US20140179770A1 - Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications - Google Patents
Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications Download PDFInfo
- Publication number
- US20140179770A1 US20140179770A1 US14/104,837 US201314104837A US2014179770A1 US 20140179770 A1 US20140179770 A1 US 20140179770A1 US 201314104837 A US201314104837 A US 201314104837A US 2014179770 A1 US2014179770 A1 US 2014179770A1
- Authority
- US
- United States
- Prior art keywords
- sequence
- crispr
- tracr
- target
- cells
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 238000000034 method Methods 0.000 title claims abstract description 172
- 239000000203 mixture Substances 0.000 title claims abstract description 87
- 238000012384 transportation and delivery Methods 0.000 title abstract description 132
- 238000005457 optimization Methods 0.000 title abstract description 9
- 230000001225 therapeutic effect Effects 0.000 title description 20
- 108091033409 CRISPR Proteins 0.000 claims abstract description 173
- 239000013598 vector Substances 0.000 claims abstract description 163
- 210000003527 eukaryotic cell Anatomy 0.000 claims abstract description 40
- 238000010354 CRISPR gene editing Methods 0.000 claims abstract 14
- 210000004027 cell Anatomy 0.000 claims description 179
- 102000004190 Enzymes Human genes 0.000 claims description 156
- 108090000790 Enzymes Proteins 0.000 claims description 156
- 230000014509 gene expression Effects 0.000 claims description 110
- 102000040430 polynucleotide Human genes 0.000 claims description 87
- 108091033319 polynucleotide Proteins 0.000 claims description 87
- 239000002157 polynucleotide Substances 0.000 claims description 87
- 108020004414 DNA Proteins 0.000 claims description 63
- 241000282414 Homo sapiens Species 0.000 claims description 62
- 108091032973 (ribonucleotides)n+m Proteins 0.000 claims description 51
- 239000002502 liposome Substances 0.000 claims description 48
- 239000002105 nanoparticle Substances 0.000 claims description 46
- 108020004999 messenger RNA Proteins 0.000 claims description 34
- 238000011282 treatment Methods 0.000 claims description 32
- 241000700605 Viruses Species 0.000 claims description 31
- 239000013612 plasmid Substances 0.000 claims description 31
- 230000001105 regulatory effect Effects 0.000 claims description 30
- 102000039446 nucleic acids Human genes 0.000 claims description 29
- 108020004707 nucleic acids Proteins 0.000 claims description 29
- 150000007523 nucleic acids Chemical class 0.000 claims description 28
- 239000013603 viral vector Substances 0.000 claims description 28
- 241000713666 Lentivirus Species 0.000 claims description 27
- 108091092236 Chimeric RNA Proteins 0.000 claims description 22
- 238000000338 in vitro Methods 0.000 claims description 21
- 230000030648 nucleus localization Effects 0.000 claims description 17
- 230000009870 specific binding Effects 0.000 claims description 16
- 239000002773 nucleotide Substances 0.000 claims description 13
- 125000003729 nucleotide group Chemical group 0.000 claims description 13
- 241000124008 Mammalia Species 0.000 claims description 11
- 210000004962 mammalian cell Anatomy 0.000 claims description 11
- 230000001939 inductive effect Effects 0.000 claims description 10
- 238000004806 packaging method and process Methods 0.000 claims description 8
- 229910052740 iodine Inorganic materials 0.000 claims description 7
- 241000238631 Hexapoda Species 0.000 claims description 6
- 108091026890 Coding region Proteins 0.000 claims description 5
- 230000007547 defect Effects 0.000 claims description 5
- 230000005764 inhibitory process Effects 0.000 claims description 5
- 230000002401 inhibitory effect Effects 0.000 claims description 4
- 230000010076 replication Effects 0.000 claims description 4
- 241000701447 unidentified baculovirus Species 0.000 claims description 4
- 241000589941 Azospirillum Species 0.000 claims description 2
- 241000206602 Eukaryota Species 0.000 claims description 2
- 241000194017 Streptococcus Species 0.000 claims description 2
- 241000204031 Mycoplasma Species 0.000 claims 2
- 241000606125 Bacteroides Species 0.000 claims 1
- 241000186394 Eubacterium Species 0.000 claims 1
- 241000178967 Filifactor Species 0.000 claims 1
- 241000589565 Flavobacterium Species 0.000 claims 1
- 241000032681 Gluconacetobacter Species 0.000 claims 1
- 241000186660 Lactobacillus Species 0.000 claims 1
- 241000589248 Legionella Species 0.000 claims 1
- 208000007764 Legionnaires' Disease Diseases 0.000 claims 1
- 241000588653 Neisseria Species 0.000 claims 1
- 241000135938 Nitratifractor Species 0.000 claims 1
- 241001386753 Parvibaculum Species 0.000 claims 1
- 241000605947 Roseburia Species 0.000 claims 1
- 241000949716 Sphaerochaeta Species 0.000 claims 1
- 241000123710 Sutterella Species 0.000 claims 1
- 241000589886 Treponema Species 0.000 claims 1
- 229940039696 lactobacillus Drugs 0.000 claims 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 54
- 230000000694 effects Effects 0.000 abstract description 32
- 201000010099 disease Diseases 0.000 abstract description 25
- 231100000419 toxicity Toxicity 0.000 abstract description 10
- 230000001988 toxicity Effects 0.000 abstract description 10
- 210000000056 organ Anatomy 0.000 abstract description 7
- 238000013461 design Methods 0.000 abstract description 6
- 230000009918 complex formation Effects 0.000 abstract 1
- 108090000623 proteins and genes Proteins 0.000 description 240
- 229940088598 enzyme Drugs 0.000 description 155
- 102000004169 proteins and genes Human genes 0.000 description 131
- 235000018102 proteins Nutrition 0.000 description 129
- 108020004459 Small interfering RNA Proteins 0.000 description 107
- 239000004055 small Interfering RNA Substances 0.000 description 101
- 108020005004 Guide RNA Proteins 0.000 description 100
- 230000035772 mutation Effects 0.000 description 67
- 150000002632 lipids Chemical class 0.000 description 60
- 210000001808 exosome Anatomy 0.000 description 55
- 239000003814 drug Substances 0.000 description 53
- 239000002245 particle Substances 0.000 description 52
- 239000000047 product Substances 0.000 description 52
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 50
- 238000001727 in vivo Methods 0.000 description 49
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 45
- 241000191967 Staphylococcus aureus Species 0.000 description 45
- 230000008685 targeting Effects 0.000 description 43
- 210000004556 brain Anatomy 0.000 description 42
- 229940079593 drug Drugs 0.000 description 37
- 150000001875 compounds Chemical class 0.000 description 36
- 238000002347 injection Methods 0.000 description 35
- 239000007924 injection Substances 0.000 description 35
- 238000003776 cleavage reaction Methods 0.000 description 33
- 230000007017 scission Effects 0.000 description 33
- 239000002585 base Substances 0.000 description 30
- 208000035475 disorder Diseases 0.000 description 29
- 210000001519 tissue Anatomy 0.000 description 28
- 238000009472 formulation Methods 0.000 description 27
- 238000001415 gene therapy Methods 0.000 description 26
- 229940090044 injection Drugs 0.000 description 26
- 210000002569 neuron Anatomy 0.000 description 26
- 229920000642 polymer Polymers 0.000 description 26
- 235000012000 cholesterol Nutrition 0.000 description 25
- 230000004048 modification Effects 0.000 description 25
- 238000012986 modification Methods 0.000 description 25
- -1 RecBCD Proteins 0.000 description 24
- 241001465754 Metazoa Species 0.000 description 23
- 230000015572 biosynthetic process Effects 0.000 description 22
- 210000004185 liver Anatomy 0.000 description 21
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 20
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 20
- 230000001404 mediated effect Effects 0.000 description 20
- 241000699670 Mus sp. Species 0.000 description 19
- 238000010362 genome editing Methods 0.000 description 19
- 239000005090 green fluorescent protein Substances 0.000 description 19
- 241000699666 Mus <mouse, genus> Species 0.000 description 18
- 229920001223 polyethylene glycol Polymers 0.000 description 18
- 108090000765 processed proteins & peptides Proteins 0.000 description 18
- 238000001890 transfection Methods 0.000 description 18
- 206010028980 Neoplasm Diseases 0.000 description 17
- 238000003556 assay Methods 0.000 description 17
- 239000003795 chemical substances by application Substances 0.000 description 17
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 17
- 239000002953 phosphate buffered saline Substances 0.000 description 17
- 241000196324 Embryophyta Species 0.000 description 16
- 238000003197 gene knockdown Methods 0.000 description 16
- NRJAVPSFFCBXDT-HUESYALOSA-N 1,2-distearoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCCCCCC NRJAVPSFFCBXDT-HUESYALOSA-N 0.000 description 15
- 102000053602 DNA Human genes 0.000 description 15
- 238000013459 approach Methods 0.000 description 15
- 238000012377 drug delivery Methods 0.000 description 15
- 210000003027 ear inner Anatomy 0.000 description 15
- 210000001508 eye Anatomy 0.000 description 15
- 230000006870 function Effects 0.000 description 15
- 238000002513 implantation Methods 0.000 description 15
- 239000000243 solution Substances 0.000 description 15
- 101000931098 Homo sapiens DNA (cytosine-5)-methyltransferase 1 Proteins 0.000 description 14
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 14
- 239000000412 dendrimer Substances 0.000 description 14
- 229920000736 dendritic polymer Polymers 0.000 description 14
- 238000002744 homologous recombination Methods 0.000 description 14
- 230000006801 homologous recombination Effects 0.000 description 14
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 14
- 241001655883 Adeno-associated virus - 1 Species 0.000 description 13
- 102100036279 DNA (cytosine-5)-methyltransferase 1 Human genes 0.000 description 13
- 239000002202 Polyethylene glycol Substances 0.000 description 13
- 239000008280 blood Substances 0.000 description 13
- 125000002091 cationic group Chemical group 0.000 description 13
- 238000005516 engineering process Methods 0.000 description 13
- 230000008439 repair process Effects 0.000 description 13
- 238000001262 western blot Methods 0.000 description 13
- 210000004369 blood Anatomy 0.000 description 12
- 230000000295 complement effect Effects 0.000 description 12
- 239000007943 implant Substances 0.000 description 12
- 230000001965 increasing effect Effects 0.000 description 12
- 238000003780 insertion Methods 0.000 description 12
- 210000004940 nucleus Anatomy 0.000 description 12
- 208000002491 severe combined immunodeficiency Diseases 0.000 description 12
- 210000000130 stem cell Anatomy 0.000 description 12
- 239000000126 substance Substances 0.000 description 12
- 241000701161 unidentified adenovirus Species 0.000 description 12
- 230000003612 virological effect Effects 0.000 description 12
- 108020004705 Codon Proteins 0.000 description 11
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 11
- 229940024606 amino acid Drugs 0.000 description 11
- 235000001014 amino acid Nutrition 0.000 description 11
- 150000001413 amino acids Chemical class 0.000 description 11
- 238000004458 analytical method Methods 0.000 description 11
- 230000002759 chromosomal effect Effects 0.000 description 11
- 230000009368 gene silencing by RNA Effects 0.000 description 11
- 238000011534 incubation Methods 0.000 description 11
- 230000037431 insertion Effects 0.000 description 11
- 102000004196 processed proteins & peptides Human genes 0.000 description 11
- 241000894007 species Species 0.000 description 11
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 10
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 10
- 241000282412 Homo Species 0.000 description 10
- 241000193996 Streptococcus pyogenes Species 0.000 description 10
- 230000003247 decreasing effect Effects 0.000 description 10
- 238000012217 deletion Methods 0.000 description 10
- 102000005962 receptors Human genes 0.000 description 10
- 108020003175 receptors Proteins 0.000 description 10
- 238000012360 testing method Methods 0.000 description 10
- 230000035897 transcription Effects 0.000 description 10
- 238000013518 transcription Methods 0.000 description 10
- 101710163270 Nuclease Proteins 0.000 description 9
- 230000008901 benefit Effects 0.000 description 9
- 230000027455 binding Effects 0.000 description 9
- 238000009739 binding Methods 0.000 description 9
- 238000005520 cutting process Methods 0.000 description 9
- 230000037430 deletion Effects 0.000 description 9
- 238000005538 encapsulation Methods 0.000 description 9
- 230000030279 gene silencing Effects 0.000 description 9
- 238000004519 manufacturing process Methods 0.000 description 9
- 230000002829 reductive effect Effects 0.000 description 9
- 239000002924 silencing RNA Substances 0.000 description 9
- 239000000725 suspension Substances 0.000 description 9
- 230000009261 transgenic effect Effects 0.000 description 9
- 102100029470 Apolipoprotein E Human genes 0.000 description 8
- 108700013048 CCL2 Proteins 0.000 description 8
- 208000024172 Cardiovascular disease Diseases 0.000 description 8
- 241000713730 Equine infectious anemia virus Species 0.000 description 8
- 241000700159 Rattus Species 0.000 description 8
- 230000004913 activation Effects 0.000 description 8
- 238000001994 activation Methods 0.000 description 8
- 230000034431 double-strand break repair via homologous recombination Effects 0.000 description 8
- 230000002068 genetic effect Effects 0.000 description 8
- 210000002768 hair cell Anatomy 0.000 description 8
- 238000001802 infusion Methods 0.000 description 8
- 239000000463 material Substances 0.000 description 8
- NFQBIAXADRDUGK-KWXKLSQISA-N n,n-dimethyl-2,3-bis[(9z,12z)-octadeca-9,12-dienoxy]propan-1-amine Chemical compound CCCCC\C=C/C\C=C/CCCCCCCCOCC(CN(C)C)OCCCCCCCC\C=C/C\C=C/CCCCC NFQBIAXADRDUGK-KWXKLSQISA-N 0.000 description 8
- 230000006780 non-homologous end joining Effects 0.000 description 8
- 210000002243 primary neuron Anatomy 0.000 description 8
- 102100024812 DNA (cytosine-5)-methyltransferase 3A Human genes 0.000 description 7
- 108050002829 DNA (cytosine-5)-methyltransferase 3A Proteins 0.000 description 7
- 102100023915 Insulin Human genes 0.000 description 7
- 108090001061 Insulin Proteins 0.000 description 7
- 238000011529 RT qPCR Methods 0.000 description 7
- FPIPGXGPPPQFEQ-OVSJKPMPSA-N all-trans-retinol Chemical compound OC\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-OVSJKPMPSA-N 0.000 description 7
- 150000001412 amines Chemical class 0.000 description 7
- 125000003277 amino group Chemical group 0.000 description 7
- 239000000427 antigen Substances 0.000 description 7
- 102000036639 antigens Human genes 0.000 description 7
- 108091007433 antigens Proteins 0.000 description 7
- 201000011510 cancer Diseases 0.000 description 7
- 238000000576 coating method Methods 0.000 description 7
- 235000018417 cysteine Nutrition 0.000 description 7
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 7
- 210000004443 dendritic cell Anatomy 0.000 description 7
- 239000000499 gel Substances 0.000 description 7
- 229940125396 insulin Drugs 0.000 description 7
- 239000003446 ligand Substances 0.000 description 7
- 210000004379 membrane Anatomy 0.000 description 7
- 239000012528 membrane Substances 0.000 description 7
- 230000036961 partial effect Effects 0.000 description 7
- 244000052769 pathogen Species 0.000 description 7
- 230000008569 process Effects 0.000 description 7
- 238000012546 transfer Methods 0.000 description 7
- 102100021257 Beta-secretase 1 Human genes 0.000 description 6
- 102100031151 C-C chemokine receptor type 2 Human genes 0.000 description 6
- 102100021943 C-C motif chemokine 2 Human genes 0.000 description 6
- 102000003908 Cathepsin D Human genes 0.000 description 6
- 108090000258 Cathepsin D Proteins 0.000 description 6
- 102100024108 Dystrophin Human genes 0.000 description 6
- 108010069091 Dystrophin Proteins 0.000 description 6
- 238000002965 ELISA Methods 0.000 description 6
- 101001108225 Homo sapiens NADPH oxidase 3 Proteins 0.000 description 6
- 101000801643 Homo sapiens Retinal-specific phospholipid-transporting ATPase ABCA4 Proteins 0.000 description 6
- 102100026261 Metalloproteinase inhibitor 3 Human genes 0.000 description 6
- 102100021874 NADPH oxidase 3 Human genes 0.000 description 6
- 108010071690 Prealbumin Proteins 0.000 description 6
- 102100029290 Transthyretin Human genes 0.000 description 6
- 125000003275 alpha amino acid group Chemical group 0.000 description 6
- 230000000975 bioactive effect Effects 0.000 description 6
- 230000008499 blood brain barrier function Effects 0.000 description 6
- 210000001218 blood-brain barrier Anatomy 0.000 description 6
- 210000003855 cell nucleus Anatomy 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- 238000009792 diffusion process Methods 0.000 description 6
- 238000009826 distribution Methods 0.000 description 6
- 239000013604 expression vector Substances 0.000 description 6
- 230000005847 immunogenicity Effects 0.000 description 6
- 208000015181 infectious disease Diseases 0.000 description 6
- 210000003734 kidney Anatomy 0.000 description 6
- 210000004698 lymphocyte Anatomy 0.000 description 6
- 238000009126 molecular therapy Methods 0.000 description 6
- 239000008194 pharmaceutical composition Substances 0.000 description 6
- 230000002035 prolonged effect Effects 0.000 description 6
- 230000004044 response Effects 0.000 description 6
- 210000002966 serum Anatomy 0.000 description 6
- 238000003786 synthesis reaction Methods 0.000 description 6
- 238000010361 transduction Methods 0.000 description 6
- 230000026683 transduction Effects 0.000 description 6
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 5
- FPIPGXGPPPQFEQ-UHFFFAOYSA-N 13-cis retinol Natural products OCC=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-UHFFFAOYSA-N 0.000 description 5
- LRFJOIPOPUJUMI-KWXKLSQISA-N 2-[2,2-bis[(9z,12z)-octadeca-9,12-dienyl]-1,3-dioxolan-4-yl]-n,n-dimethylethanamine Chemical compound CCCCC\C=C/C\C=C/CCCCCCCCC1(CCCCCCCC\C=C/C\C=C/CCCCC)OCC(CCN(C)C)O1 LRFJOIPOPUJUMI-KWXKLSQISA-N 0.000 description 5
- 239000013607 AAV vector Substances 0.000 description 5
- 102000009027 Albumins Human genes 0.000 description 5
- 108010088751 Albumins Proteins 0.000 description 5
- 102000014461 Ataxins Human genes 0.000 description 5
- 108010078286 Ataxins Proteins 0.000 description 5
- 102000004219 Brain-derived neurotrophic factor Human genes 0.000 description 5
- 108090000715 Brain-derived neurotrophic factor Proteins 0.000 description 5
- 101710149815 C-C chemokine receptor type 2 Proteins 0.000 description 5
- 241000702421 Dependoparvovirus Species 0.000 description 5
- 206010013801 Duchenne Muscular Dystrophy Diseases 0.000 description 5
- 102000003869 Frataxin Human genes 0.000 description 5
- 108090000217 Frataxin Proteins 0.000 description 5
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 5
- 108010010234 HDL Lipoproteins Proteins 0.000 description 5
- 102000015779 HDL Lipoproteins Human genes 0.000 description 5
- 108090001005 Interleukin-6 Proteins 0.000 description 5
- 208000009869 Neu-Laxova syndrome Diseases 0.000 description 5
- 108010077850 Nuclear Localization Signals Proteins 0.000 description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 108091034117 Oligonucleotide Proteins 0.000 description 5
- 241000288906 Primates Species 0.000 description 5
- 102100033617 Retinal-specific phospholipid-transporting ATPase ABCA4 Human genes 0.000 description 5
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 5
- 208000009415 Spinocerebellar Ataxias Diseases 0.000 description 5
- 102000001435 Synapsin Human genes 0.000 description 5
- 108050009621 Synapsin Proteins 0.000 description 5
- 210000001744 T-lymphocyte Anatomy 0.000 description 5
- 239000002671 adjuvant Substances 0.000 description 5
- 238000010171 animal model Methods 0.000 description 5
- 210000003719 b-lymphocyte Anatomy 0.000 description 5
- 210000001185 bone marrow Anatomy 0.000 description 5
- 229940077737 brain-derived neurotrophic factor Drugs 0.000 description 5
- 230000003197 catalytic effect Effects 0.000 description 5
- 230000005782 double-strand break Effects 0.000 description 5
- 238000004520 electroporation Methods 0.000 description 5
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 5
- 229910052737 gold Inorganic materials 0.000 description 5
- 239000010931 gold Substances 0.000 description 5
- 210000002216 heart Anatomy 0.000 description 5
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 5
- 210000003494 hepatocyte Anatomy 0.000 description 5
- 210000005260 human cell Anatomy 0.000 description 5
- 238000001990 intravenous administration Methods 0.000 description 5
- 238000010253 intravenous injection Methods 0.000 description 5
- 238000011068 loading method Methods 0.000 description 5
- 229920002521 macromolecule Polymers 0.000 description 5
- 208000002780 macular degeneration Diseases 0.000 description 5
- 238000002156 mixing Methods 0.000 description 5
- 239000013600 plasmid vector Substances 0.000 description 5
- 108010040003 polyglutamine Proteins 0.000 description 5
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 230000001603 reducing effect Effects 0.000 description 5
- 238000011160 research Methods 0.000 description 5
- 238000012552 review Methods 0.000 description 5
- 238000003196 serial analysis of gene expression Methods 0.000 description 5
- 238000010186 staining Methods 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- 238000002560 therapeutic procedure Methods 0.000 description 5
- RSWGJHLUYNHPMX-UHFFFAOYSA-N Abietic-Saeure Natural products C12CCC(C(C)C)=CC2=CCC2C1(C)CCCC2(C)C(O)=O RSWGJHLUYNHPMX-UHFFFAOYSA-N 0.000 description 4
- 102100032187 Androgen receptor Human genes 0.000 description 4
- 101710095339 Apolipoprotein E Proteins 0.000 description 4
- 108010032963 Ataxin-1 Proteins 0.000 description 4
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 101710150192 Beta-secretase 1 Proteins 0.000 description 4
- 102100032752 C-reactive protein Human genes 0.000 description 4
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 4
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 4
- 230000007018 DNA scission Effects 0.000 description 4
- 241001337814 Erysiphe glycines Species 0.000 description 4
- 102000003951 Erythropoietin Human genes 0.000 description 4
- 108090000394 Erythropoietin Proteins 0.000 description 4
- 108010007005 Estrogen Receptor alpha Proteins 0.000 description 4
- 102100038595 Estrogen receptor Human genes 0.000 description 4
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 4
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 4
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 4
- 101001053946 Homo sapiens Dystrophin Proteins 0.000 description 4
- 101001048956 Homo sapiens Homeobox protein EMX1 Proteins 0.000 description 4
- 101000852815 Homo sapiens Insulin receptor Proteins 0.000 description 4
- 101001026232 Homo sapiens Small conductance calcium-activated potassium channel protein 3 Proteins 0.000 description 4
- 102000004889 Interleukin-6 Human genes 0.000 description 4
- 108091092195 Intron Proteins 0.000 description 4
- 108010052185 Myotonin-Protein Kinase Proteins 0.000 description 4
- 102100022437 Myotonin-protein kinase Human genes 0.000 description 4
