren's syndrome
US12152073B2 (en) 2018-03-14 2024-11-26 Marengo Therapeutics, Inc. Multifunctional molecules that bind to calreticulin and uses thereof
WO2019178364A2 (en) 2018-03-14 2019-09-19 Elstar Therapeutics, Inc. Multifunctional molecules and uses thereof
US20210024631A1 (en) 2018-03-28 2021-01-28 Orionis Biosciences, Inc. Bi-functional proteins and construction thereof
CA3099308A1 (en) 2018-05-21 2019-11-28 Compass Therapeutics Llc Compositions and methods for enhancing the killing of target cells by nk cells
EA202091977A1 (ru) 2018-05-28 2021-02-09 Драгонфлай Терапьютикс, Инк. Мультиспецифические связывающие белки, которые связывают cd33, nkg2d и cd16, и способы применения
EP3810640A1 (en) 2018-06-25 2021-04-28 University of Washington De novo design of potent and selective interleukin mimetics
EP3818083A2 (en) 2018-07-03 2021-05-12 Elstar Therapeutics, Inc. Anti-tcr antibody molecules and uses thereof
US20210277120A1 (en) 2018-07-18 2021-09-09 The General Hospital Corporation Compositions and methods for treatment of t cell malignancies
CN108949698B (zh) 2018-07-31 2019-05-31 广东和信健康科技有限公司 杂交瘤细胞株c11-6f7及其产生的hcmv单克隆抗体和应用
JOP20210022A1 (ar) 2018-08-03 2021-01-28 Amgen Inc بنيات جسم مضاد لـ cldn18.2وcd3
GB201812650D0 (en) 2018-08-03 2018-09-19 Autolus Ltd Molecular assessment of TRBC usage
EA202091888A1 (ru) 2018-08-08 2020-10-23 Драгонфлай Терапьютикс, Инк. Вариабельные домены антител, нацеленные на рецептор nkg2d
WO2020057646A1 (zh) 2018-09-21 2020-03-26 信达生物制药(苏州)有限公司 新型白介素2及其用途
SG11202103022WA (en) 2018-09-25 2021-04-29 Harpoon Therapeutics Inc Dll3 binding proteins and methods of use
JP2022502443A (ja) 2018-09-28 2022-01-11 ピエール、ファーブル、メディカマン 癌の処置のための新規な免疫サイトカイン
CN113194984A (zh) 2018-10-18 2021-07-30 金德雷德生物科学股份有限公司 兽用的与新生儿Fc受体(FcRn)结合改变的Fc变体
GB201817172D0 (en) 2018-10-22 2018-12-05 Autolus Ltd Antibody
AU2019366956B2 (en) 2018-10-23 2025-10-30 Dragonfly Therapeutics, Inc. Heterodimeric Fc-fused proteins
US12378295B2 (en) 2018-10-29 2025-08-05 1Globe Biomedical Co., Ltd. Rationally designed protein compositions
GB201817822D0 (en) 2018-10-31 2018-12-19 Autolus Ltd Binding domain
EP3883956A1 (en) 2018-11-20 2021-09-29 University of Washington Split interleukin mimetics and their use
AR117735A1 (es) 2018-12-25 2021-08-25 Joint Stock Company “Biocad” ANTICUERPOS MONOCLONALES QUE SE UNEN ESPECÍFICAMENTE A LA REGIÓN b DE LA FAMILIA TRBV-9 DEL RECEPTOR DE CÉLULAS T HUMANO, Y LOS MÉTODOS PARA SU USO
RU2712251C1 (ru) 2018-12-25 2020-01-27 Федеральное государственное автономное образовательное учреждение высшего образования "Российский национальный исследовательский медицинский университет имени Н.И. Пирогова" Министерства здравоохранения Российской Федерации (ФГАОУ ВО РНИМУ им. Н.И. Пирогова Минздрава России) Гуманизированные антитела против участка бета цепи 9-го семейства TRBV9 TKP человека, и способы их применения
GB2595980B (en) * 2019-01-04 2023-06-14 Marengo Therapeutics Inc Anti-TCR antibody molecules and uses thereof
WO2020154032A1 (en) 2019-01-23 2020-07-30 Massachusetts Institute Of Technology Combination immunotherapy dosing regimen for immune checkpoint blockade
WO2020172601A1 (en) 2019-02-21 2020-08-27 Elstar Therapeutics, Inc. Multifunctional molecules that bind to calreticulin and uses thereof
JP7710373B2 (ja) 2019-02-21 2025-07-18 マレンゴ・セラピューティクス,インコーポレーテッド T細胞関連のがん細胞に結合する多機能性分子およびその使用
AU2020226904B2 (en) 2019-02-21 2025-05-01 Marengo Therapeutics, Inc. Anti-TCR antibody molecules and uses thereof
AU2020224681A1 (en) 2019-02-21 2021-09-16 Marengo Therapeutics, Inc. Antibody molecules that bind to NKp30 and uses thereof
EP3927745A1 (en) 2019-02-21 2021-12-29 Marengo Therapeutics, Inc. Multifunctional molecules that bind to t cells and uses thereof to treat autoimmune disorders
WO2020180591A1 (en) 2019-03-01 2020-09-10 Allogene Therapeutics, Inc. Dll3 targeting chimeric antigen receptors and binding agents
JP7566766B2 (ja) 2019-03-11 2024-10-15 ヤンセン バイオテツク,インコーポレーテツド 抗Vβ17/抗CD123二重特異性抗体
WO2020249757A1 (en) 2019-06-14 2020-12-17 Philogen S.P.A Immunoconjugates comprising a single chain diabody and interleukin-15 or interleukin-15 and a sushi domain of interleukin-15 receptor alpha
EP4054633A1 (en) 2019-11-05 2022-09-14 Merck Patent GmbH Combined inhibition of pd-1, tgfb and tigit for the treatment of cancer
JP7590430B2 (ja) 2019-11-14 2024-11-26 マレンゴ・セラピューティクス,インコーポレーテッド 抗tcr抗体分子およびその使用
CN116234829A (zh) 2020-01-03 2023-06-06 马伦戈治疗公司 抗tcr抗体分子及其用途
WO2021138407A2 (en) 2020-01-03 2021-07-08 Marengo Therapeutics, Inc. Multifunctional molecules that bind to cd33 and uses thereof
KR20220147583A (ko) 2020-01-09 2022-11-03 바이오뮤넥스 파마슈티컬스 Mait 및 종양 세포 둘 모두에 결합하는 다중특이적 항체
US20230108300A1 (en) * 2020-01-29 2023-04-06 The Trustees Of The University Of Pennsylvania Compositions and methods of t cell receptor vb family member targeting for the treatment of t cell associated disease
WO2021188454A1 (en) 2020-03-16 2021-09-23 Marengo Therapeutics, Inc. Engineered cell compositions and methods of use thereof
GB2612450A (en) 2020-04-24 2023-05-03 Marengo Therapeutics Inc Multifunctional molecules that bind to T cell related cancer cells and uses thereof
CA3190755A1 (en) 2020-08-26 2022-03-03 Andreas Loew Multifunctional molecules that bind to calreticulin and uses thereof
AU2021331076A1 (en) 2020-08-26 2023-04-06 Marengo Therapeutics, Inc. Antibody molecules that bind to NKp30 and uses thereof
KR20230074487A (ko) 2020-08-26 2023-05-30 마렝고 테라퓨틱스, 인크. Trbc1 또는 trbc2를 검출하는 방법
TW202246338A (zh) 2021-02-17 2022-12-01 英商適應生物治療有限公司 抗TCRδ可變1抗體
WO2022179580A1 (zh) 2021-02-26 2022-09-01 盛禾(中国)生物制药有限公司 一种抗NKp30抗体及其应用
CA3214757A1 (en) 2021-04-08 2022-10-13 Andreas Loew Multifuntional molecules binding to tcr and uses thereof
US20240317856A1 (en) 2021-05-10 2024-09-26 Amgen Inc. Dosing regimen for combination therapy targeting dll3 and pd-1
WO2023081412A2 (en) 2021-11-05 2023-05-11 Marengo Therapeutics, Inc. Immune cell populations and uses thereof
CN118786150A (zh) 2021-12-22 2024-10-15 马伦戈治疗公司 与tcr结合的多功能分子及其用途
EP4466019A4 (en) 2022-01-21 2026-01-07 Marengo Therapeutics Inc MULTIFUNCTIONAL MOLECULES COMPRISING A G6B BINDER AND/OR A CD34 BINDER AND THEIR USES
AU2023361491A1 (en) 2022-10-12 2025-05-08 Marengo Therapeutics, Inc. Multifunctional molecules binding to tcr and uses thereof
EP4601747A1 (en) 2022-10-12 2025-08-20 Marengo Therapeutics, Inc. Multifunctional molecules binding to tcr and uses thereof
WO2024197082A2 (en) 2023-03-21 2024-09-26 Marengo Therapeutics, Inc. Tcr targeting molecules and uses thereof
WO2024226532A2 (en) 2023-04-24 2024-10-31 Marengo Therapeutics, Inc. Multifunctional molecules binding to tcr and uses thereof
AU2024264260A1 (en) 2023-04-27 2025-11-13 Marengo Therapeutics, Inc. Combination therapies using molecules binding to tcr
EP4724500A2 (en) 2023-06-09 2026-04-15 Marengo Therapeutics, Inc. Multispecific molecules binding to tcr and uses thereof
WO2025049771A1 (en) 2023-08-30 2025-03-06 Marengo Therapeutics, Inc. Multifunctional molecules binding to tcr and uses thereof
WO2025080685A2 (en) 2023-10-10 2025-04-17 Marengo Therapeutics, Inc. Antibody molecules that bind to nkp30 and uses thereof

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12247060B2 (en) 2018-01-09 2025-03-11 Marengo Therapeutics, Inc. Calreticulin binding constructs and engineered T cells for the treatment of diseases
US12152073B2 (en) 2018-03-14 2024-11-26 Marengo Therapeutics, Inc. Multifunctional molecules that bind to calreticulin and uses thereof
US12351632B2 (en) 2018-07-03 2025-07-08 Marengo Therapeutics, Inc. Anti-TCR antibody molecules and uses thereof
US11965025B2 (en) 2018-07-03 2024-04-23 Marengo Therapeutics, Inc. Method of treating solid cancers with bispecific interleukin-anti-TCRß molecules
US12286477B2 (en) 2018-07-03 2025-04-29 Marengo Therapeutics, Inc. Anti-TCR antibody molecules and uses thereof
US12384842B2 (en) 2019-02-21 2025-08-12 Marengo Therapeutics, Inc. Antibody molecules that bind to NKP30 and uses thereof
US12358982B2 (en) 2019-02-21 2025-07-15 Marengo Therapeutics, Inc. Multifunctional molecules that bind to T cell related cancer cells and uses thereof
US12486326B2 (en) 2020-01-03 2025-12-02 Marengo Therapeutics, Inc. Anti-TCR antibody molecules and uses thereof
WO2023081412A3 (en) * 2021-11-05 2023-08-03 Marengo Therapeutics, Inc. Immune cell populations and uses thereof
GB2631849A (en) * 2021-12-22 2025-01-15 Marengo Therapeutics Inc Multifuntional molecules binding to TCR and uses thereof
WO2023122206A3 (en) * 2021-12-22 2023-08-31 Marengo Therapeutics, Inc. Multifuntional molecules binding to tcr and uses thereof
EP4453039A4 (en) * 2021-12-22 2025-12-17 Marengo Therapeutics Inc TCR-binding multifunctional molecules and uses thereof
WO2024197082A3 (en) * 2023-03-21 2024-11-07 Marengo Therapeutics, Inc. Tcr targeting molecules and uses thereof
GB2644460A (en) * 2023-03-21 2026-04-15 Marengo Therapeutics Inc TCR targeting molecules and uses thereof
WO2024226532A3 (en) * 2023-04-24 2025-01-16 Marengo Therapeutics, Inc. Multifunctional molecules binding to tcr and uses thereof
WO2025051339A1 (en) * 2023-09-05 2025-03-13 Tiber Biotech Srl SINGLE-CHAIN VARIABLE FRAGMENT AND MOLECULES DERIVING THEREFROM THAT BIND FRAGMENT TRVB5-1 OF THE β CHAIN OF HUMAN T-CELL RECEPTOR