- KHPCPRHQVVSZAH-HUOMCSJISA-N Rosin Natural products O(C/C=C/c1ccccc1)[C@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 KHPCPRHQVVSZAH-HUOMCSJISA-N 0.000 description 4
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 4
- 102100037442 Small conductance calcium-activated potassium channel protein 3 Human genes 0.000 description 4
- 241000194020 Streptococcus thermophilus Species 0.000 description 4
- 102100023532 Synaptic functional regulator FMR1 Human genes 0.000 description 4
- HCAJCMUKLZSPFT-KWXKLSQISA-N [3-(dimethylamino)-2-[(9z,12z)-octadeca-9,12-dienoyl]oxypropyl] (9z,12z)-octadeca-9,12-dienoate Chemical compound CCCCC\C=C/C\C=C/CCCCCCCC(=O)OCC(CN(C)C)OC(=O)CCCCCCC\C=C/C\C=C/CCCCC HCAJCMUKLZSPFT-KWXKLSQISA-N 0.000 description 4
- 206010064930 age-related macular degeneration Diseases 0.000 description 4
- 108010080146 androgen receptors Proteins 0.000 description 4
- 230000003466 anti-cipated effect Effects 0.000 description 4
- 230000000692 anti-sense effect Effects 0.000 description 4
- 239000007864 aqueous solution Substances 0.000 description 4
- 210000000988 bone and bone Anatomy 0.000 description 4
- 210000005013 brain tissue Anatomy 0.000 description 4
- 229920006317 cationic polymer Polymers 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 238000012937 correction Methods 0.000 description 4
- 210000003618 cortical neuron Anatomy 0.000 description 4
- 230000007423 decrease Effects 0.000 description 4
- 238000000502 dialysis Methods 0.000 description 4
- 210000005069 ears Anatomy 0.000 description 4
- 230000002526 effect on cardiovascular system Effects 0.000 description 4
- 230000002708 enhancing effect Effects 0.000 description 4
- 229940105423 erythropoietin Drugs 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 210000002744 extracellular matrix Anatomy 0.000 description 4
- 210000002950 fibroblast Anatomy 0.000 description 4
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 4
- 239000012634 fragment Substances 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 238000001476 gene delivery Methods 0.000 description 4
- 238000012226 gene silencing method Methods 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 230000001976 improved effect Effects 0.000 description 4
- 230000004807 localization Effects 0.000 description 4
- 210000004072 lung Anatomy 0.000 description 4
- 239000011159 matrix material Substances 0.000 description 4
- 208000015122 neurodegenerative disease Diseases 0.000 description 4
- 230000007935 neutral effect Effects 0.000 description 4
- 230000009437 off-target effect Effects 0.000 description 4
- 150000002924 oxiranes Chemical class 0.000 description 4
- 239000000546 pharmaceutical excipient Substances 0.000 description 4
- 150000003904 phospholipids Chemical class 0.000 description 4
- 229920000155 polyglutamine Polymers 0.000 description 4
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 4
- 230000002265 prevention Effects 0.000 description 4
- 150000003141 primary amines Chemical class 0.000 description 4
- 210000001236 prokaryotic cell Anatomy 0.000 description 4
- KAQKFAOMNZTLHT-OZUDYXHBSA-N prostaglandin I2 Chemical compound O1\C(=C/CCCC(O)=O)C[C@@H]2[C@@H](/C=C/[C@@H](O)CCCCC)[C@H](O)C[C@@H]21 KAQKFAOMNZTLHT-OZUDYXHBSA-N 0.000 description 4
- 210000001525 retina Anatomy 0.000 description 4
- 150000003839 salts Chemical class 0.000 description 4
- 210000001323 spiral ganglion Anatomy 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- 239000000758 substrate Substances 0.000 description 4
- 208000024891 symptom Diseases 0.000 description 4
- KHPCPRHQVVSZAH-UHFFFAOYSA-N trans-cinnamyl beta-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OCC=CC1=CC=CC=C1 KHPCPRHQVVSZAH-UHFFFAOYSA-N 0.000 description 4
- 230000002463 transducing effect Effects 0.000 description 4
- 239000012096 transfection reagent Substances 0.000 description 4
- 230000009466 transformation Effects 0.000 description 4
- 230000032258 transport Effects 0.000 description 4
- 238000005199 ultracentrifugation Methods 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 229910001868 water Inorganic materials 0.000 description 4
- KILNVBDSWZSGLL-KXQOOQHDSA-N 1,2-dihexadecanoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCCCC KILNVBDSWZSGLL-KXQOOQHDSA-N 0.000 description 3
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 3
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- 241001634120 Adeno-associated virus - 5 Species 0.000 description 3
- 102100036664 Adenosine deaminase Human genes 0.000 description 3
- 208000024827 Alzheimer disease Diseases 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- 102000007368 Ataxin-7 Human genes 0.000 description 3
- 108010032953 Ataxin-7 Proteins 0.000 description 3
- 102100020741 Atrophin-1 Human genes 0.000 description 3
- 108010074051 C-Reactive Protein Proteins 0.000 description 3
- 108010075016 Ceruloplasmin Proteins 0.000 description 3
- 102100023321 Ceruloplasmin Human genes 0.000 description 3
- 108010053085 Complement Factor H Proteins 0.000 description 3
- 102100035432 Complement factor H Human genes 0.000 description 3
- 241000195493 Cryptophyta Species 0.000 description 3
- 229920000858 Cyclodextrin Polymers 0.000 description 3
- 102000012192 Cystatin C Human genes 0.000 description 3
- 108010061642 Cystatin C Proteins 0.000 description 3
- 201000003883 Cystic fibrosis Diseases 0.000 description 3
- 102000004127 Cytokines Human genes 0.000 description 3
- 108090000695 Cytokines Proteins 0.000 description 3
- 241000701022 Cytomegalovirus Species 0.000 description 3
- 108010024491 DNA Methyltransferase 3A Proteins 0.000 description 3
- 238000000018 DNA microarray Methods 0.000 description 3
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 3
- 101710096438 DNA-binding protein Proteins 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 3
- 241000283086 Equidae Species 0.000 description 3
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 3
- 102000053171 Glial Fibrillary Acidic Human genes 0.000 description 3
- 101710193519 Glial fibrillary acidic protein Proteins 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 206010019695 Hepatic neoplasm Diseases 0.000 description 3
- 102100023823 Homeobox protein EMX1 Human genes 0.000 description 3
- 101000610551 Homo sapiens Prominin-1 Proteins 0.000 description 3
- 101001041393 Homo sapiens Serine protease HTRA1 Proteins 0.000 description 3
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 3
- 208000023105 Huntington disease Diseases 0.000 description 3
- 206010061218 Inflammation Diseases 0.000 description 3
- 101150008942 J gene Proteins 0.000 description 3
- 206010025421 Macule Diseases 0.000 description 3
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 208000018737 Parkinson disease Diseases 0.000 description 3
- 208000037581 Persistent Infection Diseases 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 102100021119 Serine protease HTRA1 Human genes 0.000 description 3
- 102100037082 Signal recognition particle 14 kDa protein Human genes 0.000 description 3
- 208000012827 T-B+ severe combined immunodeficiency due to gamma chain deficiency Diseases 0.000 description 3
- 108010073062 Transcription Activator-Like Effectors Proteins 0.000 description 3
- 108700019146 Transgenes Proteins 0.000 description 3
- 102000004243 Tubulin Human genes 0.000 description 3
- 108090000704 Tubulin Proteins 0.000 description 3
- 102100029591 V(D)J recombination-activating protein 2 Human genes 0.000 description 3
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 3
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 3
- FPIPGXGPPPQFEQ-BOOMUCAASA-N Vitamin A Natural products OC/C=C(/C)\C=C\C=C(\C)/C=C/C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-BOOMUCAASA-N 0.000 description 3
- 201000007146 X-linked severe combined immunodeficiency Diseases 0.000 description 3
- 108010017070 Zinc Finger Nucleases Proteins 0.000 description 3
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 3
- 230000002159 abnormal effect Effects 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 229940088710 antibiotic agent Drugs 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 210000001130 astrocyte Anatomy 0.000 description 3
- 239000013060 biological fluid Substances 0.000 description 3
- 238000001574 biopsy Methods 0.000 description 3
- 229960002685 biotin Drugs 0.000 description 3
- 239000011616 biotin Substances 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 125000003917 carbamoyl group Chemical group [H]N([H])C(*)=O 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- 230000015556 catabolic process Effects 0.000 description 3
- 108020001778 catalytic domains Proteins 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 210000000170 cell membrane Anatomy 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 210000003477 cochlea Anatomy 0.000 description 3
- 230000009850 completed effect Effects 0.000 description 3
- 230000003750 conditioning effect Effects 0.000 description 3
- 210000004087 cornea Anatomy 0.000 description 3
- 210000000805 cytoplasm Anatomy 0.000 description 3
- 230000006378 damage Effects 0.000 description 3
- 230000007812 deficiency Effects 0.000 description 3
- 238000006731 degradation reaction Methods 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 230000000994 depressogenic effect Effects 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 238000002296 dynamic light scattering Methods 0.000 description 3
- 210000001163 endosome Anatomy 0.000 description 3
- 230000001973 epigenetic effect Effects 0.000 description 3
- 238000001125 extrusion Methods 0.000 description 3
- ZXQYGBMAQZUVMI-GCMPRSNUSA-N gamma-cyhalothrin Chemical compound CC1(C)[C@@H](\C=C(/Cl)C(F)(F)F)[C@H]1C(=O)O[C@H](C#N)C1=CC=CC(OC=2C=CC=CC=2)=C1 ZXQYGBMAQZUVMI-GCMPRSNUSA-N 0.000 description 3
- 238000003209 gene knockout Methods 0.000 description 3
- 238000011331 genomic analysis Methods 0.000 description 3
- 210000005046 glial fibrillary acidic protein Anatomy 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 3
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 239000003102 growth factor Substances 0.000 description 3
- 210000002443 helper t lymphocyte Anatomy 0.000 description 3
- 102000047882 human INSR Human genes 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 238000011532 immunohistochemical staining Methods 0.000 description 3
- 230000003308 immunostimulating effect Effects 0.000 description 3
- 230000004054 inflammatory process Effects 0.000 description 3
- 239000003112 inhibitor Substances 0.000 description 3
- 230000002452 interceptive effect Effects 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 208000014018 liver neoplasm Diseases 0.000 description 3
- 231100000053 low toxicity Toxicity 0.000 description 3
- 238000004949 mass spectrometry Methods 0.000 description 3
- 230000035800 maturation Effects 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 210000004779 membrane envelope Anatomy 0.000 description 3
- 230000011987 methylation Effects 0.000 description 3
- 238000007069 methylation reaction Methods 0.000 description 3
- 239000000693 micelle Substances 0.000 description 3
- RSILPKJOINTLOK-UJRRQQMQSA-N n-[2-[2-[(2r,3r,4r,5r,6r)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyethoxy]ethyl]-3-(4-methyl-2,5-dioxofuran-3-yl)propanamide Chemical compound CC(=O)N[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1OCCOCCNC(=O)CCC1=C(C)C(=O)OC1=O RSILPKJOINTLOK-UJRRQQMQSA-N 0.000 description 3
- 230000004770 neurodegeneration Effects 0.000 description 3
- 210000000633 nuclear envelope Anatomy 0.000 description 3
- 239000003921 oil Substances 0.000 description 3
- 235000019198 oils Nutrition 0.000 description 3
- 230000001717 pathogenic effect Effects 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 3
- 239000010452 phosphate Substances 0.000 description 3
- 229910052698 phosphorus Inorganic materials 0.000 description 3
- 239000002243 precursor Substances 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- HFHDHCJBZVLPGP-UHFFFAOYSA-N schardinger α-dextrin Chemical compound O1C(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(O)C2O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC2C(O)C(O)C1OC2CO HFHDHCJBZVLPGP-UHFFFAOYSA-N 0.000 description 3
- 150000003335 secondary amines Chemical class 0.000 description 3
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 3
- 239000004017 serum-free culture medium Substances 0.000 description 3
- 150000003384 small molecules Chemical class 0.000 description 3
- 210000000329 smooth muscle myocyte Anatomy 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 210000001082 somatic cell Anatomy 0.000 description 3
- 201000003624 spinocerebellar ataxia type 1 Diseases 0.000 description 3
- 230000002269 spontaneous effect Effects 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 238000003756 stirring Methods 0.000 description 3
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 3
- 238000001356 surgical procedure Methods 0.000 description 3
- 230000009885 systemic effect Effects 0.000 description 3
- 150000003512 tertiary amines Chemical class 0.000 description 3
- 238000002604 ultrasonography Methods 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- 210000003932 urinary bladder Anatomy 0.000 description 3
- 238000012795 verification Methods 0.000 description 3
- 230000001720 vestibular Effects 0.000 description 3
- 238000012800 visualization Methods 0.000 description 3
- 235000019155 vitamin A Nutrition 0.000 description 3
- 239000011719 vitamin A Substances 0.000 description 3
- 229940045997 vitamin a Drugs 0.000 description 3
- GVJHHUAWPYXKBD-IEOSBIPESA-N (R)-alpha-Tocopherol Natural products OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-IEOSBIPESA-N 0.000 description 2
- GVJHHUAWPYXKBD-UHFFFAOYSA-N (±)-α-Tocopherol Chemical compound OC1=C(C)C(C)=C2OC(CCCC(C)CCCC(C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-UHFFFAOYSA-N 0.000 description 2
- RVHYPUORVDKRTM-UHFFFAOYSA-N 1-[2-[bis(2-hydroxydodecyl)amino]ethyl-[2-[4-[2-[bis(2-hydroxydodecyl)amino]ethyl]piperazin-1-yl]ethyl]amino]dodecan-2-ol Chemical compound CCCCCCCCCCC(O)CN(CC(O)CCCCCCCCCC)CCN(CC(O)CCCCCCCCCC)CCN1CCN(CCN(CC(O)CCCCCCCCCC)CC(O)CCCCCCCCCC)CC1 RVHYPUORVDKRTM-UHFFFAOYSA-N 0.000 description 2
- NCYCYZXNIZJOKI-IOUUIBBYSA-N 11-cis-retinal Chemical compound O=C/C=C(\C)/C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C NCYCYZXNIZJOKI-IOUUIBBYSA-N 0.000 description 2
- NGNBDVOYPDDBFK-UHFFFAOYSA-N 2-[2,4-di(pentan-2-yl)phenoxy]acetyl chloride Chemical compound CCCC(C)C1=CC=C(OCC(Cl)=O)C(C(C)CCC)=C1 NGNBDVOYPDDBFK-UHFFFAOYSA-N 0.000 description 2
- WRMNZCZEMHIOCP-UHFFFAOYSA-N 2-phenylethanol Chemical compound OCCC1=CC=CC=C1 WRMNZCZEMHIOCP-UHFFFAOYSA-N 0.000 description 2
- 102100029077 3-hydroxy-3-methylglutaryl-coenzyme A reductase Human genes 0.000 description 2
- 101710158485 3-hydroxy-3-methylglutaryl-coenzyme A reductase Proteins 0.000 description 2
- 101710169336 5'-deoxyadenosine deaminase Proteins 0.000 description 2
- 102100024378 AF4/FMR2 family member 2 Human genes 0.000 description 2
- 101150059573 AGTR1 gene Proteins 0.000 description 2
- 102100033106 ATP-binding cassette sub-family G member 5 Human genes 0.000 description 2
- 102100033092 ATP-binding cassette sub-family G member 8 Human genes 0.000 description 2
- 102100040431 Activator of basal transcription 1 Human genes 0.000 description 2
- 101710102819 Activator of basal transcription 1 Proteins 0.000 description 2
- 241000702423 Adeno-associated virus - 2 Species 0.000 description 2
- 241001164825 Adeno-associated virus - 8 Species 0.000 description 2
- ZKHQWZAMYRWXGA-KQYNXXCUSA-N Adenosine triphosphate Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O ZKHQWZAMYRWXGA-KQYNXXCUSA-N 0.000 description 2
- ZKHQWZAMYRWXGA-UHFFFAOYSA-N Adenosine triphosphate Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)C(O)C1O ZKHQWZAMYRWXGA-UHFFFAOYSA-N 0.000 description 2
- 102100031786 Adiponectin Human genes 0.000 description 2
- 108700028369 Alleles Proteins 0.000 description 2
- 102100036666 Alpha-2B adrenergic receptor Human genes 0.000 description 2
- 102100034452 Alternative prion protein Human genes 0.000 description 2
- 102000004550 Angiostatic Proteins Human genes 0.000 description 2
- 108010017551 Angiostatic Proteins Proteins 0.000 description 2
- 102400000068 Angiostatin Human genes 0.000 description 2
- 108010079709 Angiostatins Proteins 0.000 description 2
- 108010059886 Apolipoprotein A-I Proteins 0.000 description 2
- 102000005666 Apolipoprotein A-I Human genes 0.000 description 2
- 102100040202 Apolipoprotein B-100 Human genes 0.000 description 2
- 102100040214 Apolipoprotein(a) Human genes 0.000 description 2
- 102100027308 Apoptosis regulator BAX Human genes 0.000 description 2
- IYMAXBFPHPZYIK-BQBZGAKWSA-N Arg-Gly-Asp Chemical compound NC(N)=NCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O IYMAXBFPHPZYIK-BQBZGAKWSA-N 0.000 description 2
- 102000003984 Aryl Hydrocarbon Receptors Human genes 0.000 description 2
- 108090000448 Aryl Hydrocarbon Receptors Proteins 0.000 description 2
- 102100026789 Aryl hydrocarbon receptor repressor Human genes 0.000 description 2
- 108050004261 Aryl hydrocarbon receptor repressor Proteins 0.000 description 2
- 102100035029 Ataxin-1 Human genes 0.000 description 2
- 102000007372 Ataxin-1 Human genes 0.000 description 2
- 102100035022 Ataxin-2-like protein Human genes 0.000 description 2
- 108010032947 Ataxin-3 Proteins 0.000 description 2
- 102000007371 Ataxin-3 Human genes 0.000 description 2
- 102100026565 Ataxin-8 Human genes 0.000 description 2
- 102000007370 Ataxin2 Human genes 0.000 description 2
- 108010032951 Ataxin2 Proteins 0.000 description 2
- 108090000806 Atrophin-1 Proteins 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 2
- 102100022976 B-cell lymphoma/leukemia 11A Human genes 0.000 description 2
- 101150035467 BDNF gene Proteins 0.000 description 2
- 102100031006 Beta-Ala-His dipeptidase Human genes 0.000 description 2
- 101000623895 Bos taurus Mucin-15 Proteins 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 102100025248 C-X-C motif chemokine 10 Human genes 0.000 description 2
- 101710098275 C-X-C motif chemokine 10 Proteins 0.000 description 2
- 238000011740 C57BL/6 mouse Methods 0.000 description 2
- 102100032912 CD44 antigen Human genes 0.000 description 2
- 102100031198 CGG triplet repeat-binding protein 1 Human genes 0.000 description 2
- 101710132053 CGG triplet repeat-binding protein 1 Proteins 0.000 description 2
- 108010040163 CREB-Binding Protein Proteins 0.000 description 2
- 102100021975 CREB-binding protein Human genes 0.000 description 2
- 238000010356 CRISPR-Cas9 genome editing Methods 0.000 description 2
- 102100025492 CUGBP Elav-like family member 3 Human genes 0.000 description 2
- 102100025465 Calpain-10 Human genes 0.000 description 2
- 102100030006 Calpain-5 Human genes 0.000 description 2
- 208000002177 Cataract Diseases 0.000 description 2
- 102100024940 Cathepsin K Human genes 0.000 description 2
- 102000000018 Chemokine CCL2 Human genes 0.000 description 2
- 102000019034 Chemokines Human genes 0.000 description 2
- 108010012236 Chemokines Proteins 0.000 description 2
- 102100037637 Cholesteryl ester transfer protein Human genes 0.000 description 2
- 108010077544 Chromatin Proteins 0.000 description 2
- 102100040484 Claspin Human genes 0.000 description 2
- 102100023804 Coagulation factor VII Human genes 0.000 description 2
- 102100027041 Crossover junction endonuclease MUS81 Human genes 0.000 description 2
- 102100029140 Cyclic nucleotide-gated cation channel beta-3 Human genes 0.000 description 2
- 108010060273 Cyclin A2 Proteins 0.000 description 2
- 108010058546 Cyclin D1 Proteins 0.000 description 2
- 102100025191 Cyclin-A2 Human genes 0.000 description 2
- 102100020756 D(2) dopamine receptor Human genes 0.000 description 2
- 108010009540 DNA (Cytosine-5-)-Methyltransferase 1 Proteins 0.000 description 2
- 102100034157 DNA mismatch repair protein Msh2 Human genes 0.000 description 2
- 102100037700 DNA mismatch repair protein Msh3 Human genes 0.000 description 2
- 102100028675 DNA polymerase subunit gamma-2, mitochondrial Human genes 0.000 description 2
- 102100035619 DNA-(apurinic or apyrimidinic site) lyase Human genes 0.000 description 2
- 206010011878 Deafness Diseases 0.000 description 2
- 201000008163 Dentatorubral pallidoluysian atrophy Diseases 0.000 description 2
- 102100023471 E-selectin Human genes 0.000 description 2
- 102100035813 E3 ubiquitin-protein ligase CBL Human genes 0.000 description 2
- 102100034597 E3 ubiquitin-protein ligase TRIM22 Human genes 0.000 description 2
- 108700024394 Exon Proteins 0.000 description 2
- 108010023321 Factor VII Proteins 0.000 description 2
- 102000004204 Fascin Human genes 0.000 description 2
- 108090000786 Fascin Proteins 0.000 description 2
- 102100026748 Fatty acid-binding protein, intestinal Human genes 0.000 description 2
- 102100020760 Ferritin heavy chain Human genes 0.000 description 2
- 108010044495 Fetal Hemoglobin Proteins 0.000 description 2
- 108010032606 Fragile X Mental Retardation Protein Proteins 0.000 description 2
- 208000024412 Friedreich ataxia Diseases 0.000 description 2
- 102100021237 G protein-activated inward rectifier potassium channel 4 Human genes 0.000 description 2
- 102100024165 G1/S-specific cyclin-D1 Human genes 0.000 description 2
- 108091092584 GDNA Proteins 0.000 description 2
- 102100040196 GRB10-interacting GYF protein 2 Human genes 0.000 description 2
- 101710132788 GRB10-interacting GYF protein 2 Proteins 0.000 description 2
- 102100033962 GTP-binding protein RAD Human genes 0.000 description 2
- 102100032518 Gamma-crystallin B Human genes 0.000 description 2
- 102100027813 Gamma-crystallin C Human genes 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 102100039696 Glutamate-cysteine ligase catalytic subunit Human genes 0.000 description 2
- 102100033039 Glutathione peroxidase 1 Human genes 0.000 description 2
- 102100035341 Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 Human genes 0.000 description 2
- 102100031249 H/ACA ribonucleoprotein complex subunit DKC1 Human genes 0.000 description 2
- 229940121710 HMGCoA reductase inhibitor Drugs 0.000 description 2
- 102100031561 Hamartin Human genes 0.000 description 2
- 101710175981 Hamartin Proteins 0.000 description 2
- 102100028893 Hemicentin-1 Human genes 0.000 description 2
- 101150029234 Hes5 gene Proteins 0.000 description 2
- 108010033040 Histones Proteins 0.000 description 2
- 241000251188 Holocephali Species 0.000 description 2
- 102100031470 Homeobox protein ARX Human genes 0.000 description 2
- 101710081544 Homeobox protein ARX Proteins 0.000 description 2
- 102100022377 Homeobox protein DLX-2 Human genes 0.000 description 2
- 102100030309 Homeobox protein Hox-A1 Human genes 0.000 description 2
- 102100030636 Homeobox protein OTX1 Human genes 0.000 description 2
- 102100030634 Homeobox protein OTX2 Human genes 0.000 description 2
- 102100025449 Homeobox protein SIX5 Human genes 0.000 description 2
- 102100027695 Homeobox protein engrailed-2 Human genes 0.000 description 2
- 101000833172 Homo sapiens AF4/FMR2 family member 2 Proteins 0.000 description 2
- 101000614701 Homo sapiens ATP-sensitive inward rectifier potassium channel 11 Proteins 0.000 description 2
- 101000775469 Homo sapiens Adiponectin Proteins 0.000 description 2
- 101000929512 Homo sapiens Alpha-2B adrenergic receptor Proteins 0.000 description 2
- 101000889953 Homo sapiens Apolipoprotein B-100 Proteins 0.000 description 2
- 101000873088 Homo sapiens Ataxin-2-like protein Proteins 0.000 description 2
- 101000903703 Homo sapiens B-cell lymphoma/leukemia 11A Proteins 0.000 description 2
- 101000919694 Homo sapiens Beta-Ala-His dipeptidase Proteins 0.000 description 2
- 101000894895 Homo sapiens Beta-secretase 1 Proteins 0.000 description 2
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 2
- 101000914299 Homo sapiens CUGBP Elav-like family member 3 Proteins 0.000 description 2
- 101000880514 Homo sapiens Cholesteryl ester transfer protein Proteins 0.000 description 2
- 101000750011 Homo sapiens Claspin Proteins 0.000 description 2
- 101000982890 Homo sapiens Crossover junction endonuclease MUS81 Proteins 0.000 description 2
- 101000771083 Homo sapiens Cyclic nucleotide-gated cation channel beta-3 Proteins 0.000 description 2
- 101000931901 Homo sapiens D(2) dopamine receptor Proteins 0.000 description 2
- 101001134036 Homo sapiens DNA mismatch repair protein Msh2 Proteins 0.000 description 2
- 101001027762 Homo sapiens DNA mismatch repair protein Msh3 Proteins 0.000 description 2
- 101000804964 Homo sapiens DNA polymerase subunit gamma-1 Proteins 0.000 description 2
- 101000837415 Homo sapiens DNA polymerase subunit gamma-2, mitochondrial Proteins 0.000 description 2
- 101000622123 Homo sapiens E-selectin Proteins 0.000 description 2
- 101000848629 Homo sapiens E3 ubiquitin-protein ligase TRIM22 Proteins 0.000 description 2
- 101000911337 Homo sapiens Fatty acid-binding protein, intestinal Proteins 0.000 description 2
- 101001002987 Homo sapiens Ferritin heavy chain Proteins 0.000 description 2
- 101000614712 Homo sapiens G protein-activated inward rectifier potassium channel 4 Proteins 0.000 description 2
- 101001132495 Homo sapiens GTP-binding protein RAD Proteins 0.000 description 2
- 101000942158 Homo sapiens Gamma-crystallin B Proteins 0.000 description 2
- 101000859938 Homo sapiens Gamma-crystallin C Proteins 0.000 description 2
- 101001034527 Homo sapiens Glutamate-cysteine ligase catalytic subunit Proteins 0.000 description 2
- 101001024278 Homo sapiens Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 Proteins 0.000 description 2
- 101000901635 Homo sapiens Homeobox protein DLX-2 Proteins 0.000 description 2
- 101001083156 Homo sapiens Homeobox protein Hox-A1 Proteins 0.000 description 2
- 101000584392 Homo sapiens Homeobox protein OTX1 Proteins 0.000 description 2
- 101000584400 Homo sapiens Homeobox protein OTX2 Proteins 0.000 description 2
- 101000835959 Homo sapiens Homeobox protein SIX5 Proteins 0.000 description 2
- 101001081122 Homo sapiens Homeobox protein engrailed-2 Proteins 0.000 description 2
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 description 2
- 101001003138 Homo sapiens Interleukin-12 receptor subunit beta-2 Proteins 0.000 description 2
- 101001027192 Homo sapiens Kelch-like protein 41 Proteins 0.000 description 2
- 101000583839 Homo sapiens Muscleblind-like protein 1 Proteins 0.000 description 2
- 101000780028 Homo sapiens Natriuretic peptides A Proteins 0.000 description 2
- 101000928278 Homo sapiens Natriuretic peptides B Proteins 0.000 description 2
- 101001124309 Homo sapiens Nitric oxide synthase, endothelial Proteins 0.000 description 2
- 101001098523 Homo sapiens PAX-interacting protein 1 Proteins 0.000 description 2
- 101000595929 Homo sapiens POLG alternative reading frame Proteins 0.000 description 2
- 101000922137 Homo sapiens Peripheral plasma membrane protein CASK Proteins 0.000 description 2
- 101000692455 Homo sapiens Platelet-derived growth factor receptor beta Proteins 0.000 description 2
- 101000605534 Homo sapiens Prostate-specific antigen Proteins 0.000 description 2
- 101000710817 Homo sapiens Protein canopy homolog 3 Proteins 0.000 description 2
- 101001000998 Homo sapiens Protein phosphatase 1 regulatory subunit 12C Proteins 0.000 description 2
- 101000957337 Homo sapiens Putative nucleotidyltransferase MAB21L1 Proteins 0.000 description 2
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 2
- 101000575639 Homo sapiens Ribonucleoside-diphosphate reductase subunit M2 Proteins 0.000 description 2
- 101000766306 Homo sapiens Serotransferrin Proteins 0.000 description 2
- 101000663158 Homo sapiens Signal recognition particle 14 kDa protein Proteins 0.000 description 2
- 101000828537 Homo sapiens Synaptic functional regulator FMR1 Proteins 0.000 description 2
- 101000635938 Homo sapiens Transforming growth factor beta-1 proprotein Proteins 0.000 description 2
- 101000655155 Homo sapiens Transmembrane protein 158 Proteins 0.000 description 2
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 2
- 101000693985 Homo sapiens Twinkle mtDNA helicase Proteins 0.000 description 2
- 101000863873 Homo sapiens Tyrosine-protein phosphatase non-receptor type substrate 1 Proteins 0.000 description 2
- 101001061851 Homo sapiens V(D)J recombination-activating protein 2 Proteins 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- 108010091358 Hypoxanthine Phosphoribosyltransferase Proteins 0.000 description 2
- 102100029098 Hypoxanthine-guanine phosphoribosyltransferase Human genes 0.000 description 2
- 206010051792 Infusion related reaction Diseases 0.000 description 2
- 102100036721 Insulin receptor Human genes 0.000 description 2
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 2
- 102100034349 Integrase Human genes 0.000 description 2
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 2
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 2
- 102000018682 Interleukin Receptor Common gamma Subunit Human genes 0.000 description 2
- 108010066719 Interleukin Receptor Common gamma Subunit Proteins 0.000 description 2
- 108090000174 Interleukin-10 Proteins 0.000 description 2
- 102000003814 Interleukin-10 Human genes 0.000 description 2
- 102100020792 Interleukin-12 receptor subunit beta-2 Human genes 0.000 description 2
- 102000004388 Interleukin-4 Human genes 0.000 description 2
- 108090000978 Interleukin-4 Proteins 0.000 description 2
- 102100026019 Interleukin-6 Human genes 0.000 description 2
- 102100037644 Kelch-like protein 41 Human genes 0.000 description 2
- 208000027747 Kennedy disease Diseases 0.000 description 2
- 101710172072 Kexin Proteins 0.000 description 2
- 102100035792 Kininogen-1 Human genes 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- 102000016267 Leptin Human genes 0.000 description 2
- 108010092277 Leptin Proteins 0.000 description 2
- 239000012097 Lipofectamine 2000 Substances 0.000 description 2
- 108010013563 Lipoprotein Lipase Proteins 0.000 description 2
- 102100022119 Lipoprotein lipase Human genes 0.000 description 2
- 108060001084 Luciferase Proteins 0.000 description 2
- 239000005089 Luciferase Substances 0.000 description 2
- 235000007688 Lycopersicon esculentum Nutrition 0.000 description 2
- 108010018650 MEF2 Transcription Factors Proteins 0.000 description 2
- 241000282560 Macaca mulatta Species 0.000 description 2
- 102100029663 Mediator of RNA polymerase II transcription subunit 15 Human genes 0.000 description 2
- 102000018697 Membrane Proteins Human genes 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 208000036626 Mental retardation Diseases 0.000 description 2
- 102100021833 Mesencephalic astrocyte-derived neurotrophic factor Human genes 0.000 description 2
- 101710155665 Mesencephalic astrocyte-derived neurotrophic factor Proteins 0.000 description 2
- 102100029684 Methylenetetrahydrofolate reductase Human genes 0.000 description 2
- 102100040243 Microtubule-associated protein tau Human genes 0.000 description 2
- 101710115937 Microtubule-associated protein tau Proteins 0.000 description 2
- 102100037480 Mismatch repair endonuclease PMS2 Human genes 0.000 description 2
- 102100024193 Mitogen-activated protein kinase 1 Human genes 0.000 description 2
- 108700015928 Mitogen-activated protein kinase 13 Proteins 0.000 description 2
- 101100445099 Mus musculus Emx1 gene Proteins 0.000 description 2
- 101001033765 Mus musculus Methyl-CpG-binding protein 2 Proteins 0.000 description 2
- 102100030965 Muscleblind-like protein 1 Human genes 0.000 description 2
- 102000003896 Myeloperoxidases Human genes 0.000 description 2
- 108090000235 Myeloperoxidases Proteins 0.000 description 2
- 102100021148 Myocyte-specific enhancer factor 2A Human genes 0.000 description 2
- OVBPIULPVIDEAO-UHFFFAOYSA-N N-Pteroyl-L-glutaminsaeure Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-UHFFFAOYSA-N 0.000 description 2
- 102100034296 Natriuretic peptides A Human genes 0.000 description 2
- 102100036836 Natriuretic peptides B Human genes 0.000 description 2
- 102100028452 Nitric oxide synthase, endothelial Human genes 0.000 description 2
- 108020004485 Nonsense Codon Proteins 0.000 description 2
- 238000000636 Northern blotting Methods 0.000 description 2
- 108090001145 Nuclear Receptor Coactivator 3 Proteins 0.000 description 2
- 102100022883 Nuclear receptor coactivator 3 Human genes 0.000 description 2
- 208000022873 Ocular disease Diseases 0.000 description 2
- 239000012124 Opti-MEM Substances 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 102100037141 PAX-interacting protein 1 Human genes 0.000 description 2
- 102100035196 POLG alternative reading frame Human genes 0.000 description 2
- 108010016731 PPAR gamma Proteins 0.000 description 2
- 208000002193 Pain Diseases 0.000 description 2
- 102100031166 Peripheral plasma membrane protein CASK Human genes 0.000 description 2
- 102100038831 Peroxisome proliferator-activated receptor alpha Human genes 0.000 description 2
- 102000012132 Peroxisome proliferator-activated receptor gamma Human genes 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 102100026547 Platelet-derived growth factor receptor beta Human genes 0.000 description 2
- 102100040990 Platelet-derived growth factor subunit B Human genes 0.000 description 2
- 102100037862 Pleckstrin homology domain-containing family A member 1 Human genes 0.000 description 2
- 101710176404 Pleckstrin homology domain-containing family A member 1 Proteins 0.000 description 2
- 102100039427 Polyadenylate-binding protein 2 Human genes 0.000 description 2
- 229920002873 Polyethylenimine Polymers 0.000 description 2
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 2
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 2
- 108010076181 Proinsulin Proteins 0.000 description 2
- 102100040120 Prominin-1 Human genes 0.000 description 2
- ZTHYODDOHIVTJV-UHFFFAOYSA-N Propyl gallate Chemical compound CCCOC(=O)C1=CC(O)=C(O)C(O)=C1 ZTHYODDOHIVTJV-UHFFFAOYSA-N 0.000 description 2
- 102100033076 Prostaglandin E synthase Human genes 0.000 description 2
- 102100038280 Prostaglandin G/H synthase 2 Human genes 0.000 description 2
- 108090000748 Prostaglandin-E Synthases Proteins 0.000 description 2
- 102100038358 Prostate-specific antigen Human genes 0.000 description 2
- 102100033856 Protein canopy homolog 3 Human genes 0.000 description 2
- 102100035620 Protein phosphatase 1 regulatory subunit 12C Human genes 0.000 description 2
- 201000004681 Psoriasis Diseases 0.000 description 2
- 102100038753 Putative nucleotidyltransferase MAB21L1 Human genes 0.000 description 2
- 102100026872 RNA-binding E3 ubiquitin-protein ligase MEX3C Human genes 0.000 description 2
- 101100344443 Rattus norvegicus Map1b gene Proteins 0.000 description 2
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 2
- 108090000783 Renin Proteins 0.000 description 2
- 102100028255 Renin Human genes 0.000 description 2
- 206010038848 Retinal detachment Diseases 0.000 description 2
- 208000007014 Retinitis pigmentosa Diseases 0.000 description 2
- 108090000820 Rhodopsin Proteins 0.000 description 2
- 102100026006 Ribonucleoside-diphosphate reductase subunit M2 Human genes 0.000 description 2
- 102000004387 Ribosomal protein L14 Human genes 0.000 description 2
- 108090000985 Ribosomal protein L14 Proteins 0.000 description 2
- 102100035476 Serum paraoxonase/arylesterase 1 Human genes 0.000 description 2
- 108091027967 Small hairpin RNA Proteins 0.000 description 2
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- 240000003768 Solanum lycopersicum Species 0.000 description 2
- 108010053551 Sp1 Transcription Factor Proteins 0.000 description 2
- 108091061980 Spherical nucleic acid Proteins 0.000 description 2
- 102100030511 Stanniocalcin-1 Human genes 0.000 description 2
- 241001633172 Streptococcus thermophilus LMD-9 Species 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 2
- RAHZWNYVWXNFOC-UHFFFAOYSA-N Sulphur dioxide Chemical compound O=S=O RAHZWNYVWXNFOC-UHFFFAOYSA-N 0.000 description 2
- 102100038836 Superoxide dismutase [Cu-Zn] Human genes 0.000 description 2
- 101710139715 Superoxide dismutase [Cu-Zn] Proteins 0.000 description 2
- 108010044281 TATA-Box Binding Protein Proteins 0.000 description 2
- 102100040296 TATA-box-binding protein Human genes 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- 102100036034 Thrombospondin-1 Human genes 0.000 description 2
- 102000003978 Tissue Plasminogen Activator Human genes 0.000 description 2
- 108090000373 Tissue Plasminogen Activator Proteins 0.000 description 2
- 102100030246 Transcription factor Sp1 Human genes 0.000 description 2
- 102100027671 Transcriptional repressor CTCF Human genes 0.000 description 2
- 102100030742 Transforming growth factor beta-1 proprotein Human genes 0.000 description 2
- 102100033036 Transmembrane protein 158 Human genes 0.000 description 2
- 102100040666 Transmembrane protein 185A Human genes 0.000 description 2
- 102100040241 Trinucleotide repeat-containing gene 6A protein Human genes 0.000 description 2
- 101710126045 Trinucleotide repeat-containing gene 6A protein Proteins 0.000 description 2
- 102100040244 Trinucleotide repeat-containing gene 6B protein Human genes 0.000 description 2
- 101710087261 Trinucleotide repeat-containing gene 6B protein Proteins 0.000 description 2
- 102100040242 Trinucleotide repeat-containing gene 6C protein Human genes 0.000 description 2
- 101710163378 Trinucleotide repeat-containing gene 6C protein Proteins 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 2
- 102100040247 Tumor necrosis factor Human genes 0.000 description 2
- 102100027193 Twinkle mtDNA helicase Human genes 0.000 description 2
- 102100039094 Tyrosinase Human genes 0.000 description 2
- 102100025387 Tyrosine-protein kinase JAK3 Human genes 0.000 description 2
- 102100029948 Tyrosine-protein phosphatase non-receptor type substrate 1 Human genes 0.000 description 2
- 108010072685 Uracil-DNA Glycosidase Proteins 0.000 description 2
- 102100037111 Uracil-DNA glycosylase Human genes 0.000 description 2
- 108010000134 Vascular Cell Adhesion Molecule-1 Proteins 0.000 description 2
- 102100023543 Vascular cell adhesion protein 1 Human genes 0.000 description 2
- 102100039066 Very low-density lipoprotein receptor Human genes 0.000 description 2
- 101710177612 Very low-density lipoprotein receptor Proteins 0.000 description 2
- 208000008383 Wilms tumor Diseases 0.000 description 2
- 208000026448 Wilms tumor 1 Diseases 0.000 description 2
- 102100022748 Wilms tumor protein Human genes 0.000 description 2
- 101710127857 Wilms tumor protein Proteins 0.000 description 2
- 208000006269 X-Linked Bulbo-Spinal Atrophy Diseases 0.000 description 2
- 208000023940 X-Linked Combined Immunodeficiency disease Diseases 0.000 description 2
- 102000005773 Xanthine dehydrogenase Human genes 0.000 description 2
- 108010091383 Xanthine dehydrogenase Proteins 0.000 description 2
- 108010093894 Xanthine oxidase Proteins 0.000 description 2
- ZKSPKDDUPMUGBG-KWXKLSQISA-N [(9z,12z)-octadeca-9,12-dienyl] 3-(dimethylamino)-2-[(9z,12z)-octadeca-9,12-dienoxy]propanoate Chemical compound CCCCC\C=C/C\C=C/CCCCCCCCOC(CN(C)C)C(=O)OCCCCCCCC\C=C/C\C=C/CCCCC ZKSPKDDUPMUGBG-KWXKLSQISA-N 0.000 description 2
- 210000000683 abdominal cavity Anatomy 0.000 description 2
- 230000001133 acceleration Effects 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 101150027964 ada gene Proteins 0.000 description 2
- 230000006978 adaptation Effects 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 230000002776 aggregation Effects 0.000 description 2
- 238000004220 aggregation Methods 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 150000001298 alcohols Chemical class 0.000 description 2
- 229940087168 alpha tocopherol Drugs 0.000 description 2
- 206010002022 amyloidosis Diseases 0.000 description 2
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 2
- 239000003587 angiostatic protein Substances 0.000 description 2
- 230000002424 anti-apoptotic effect Effects 0.000 description 2
- 230000001796 anti-degenerative effect Effects 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 235000006708 antioxidants Nutrition 0.000 description 2
- 239000012062 aqueous buffer Substances 0.000 description 2
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 2
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000004888 barrier function Effects 0.000 description 2
- 108700000707 bcl-2-Associated X Proteins 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 230000006399 behavior Effects 0.000 description 2
- 239000002551 biofuel Substances 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- 239000012620 biological material Substances 0.000 description 2
- 238000002725 brachytherapy Methods 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 230000000747 cardiac effect Effects 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 229960001231 choline Drugs 0.000 description 2
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 2
- 210000003483 chromatin Anatomy 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 230000004087 circulation Effects 0.000 description 2
- 208000019425 cirrhosis of liver Diseases 0.000 description 2
- 230000004186 co-expression Effects 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 208000010877 cognitive disease Diseases 0.000 description 2
- 230000001268 conjugating effect Effects 0.000 description 2
- 238000001816 cooling Methods 0.000 description 2
- 210000004748 cultured cell Anatomy 0.000 description 2
- 230000002354 daily effect Effects 0.000 description 2
- 231100000895 deafness Toxicity 0.000 description 2
- 238000012350 deep sequencing Methods 0.000 description 2
- 230000003412 degenerative effect Effects 0.000 description 2
- 229940124447 delivery agent Drugs 0.000 description 2
- 238000002716 delivery method Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 210000005110 dorsal hippocampus Anatomy 0.000 description 2
- 231100000371 dose-limiting toxicity Toxicity 0.000 description 2
- 231100000673 dose–response relationship Toxicity 0.000 description 2
- 238000011143 downstream manufacturing Methods 0.000 description 2
- 238000007876 drug discovery Methods 0.000 description 2
- 210000000883 ear external Anatomy 0.000 description 2
- 238000001493 electron microscopy Methods 0.000 description 2
- 230000009881 electrostatic interaction Effects 0.000 description 2
- 108010025678 empty spiracles homeobox proteins Proteins 0.000 description 2
- 230000012202 endocytosis Effects 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 2
- 210000000981 epithelium Anatomy 0.000 description 2
- 229960001123 epoprostenol Drugs 0.000 description 2
- 230000003628 erosive effect Effects 0.000 description 2
- CBOQJANXLMLOSS-UHFFFAOYSA-N ethyl vanillin Chemical compound CCOC1=CC(C=O)=CC=C1O CBOQJANXLMLOSS-UHFFFAOYSA-N 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 229940012413 factor vii Drugs 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 108700014844 flt3 ligand Proteins 0.000 description 2
- 235000019152 folic acid Nutrition 0.000 description 2
- 239000011724 folic acid Substances 0.000 description 2
- 229960000304 folic acid Drugs 0.000 description 2
- 230000037433 frameshift Effects 0.000 description 2
- 238000007710 freezing Methods 0.000 description 2
- 230000008014 freezing Effects 0.000 description 2
- 230000000799 fusogenic effect Effects 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 238000010363 gene targeting Methods 0.000 description 2
- 238000012268 genome sequencing Methods 0.000 description 2
- 108010086596 glutathione peroxidase GPX1 Proteins 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 208000016354 hearing loss disease Diseases 0.000 description 2
- 238000010438 heat treatment Methods 0.000 description 2
- 229920001477 hydrophilic polymer Polymers 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 238000003365 immunocytochemistry Methods 0.000 description 2
- 230000001771 impaired effect Effects 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 229910052500 inorganic mineral Inorganic materials 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 229940028885 interleukin-4 Drugs 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229940039781 leptin Drugs 0.000 description 2
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 description 2
- 231100000518 lethal Toxicity 0.000 description 2
- 230000001665 lethal effect Effects 0.000 description 2
- 210000001165 lymph node Anatomy 0.000 description 2
- 229920001427 mPEG Polymers 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 208000030159 metabolic disease Diseases 0.000 description 2
- 239000002679 microRNA Substances 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- 239000004005 microsphere Substances 0.000 description 2
- 235000010755 mineral Nutrition 0.000 description 2
- 239000011707 mineral Substances 0.000 description 2
- 210000001616 monocyte Anatomy 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- 239000003471 mutagenic agent Substances 0.000 description 2
- 210000004165 myocardium Anatomy 0.000 description 2
- UMFJAHHVKNCGLG-UHFFFAOYSA-N n-Nitrosodimethylamine Chemical compound CN(C)N=O UMFJAHHVKNCGLG-UHFFFAOYSA-N 0.000 description 2
- 210000000822 natural killer cell Anatomy 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 230000001537 neural effect Effects 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- CTSLXHKWHWQRSH-UHFFFAOYSA-N oxalyl chloride Chemical compound ClC(=O)C(Cl)=O CTSLXHKWHWQRSH-UHFFFAOYSA-N 0.000 description 2
- 210000000496 pancreas Anatomy 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 108091008725 peroxisome proliferator-activated receptors alpha Proteins 0.000 description 2
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 2
- 238000013081 phylogenetic analysis Methods 0.000 description 2
- 229940068196 placebo Drugs 0.000 description 2
- 239000000902 placebo Substances 0.000 description 2
- 229920000768 polyamine Polymers 0.000 description 2
- 238000004321 preservation Methods 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- 210000002307 prostate Anatomy 0.000 description 2
- 208000020016 psychiatric disease Diseases 0.000 description 2
- 238000011002 quantification Methods 0.000 description 2
- 238000003753 real-time PCR Methods 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 238000005215 recombination Methods 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 230000008929 regeneration Effects 0.000 description 2
- 238000011069 regeneration method Methods 0.000 description 2
- 230000004264 retinal detachment Effects 0.000 description 2
- 229960003471 retinol Drugs 0.000 description 2