Also Published As

Publication number Publication date
GB2609554A (en) 2023-02-08
JP2026027226A (ja) 2026-02-18
CA3166629A1 (en) 2021-07-08
WO2021138474A3 (en) 2021-09-02
AU2020416273A1 (en) 2022-07-28
US20260022173A1 (en) 2026-01-22
GB202210131D0 (en) 2022-08-24
US12486326B2 (en) 2025-12-02
EP4084823A2 (en) 2022-11-09
EP4084823A4 (en) 2024-05-15
US20230374133A1 (en) 2023-11-23
US20230227552A1 (en) 2023-07-20
CN116234829A (zh) 2023-06-06
GB2609554B (en) 2025-08-20
JP2023509708A (ja) 2023-03-09

Similar Documents

Publication Publication Date Title
US12351632B2 (en) Anti-TCR antibody molecules and uses thereof
US12486326B2 (en) Anti-TCR antibody molecules and uses thereof
US20250099579A1 (en) Multispecific molecules binding to tcr and uses thereof
US20240409636A1 (en) Multifunctional molecules binding to tcr and uses thereof
US20250297007A1 (en) Multifunctional molecules binding to tcr and uses thereof
AU2021331075A1 (en) Multifunctional molecules that bind to calreticulin and uses thereof
US20240400990A1 (en) Immune cell populations and uses thereof
WO2024226532A2 (en) Multifunctional molecules binding to tcr and uses thereof
WO2025222063A2 (en) Multifunctional molecules binding to tcr and uses thereof
WO2025222066A1 (en) Multifunctional molecules binding to tcr and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20910571

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 3166629

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022541232

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 202210131

Country of ref document: GB

Kind code of ref document: A

Free format text: PCT FILING DATE = 20201230

WWE Wipo information: entry into national phase

Ref document number: 2210131.5

Country of ref document: GB

ENP Entry into the national phase

Ref document number: 2020416273

Country of ref document: AU

Date of ref document: 20201230

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2020910571

Country of ref document: EP

Effective date: 20220803

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20910571

Country of ref document: EP

Kind code of ref document: A2

WWP Wipo information: published in national office

Ref document number: 2210131.5

Country of ref document: GB

WWG Wipo information: grant in national office

Ref document number: 2210131.5

Country of ref document: GB