- 235000020944 retinol Nutrition 0.000 description 2
- 239000011607 retinol Substances 0.000 description 2
- 239000000523 sample Substances 0.000 description 2
- 210000003786 sclera Anatomy 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 230000001953 sensory effect Effects 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 239000001632 sodium acetate Substances 0.000 description 2
- 235000017281 sodium acetate Nutrition 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 125000006850 spacer group Chemical group 0.000 description 2
- 210000000952 spleen Anatomy 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 208000011580 syndromic disease Diseases 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 229960000984 tocofersolan Drugs 0.000 description 2
- AOBORMOPSGHCAX-DGHZZKTQSA-N tocofersolan Chemical compound OCCOC(=O)CCC(=O)OC1=C(C)C(C)=C2O[C@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C AOBORMOPSGHCAX-DGHZZKTQSA-N 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 239000002691 unilamellar liposome Substances 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 230000004393 visual impairment Effects 0.000 description 2
- 108010047303 von Willebrand Factor Proteins 0.000 description 2
- 102100036537 von Willebrand factor Human genes 0.000 description 2
- 229960001134 von willebrand factor Drugs 0.000 description 2
- 238000003260 vortexing Methods 0.000 description 2
- 235000004835 α-tocopherol Nutrition 0.000 description 2
- 239000002076 α-tocopherol Substances 0.000 description 2
- GKSPIZSKQWTXQG-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[1-(pyridin-2-yldisulfanyl)ethyl]benzoate Chemical compound C=1C=C(C(=O)ON2C(CCC2=O)=O)C=CC=1C(C)SSC1=CC=CC=N1 GKSPIZSKQWTXQG-UHFFFAOYSA-N 0.000 description 1
- SGKRLCUYIXIAHR-AKNGSSGZSA-N (4s,4ar,5s,5ar,6r,12ar)-4-(dimethylamino)-1,5,10,11,12a-pentahydroxy-6-methyl-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1=CC=C2[C@H](C)[C@@H]([C@H](O)[C@@H]3[C@](C(O)=C(C(N)=O)C(=O)[C@H]3N(C)C)(O)C3=O)C3=C(O)C2=C1O SGKRLCUYIXIAHR-AKNGSSGZSA-N 0.000 description 1
- MWRBNPKJOOWZPW-NYVOMTAGSA-N 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine zwitterion Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](COP(O)(=O)OCCN)OC(=O)CCCCCCC\C=C/CCCCCCCC MWRBNPKJOOWZPW-NYVOMTAGSA-N 0.000 description 1
- XXMFJKNOJSDQBM-UHFFFAOYSA-N 2,2,2-trifluoroacetic acid;hydrate Chemical compound [OH3+].[O-]C(=O)C(F)(F)F XXMFJKNOJSDQBM-UHFFFAOYSA-N 0.000 description 1
- CHHHXKFHOYLYRE-UHFFFAOYSA-M 2,4-Hexadienoic acid, potassium salt (1:1), (2E,4E)- Chemical compound [K+].CC=CC=CC([O-])=O CHHHXKFHOYLYRE-UHFFFAOYSA-M 0.000 description 1
- XNWFRZJHXBZDAG-UHFFFAOYSA-N 2-METHOXYETHANOL Chemical compound COCCO XNWFRZJHXBZDAG-UHFFFAOYSA-N 0.000 description 1
- KCYOZNARADAZIZ-CWBQGUJCSA-N 2-[(2e,4e,6e,8e,10e,12e,14e)-15-(4,4,7a-trimethyl-2,5,6,7-tetrahydro-1-benzofuran-2-yl)-6,11-dimethylhexadeca-2,4,6,8,10,12,14-heptaen-2-yl]-4,4,7a-trimethyl-2,5,6,7-tetrahydro-1-benzofuran-6-ol Chemical compound O1C2(C)CC(O)CC(C)(C)C2=CC1C(\C)=C\C=C\C(\C)=C\C=C\C=C(/C)\C=C\C=C(/C)C1C=C2C(C)(C)CCCC2(C)O1 KCYOZNARADAZIZ-CWBQGUJCSA-N 0.000 description 1
- XSVWFLQICKPQAA-UHFFFAOYSA-N 2-[4,10-bis(carboxymethyl)-7-[2-(2,5-dioxopyrrolidin-1-yl)oxy-2-oxoethyl]-1,4,7,10-tetrazacyclododec-1-yl]acetic acid Chemical compound C1CN(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CCN1CC(=O)ON1C(=O)CCC1=O XSVWFLQICKPQAA-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- SPCKHVPPRJWQRZ-UHFFFAOYSA-N 2-benzhydryloxy-n,n-dimethylethanamine;2-hydroxypropane-1,2,3-tricarboxylic acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O.C=1C=CC=CC=1C(OCCN(C)C)C1=CC=CC=C1 SPCKHVPPRJWQRZ-UHFFFAOYSA-N 0.000 description 1
- 101150092649 3a gene Proteins 0.000 description 1
- 101150006159 3b gene Proteins 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- WXNZTHHGJRFXKQ-UHFFFAOYSA-N 4-chlorophenol Chemical compound OC1=CC=C(Cl)C=C1 WXNZTHHGJRFXKQ-UHFFFAOYSA-N 0.000 description 1
- BSFODEXXVBBYOC-UHFFFAOYSA-N 8-[4-(dimethylamino)butan-2-ylamino]quinolin-6-ol Chemical compound C1=CN=C2C(NC(CCN(C)C)C)=CC(O)=CC2=C1 BSFODEXXVBBYOC-UHFFFAOYSA-N 0.000 description 1
- 101150037123 APOE gene Proteins 0.000 description 1
- 102100021177 ATP-sensitive inward rectifier potassium channel 11 Human genes 0.000 description 1
- NLHHRLWOUZZQLW-UHFFFAOYSA-N Acrylonitrile Chemical compound C=CC#N NLHHRLWOUZZQLW-UHFFFAOYSA-N 0.000 description 1
- 241000580270 Adeno-associated virus - 4 Species 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 102100038568 Age-related maculopathy susceptibility protein 2 Human genes 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- APKFDSVGJQXUKY-KKGHZKTASA-N Amphotericin-B Natural products O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1C=CC=CC=CC=CC=CC=CC=C[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-KKGHZKTASA-N 0.000 description 1
- 108091093088 Amplicon Proteins 0.000 description 1
- 208000037259 Amyloid Plaque Diseases 0.000 description 1
- 102100022987 Angiogenin Human genes 0.000 description 1
- 102100034594 Angiopoietin-1 Human genes 0.000 description 1
- 108010048154 Angiopoietin-1 Proteins 0.000 description 1
- 102100030988 Angiotensin-converting enzyme Human genes 0.000 description 1
- 108020004491 Antisense DNA Proteins 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 208000019901 Anxiety disease Diseases 0.000 description 1
- 108010027006 Apolipoproteins B Proteins 0.000 description 1
- 102000018616 Apolipoproteins B Human genes 0.000 description 1
- 241000238421 Arthropoda Species 0.000 description 1
- 108010008184 Aryldialkylphosphatase Proteins 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 208000036640 Asperger disease Diseases 0.000 description 1
- 201000006062 Asperger syndrome Diseases 0.000 description 1
- 102000002785 Ataxin-10 Human genes 0.000 description 1
- 101710147490 Ataxin-8 Proteins 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 101150070808 Atxn10 gene Proteins 0.000 description 1
- 101150074725 Atxn3 gene Proteins 0.000 description 1
- 229940125759 BACE1 protease inhibitor Drugs 0.000 description 1
- 208000008035 Back Pain Diseases 0.000 description 1
- 108060000903 Beta-catenin Proteins 0.000 description 1
- 201000004569 Blindness Diseases 0.000 description 1
- 208000010392 Bone Fractures Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 101150111062 C gene Proteins 0.000 description 1
- 101710117545 C protein Proteins 0.000 description 1
- 108010027741 CASP8 and FADD Like Apoptosis Regulating Protein Proteins 0.000 description 1
- 102100025752 CASP8 and FADD-like apoptosis regulator Human genes 0.000 description 1
- 108010014064 CCCTC-Binding Factor Proteins 0.000 description 1
- 101150052909 CCL2 gene Proteins 0.000 description 1
- 101150083327 CCR2 gene Proteins 0.000 description 1
- 108010045374 CD36 Antigens Proteins 0.000 description 1
- 102000053028 CD36 Antigens Human genes 0.000 description 1
- 101150029409 CFTR gene Proteins 0.000 description 1
- FERYQCKYTIHZNX-UHFFFAOYSA-N CNNNNNN Chemical compound CNNNNNN FERYQCKYTIHZNX-UHFFFAOYSA-N 0.000 description 1
- 101150083464 CP gene Proteins 0.000 description 1
- 238000010453 CRISPR/Cas method Methods 0.000 description 1
- 101150085973 CTSD gene Proteins 0.000 description 1
- 108090000835 CX3C Chemokine Receptor 1 Proteins 0.000 description 1
- 102100039196 CX3C chemokine receptor 1 Human genes 0.000 description 1
- 101150066398 CXCR4 gene Proteins 0.000 description 1
- 101100385576 Caenorhabditis elegans ctg-1 gene Proteins 0.000 description 1
- 108090000451 Calpain-10 Proteins 0.000 description 1
- 101710099825 Calpain-5 Proteins 0.000 description 1
- 241000589986 Campylobacter lari Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 208000031229 Cardiomyopathies Diseases 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 102000055007 Cartilage Oligomeric Matrix Human genes 0.000 description 1
- 108700005376 Cartilage Oligomeric Matrix Proteins 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 108090000625 Cathepsin K Proteins 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- ZKLPARSLTMPFCP-UHFFFAOYSA-N Cetirizine Chemical compound C1CN(CCOCC(=O)O)CCN1C(C=1C=CC(Cl)=CC=1)C1=CC=CC=C1 ZKLPARSLTMPFCP-UHFFFAOYSA-N 0.000 description 1
- 208000000094 Chronic Pain Diseases 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 108700040183 Complement C1 Inhibitor Proteins 0.000 description 1
- 102000055157 Complement C1 Inhibitor Human genes 0.000 description 1
- 102100030135 Complement C1q tumor necrosis factor-related protein 5 Human genes 0.000 description 1
- 108090000955 Complement C2 Proteins 0.000 description 1
- 102000004381 Complement C2 Human genes 0.000 description 1
- 108010028780 Complement C3 Proteins 0.000 description 1
- 102000016918 Complement C3 Human genes 0.000 description 1
- 102100034622 Complement factor B Human genes 0.000 description 1
- 102100040132 Complement factor H-related protein 1 Human genes 0.000 description 1
- 102100035321 Complement factor H-related protein 3 Human genes 0.000 description 1
- 108091028732 Concatemer Proteins 0.000 description 1
- 206010062759 Congenital dyskeratosis Diseases 0.000 description 1
- 108091029523 CpG island Proteins 0.000 description 1
- KCYOZNARADAZIZ-PPBBKLJYSA-N Cryptochrome Natural products O[C@@H]1CC(C)(C)C=2[C@@](C)(O[C@H](/C(=C\C=C\C(=C/C=C/C=C(\C=C\C=C(\C)/[C@H]3O[C@@]4(C)C(C(C)(C)CCC4)=C3)/C)\C)/C)C=2)C1 KCYOZNARADAZIZ-PPBBKLJYSA-N 0.000 description 1
- 108010037139 Cryptochromes Proteins 0.000 description 1
- 108010037462 Cyclooxygenase 2 Proteins 0.000 description 1
- 125000002038 D-arginyl group Chemical class N[C@@H](C(=O)*)CCCNC(=N)N 0.000 description 1
- 102100024810 DNA (cytosine-5)-methyltransferase 3B Human genes 0.000 description 1
- 101710123222 DNA (cytosine-5)-methyltransferase 3B Proteins 0.000 description 1
- 102100031867 DNA excision repair protein ERCC-6 Human genes 0.000 description 1
- 230000033616 DNA repair Effects 0.000 description 1
- 102100022928 DNA repair protein RAD51 homolog 1 Human genes 0.000 description 1
- 108010063362 DNA-(Apurinic or Apyrimidinic Site) Lyase Proteins 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- 101100033027 Danio rerio rbbp4 gene Proteins 0.000 description 1
- 102000016911 Deoxyribonucleases Human genes 0.000 description 1
- 108010053770 Deoxyribonucleases Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 101100386911 Dictyostelium discoideum ddx3 gene Proteins 0.000 description 1
- 240000008570 Digitaria exilis Species 0.000 description 1
- 235000005459 Digitaria exilis Nutrition 0.000 description 1
- 101150007297 Dnmt1 gene Proteins 0.000 description 1
- 238000007355 Double Michael addition reaction Methods 0.000 description 1
- 102000000331 Double-stranded RNA-binding domains Human genes 0.000 description 1
- 108050008793 Double-stranded RNA-binding domains Proteins 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 102100025682 Dystroglycan 1 Human genes 0.000 description 1
- 108010071885 Dystroglycans Proteins 0.000 description 1
- 102100038913 E1A-binding protein p400 Human genes 0.000 description 1
- 102100039793 E3 ubiquitin-protein ligase RAG1 Human genes 0.000 description 1
- 239000001692 EU approved anti-caking agent Substances 0.000 description 1
- 102100032053 Elongation of very long chain fatty acids protein 4 Human genes 0.000 description 1
- 102400000686 Endothelin-1 Human genes 0.000 description 1
- 101800004490 Endothelin-1 Proteins 0.000 description 1
- 101710121417 Envelope glycoprotein Proteins 0.000 description 1
- 241001531192 Eubacterium ventriosum Species 0.000 description 1
- 101150030532 F7 gene Proteins 0.000 description 1
- 208000034846 Familial Amyloid Neuropathies Diseases 0.000 description 1
- 102000008857 Ferritin Human genes 0.000 description 1
- 108050000784 Ferritin Proteins 0.000 description 1
- 238000008416 Ferritin Methods 0.000 description 1
- 102100037362 Fibronectin Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 206010016654 Fibrosis Diseases 0.000 description 1
- 102100028065 Fibulin-5 Human genes 0.000 description 1
- 102100026121 Flap endonuclease 1 Human genes 0.000 description 1
- 108050002219 Flap endonuclease 1 Proteins 0.000 description 1
- 208000001914 Fragile X syndrome Diseases 0.000 description 1
- 206010017533 Fungal infection Diseases 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 241000223221 Fusarium oxysporum Species 0.000 description 1
- 241000611205 Fusarium oxysporum f. sp. lycopersici Species 0.000 description 1
- 101150014889 Gad1 gene Proteins 0.000 description 1
- 102000002464 Galactosidases Human genes 0.000 description 1
- 108010093031 Galactosidases Proteins 0.000 description 1
- 208000003098 Ganglion Cysts Diseases 0.000 description 1
- 206010064571 Gene mutation Diseases 0.000 description 1
- 229940123611 Genome editing Drugs 0.000 description 1
- 208000010412 Glaucoma Diseases 0.000 description 1
- 102100033299 Glia-derived nexin Human genes 0.000 description 1
- 241001468096 Gluconacetobacter diazotrophicus Species 0.000 description 1
- 102100035902 Glutamate decarboxylase 1 Human genes 0.000 description 1
- 102100035857 Glutamate decarboxylase 2 Human genes 0.000 description 1
- 102100036698 Golgi reassembly-stacking protein 1 Human genes 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 description 1
- 101710167047 H/ACA ribonucleoprotein complex subunit DKC1 Proteins 0.000 description 1
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 1
- 108090001102 Hammerhead ribozyme Proteins 0.000 description 1
- 102000014702 Haptoglobin Human genes 0.000 description 1
- 108050005077 Haptoglobin Proteins 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- 101710154606 Hemagglutinin Proteins 0.000 description 1
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 1
- 101710142180 Hemicentin-1 Proteins 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 102100025110 Homeobox protein Hox-A5 Human genes 0.000 description 1
- 101000800387 Homo sapiens ATP-binding cassette sub-family G member 5 Proteins 0.000 description 1
- 101000800430 Homo sapiens ATP-binding cassette sub-family G member 8 Proteins 0.000 description 1
- 101000808726 Homo sapiens Age-related maculopathy susceptibility protein 2 Proteins 0.000 description 1
- 101000924727 Homo sapiens Alternative prion protein Proteins 0.000 description 1
- 101000889990 Homo sapiens Apolipoprotein(a) Proteins 0.000 description 1
- 101000765700 Homo sapiens Ataxin-8 Proteins 0.000 description 1
- 101000785083 Homo sapiens Atrophin-1 Proteins 0.000 description 1
- 101000777599 Homo sapiens C-C chemokine receptor type 2 Proteins 0.000 description 1
- 101000942118 Homo sapiens C-reactive protein Proteins 0.000 description 1
- 101000984149 Homo sapiens Calpain-10 Proteins 0.000 description 1
- 101000793666 Homo sapiens Calpain-5 Proteins 0.000 description 1
- 101000761509 Homo sapiens Cathepsin K Proteins 0.000 description 1
- 101000851684 Homo sapiens Chimeric ERCC6-PGBD3 protein Proteins 0.000 description 1
- 101000794265 Homo sapiens Complement C1q tumor necrosis factor-related protein 5 Proteins 0.000 description 1
- 101000890732 Homo sapiens Complement factor H-related protein 1 Proteins 0.000 description 1
- 101000878136 Homo sapiens Complement factor H-related protein 3 Proteins 0.000 description 1
- 101001055227 Homo sapiens Cytokine receptor common subunit gamma Proteins 0.000 description 1
- 101000920783 Homo sapiens DNA excision repair protein ERCC-6 Proteins 0.000 description 1
- 101000620735 Homo sapiens DNA repair protein RAD51 homolog 1 Proteins 0.000 description 1
- 101001137256 Homo sapiens DNA-(apurinic or apyrimidinic site) lyase Proteins 0.000 description 1
- 101000715390 Homo sapiens E3 ubiquitin-protein ligase CBL Proteins 0.000 description 1
- 101000744443 Homo sapiens E3 ubiquitin-protein ligase RAG1 Proteins 0.000 description 1
- 101000921354 Homo sapiens Elongation of very long chain fatty acids protein 4 Proteins 0.000 description 1
- 101001060252 Homo sapiens Fibulin-5 Proteins 0.000 description 1
- 101000997803 Homo sapiens Glia-derived nexin Proteins 0.000 description 1
- 101000873786 Homo sapiens Glutamate decarboxylase 2 Proteins 0.000 description 1
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 1
- 101000839060 Homo sapiens Hemicentin-1 Proteins 0.000 description 1
- 101001077568 Homo sapiens Homeobox protein Hox-A5 Proteins 0.000 description 1
- 101001040800 Homo sapiens Integral membrane protein GPR180 Proteins 0.000 description 1
- 101000599940 Homo sapiens Interferon gamma Proteins 0.000 description 1
- 101001076408 Homo sapiens Interleukin-6 Proteins 0.000 description 1
- 101000614618 Homo sapiens Junctophilin-3 Proteins 0.000 description 1
- 101001091590 Homo sapiens Kininogen-1 Proteins 0.000 description 1
- 101000573901 Homo sapiens Major prion protein Proteins 0.000 description 1
- 101001005668 Homo sapiens Mastermind-like protein 3 Proteins 0.000 description 1
- 101001013208 Homo sapiens Mediator of RNA polymerase II transcription subunit 15 Proteins 0.000 description 1
- 101000615488 Homo sapiens Methyl-CpG-binding domain protein 2 Proteins 0.000 description 1
- 101000587058 Homo sapiens Methylenetetrahydrofolate reductase Proteins 0.000 description 1
- 101000738911 Homo sapiens Mismatch repair endonuclease PMS2 Proteins 0.000 description 1
- 101001128156 Homo sapiens Nanos homolog 3 Proteins 0.000 description 1
- 101000597928 Homo sapiens Numb-like protein Proteins 0.000 description 1
- 101000706121 Homo sapiens Parvalbumin alpha Proteins 0.000 description 1
- 101000611202 Homo sapiens Peptidyl-prolyl cis-trans isomerase B Proteins 0.000 description 1
- 101000610652 Homo sapiens Peripherin-2 Proteins 0.000 description 1
- 101001090065 Homo sapiens Peroxiredoxin-2 Proteins 0.000 description 1
- 101001091365 Homo sapiens Plasma kallikrein Proteins 0.000 description 1
- 101000611951 Homo sapiens Platelet-derived growth factor subunit B Proteins 0.000 description 1
- 101000609211 Homo sapiens Polyadenylate-binding protein 2 Proteins 0.000 description 1
- 101000692650 Homo sapiens Prostacyclin receptor Proteins 0.000 description 1
- 101001135385 Homo sapiens Prostacyclin synthase Proteins 0.000 description 1
- 101000605127 Homo sapiens Prostaglandin G/H synthase 2 Proteins 0.000 description 1
- 101001026864 Homo sapiens Protein kinase C gamma type Proteins 0.000 description 1
- 101000613615 Homo sapiens Protein mono-ADP-ribosyltransferase PARP14 Proteins 0.000 description 1
- 101000651439 Homo sapiens Prothrombin Proteins 0.000 description 1
- 101001082131 Homo sapiens Pumilio homolog 3 Proteins 0.000 description 1
- 101001092197 Homo sapiens RNA binding protein fox-1 homolog 3 Proteins 0.000 description 1
- 101000629826 Homo sapiens RNA-binding E3 ubiquitin-protein ligase MEX3C Proteins 0.000 description 1
- 101000611338 Homo sapiens Rhodopsin Proteins 0.000 description 1
- 101001094647 Homo sapiens Serum paraoxonase/arylesterase 1 Proteins 0.000 description 1
- 101000701440 Homo sapiens Stanniocalcin-1 Proteins 0.000 description 1
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 1
- 101000799388 Homo sapiens Thiopurine S-methyltransferase Proteins 0.000 description 1
- 101000659879 Homo sapiens Thrombospondin-1 Proteins 0.000 description 1
- 101000831496 Homo sapiens Toll-like receptor 3 Proteins 0.000 description 1
- 101000725972 Homo sapiens Transcriptional repressor CTCF Proteins 0.000 description 1
- 101000892344 Homo sapiens Transmembrane protein 185A Proteins 0.000 description 1
- 101000891326 Homo sapiens Treacle protein Proteins 0.000 description 1
- 101000606090 Homo sapiens Tyrosinase Proteins 0.000 description 1
- 101000742373 Homo sapiens Vesicular inhibitory amino acid transporter Proteins 0.000 description 1
- 101000935117 Homo sapiens Voltage-dependent P/Q-type calcium channel subunit alpha-1A Proteins 0.000 description 1
- 101001104102 Homo sapiens X-linked retinitis pigmentosa GTPase regulator Proteins 0.000 description 1
- 101000804921 Homo sapiens X-ray repair cross-complementing protein 5 Proteins 0.000 description 1
- 108010070875 Human Immunodeficiency Virus tat Gene Products Proteins 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- 208000035150 Hypercholesterolemia Diseases 0.000 description 1
- 206010020772 Hypertension Diseases 0.000 description 1
- 101150047851 IL2RG gene Proteins 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 206010062016 Immunosuppression Diseases 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- 206010022004 Influenza like illness Diseases 0.000 description 1
- 108010001127 Insulin Receptor Proteins 0.000 description 1
- 102100021244 Integral membrane protein GPR180 Human genes 0.000 description 1
- 108010061833 Integrases Proteins 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 102000000589 Interleukin-1 Human genes 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 102000004890 Interleukin-8 Human genes 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 1
- 108010019421 Janus Kinase 3 Proteins 0.000 description 1
- 102100040488 Junctophilin-3 Human genes 0.000 description 1
- 102000017792 KCNJ11 Human genes 0.000 description 1
- 239000007836 KH2PO4 Substances 0.000 description 1
- 101710111227 Kininogen-1 Proteins 0.000 description 1
- 201000006165 Kuhnt-Junius degeneration Diseases 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 238000008214 LDL Cholesterol Methods 0.000 description 1
- 108010028554 LDL Cholesterol Proteins 0.000 description 1
- 108010007622 LDL Lipoproteins Proteins 0.000 description 1
- 102000007330 LDL Lipoproteins Human genes 0.000 description 1
- 102000000853 LDL receptors Human genes 0.000 description 1
- 108010001831 LDL receptors Proteins 0.000 description 1
- 241000186841 Lactobacillus farciminis Species 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 239000000232 Lipid Bilayer Substances 0.000 description 1
- 108010033266 Lipoprotein(a) Proteins 0.000 description 1
- 208000007433 Lymphatic Metastasis Diseases 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 229910015837 MSH2 Inorganic materials 0.000 description 1
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 1
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 101150060380 Map1b gene Proteins 0.000 description 1
- 102100025134 Mastermind-like protein 3 Human genes 0.000 description 1
- 108091027974 Mature messenger RNA Proteins 0.000 description 1
- 102100025169 Max-binding protein MNT Human genes 0.000 description 1
- 101710179287 Mediator of RNA polymerase II transcription subunit 15 Proteins 0.000 description 1
- 108010090837 Member 5 Subfamily G ATP Binding Cassette Transporter Proteins 0.000 description 1
- 108010090822 Member 8 Subfamily G ATP Binding Cassette Transporter Proteins 0.000 description 1
- 102000005741 Metalloproteases Human genes 0.000 description 1
- 108010006035 Metalloproteases Proteins 0.000 description 1
- 108050006600 Metalloproteinase inhibitor 3 Proteins 0.000 description 1
- 206010027457 Metastases to liver Diseases 0.000 description 1
- 206010027480 Metastatic malignant melanoma Diseases 0.000 description 1
- 102100021299 Methyl-CpG-binding domain protein 2 Human genes 0.000 description 1
- 108010030837 Methylenetetrahydrofolate Reductase (NADPH2) Proteins 0.000 description 1
- 108700011259 MicroRNAs Proteins 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 108010074346 Mismatch Repair Endonuclease PMS2 Proteins 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 101100452019 Mus musculus Icam2 gene Proteins 0.000 description 1
- 101100456965 Mus musculus Mex3c gene Proteins 0.000 description 1
- 101000687343 Mus musculus PR domain zinc finger protein 1 Proteins 0.000 description 1
- 101100101250 Mus musculus Th gene Proteins 0.000 description 1
- 206010028289 Muscle atrophy Diseases 0.000 description 1
- 208000031888 Mycoses Diseases 0.000 description 1
- 102100030856 Myoglobin Human genes 0.000 description 1
- 108010062374 Myoglobin Proteins 0.000 description 1
- 206010068871 Myotonic dystrophy Diseases 0.000 description 1
- 241000588654 Neisseria cinerea Species 0.000 description 1
- 241000244206 Nematoda Species 0.000 description 1
- 206010029113 Neovascularisation Diseases 0.000 description 1
- 208000033383 Neuroendocrine tumor of pancreas Diseases 0.000 description 1
- 206010029333 Neurosis Diseases 0.000 description 1
- 241001276274 Nitratifractor salsuginis DSM 16511 Species 0.000 description 1
- 208000025464 Norrie disease Diseases 0.000 description 1
- 230000005913 Notch signaling pathway Effects 0.000 description 1
- 102100036986 Numb-like protein Human genes 0.000 description 1
- 102000043276 Oncogene Human genes 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 108010049358 Oncogene Protein p65(gag-jun) Proteins 0.000 description 1
- 241000906034 Orthops Species 0.000 description 1
- 206010031252 Osteomyelitis Diseases 0.000 description 1
- 206010033109 Ototoxicity Diseases 0.000 description 1
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 1
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 101150094724 PCSK9 gene Proteins 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 208000009608 Papillomavirus Infections Diseases 0.000 description 1
- 241001386755 Parvibaculum lavamentivorans Species 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 229940122344 Peptidase inhibitor Drugs 0.000 description 1
- 102100040283 Peptidyl-prolyl cis-trans isomerase B Human genes 0.000 description 1
- 102100040375 Peripherin-2 Human genes 0.000 description 1
- 102000007456 Peroxiredoxin Human genes 0.000 description 1
- 102100034763 Peroxiredoxin-2 Human genes 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 108010022233 Plasminogen Activator Inhibitor 1 Proteins 0.000 description 1
- 108010077971 Plasminogen Inactivators Proteins 0.000 description 1
- 102100039418 Plasminogen activator inhibitor 1 Human genes 0.000 description 1
- 102100039419 Plasminogen activator inhibitor 2 Human genes 0.000 description 1
- 108010041472 Poly(A)-Binding Protein II Proteins 0.000 description 1
- 108010061844 Poly(ADP-ribose) Polymerases Proteins 0.000 description 1
- 102000012338 Poly(ADP-ribose) Polymerases Human genes 0.000 description 1
- 229920000776 Poly(Adenosine diphosphate-ribose) polymerase Polymers 0.000 description 1
- 206010036105 Polyneuropathy Diseases 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 108091000054 Prion Proteins 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-N Propionic acid Chemical class CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 1
- 102100026476 Prostacyclin receptor Human genes 0.000 description 1
- 102100033075 Prostacyclin synthase Human genes 0.000 description 1
- 101800001494 Protease 2A Proteins 0.000 description 1
- 101800001066 Protein 2A Proteins 0.000 description 1
- 101710176177 Protein A56 Proteins 0.000 description 1
- 102000055027 Protein Methyltransferases Human genes 0.000 description 1
- 108700040121 Protein Methyltransferases Proteins 0.000 description 1
- 108010058956 Protein Phosphatase 2 Proteins 0.000 description 1
- 102000006478 Protein Phosphatase 2 Human genes 0.000 description 1
- 101710149951 Protein Tat Proteins 0.000 description 1
- 102000002727 Protein Tyrosine Phosphatase Human genes 0.000 description 1
- 102100037314 Protein kinase C gamma type Human genes 0.000 description 1
- 102100040848 Protein mono-ADP-ribosyltransferase PARP14 Human genes 0.000 description 1
- 102100027378 Prothrombin Human genes 0.000 description 1
- 108010019674 Proto-Oncogene Proteins c-sis Proteins 0.000 description 1
- 208000028017 Psychotic disease Diseases 0.000 description 1
- 241000567197 Puccinia graminis f. sp. tritici Species 0.000 description 1
- 102100030469 Putative protein ATXN8OS Human genes 0.000 description 1
- 101710204903 Putative protein ATXN8OS Proteins 0.000 description 1
- 244000305267 Quercus macrolepis Species 0.000 description 1
- 235000016976 Quercus macrolepis Nutrition 0.000 description 1
- 102000001195 RAD51 Human genes 0.000 description 1
- 102000001183 RAG-1 Human genes 0.000 description 1
- 108060006897 RAG1 Proteins 0.000 description 1
- 102100035530 RNA binding protein fox-1 homolog 3 Human genes 0.000 description 1
- 208000036448 RPGR-related retinopathy Diseases 0.000 description 1
- 108010068097 Rad51 Recombinase Proteins 0.000 description 1
- 108010055016 Rec A Recombinases Proteins 0.000 description 1
- 102000001218 Rec A Recombinases Human genes 0.000 description 1
- 102000018120 Recombinases Human genes 0.000 description 1
- 108010091086 Recombinases Proteins 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 108091081062 Repeated sequence (DNA) Proteins 0.000 description 1
- 206010038923 Retinopathy Diseases 0.000 description 1
- 102100027609 Rho-related GTP-binding protein RhoD Human genes 0.000 description 1
- 102100040756 Rhodopsin Human genes 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 241000398180 Roseburia intestinalis Species 0.000 description 1
- 101100407812 Schizosaccharomyces pombe (strain 972 / ATCC 24843) pas4 gene Proteins 0.000 description 1
- 108091081021 Sense strand Proteins 0.000 description 1
- 102100021117 Serine protease HTRA2, mitochondrial Human genes 0.000 description 1
- 101710146118 Serine protease HTRA2, mitochondrial Proteins 0.000 description 1
- 102000008847 Serpin Human genes 0.000 description 1
- 108050000761 Serpin Proteins 0.000 description 1
- 108010005113 Serpin E2 Proteins 0.000 description 1
- 102000005821 Serpin E2 Human genes 0.000 description 1
- 101710089523 Signal recognition particle 14 kDa protein Proteins 0.000 description 1
- 241000639167 Sphaerochaeta globosa Species 0.000 description 1
- 101710142157 Stanniocalcin-1 Proteins 0.000 description 1
- 208000027073 Stargardt disease Diseases 0.000 description 1
- 241001501869 Streptococcus pasteurianus Species 0.000 description 1
- 241000320123 Streptococcus pyogenes M1 GAS Species 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- 108090000787 Subtilisin Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 208000005400 Synovial Cyst Diseases 0.000 description 1
- 229940126530 T cell activator Drugs 0.000 description 1
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 1
- 108091084976 TET family Proteins 0.000 description 1
- 101150070537 Tet3 gene Proteins 0.000 description 1
- WDLRUFUQRNWCPK-UHFFFAOYSA-N Tetraxetan Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC1 WDLRUFUQRNWCPK-UHFFFAOYSA-N 0.000 description 1
- 208000002903 Thalassemia Diseases 0.000 description 1
- 238000012338 Therapeutic targeting Methods 0.000 description 1
- 102100034162 Thiopurine S-methyltransferase Human genes 0.000 description 1
- 102000004377 Thiopurine S-methyltransferases Human genes 0.000 description 1
- 108090000958 Thiopurine S-methyltransferases Proteins 0.000 description 1
- 102000036693 Thrombopoietin Human genes 0.000 description 1
- 108010041111 Thrombopoietin Proteins 0.000 description 1
- 108010046722 Thrombospondin 1 Proteins 0.000 description 1
- 101150079992 Timp3 gene Proteins 0.000 description 1
- 108010031429 Tissue Inhibitor of Metalloproteinase-3 Proteins 0.000 description 1
- 102000005406 Tissue Inhibitor of Metalloproteinase-3 Human genes 0.000 description 1
- 102100024324 Toll-like receptor 3 Human genes 0.000 description 1
- 102100023132 Transcription factor Jun Human genes 0.000 description 1
- 101710197968 Transmembrane protein 185A Proteins 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- 108010020764 Transposases Proteins 0.000 description 1
- 102000008579 Transposases Human genes 0.000 description 1
- 102100040421 Treacle protein Human genes 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- 244000098338 Triticum aestivum Species 0.000 description 1
- 208000034953 Twin anemia-polycythemia sequence Diseases 0.000 description 1
- 108060008724 Tyrosinase Proteins 0.000 description 1
- 101710112792 Tyrosine-protein kinase JAK3 Proteins 0.000 description 1
- 102100035824 Unconventional myosin-Ig Human genes 0.000 description 1
- 108010032099 V(D)J recombination activating protein 2 Proteins 0.000 description 1
- 108010062497 VLDL Lipoproteins Proteins 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 1
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 1
- 102100038170 Vesicular inhibitory amino acid transporter Human genes 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 206010047571 Visual impairment Diseases 0.000 description 1
- 229930003427 Vitamin E Natural products 0.000 description 1
- 102100025330 Voltage-dependent P/Q-type calcium channel subunit alpha-1A Human genes 0.000 description 1
- 208000000208 Wet Macular Degeneration Diseases 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 102100040092 X-linked retinitis pigmentosa GTPase regulator Human genes 0.000 description 1
- 102100036973 X-ray repair cross-complementing protein 5 Human genes 0.000 description 1
- 102100036976 X-ray repair cross-complementing protein 6 Human genes 0.000 description 1
- 101710124907 X-ray repair cross-complementing protein 6 Proteins 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- HMNZFMSWFCAGGW-XPWSMXQVSA-N [3-[hydroxy(2-hydroxyethoxy)phosphoryl]oxy-2-[(e)-octadec-9-enoyl]oxypropyl] (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCC(COP(O)(=O)OCCO)OC(=O)CCCCCCC\C=C\CCCCCCCC HMNZFMSWFCAGGW-XPWSMXQVSA-N 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 230000009102 absorption Effects 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 230000003044 adaptive effect Effects 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N adenyl group Chemical group N1=CN=C2N=CNC2=C1N GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 210000004504 adult stem cell Anatomy 0.000 description 1
- 238000012382 advanced drug delivery Methods 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 235000010419 agar Nutrition 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 150000001350 alkyl halides Chemical class 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- AWUCVROLDVIAJX-UHFFFAOYSA-N alpha-glycerophosphate Natural products OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 229940037003 alum Drugs 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- APKFDSVGJQXUKY-INPOYWNPSA-N amphotericin B Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/C=C/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-INPOYWNPSA-N 0.000 description 1
- 229960003942 amphotericin b Drugs 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- CWJNMKKMGIAGDK-UHFFFAOYSA-N amtolmetin guacil Chemical compound COC1=CC=CC=C1OC(=O)CNC(=O)CC(N1C)=CC=C1C(=O)C1=CC=C(C)C=C1 CWJNMKKMGIAGDK-UHFFFAOYSA-N 0.000 description 1
- 108010064397 amyloid beta-protein (1-40) Proteins 0.000 description 1
- FEWOUVRMGWFWIH-ILZZQXMPSA-N amyloid-beta polypeptide 40 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 FEWOUVRMGWFWIH-ILZZQXMPSA-N 0.000 description 1
- 230000000202 analgesic effect Effects 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 108010072788 angiogenin Proteins 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000036436 anti-hiv Effects 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 230000001028 anti-proliverative effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 239000003816 antisense DNA Substances 0.000 description 1
- 230000036506 anxiety Effects 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 108010072041 arginyl-glycyl-aspartic acid Proteins 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 210000004227 basal ganglia Anatomy 0.000 description 1
- 230000003542 behavioural effect Effects 0.000 description 1
- 150000001558 benzoic acid derivatives Chemical class 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- KCYOZNARADAZIZ-XZOHMNSDSA-N beta-cryptochrome Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C1OC2(C)CC(O)CC(C)(C)C2=C1)C=CC=C(/C)C3OC4(C)CCCC(C)(C)C4=C3 KCYOZNARADAZIZ-XZOHMNSDSA-N 0.000 description 1
- 210000003445 biliary tract Anatomy 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 239000000227 bioadhesive Substances 0.000 description 1
- 239000003181 biological factor Substances 0.000 description 1
- VJLOFJZWUDZJBX-UHFFFAOYSA-N bis(2-hydroxyethyl)azanium;chloride Chemical compound [Cl-].OCC[NH2+]CCO VJLOFJZWUDZJBX-UHFFFAOYSA-N 0.000 description 1
- 230000036770 blood supply Effects 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 210000004958 brain cell Anatomy 0.000 description 1
- 210000000133 brain stem Anatomy 0.000 description 1
- GHWVXCQZPNWFRO-UHFFFAOYSA-N butane-2,3-diamine Chemical group CC(N)C(C)N GHWVXCQZPNWFRO-UHFFFAOYSA-N 0.000 description 1
- 210000004900 c-terminal fragment Anatomy 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 102220354910 c.4C>G Human genes 0.000 description 1
- 229940009550 c1 esterase inhibitor Drugs 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 210000000234 capsid Anatomy 0.000 description 1
- 229920003123 carboxymethyl cellulose sodium Polymers 0.000 description 1
- 229940063834 carboxymethylcellulose sodium Drugs 0.000 description 1
- 230000001364 causal effect Effects 0.000 description 1
- 230000034303 cell budding Effects 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 210000000354 cell of hensen Anatomy 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 230000033077 cellular process Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 210000003679 cervix uteri Anatomy 0.000 description 1
- 229960001803 cetirizine Drugs 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 230000006020 chronic inflammation Effects 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 210000000262 cochlear duct Anatomy 0.000 description 1
- 230000019771 cognition Effects 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000010226 confocal imaging Methods 0.000 description 1
- 238000004624 confocal microscopy Methods 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 239000011258 core-shell material Substances 0.000 description 1
- 230000001054 cortical effect Effects 0.000 description 1
- 210000005257 cortical tissue Anatomy 0.000 description 1
- 230000000139 costimulatory effect Effects 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 102000003675 cytokine receptors Human genes 0.000 description 1
- 108010057085 cytokine receptors Proteins 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 229920006237 degradable polymer Polymers 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 238000000432 density-gradient centrifugation Methods 0.000 description 1
- 210000001947 dentate gyrus Anatomy 0.000 description 1
- 210000004207 dermis Anatomy 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 238000011026 diafiltration Methods 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 150000004985 diamines Chemical class 0.000 description 1
- RNPXCFINMKSQPQ-UHFFFAOYSA-N dicetyl hydrogen phosphate Chemical compound CCCCCCCCCCCCCCCCOP(O)(=O)OCCCCCCCCCCCCCCCC RNPXCFINMKSQPQ-UHFFFAOYSA-N 0.000 description 1
- 229940093541 dicetylphosphate Drugs 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000003113 dilution method Methods 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- MWRBNPKJOOWZPW-CLFAGFIQSA-N dioleoyl phosphatidylethanolamine Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC(COP(O)(=O)OCCN)OC(=O)CCCCCCC\C=C/CCCCCCCC MWRBNPKJOOWZPW-CLFAGFIQSA-N 0.000 description 1
- 229960000520 diphenhydramine Drugs 0.000 description 1
- 208000037765 diseases and disorders Diseases 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 229910000397 disodium phosphate Inorganic materials 0.000 description 1
- 235000019800 disodium phosphate Nutrition 0.000 description 1
- 101150015424 dmd gene Proteins 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000012154 double-distilled water Substances 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 229960003722 doxycycline Drugs 0.000 description 1
- 238000009510 drug design Methods 0.000 description 1
- 238000007877 drug screening Methods 0.000 description 1
- 208000009356 dyskeratosis congenita Diseases 0.000 description 1
- 210000000613 ear canal Anatomy 0.000 description 1
- 210000000959 ear middle Anatomy 0.000 description 1
- 239000012039 electrophile Substances 0.000 description 1
- 210000001671 embryonic stem cell Anatomy 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 238000007459 endoscopic retrograde cholangiopancreatography Methods 0.000 description 1
- 238000001839 endoscopy Methods 0.000 description 1
- 238000007824 enzymatic assay Methods 0.000 description 1
- 230000007515 enzymatic degradation Effects 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 229950005470 eteplirsen Drugs 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 229940073505 ethyl vanillin Drugs 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000002964 excitative effect Effects 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 230000004438 eyesight Effects 0.000 description 1
- 235000019197 fats Nutrition 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 239000000835 fiber Substances 0.000 description 1
- 230000004761 fibrosis Effects 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000012467 final product Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 239000012537 formulation buffer Substances 0.000 description 1
- 125000002485 formyl group Chemical group [H]C(*)=O 0.000 description 1
- 231100000221 frame shift mutation induction Toxicity 0.000 description 1
- 239000012458 free base Substances 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 230000007849 functional defect Effects 0.000 description 1
- 210000001222 gaba-ergic neuron Anatomy 0.000 description 1
- WIGCFUFOHFEKBI-UHFFFAOYSA-N gamma-tocopherol Natural products CC(C)CCCC(C)CCCC(C)CCCC1CCC2C(C)C(O)C(C)C(C)C2O1 WIGCFUFOHFEKBI-UHFFFAOYSA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 238000012239 gene modification Methods 0.000 description 1
- 230000037440 gene silencing effect Effects 0.000 description 1
- 230000009395 genetic defect Effects 0.000 description 1
- 208000016361 genetic disease Diseases 0.000 description 1
- 102000054766 genetic haplotypes Human genes 0.000 description 1
- 230000007614 genetic variation Effects 0.000 description 1
- 238000003205 genotyping method Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-L glutamate group Chemical group N[C@@H](CCC(=O)[O-])C(=O)[O-] WHUUTDBJXJRKMK-VKHMYHEASA-L 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 210000004884 grey matter Anatomy 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 230000035876 healing Effects 0.000 description 1
- 210000005003 heart tissue Anatomy 0.000 description 1
- 208000014951 hematologic disease Diseases 0.000 description 1
- 208000034737 hemoglobinopathy Diseases 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 231100000304 hepatotoxicity Toxicity 0.000 description 1
- 210000004295 hippocampal neuron Anatomy 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- 102000049902 human IL2RG Human genes 0.000 description 1
- 102000049240 human PVALB Human genes 0.000 description 1
- 239000003906 humectant Substances 0.000 description 1
- BHEPBYXIRTUNPN-UHFFFAOYSA-N hydridophosphorus(.) (triplet) Chemical compound [PH] BHEPBYXIRTUNPN-UHFFFAOYSA-N 0.000 description 1
- 238000005984 hydrogenation reaction Methods 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 230000008629 immune suppression Effects 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 210000004969 inflammatory cell Anatomy 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000004941 influx Effects 0.000 description 1
- 208000018337 inherited hemoglobinopathy Diseases 0.000 description 1
- 210000001445 inner phalangeal cell Anatomy 0.000 description 1
- 238000002743 insertional mutagenesis Methods 0.000 description 1
- 230000003914 insulin secretion Effects 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 102000002467 interleukin receptors Human genes 0.000 description 1
- 108010093036 interleukin receptors Proteins 0.000 description 1
- 229940076144 interleukin-10 Drugs 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000007914 intraventricular administration Methods 0.000 description 1
- INQOMBQAUSQDDS-UHFFFAOYSA-N iodomethane Chemical compound IC INQOMBQAUSQDDS-UHFFFAOYSA-N 0.000 description 1
- 125000000741 isoleucyl group Chemical group [H]N([H])C(C(C([H])([H])[H])C([H])([H])C([H])([H])[H])C(=O)O* 0.000 description 1
- 210000001630 jejunum Anatomy 0.000 description 1
- 102000019028 junctophilin Human genes 0.000 description 1
- 108010012212 junctophilin Proteins 0.000 description 1
- 210000000629 knee joint Anatomy 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 238000002357 laparoscopic surgery Methods 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 230000013016 learning Effects 0.000 description 1
- 238000007449 liver function test Methods 0.000 description 1
- 230000007056 liver toxicity Effects 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 208000018769 loss of vision Diseases 0.000 description 1
- 231100000864 loss of vision Toxicity 0.000 description 1
- 230000004777 loss-of-function mutation Effects 0.000 description 1
- 235000018977 lysine Nutrition 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 150000002690 malonic acid derivatives Chemical class 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000008204 material by function Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 210000002901 mesenchymal stem cell Anatomy 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 208000021039 metastatic melanoma Diseases 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 108091070501 miRNA Proteins 0.000 description 1
- 238000002493 microarray Methods 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 210000000274 microglia Anatomy 0.000 description 1
- 230000000394 mitotic effect Effects 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- 235000019796 monopotassium phosphate Nutrition 0.000 description 1
- 230000004973 motor coordination Effects 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- 230000003387 muscular Effects 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- YNTOKMNHRPSGFU-UHFFFAOYSA-N n-Propyl carbamate Chemical compound CCCOC(N)=O YNTOKMNHRPSGFU-UHFFFAOYSA-N 0.000 description 1
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 description 1
- 210000004898 n-terminal fragment Anatomy 0.000 description 1
- 239000004081 narcotic agent Substances 0.000 description 1
- 229940042880 natural phospholipid Drugs 0.000 description 1
- 238000013188 needle biopsy Methods 0.000 description 1
- 230000032405 negative regulation of neuron apoptotic process Effects 0.000 description 1
- 210000004498 neuroglial cell Anatomy 0.000 description 1
- 208000015238 neurotic disease Diseases 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 210000002445 nipple Anatomy 0.000 description 1
- 150000002825 nitriles Chemical class 0.000 description 1
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 1
- 231100001079 no serious adverse effect Toxicity 0.000 description 1
- 102000042567 non-coding RNA Human genes 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 210000004248 oligodendroglia Anatomy 0.000 description 1
- 229940046166 oligodeoxynucleotide Drugs 0.000 description 1
- 238000012346 open field test Methods 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 210000000963 osteoblast Anatomy 0.000 description 1
- 230000000278 osteoconductive effect Effects 0.000 description 1
- 230000002138 osteoinductive effect Effects 0.000 description 1
- 231100000262 ototoxicity Toxicity 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 238000012856 packing Methods 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 230000036407 pain Effects 0.000 description 1
- 229940090668 parachlorophenol Drugs 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 239000001814 pectin Substances 0.000 description 1
- 235000010987 pectin Nutrition 0.000 description 1
- 229920001277 pectin Polymers 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 230000007030 peptide scission Effects 0.000 description 1
- 239000000816 peptidomimetic Substances 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 108030002458 peroxiredoxin Proteins 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- 238000012247 phenotypical assay Methods 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 229940067107 phenylethyl alcohol Drugs 0.000 description 1
- NMHMNPHRMNGLLB-UHFFFAOYSA-N phloretic acid Chemical compound OC(=O)CCC1=CC=C(O)C=C1 NMHMNPHRMNGLLB-UHFFFAOYSA-N 0.000 description 1
- 150000008105 phosphatidylcholines Chemical class 0.000 description 1
- 108010079892 phosphoglycerol kinase Proteins 0.000 description 1
- 239000000049 pigment Substances 0.000 description 1
- 230000001817 pituitary effect Effects 0.000 description 1
- 238000003976 plant breeding Methods 0.000 description 1
- 239000002797 plasminogen activator inhibitor Substances 0.000 description 1
- 229920000962 poly(amidoamine) Polymers 0.000 description 1
- 229920001606 poly(lactic acid-co-glycolic acid) Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 239000004417 polycarbonate Substances 0.000 description 1
- 229920000515 polycarbonate Polymers 0.000 description 1
- 229920000867 polyelectrolyte Polymers 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 230000007824 polyneuropathy Effects 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 description 1
- 235000010241 potassium sorbate Nutrition 0.000 description 1
- 239000004302 potassium sorbate Substances 0.000 description 1
- 229940069338 potassium sorbate Drugs 0.000 description 1
- 230000036515 potency Effects 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 244000144977 poultry Species 0.000 description 1
- HIGSLXSBYYMVKI-UHFFFAOYSA-N pralidoxime chloride Chemical compound [Cl-].C[N+]1=CC=CC=C1\C=N\O HIGSLXSBYYMVKI-UHFFFAOYSA-N 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 230000035935 pregnancy Effects 0.000 description 1
- 230000002028 premature Effects 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 238000003825 pressing Methods 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 208000022256 primary systemic amyloidosis Diseases 0.000 description 1
- 208000029340 primitive neuroectodermal tumor Diseases 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000002250 progressing effect Effects 0.000 description 1
- 208000037821 progressive disease Diseases 0.000 description 1
- 239000000473 propyl gallate Substances 0.000 description 1
- 229940075579 propyl gallate Drugs 0.000 description 1
- 235000010388 propyl gallate Nutrition 0.000 description 1
- WGYKZJWCGVVSQN-UHFFFAOYSA-N propylamine Chemical compound CCCN WGYKZJWCGVVSQN-UHFFFAOYSA-N 0.000 description 1
- 230000004845 protein aggregation Effects 0.000 description 1
- 238000002731 protein assay Methods 0.000 description 1
- 238000002331 protein detection Methods 0.000 description 1
- 108020000494 protein-tyrosine phosphatase Proteins 0.000 description 1
- ZJFJVRPLNAMIKH-UHFFFAOYSA-N pseudo-u Chemical compound O=C1NC(=O)C(C)=CN1C1OC(COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=NC=NC(N)=C3N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=NC=NC(N)=C3N=C2)COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=NC=NC(N)=C3N=C2)CO)C(O)C1 ZJFJVRPLNAMIKH-UHFFFAOYSA-N 0.000 description 1
- 230000004144 purine metabolism Effects 0.000 description 1
- 210000000449 purkinje cell Anatomy 0.000 description 1
- 238000010791 quenching Methods 0.000 description 1
- 230000000171 quenching effect Effects 0.000 description 1
- 239000013608 rAAV vector Substances 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 102000005912 ran GTP Binding Protein Human genes 0.000 description 1
- VMXUWOKSQNHOCA-LCYFTJDESA-N ranitidine Chemical compound [O-][N+](=O)/C=C(/NC)NCCSCC1=CC=C(CN(C)C)O1 VMXUWOKSQNHOCA-LCYFTJDESA-N 0.000 description 1
- 229960000620 ranitidine Drugs 0.000 description 1
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 230000010282 redox signaling Effects 0.000 description 1
- 208000019465 refractory cytopenia of childhood Diseases 0.000 description 1
- 239000004627 regenerated cellulose Substances 0.000 description 1
- 230000008521 reorganization Effects 0.000 description 1
- 230000008263 repair mechanism Effects 0.000 description 1
- 230000001846 repelling effect Effects 0.000 description 1
- 238000009256 replacement therapy Methods 0.000 description 1
- 230000000754 repressing effect Effects 0.000 description 1
- 238000007894 restriction fragment length polymorphism technique Methods 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 230000002207 retinal effect Effects 0.000 description 1
- 108010056030 retronectin Proteins 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 102200111942 rs1762111 Human genes 0.000 description 1
- 102200111955 rs1800549 Human genes 0.000 description 1
- 102200111966 rs1800550 Human genes 0.000 description 1
- 102200111937 rs1800551 Human genes 0.000 description 1
- 102200110594 rs1801269 Human genes 0.000 description 1
- 210000003079 salivary gland Anatomy 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 238000007480 sanger sequencing Methods 0.000 description 1
- 210000001079 scala tympani Anatomy 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000007789 sealing Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 210000003949 semicircular duct Anatomy 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 230000036362 sensorimotor function Effects 0.000 description 1
- 239000003001 serine protease inhibitor Substances 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 208000007056 sickle cell anemia Diseases 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- RYMZZMVNJRMUDD-HGQWONQESA-N simvastatin Chemical compound C([C@H]1[C@@H](C)C=CC2=C[C@H](C)C[C@@H]([C@H]12)OC(=O)C(C)(C)CC)C[C@@H]1C[C@@H](O)CC(=O)O1 RYMZZMVNJRMUDD-HGQWONQESA-N 0.000 description 1
- 229960002930 sirolimus Drugs 0.000 description 1
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 1
- 238000004513 sizing Methods 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 208000017520 skin disease Diseases 0.000 description 1
- 210000002460 smooth muscle Anatomy 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- 210000004872 soft tissue Anatomy 0.000 description 1
- 230000003381 solubilizing effect Effects 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 210000000278 spinal cord Anatomy 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 238000002672 stereotactic surgery Methods 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 210000003699 striated muscle Anatomy 0.000 description 1
- 230000004960 subcellular localization Effects 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 229940044609 sulfur dioxide Drugs 0.000 description 1
- 235000010269 sulphur dioxide Nutrition 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 239000002344 surface layer Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 230000002889 sympathetic effect Effects 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 238000012385 systemic delivery Methods 0.000 description 1
- 238000010809 targeting technique Methods 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 210000000211 third ventricle Anatomy 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 230000036962 time dependent Effects 0.000 description 1
- 229910021654 trace metal Inorganic materials 0.000 description 1
- 238000012549 training Methods 0.000 description 1
- 108091006106 transcriptional activators Proteins 0.000 description 1
- 108091006107 transcriptional repressors Proteins 0.000 description 1
- 230000031998 transcytosis Effects 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 201000007905 transthyretin amyloidosis Diseases 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 230000005747 tumor angiogenesis Effects 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 125000002987 valine group Chemical group [H]N([H])C([H])(C(*)=O)C([H])(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 208000019553 vascular disease Diseases 0.000 description 1
- 230000006444 vascular growth Effects 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 210000005111 ventral hippocampus Anatomy 0.000 description 1
- 150000004669 very long chain fatty acids Chemical class 0.000 description 1
- 230000007332 vesicle formation Effects 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 208000029257 vision disease Diseases 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 235000019165 vitamin E Nutrition 0.000 description 1
- 229940046009 vitamin E Drugs 0.000 description 1
- 239000011709 vitamin E Substances 0.000 description 1
- 150000003722 vitamin derivatives Chemical class 0.000 description 1
- 210000004127 vitreous body Anatomy 0.000 description 1
- 239000007762 w/o emulsion Substances 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 210000004885 white matter Anatomy 0.000 description 1
- 208000027121 wild type ATTR amyloidosis Diseases 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
- A01K67/0275—Genetically modified vertebrates, e.g. transgenic
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
- A01K67/0275—Genetically modified vertebrates, e.g. transgenic
- A01K67/0278—Knock-in vertebrates, e.g. humanised vertebrates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
- A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
- A61P25/16—Anti-Parkinson drugs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/18—Antipsychotics, i.e. neuroleptics; Drugs for mania or schizophrenia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/01—Preparation of mutants without inserting foreign genetic material therein; Screening processes therefor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1082—Preparation or screening gene libraries by chromosomal integration of polynucleotide sequences, HR-, site-specific-recombination, transposons, viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8201—Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation
- C12N15/8213—Targeted insertion of genes into the plant genome by homologous recombination
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/8509—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells for producing genetically modified animals, e.g. transgenic
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/96—Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
- G16B20/00—ICT specially adapted for functional genomics or proteomics, e.g. genotype-phenotype associations
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
- G16B20/00—ICT specially adapted for functional genomics or proteomics, e.g. genotype-phenotype associations
- G16B20/20—Allele or variant detection, e.g. single nucleotide polymorphism [SNP] detection
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
- G16B20/00—ICT specially adapted for functional genomics or proteomics, e.g. genotype-phenotype associations
- G16B20/30—Detection of binding sites or motifs
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
- G16B20/00—ICT specially adapted for functional genomics or proteomics, e.g. genotype-phenotype associations
- G16B20/50—Mutagenesis
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
- G16B30/00—ICT specially adapted for sequence analysis involving nucleotides or amino acids
- G16B30/10—Sequence alignment; Homology search
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/05—Animals comprising random inserted nucleic acids (transgenic)
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/05—Animals comprising random inserted nucleic acids (transgenic)
- A01K2217/052—Animals comprising random inserted nucleic acids (transgenic) inducing gain of function
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/07—Animals genetically altered by homologous recombination
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/07—Animals genetically altered by homologous recombination
- A01K2217/072—Animals genetically altered by homologous recombination maintaining or altering function, i.e. knock in
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2227/00—Animals characterised by species
- A01K2227/10—Mammal
- A01K2227/105—Murine
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/03—Animal model, e.g. for test or diseases
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/10—Applications; Uses in screening processes
- C12N2320/11—Applications; Uses in screening processes for the determination of target sites, i.e. of active nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/30—Special therapeutic applications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/22—Vectors comprising a coding region that has been codon optimised for expression in a respective host
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
- G16B30/00—ICT specially adapted for sequence analysis involving nucleotides or amino acids
Definitions
- the present invention generally relates to the delivery, engineering, optimization and therapeutic applications of systems, methods, and compositions used for the control of gene expression involving sequence targeting, such as genome perturbation or gene-editing, that relate to Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and components thereof.
- sequence targeting such as genome perturbation or gene-editing
- CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
- the CRISPR-Cas system does not require the generation of customized proteins to target specific sequences but rather a single Cas enzyme can be programmed by a short RNA molecule to recognize a specific DNA target. Adding the CRISPR-Cas system to the repertoire of genome sequencing techniques and analysis methods may significantly simplify the methodology and accelerate the ability to catalog and map genetic factors associated with a diverse range of biological functions and diseases. To utilize the CRISPR-Cas system effectively for genome editing without deleterious effects, it is critical to understand aspects of engineering, optimization and cell-type/tissue/organ specific delivery of these genome engineering tools, which are aspects of the claimed invention.
- An exemplary CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within the target polynucleotide.
- the guide sequence is linked to a tracr mate sequence, which in turn hybridizes to a tracr sequence.
- the invention provides methods for using one or more elements of a CRISPR-Cas system.
- the CRISPR complex of the invention provides an effective means for modifying a target polynucleotide.
- the CRISPR complex of the invention has a wide variety of utilities including modifying (e.g., deleting, inserting, translocating, inactivating, activating) a target polynucleotide in a multiplicity of cell types in various tissues and organs.
- modifying e.g., deleting, inserting, translocating, inactivating, activating
- a target polynucleotide in a multiplicity of cell types in various tissues and organs.
- the CRISPR complex of the invention has a broad spectrum of applications in, e.g., gene or genome editing, gene therapy, drug discovery, drug screening, disease diagnosis, and prognosis.
- aspects of the invention relate to Cas9 enzymes having improved targeting specificity in a CRISPR-Cas9 system having guide RNAs having optimal activity, smaller in length than wild-type Cas9 enzymes and nucleic acid molecules coding therefor, and chimeric Cas9 enzymes, as well as methods of improving the target specificity of a Cas9 enzyme or of designing a CRISPR-Cas9 system comprising designing or preparing guide RNAs having optimal activity and/or selecting or preparing a Cas9 enzyme having a smaller size or length than wild-type Cas9 whereby packaging a nucleic acid coding therefor into a delivery vector is more advanced as there is less coding therefor in the delivery vector than for wild-type Cas9, and/or generating chimeric Cas9 enzymes.
- a Cas9 enzyme may comprise one or more mutations and may be used as a generic DNA binding protein with or without fusion to a functional domain.
- the mutations may be artificially introduced mutations or gain- or loss-of-function mutations.
- the mutations may include but are not limited to mutations in one of the catalytic domains (D10 and H840) in the RuvC and HNH catalytic domains, respectively. Further mutations have been characterized.
- the transcriptional activation domain may be VP64.
- the transcriptional repressor domain may be KRAB or SID4X.
- mutated Cas 9 enzyme being fused to domains which include but are not limited to a transcriptional activator, repressor, a recombinase, a transposase, a histone remodeler, a demethylase, a DNA methyltransferase, a cryptochrome, a light inducible/controllable domain or a chemically inducible/controllable domain.
- the invention provides for methods to generate mutant tracrRNA and direct repeat sequences or mutant chimeric guide sequences that allow for enhancing performance of these RNAs in cells. Aspects of the invention also provide for selection of said sequences.
- aspects of the invention also provide for methods of simplifying the cloning and delivery of components of the CRISPR complex.
- a suitable promoter such as the U6 promoter
- a DNA oligo is amplified with a DNA oligo and added onto the guide RNA.
- the resulting PCR product can then be transfected into cells to drive expression of the guide RNA.
- aspects of the invention also relate to the guide RNA being transcribed in vitro or ordered from a synthesis company and directly transfected.
- the invention provides for methods to improve activity by using a more active polymerase.
- the expression of guide RNAs under the control of the T7 promoter is driven by the expression of the T7 polymerase in the cell.
- the cell is a eukaryotic cell.
- the eukaryotic cell is a human cell.
- the human cell is a patient specific cell.
- the invention provides for methods of reducing the toxicity of Cas enzymes.
- the Cas enzyme is any Cas9 as described herein, for instance any naturally-occurring bacterial Cas9 as well as any chimaeras, mutants, homologs or orthologs.
- the Cas9 is delivered into the cell in the form of mRNA. This allows for the transient expression of the enzyme thereby reducing toxicity.
- the invention also provides for methods of expressing Cas9 under the control of an inducible promoter, and the constructs used therein.
- the invention provides for methods of improving the in vivo applications of the CRISPR-Cas system.
- the Cas enzyme is wildtype Cas9 or any of the modified versions described herein, including any naturally-occurring bacterial Cas9 as well as any chimaeras, mutants, homologs or orthologs.
- An advantageous aspect of the invention provides for the selection of Cas9 homologs that are easily packaged into viral vectors for delivery.
- Cas9 orthologs typically share the general organization of 3-4 RuvC domains and a HNH domain. The 5′ most RuvC domain cleaves the non-complementary strand, and the HNH domain cleaves the complementary strand. All notations are in reference to the guide sequence.
- the catalytic residue in the 5′ RuvC domain is identified through homology comparison of the Cas9 of interest with other Cas9 orthologs (from S. pyogenes type II CRISPR locus, S. thermophilus CRISPR locus 1 , S. thermophilus CRISPR locus 3, and Franciscilla novicida type II CRISPR locus), and the conserved Asp residue (D10) is mutated to alanine to convert Cas9 into a complementary-strand nicking enzyme. Similarly, the conserved His and Asn residues in the HNH domains are mutated to Alanine to convert Cas9 into a non-complementary-strand nicking enzyme. In some embodiments, both sets of mutations may be made, to convert Cas9 into a non-cutting enzyme.
- the CRISPR enzyme is a type I or III CRISPR enzyme, preferably a type II CRISPR enzyme.
- This type II CRISPR enzyme may be any Cas enzyme.
- a preferred Cas enzyme may be identified as Cas9 as this can refer to the general class of enzymes that share homology to the biggest nuclease with multiple nuclease domains from the type II CRISPR system.
- the Cas9 enzyme is from, or is derived from, spCas9 or saCas9.
- Applicants mean that the derived enzyme is largely based, in the sense of having a high degree of sequence homology with, a wildtype enzyme, but that it has been mutated (modified) in some way as described herein
- Cas and CRISPR enzyme are generally used herein interchangeably, unless otherwise apparent.
- residue numberings used herein refer to the Cas9 enzyme from the type II CRISPR locus in Streptococcus pyvogenes .
- this invention includes many more Cas9s from other species of microbes, such as SpCas9, SaCas9, St1Cas9 and so forth. Further examples are provided herein.
- the skilled person will be able to determine appropriate corresponding residues in Cas9 enzymes other than SpCas9 by comparison of the relevant amino acid sequences.
- a specific amino acid replacement is referred to using the SpCas9 numbering, then, unless the context makes it apparent this is not intended to refer to other Cas9 enzymes, the disclosure is intended to encompass corresponding modifications in other Cas9 enzymes.
- codon optimized sequence in this instance optimized for humans (i.e. being optimized for expression in humans) is provided herein, see the SaCas9 human codon optimized sequence. Whilst this is preferred, it will be appreciated that other examples are possible and codon optimization for a host species is known.
- the invention provides for methods of enhancing the function of Cas9 by generating chimeric Cas9 proteins.
- Chimeric Cas9 proteins chimeric Cas9s may be new Cas9 containing fragments from more than one naturally occurring Cas9. These methods may comprise fusing N-terminal fragments of one Cas9 homolog with C-terminal fragments of another Cas9 homolog. These methods also allow for the selection of new properties displayed by the chimeric Cas9 proteins.
- the modification may occur ex vivo or in vitro, for instance in a cell culture and in some instances not in vivo. In other embodiments, it may occur in vivo.
- the invention provides a method of modifying an organism or a non-human organism by manipulation of a target sequence in a genomic locus of interest comprising: delivering a non-naturally occurring or engineered composition comprising:
- chiRNA CRISPR-Cas system chimeric RNA
- a polynucleotide sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences, wherein (a), (b) and (c) are arranged in a 5′ to 3′ orientation, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence and the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA, or (B) I.
- polynucleotides comprising: (a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, and (b) at least one or more tracr mate sequences, II. a polynucleotide sequence encoding a CRISPR enzyme, and III.
- a polynucleotide sequence comprising a tracr sequence, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, and the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA.
- any or all of the polynucleotide sequence encoding a CRISPR enzyme, guide sequence, tracr mate sequence or tracr sequence may be RNA.
- the polynucleotides encoding the sequence encoding a CRISPR enzyme, the guide sequence, tracr mate sequence or tracr sequence may be RNA and may be delivered via liposomes, nanoparticles, exosomes, microvesicles, or a gene-gun.
- RNA sequence includes the feature.
- the DNA sequence is or can be transcribed into the RNA including the feature at issue.
- the feature is a protein, such as the CRISPR enzyme
- the DNA or RNA sequence referred to is, or can be, translated (and in the case of DNA transcribed first).
- the invention provides a method of modifying an organism, e.g., mammal including human or a non-human mammal or organism by manipulation of a target sequence in a genomic locus of interest comprising delivering a non-naturally occurring or engineered composition comprising a viral or plasmid vector system comprising one or more viral or plasmid vectors operably encoding a composition for expression thereof, wherein the composition comprises: (A) a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising I.
- a first regulatory element operably linked to a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence wherein the polynucleotide sequence comprises (a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, (b) a tracr mate sequence, and (c) a tracr sequence, and II.
- chiRNA CRISPR-Cas system chimeric RNA
- a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, and III.
- a third regulatory element operably linked to a tracr sequence wherein components I, II and III are located on the same or different vectors of the system, wherein when transcribed, the tractr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
- components I, II and III are located on the same vector.
- components I and II are located on the same vector, while component III is located on another vector. In other embodiments, components I and III are located on the same vector, while component II is located on another vector. In other embodiments, components II and III are located on the same vector, while component I is located on another vector. In other embodiments, each of components I, II and Ill is located on different vectors.
- the invention also provides a viral or plasmid vector system as described herein.
- the vector is a viral vector, such as a lenti- or baculo- or preferably adeno-viral/adeno-associated viral vectors, but other means of delivery are known (such as yeast systems, microvesicles, gene guns/means of attaching vectors to gold nanoparticles) and are provided.
- a viral vector such as a lenti- or baculo- or preferably adeno-viral/adeno-associated viral vectors, but other means of delivery are known (such as yeast systems, microvesicles, gene guns/means of attaching vectors to gold nanoparticles) and are provided.
- one or more of the viral or plasmid vectors may be delivered via liposomes, nanoparticles, exosomes, microvesicles, or a gene-gun.
- Applicants also mean the epigenetic manipulation of a target sequence. This may be of the chromatin state of a target sequence, such as by modification of the methylation state of the target sequence (i.e. addition or removal of methylation or methylation patterns or CpG islands), histone modification, increasing or reducing accessibility to the target sequence, or by promoting 3D folding.
- the invention provides a method of treating or inhibiting a condition caused by a defect in a target sequence in a genomic locus of interest in a subject (e.g., mammal or human) or a non-human subject (e.g., mammal) in need thereof comprising modifying the subject or a non-human subject by manipulation of the target sequence and wherein the condition is susceptible to treatment or inhibition by manipulation of the target sequence comprising providing treatment comprising: delivering a non-naturally occurring or engineered composition comprising an AAV or lentivirus vector system comprising one or more AAV or lentivirus vectors operably encoding a composition for expression thereof, wherein the target sequence is manipulated by the composition when expressed, wherein the composition comprises: (A) a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising I.
- a first regulatory element operably linked to a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence wherein the polynucleotide sequence comprises (a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, (b) a tracr mate sequence, and (c) a tracr sequence, and II.
- chiRNA CRISPR-Cas system chimeric RNA
- a first regulatory element operably linked to (a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, and (b) at least one or more tracr mate sequences, II. a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, and III.
- a third regulatory element operably linked to a tracr sequence wherein components I, II and III are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
- components 1, II and III are located on the same vector.
- components I and II are located on the same vector, while component III is located on another vector.
- components I and III are located on the same vector, while component II is located on another vector. In other embodiments, components II and III are located on the same vector, while component I is located on another vector. In other embodiments, each of components I, II and III is located on different vectors.
- the invention also provides a viral (e.g. AAV or lentivirus) vector system as described herein, and can be part of a vector system as described herein.
- Some methods of the invention can include inducing expression.
- the organism or subject is a eukaryote (including mammal including human) or a non-human eukaryote or a non-human animal or a non-human mammal.
- the organism or subject is a non-human animal, and may be an arthropod, for example, an insect, or may be a nematode.
- the organism or subject is a plant.
- the organism or subject is a mammal or a non-human mammal.
- a non-human mammal may be for example a rodent (preferably a mouse or a rat), an ungulate, or a primate.
- the organism or subject is algae, including microalgae, or is a fungus.
- the viral vector is an AAV or a lentivirus, and can be part of a vector system as described herein.
- the CRISPR enzyme is a Cas9.
- the expression of the guide sequence is under the control of the T7 promoter and is driven by the expression of T7 polymerase.
- the invention in some embodiments comprehends a method of delivering a CRISPR enzyme comprising delivering to a cell mRNA encoding the CRISPR enzyme.
- the CRISPR enzyme is a Cas9.
- the invention also provides methods of preparing the vector systems of the invention, in particular the viral vector systems as described herein.
- the invention in some embodiments comprehends a method of preparing the AAV of the invention comprising transfecting plasmid(s) containing or consisting essentially of nucleic acid molecule(s) coding for the AAV into AAV-infected cells, and supplying AAV rep and/or cap obligatory for replication and packaging of the AAV.
- the AAV rep and/or cap obligatory for replication and packaging of the AAV are supplied by transfecting the cells with helper plasmid(s) or helper virus(es).
- the helper virus is a poxvirus, adenovirus, herpesvirus or baculovirus.
- the poxvirus is a vaccinia virus.
- the cells are mammalian cells. And in some embodiments the cells are insect cells and the helper virus is baculovirus. In other embodiments, the virus is a lentivirus.
- pathogens are often host-specific.
- Fusarium oxysporum f . sp. lycopersici causes tomato wilt but attacks only tomato
- Plants have existing and induced defenses to resist most pathogens. Mutations and recombination events across plant generations lead to genetic variability that gives rise to susceptibility, especially as pathogens reproduce with more frequency than plants. In plants there can be non-host resistance, e.g., the host and pathogen are incompatible.
- Horizontal Resistance e.g., partial resistance against all races of a pathogen, typically controlled by many genes
- Vertical Resistance e.g., complete resistance to some races of a pathogen but not to other races, typically controlled by a few genes.
- plants and pathogens evolve together, and the genetic changes in one balance changes in other. Accordingly, using Natural Variability, breeders combine most useful genes for Yield, Quality, Uniformity, Hardiness, Resistance.
- the sources of resistance genes include native or foreign Varieties. Heirloom Varieties, Wild Plant Relatives, and Induced Mutations, e.g., treating plant material with mutagenic agents.
- plant breeders are provided with a new tool to induce mutations. Accordingly, one skilled in the art can analyze the genome of sources of resistance genes, and in Varieties having desired characteristics or traits employ the present invention to induce the rise of resistance genes, with more precision than previous mutagenic agents and hence accelerate and improve plant breeding programs.
- the invention further comprehends a composition of the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) for use in medicine or in therapy.
- the invention comprehends a composition according to the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) for use in a method according to the invention.
- the invention provides for the use of a composition of the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) in ex vivo gene or genome editing.
- the invention comprehends use of a composition of the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) in the manufacture of a medicament for ex vivo gene or genome editing or for use in a method according of the invention.
- the invention comprehends in some embodiments a composition of the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme), wherein the target sequence is flanked at its 3′ end by a PAM (protospacer adjacent motif) sequence comprising 5′-motif, especially where the Cas9 is (or is derived from) S. pyogenes or S. aureus Cas9.
- a suitable PAM is 5′-NRG or 5′-NNGRR (where N is any Nucleotide) for SpCas9 or SaCas9 enzymes (or derived enzymes), respectively, as mentioned below.
- SpCas9 or SaCas9 are those from or derived from S. pyogenes or S. aureus Cas9.
- Apects of the invention comprehend improving the specificity of a CRISPR enzyme, e.g. Cas9, mediated gene targeting and reducing the likelihood of off-target modification by the CRISPR enzyme, e.g. Cas9.
- the invention in some embodiments comprehends a method of modifying an organism or a non-human organism by minimizing off-target modifications by manipulation of a first and a second target sequence on opposite strands of a DNA duplex in a genomic locus of interest in a cell comprising delivering a non-naturally occurring or engineered composition comprising:
- a first CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence wherein the first polynucleotide sequence comprises:
- a second CRISPR-Cas system chiRNA polynucleotide sequence wherein the second polynucleotide sequence comprises:
- a polynucleotide sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences and comprising one or more mutations wherein (a), (b) and (c) are arranged in a 5′ to 3′ orientation, wherein when transcribed, the first and the second tracr mate sequence hybridize to the first and second tracr sequence respectively and the first and the second guide sequence directs sequence-specific binding of a first and a second CRISPR complex to the first and second target sequences respectively, wherein the first CRISPR complex comprises the CRISPR enzyme complexed with (1) the first guide sequence that is hybridized to the first target sequence, and (2) the first tracr mate sequence that is hybridized to the first tracr sequence, wherein the second CRISPR complex comprises the CRISPR enzyme complexed with (1) the second guide sequence that is hybridized to the second target sequence, and (2) the second tract mate sequence that is hybridized to the second tracr sequence, wherein the polynucleotide sequence encoding
- any or all of the polynucleotide sequence encoding the CRISPR enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence is/are RNA.
- the polynucleotides encoding the sequence encoding the CRISPR enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence is/are RNA and are delivered via liposomes, nanoparticles, exosomes, microvesicles, or a gene-gun.
- the first and second tractr mate sequence share 100% identity and/or the first and second tracr sequence share 100% identity.
- the polynucleotides may be comprised within a vector system comprising one or more vectors.
- the CRISPR enzyme is a Cas9 enzyme, e.g. SpCas9.
- the CRISPR enzyme comprises one or more mutations in a catalytic domain, wherein the one or more mutations are selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A.
- the CRISPR enzyme has the D100A mutation.
- the first CRISPR enzyme has one or more mutations such that the enzyme is a complementary strand nicking enzyme
- the second CRISPR enzyme has one or more mutations such that the enzyme is a non-complementary strand nicking enzyme.
- the first enzyme may be a non-complementary strand nicking enzyme
- the second enzyme may be a complementary strand nicking enzyme.
- the first guide sequence directing cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directing cleavage of the other strand near the second target sequence results in a 5′ overhang.
- the 5′ overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs.
- the 5′ overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs.
- the tracr mate sequence hybridizes to the tracr sequence and the first and the second guide sequence direct sequence-specific binding of a first and a second CRISPR complex to the first and second target sequences respectively
- the first CRISPR complex comprises the CRISPR enzyme complexed with (1) the first guide sequence that is hybridized to the first target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence
- the second CRISPR complex comprises the CRISPR enzyme complexed with (1) the second guide sequence that is hybridized to the second target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence
- the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA
- the first guide sequence directs cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directs cleavage of the other strand near
- the invention also provides a vector system as described herein.
- the system may comprise one, two, three or four different vectors.
- Components I, II, III and IV may thus be located on one, two, three or four different vectors, and all combinations for possible locations of the components are herein envisaged, for example: components I, II, III and IV can be located on the same vector; components I, II, III and IV can each be located on different vectors; components I, II, III and IV may be located on a total of two or three different vectors, with all combinations of locations envisaged, etc.
- any or all of the polynucleotide sequence encoding the CRISPR enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence is/are RNA.
- the first and second tracr mate sequence share 100% identity and/or the first and second tracr sequence share 100% identity.
- the CRISPR enzyme is a Cas9 enzyme, e.g. SpCas9.
- the CRISPR enzyme comprises one or more mutations in a catalytic domain, wherein the one or more mutations are selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A.
- the CRISPR enzyme has the D10A mutation.
- the first CRISPR enzyme has one or more mutations such that the enzyme is a complementary strand nicking enzyme
- the second CRISPR enzyme has one or more mutations such that the enzyme is a non-complementary strand nicking enzyme.
- the first enzyme may be a non-complementary strand nicking enzyme
- the second enzyme may be a complementary strand nicking enzyme.
- one or more of the viral vectors are delivered via liposomes, nanoparticles, exosomes, microvesicles, or a gene-gun.
- the first guide sequence directing cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directing cleavage of other strand near the second target sequence results in a 5′ overhang.
- the 5′ overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs.
- the 5′ overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs.
- the invention in some embodiments comprehends a method of modifying a genomic locus of interest by minimizing off-target modifications by introducing into a cell containing and expressing a double stranded DNA molecule encoding a gene product of interest an engineered, non-naturally occurring CRISPR-Cas system comprising a Cas protein having one or more mutations and two guide RNAs that target a first strand and a second strand of the DNA molecule respectively, whereby the guide RNAs target the DNA molecule encoding the gene product and the Cas protein nicks each of the first strand and the second strand of the DNA molecule encoding the gene product, whereby expression of the gene product is altered; and, wherein the Cas protein and the two guide RNAs do not naturally occur together.
- the Cas protein nicking each of the first strand and the second strand of the DNA molecule encoding the gene product results in a 5′ overhang.
- the 5′ overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs.
- the 5′ overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs.
- Embodiments of the invention also comprehend the guide RNAs comprising a guide sequence fused to a tracr mate sequence and a tracr sequence.
- the Cas protein is codon optimized for expression in a eukaryotic cell, preferably a mammalian cell or a human cell.
- the Cas protein is a type II CRISPR-Cas protein, e.g. a Cas 9 protein.
- the Cas protein is a Cas9 protein, e.g. SpCas9.
- the Cas protein has one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A.
- the Cas protein has the D10A mutation.
- aspects of the invention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5′ overhangs to reanneal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased.
- the gene product is a protein.
- the invention also comprehends an engineered, non-naturally occurring CRISPR-Cas system comprising a Cas protein having one or more mutations and two guide RNAs that target a first strand and a second strand respectively of a double stranded DNA molecule encoding a gene product in a cell, whereby the guide RNAs target the DNA molecule encoding the gene product and the Cas protein nicks each of the first strand and the second strand of the DNA molecule encoding the gene product, whereby expression of the gene product is altered; and, wherein the Cas protein and the two guide RNAs do not naturally occur together.
- the guide RNAs may comprise a guide sequence fused to a tracr mate sequence and a tracr sequence.
- the Cas protein is a type II CRISPR-Cas protein.
- the Cas protein is codon optimized for expression in a eukaryotic cell, preferably a mammalian cell or a human cell.
- the Cas protein is a type II CRISPR-Cas protein, e.g. a Cas 9 protein.
- the (as protein is a Cas9 protein, e.g. SpCas9.
- the Cas protein has one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A.
- the Cas protein has the D10A mutation.
- aspects of the invention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5′ overhangs to reanneal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased.
- the gene product is a protein.
- the invention also comprehends an engineered, non-naturally occurring vector system comprising one or more vectors comprising:
- the guide RNAs may comprise a guide sequence fused to a tracr mate sequence and a tracr sequence.
- the Cas protein is a type II CRISPR-Cas protein.
- the Cas protein is codon optimized for expression in a eukaryotic cell, preferably a mammalian cell or a human cell.
- the Cas protein is a type II CRISPR-Cas protein, e.g. a Cas 9 protein.
- the (as protein is a Cas9 protein, e.g. SpCas9.
- the Cas protein has one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A.
- the Cas protein has the D10A mutation.
- aspects of the invention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5′ overhangs to reanneal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased.
- the gene product is a protein.
- the vectors of the system are viral vectors.
- the vectors of the system are delivered via liposomes, nanoparticles, exosomes, microvesicles, or a gene-gun.
- the invention provides a method of modifying a target polynucleotide in a eukaryotic cell.
- the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
- said cleavage comprises cleaving one or two strands at the location of the target sequence by said CRISPR enzyme. In some embodiments, said cleavage results in decreased transcription of a target gene. In some embodiments, the method further comprises repairing said cleaved target polynucleotide by homologous recombination with an exogenous template polynucleotide, wherein said repair results in a mutation comprising an insertion, deletion, or substitution of one or more nucleotides of said target polynucleotide. In some embodiments, said mutation results in one or more amino acid changes in a protein expressed from a gene comprising the target sequence.
- the method further comprises delivering one or more vectors to said eukaryotic cell, wherein the one or more vectors drive expression of one or more of: the CRISPR enzyme, the guide sequence linked to the tracr mate sequence, and the tracr sequence.
- said vectors are delivered to the eukaryotic cell in a subject.
- said modifying takes place in said eukaryotic cell in a cell culture.
- the method further comprises isolating said eukaryotic cell from a subject prior to said modifying.
- the method further comprises returning said eukaryotic cell and/or cells derived therefrom to said subject.
- the invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell.
- the method comprises allowing a CRISPR complex to bind to the polynucleotide such that said binding results in increased or decreased expression of said polynucleotide; wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
- the method further comprises delivering one or more vectors to said eukaryotic cells, wherein the one or more vectors drive expression of one or more of: the CRISPR enzyme, the guide sequence linked to the tract mate sequence, and the tracr sequence.
- the invention provides a method of generating a model eukaryotic cell comprising a mutated disease gene.
- a disease gene is any gene associated with an increase in the risk of having or developing a disease.
- the method comprises (a) introducing one or more vectors into a eukaryotic cell, wherein the one or more vectors drive expression of one or more of: a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, and a tracr sequence; and (b) allowing a CRISPR complex to bind to a target polynucleotide to effect cleavage of the target polynucleotide within said disease gene, wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence within the target polynucleotide, and (2) the tracr mate sequence that is hybridized to the tracr sequence, thereby generating a model eukaryotic cell comprising
- said cleavage comprises cleaving one or two strands at the location of the target sequence by said CRISPR enzyme. In some embodiments, said cleavage results in decreased transcription of a target gene. In some embodiments, the method further comprises repairing said cleaved target polynucleotide by homologous recombination with an exogenous template polynucleotide, wherein said repair results in a mutation comprising an insertion, deletion, or substitution of one or more nucleotides of said target polynucleotide. In some embodiments, said mutation results in one or more amino acid changes in a protein expression from a gene comprising the target sequence.
- the invention provides for a method of selecting one or more prokaryotic cell(s) by introducing one or more mutations in a gene in the one or more prokaryotic cell (s), the method comprising: introducing one or more vectors into the prokaryotic cell (s), wherein the one or more vectors drive expression of one or more of: a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, a tracr sequence, and an editing template; wherein the editing template comprises the one or more mutations that abolish CRISPR enzyme cleavage; allowing homologous recombination of the editing template with the target polynucleotide in the cell(s) to be selected; allowing a CRISPR complex to bind to a target polynucleotide to effect cleavage of the target polynucleotide within said gene, wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence within the target polynucle
- the CRISPR enzyme is Cas9.
- the cell to be selected may be a eukaryotic cell. Aspects of the invention allow for selection of specific cells without requiring a selection marker or a two-step process that may include a counter-selection system.
- the invention provides for methods of modifying a target polynucleotide in a eukaryotic cell.
- the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
- this invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell.
- the method comprises increasing or decreasing expression of a target polynucleotide by using a CRISPR complex that binds to the polynucleotide.
- one or more vectors comprising a tracr sequence, a guide sequence linked to the tracr mate sequence, a sequence encoding a CRISPR enzyme is delivered to a cell.
- the one or more vectors comprises a regulatory element operably linked to an enzyme-coding sequence encoding said CRISPR enzyme comprising a nuclear localization sequence; and a regulatory element operably linked to a tracr mate sequence and one or more insertion sites for inserting a guide sequence upstream of the tracr mate sequence.
- the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a cell.
- the CRISPR complex comprises a CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
- a target polynucleotide can be inactivated to effect the modification of the expression in a cell. For example, upon the binding of a CRISPR complex to a target sequence in a cell, the target polynucleotide is inactivated such that the sequence is not transcribed, the coded protein is not produced, or the sequence does not function as the wild-type sequence does. For example, a protein or microRNA coding sequence may be inactivated such that the protein is not produced.
- the CRISPR enzyme comprises one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A or D986A and/or the one or more mutations is in a RuvC1 or HNH domain of the CRISPR enzyme or is a mutation as otherwise as discussed herein.
- the CRISPR enzyme has one or more mutations in a catalytic domain, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the enzyme further comprises a functional domain.
- the functional domain is a transcriptional activation domain, preferably VP64. In some embodiments, the functional domain is a transcription repression domain, preferably KRAB. In some embodiments, the transcription repression domain is SID, or concatemers of SID (eg SID4X). In some embodiments, the functional domain is an epigenetic modifying domain, such that an epigenetic modifying enzyme is provided. In some embodiments, the functional domain is an activation domain, which may be the P65 activation domain.
- the CRISPR enzyme is a type I or III CRISPR enzyme, but is preferably a type II CRISPR enzyme.
- This type II CRISPR enzyme may be any Cas enzyme.
- a Cas enzyme may be identified as Cas9 as this can refer to the general class of enzymes that share homology to the biggest nuclease with multiple nuclease domains from the type II CRISPR system.
- the Cas9 enzyme is from, or is derived from, spCas9 or saCas9.
- Applicants mean that the derived enzyme is largely based, in the sense of having a high degree of sequence homology with, a wildtype enzyme, but that it has been mutated (modified) in some way as described herein.
- Cas and CRISPR enzyme are generally used herein interchangeably, unless otherwise apparent.
- residue numberings used herein refer to the Cas9 enzyme from the type II CRISPR locus in Streptococcus pyogenes .
- this invention includes many more Cas9s from other species of microbes, such as SpCas9, SaCa9, St1Cas9 and so forth.
- codon optimized sequence in this instance optimized for humans (i.e. being optimized for expression in humans) is provided herein, see the SaCas9 human codon optimized sequence. Whilst this is preferred, it will be appreciated that other examples are possible and codon optimization for a host species is known.
- delivery is in the form of a vector which may be a viral vector, such as a lenti- or baculo- or preferably adeno-viral/adeno-associated viral vectors, but other means of delivery are known (such as yeast systems, microvesicles, gene guns/means of attaching vectors to gold nanoparticles) and are provided.
- a vector may mean not only a viral or yeast system (for instance, where the nucleic acids of interest may be operably linked to and under the control of (in terms of expression, such as to ultimately provide a processed RNA) a promoter), but also direct delivery of nucleic acids into a host cell.
- the vector may be a viral vector and this is advantageously an AAV
- viral vectors as herein discussed can be employed, such as lentivirus.
- baculoviruses may be used for expression in insect cells. These insect cells may, in turn be useful for producing large quantities of further vectors, such as AAV or lentivirus vectors adapted for delivery of the present invention.
- a method of delivering the present CRISPR enzyme comprising delivering to a cell mRNA encoding the CRISPR enzyme.
- the CRISPR enzyme is truncated, and/or comprised of less than one thousand amino acids or less than four thousand amino acids, and/or is a nuclease or nickase, and/or is codon-optimized, and/or comprises one or more mutations, and/or comprises a chimeric CRISPR enzyme, and/or the other options as herein discussed.
- AAV and lentiviral vectors are preferred.
- the target sequence is flanked or followed, at its 3′ end, by a PAM suitable for the CRISPR enzyme, typically a Cas and in particular a Cas9.
- a suitable PAM is 5′-NRG or 5′-NNGRR for SpCas9 or SaCas9 enzymes (or derived enzymes), respectively.
- SpCas9 or SaCas9 are those from or derived from S. pyogenes or S. aureus Cas9.
- FIG. 1 shows a schematic model of the CRISPR system.
- the Cas9 nuclease from Streptococcus pyogenes (yellow) is targeted to genomic DNA by a synthetic guide RNA (sgRNA) consisting of a 20-nt guide sequence (blue) and a scaffold (red).
- the guide sequence base-pairs with the DNA target (blue), directly upstream of a requisite 5′-NGG protospacer adjacent motif (PAM; magenta), and Cas9 mediates a double-stranded break (DSB)-3 bp upstream of the PAM (red triangle).
- PAM magenta
- FIG. 2A-F shows an exemplary CRISPR system, a possible mechanism of action, an example adaptation for expression in eukaryotic cells, and results of tests assessing nuclear localization and CRISPR activity.
- FIG. 2C discloses SEQ ID NOS 212 and 213, respectively, in order of appearance.
- FIG. 2E discloses SEQ ID NOS 214-216, respectively, in order of appearance.
- FIG. 2F discloses SEQ ID NOS 217-221, respectively, in order of appearance.
- FIG. 3A-D shows results of an evaluation of SpCas9 specificity for an example target.
- FIG. 3A discloses SEQ ID NOS 222, 215 and 223-233, respectively, in order of appearance.
- FIG. 3C discloses SEQ ID NO: 222.
- FIG. 4A-G show an exemplary vector system and results for its use in directing homologous recombination in eukaryotic cells.
- FIG. 4E discloses SEQ ID NO: 234.
- FIG. 4F discloses SEQ ID NOS 235 and 236, respectively, in order of appearance.
- FIG. 4G discloses SEQ ID NOS 237-241, respectively, in order of appearance.
- FIG. 5 provides a table of protospacer sequences (SEQ ID NOS 93, 92, 91, 242-247, 95, 94 and 248-252, respectively, in order of appearance) and summarizes modification efficiency results for protospacer targets designed based on exemplary S. pyogenes and S. thermophilus CRISPR systems with corresponding PAMs against loci in human and mouse genomes.
- FIG. 6A-C shows a comparison of different tracrRNA transcripts for Cas9-mediated gene targeting.
- FIG. 6A discloses SEQ ID NOS 253 and 254, respectively, in order of appearance.
- FIG. 7 shows a schematic of a surveyor nuclease assay for detection of double strand break-induced micro-insertions and -deletions.
- FIG. 8A-B shows exemplary bicistronic expression vectors for expression of CRISPR system elements in eukaryotic cells.
- FIG. 8A discloses SEQ ID NOS 255-257, respectively, in order of appearance.
- FIG. 8B discloses SEQ ID NOS 258, 182 and 183, respectively, in order of appearance.
- FIG. 9A-C shows histograms of distances between adjacent S. pyogenes SF370 locus 1 PAM (NGG) ( FIG. 9A ) and S. thermophilus LMD9 locus 2 PAM (NNAGAAW) ( FIG. 9B ) in the human genome; and distances for each PAM by chromosome (Chr) ( FIG. 9C ).
- FIG. 10A-D shows an exemplary CRISPR system, an example adaptation for expression in eukaryotic cells, and results of tests assessing CRISPR activity.
- FIG. 10B discloses SEQ ID NOS 259 and 260, respectively, in order of appearance.
- FIG. 10C discloses SEQ ID NO: 261.
- FIG. 11A-C shows exemplary manipulations of a CRISPR system for targeting of genomic loci in mammalian cells.
- FIG. 11A discloses SEQ ID NO: 262.
- FIG. 11B discloses SEQ ID NOS 263-265, respectively, in order of appearance.
- FIG. 12A-B shows the results of a Northern blot analysis of crRNA processing in mammalian cells.
- FIG. 12A discloses SEQ ID NO: 266.
- FIG. 13A-B shows an exemplary selection of protospacers in the human PVALB (SEQ ID NO: 267) and mouse Th loci (SEQ ID NO: 268).
- FIG. 14 shows example protospacer and corresponding PAM sequence targets of the S. thermophilus CRISPR system in the human EMX1 locus.
- FIG. 14 discloses SEQ ID NO: 261.
- FIG. 15 provides a table of sequences (SEQ ID NOS 269-276, 191-192 and 277-278, respectively, in order of appearance) for primers and probes used for Surveyor, RFLP, genomic sequencing, and Northern blot assays.
- FIG. 16A-C shows exemplary manipulation of a CRISPR system with chimeric RNAs and results of SURVEYOR assays for system activity in eukaryotic cells.
- FIG. 16A discloses SEQ ID NO: 279.
- FIG. 17A-B shows a graphical representation of the results of SURVEYOR assays for CRISPR system activity in eukaryotic cells.
- FIG. 18 shows an exemplary visualization of some S. pyogenes Cas9 target sites in the human genome using the UCSC genome browser.
- FIG. 18 discloses SEQ ID NOS 280-358, respectively, in order of appearance.
- FIG. 19A-D shows a circular depiction of the phylogenetic analysis revealing five families of Cas9s, including three groups of large Cas9s ( ⁇ 1400 amino acids) and two of small Cas9s ( ⁇ 1100 amino acids).
- FIG. 20A-F shows the linear depiction of the phylogenetic analysis revealing five families of Cas9s, including three groups of large Cas9s ( ⁇ 1400 amino acids) and two of small Cas9s ( ⁇ 1100 amino acids).
- FIG. 2 A-D shows genome editing via homologous recombination
- (a) Schematic of SpCas9 nickase, with D10A mutation in the RuvC I catalytic domain (b) Schematic representing homologous recombination (HR) at the human EMX1 locus using either sense or antisense single stranded oligonucleotides as repair templates.
- Red arrow above indicates sgRNA cleavage site; PCR primers for genotyping (Tables J and K) are indicated as arrows in right panel,
- FIG. 21C discloses SEQ ID NOS 359-361, 359, 362 and 361, respectively, in order of appearance.
- FIG. 22A-B shows single vector designs for SpCas9.
- FIG. 22A discloses SEQ ID NOS 363-365, respectively, in order of appearance.
- FIG. 22B discloses SEQ ID NO: 366.
- FIG. 23 shows a graph representing the length distribution of Cas9 orthologs.
- FIG. 24A-M shows sequences where the mutation points are located within the SpCas9 gene.
- FIG. 24A-M discloses the nucleotide sequence as SEQ ID NO: 367 and the amino acid sequence as SEQ ID NO: 368.
- FIG. 25A shows the Conditional Cas9, Rosa26 targeting vector map.
- FIG. 25B shows the Constitutive Cas9, Rosa26 targeting vector map.
- FIG. 26 shows a schematic of the important elements in the Constitutive and Conditional Cas9 constructs.
- FIG. 27 shows delivery and in vivo mouse brain Cas9 expression data.
- FIG. 28 shows RNA delivery of Cas9 and chimeric RNA into cells
- A Delivery of a GFP reporter as either DNA or mRNA into Neuro-2A cells
- B Delivery of Cas9 and chimeric RNA against the Icam2 gene as RNA results in cutting for one of two spacers tested
- C Delivery of Cas9 and chimeric RNA against the F7 gene as RNA results in cutting for one of two spacers tested.
- FIG. 29 shows how DNA double-strand break (DSB) repair promotes gene editing.
- NHEJ error-prone non-homologous end joining
- Indel random insertion/deletion
- a repair template in the form of a plasmid or single-stranded oligodeoxynucleotides (ssODN) can be supplied to leverage the homology-directed repair (HDR) pathway, which allows high fidelity and precise editing.
- FIG. 30A-C shows anticipated results for HDR in HEK and HUES9 cells
- Either a targeting plasmid or an ssODN (sense or antisense) with homology arms can be used to edit the sequence at a target genomic locus cleaved by Cas9 (red triangle).
- a targeting plasmid or an ssODN (sense or antisense) with homology arms can be used to edit the sequence at a target genomic locus cleaved by Cas9 (red triangle).
- a HindIII site red bar
- ssODNs oriented in either the sense or the antisense (s or a) direction relative to the locus of interest, can be used in combination with Cas9 to achieve efficient HDR-mediated editing at the target locus.
- ssODNs Example of the effect of ssODNs on HDR in the EMX1 locus is shown using both wild-type Cas9 and Cas9 nickase (D10A).
- Each ssODN contains homology arms of 90 bp flanking a 12-bp insertion of two restriction sites.
- FIG. 30B discloses SEQ ID NOS 359-361, 359, 362 and 361, respectively, in order of appearance.
- FIG. 31A-C shows the repair strategy for Cystic Fibrosis delta F508 mutation.
- FIG. 31A discloses the nucleotide sequence as SEQ ID NO: 371 and the amino acid sequence as 372.
- FIG. 31B discloses SEQ ID NO: 279.
- FIG. 31C discloses the nucleotide sequence as SEQ ID NO: 373 and the amino acid sequence as SEQ ID NO: 374.
- FIG. 32A-B (a) shows a schematic of the GAA repeat expansion in FXN intron I and (b) shows a schematic of the strategy adopted to excise the GAA expansion region using the CRISPR/Cas system.
- FIG. 33 shows a screen for efficient SpCas9 mediated targeting of Tet1-3 and Dnmt1, 3a and 3b gene loci.
- Surveyor assay on DNA from transfected N2A cells demonstrates efficient DNA cleavage by using different gRNAs.
- FIG. 34 shows a strategy of multiplex genome targeting using a 2-vector system in an AAV1/2 delivery system. Tet1-3 and Dnmt1, 3a and 3b gRNA under the control of the U6 promoter. GFP-KASH under the control of the human synapsin promoter. Restriction sides shows simple gRNA replacement strategy by subcloning. HA-tagged SpCas9 flanked by two nuclear localization signals (NLS) is shown. Both vectors are delivered into the brain by AAV1/2 virus in a 1:1 ratio.
- NLS nuclear localization signals
- FIG. 35 shows verification of multiplex DNMT targeting vector #1 functionality using Surveyor assay.
- N2A cells were co-transfected with the DNMT targeting vector #1 (+) and the SpCas9 encoding vector for testing SpCas9 mediated cleavage of DNMTs genes family loci.
- gRNA only ( ⁇ ) is negative control. Cells were harvested for DNA purification and downstream processing 48 h after transfection.
- FIG. 36 shows verification of multiplex DNMT targeting vector #2 functionality using Surveyor assay.
- N2A cells were co-transfected with the DNMT targeting vector #1 (+) and the SpCas9 encoding vector for testing SpCas9 mediated cleavage of DNMTs genes family loci.
- gRNA only ( ⁇ ) is negative control. Cells were harvested for DNA purification and downstream processing 48 h after transfection.
- FIG. 37 shows schematic overview of short promoters and short polyA versions used for HA-SpCas9 expression in vivo. Sizes of the encoding region from L-ITR to R-ITR are shown on the right.
- FIG. 38 shows schematic overview of short promoters and short polyA versions used for HA-SaCas9 expression in vivo. Sizes of the encoding region from L-ITR to R-ITR are shown on the right.
- FIG. 39 shows expression of SpCas9 and SaCas9 in N2A cells. Representative Western blot of HA-tagged SpCas9 and SaCas9 versions under the control of different short promoters and with or short polyA (spA) sequences. Tubulin is loading control. mCherry (mCh) is a transfection control. Cells were harvested and further processed for Western blotting 48 h after transfection.
- spA short polyA
- FIG. 40 shows screen for efficient SaCas9 mediated targeting of Tet3 gene locus.
- Surveyor assay on DNA from transfected N2A cells demonstrates efficient DNA cleavage by using different gRNAs with NNGGGT PUM sequence.
- GFP transfected cells and cells expressing only SaCas9 are controls.
- FIG. 41 shows expression of HA-SaCas9 in the mouse brain.
- Animals were injected into dentate gyri with virus driving expression of HA-SaCas9 under the control of human Synapsin promoter. Animals were sacrificed 2 weeks after surgery.
- HA tag was detected using rabbit monoclonal antibody C29F4 (Cell Signaling). Cell nuclei stained in blue with DAPI stain.
- FIG. 42 shows expression of SpCas9 and SaCas9 in cortical primary neurons in culture 7 days after transduction.
- Tubulin is loading control.
- FIG. 43 shows LIVE/DEAD stain of primary cortical neurons 7 days after transduction with AAV1 particles carrying SpCas9 with different promoters and multiplex gRNAs constructs (example shown on the last panel for DNMTs). Neurons after AAV transduction were compared with control untransduced neurons. Red nuclei indicate permeabilized, dead cells (second line of panels). Live cells are marked in green color (third line of panels).
- FIG. 44 shows LIVE/DEAD stain of primary cortical neurons 7 days after transduction with AAV1 particles carrying SaCas9 with different promoters. Red nuclei indicate permeabilized, dead cells (second line of panels). Live cells are marked in green color (third line of panels).
- FIG. 45 shows comparison of morphology of neurons after transduction with AAV1 virus carrying SpCas9 and gRNA multiplexes for TETs and DNMTs genes loci. Neurons without transduction are shown as a control.
- FIG. 46 shows verification of multiplex DNMT targeting vector #1 functionality using Surveyor assay in primary cortical neurons.
- Cells were co-transduced with the DNMT targeting vector #1 and the SpCas9 viruses with different promoters for testing SpCas9 mediated cleavage of DNMTs genes family loci.
- FIG. 47 shows in vivo efficiency of SpCas9 cleavage in the brain.
- Mice were injected with AAV1/2 virus carrying gRNA multiplex targeting DNMT family genes loci together with SpCas9 viruses under control of 2 different promoters: mouse Mecp2 and rat Map1b.
- FIG. 48 shows purification of GFP-KASH labeled cell nuclei from hippocampal neurons.
- the outer nuclear membrane (ONM) of the cell nuclear membrane is tagged with a fusion of GFP and the KASH protein transmembrane domain. Strong GFP expression in the brain after one week of stereotactic surgery and AAV1/2 injection. Density gradient centrifugation step to purify cell nuclei from intact brain. Purified nuclei are shown. Chromatin stain by Vybrant® DyeCycleTM Ruby Stain is shown in red, GFP labeled nuclei are green. Representative FACS profile of GFP+ and GFP ⁇ cell nuclei (Magenta: Vybrant® DyeCycleTM Ruby Stain, Green: GFP).
- FIG. 49 shows efficiency of SpCas9 cleavage in the mouse brain.
- Mice were injected with AAV1/2 virus carrying gRNA multiplex targeting TET family genes loci together with SpCas9 viruses under control of 2 different promoters: mouse Mecp2 and rat Map1b.
- FIG. 50 shows GFP-KASH expression in cortical neurons in culture. Neurons were transduced with AAV1 virus carrying gRNA multiplex constructs targeting TET genes loci. The strongest signal localize around cells nuclei due to KASH domain localization.
- FIG. 51 shows (top) a list of spacing (as indicated by the pattern of arrangement for two PAM sequences) between pairs of guide RNAs (SEQ ID NOS 375-391, respectively, in order of appearance). Only guide RNA pairs satisfying patterns 1, 2, 3, 4 exhibited indels when used with SpCas9(D10A) nickase, (bottom) Gel images showing that combination of SpCas9(D10A) with pairs of guide RNA satisfying patterns 1, 2, 3, 4 led to the formation of indels in the target site.
- FIG. 52 shows a list of U6 reverse primer sequences (SEQ ID NOS 392-438, respectively, in order of appearance) used to generate U6-guide RNA expression cassettes. Each primer needs to be paired with the U6 forward primer “gcactgagggcctatttcccatgattc” (SEQ ID NO: 1) to generate amplicons containing U6 and the desired guide RNA.
- FIG. 53 shows a Genomic sequence map from the human Emx1 locus showing the locations of the 24 patterns listed in FIG. 33 .
- FIG. 53 discloses the nucleotide sequence as SEQ ID NO: 439 and the amino acid sequences as SEQ ID NOS 440-443, respectively, in order of appearance.
- FIG. 54 shows on (right) a gel image indicating the formation of indels at the target site when variable 5′ overhangs are present after cleavage by the Cas9 nickase targeted by different pairs of guide RNAs. on (left) a table indicating the lane numbers of the gel on the right and various parameters including identifying the guide RNA pairs used and the length of the 5′ overhang present following cleavage by the Cas9 nickase.
- FIG. 55 shows a Genomic sequence map from the human Emx1 locus showing the locations of the different pairs of guide RNAs that result in the gel patterns of FIG. 54 (right) and which are further described in Example 35.
- FIG. 55 discloses the nucleotide sequence as SEQ ID NO: 439 and the amino acid sequences as SEQ ID NOS 440-443, respectively, in order of appearance.
- FIG. 56 shows staining of HA-SpCas9 in dorsal and ventral hippocampus 8 weeks after injection of viruses encoding Mecp2-HA-SpCas9 and 3 ⁇ gRNA-TETS with Syn-KASH-GFP.
- FIG. 57 shows Syn_GFP-KASH expression 8 weeks after 3 ⁇ gRNA virus injection is specific for neurons (NeuN positive cells) and not for glia cells (GFAP positive).
- FIG. 58 shows behavior tests conducted 5 weeks after CRISPR-mediated KD of TETs and DNMTs in dentate gyrus (ventral and dorsal part) showed increased level of anxiety and learning deficits.
- E Barnes maze results.
- F Freezing behavior during contextual fear conditioning.
- H Trace fear conditioning results for TETs KD and DNMTs KD (I).
- Control animals injected with SpCas9 virus and GFP-KASH construct without gRNAs.
- TETs animals injected with both SpCas9 and construct encoding gRNAs against Tet1, Tet2 and Tet3.
- DNMTs animals injected with both SpCas9 and construct encoding gRNAs against Dnmt1, Dnmt3a and Dnmt3b.
- FIG. 59 shows cutting efficiency of Tet loci in the brain, 8 weeks after Mecp_SpCas9 virus injection in compare to control animals injected with Mecp2_SpCas9 virus only.
- FIG. 60 shows cutting efficiency of Dnmt loci in the brain, 8 weeks after Mecp_SpCas9 virus injection in compare to control animals injected with Mecp2_SpCas9 virus only.
- FIG. 61 shows Dnmt3a staining in the brain, 8 weeks after stereotaxic injection of virus encoding Mecp2_SpCas9 and gRNAs targeting Dnmt loci.
- Bottom panel shows magnification of ROI indicated on the upper panel.
- FIG. 62 shows staining of Syn_HA-SaCas9 in the dorsal hippocampus, 4 weeks after injection of virus.
- First column shows animal injected with Sa-Cas9 only, middle column animal injected with both SaCas9 and gRNAs against TETs loci and the right column represents animal injected with only gRNAs encoding virus.
- SaCas9 nuclear localization depends on the presence of gRNA.
- FIG. 63 shows SpCas9 in N2a cells.
- FIG. 64 shows SpCas9 in primary neurons.
- FIG. 65 shows knock down of Dnmt3a in primary neurons.
- FIG. 66 shows knock down of Dnmt3a in vivo.
- FIG. 67 shows expression of SaCas9 in primary neurons.
- D Nuclear localization of SaCas9 in presence of gRNA.
- D′ Higher magnification of SaCas9 positive neurons shown in D).
- FIG. 68 shows gRNA dependent nuclear localization of SaCas9.
- D Line Scan analysis of confocal picture B) showing nuclear localization of SaCas9 in presence of gRNA (red, SaCas9 signal; blue. DAPI signal; green, GFP-KASH signal).
- FIG. 69 shows an AAV-Sa-Cas9 vector, a liver-specific AAV-Sa-Cas9 vector and an alternate AAV-Sa-Cas9 vector.
- FIG. 70 shows data on optimized CMV-SaCas9-NLS-U6-sgRNA vector (submitted vector design last time); new data compares N′-term vs C′-term tagged SaCas9 and shows enhanced cleavage efficiency using C′-term NLS tagging.
- FIG. 71 shows SURVEYOR image showing indels generated by new Pcsk9 targets.
- FIG. 72 shows SaCas9 specificity: genome-wide off target sites (GWOTs) are predicted based on 2 criteria: they contain 4 or fewer mismatched bases to intended SaCas9 target and bear the least restrictive PAM for SaCas9, NNGRR.
- HEK 293FT cells are transfected with either SpCas9 or SaCas9 with their corresponding sgRNAs at a target site (EMX1: TAGGGTTAGGGGCCCCAGGC (SEQ ID NO: 2)) that has CGGGGT as a PAM (sequence including PAM disclosed as SEQ ID NO: 369) so that it can be cut by either SpCas9 (CGG) or SaCas9 (CGGGGT).
- DNAs from cells are harvested and analyzed for indels by Illumina sequencing at on-target and 41 predicted off-target loci (following protocols from Hsu et al. Nature Biotech 2013 and data analysis pipeline developed by David Scott and Josh Weinstein).
- FIG. 73 shows that that SaCas9 may have a higher level of off-target activity than SpCas9 at certain loci.
- the invention relates to the engineering and optimization of systems, methods and compositions used for the control of gene expression involving sequence targeting, such as genome perturbation or gene-editing, that relate to the CRISPR-Cas system and components thereof.
- sequence targeting such as genome perturbation or gene-editing
- the Cas enzyme is Cas9.
- An advantage of the present methods is that the CRISPR system avoids off-target binding and its resulting side effects. This is achieved using systems arranged to have a high degree of sequence specificity for the target DNA.
- Cas9 optimization may be used to enhance function or to develop new functions, one can generate chimeric Cas9 proteins. Examples that the Applicants have generated are provided in Example 6.
- Chimeric Cas9 proteins can be made by combining fragments from different Cas9 homologs. For example, two example chimeric Cas9 proteins from the Cas9s described herein. For example, Applicants fused the N-term of St1Cas9 (fragment from this protein is in bold) with C-term of SpCas9.
- chimeric Cas9s include any or all of: reduced toxicity, improved expression in eukaryotic cells; enhanced specificity; reduced molecular weight of protein, for example, making the protein smaller by combining the smallest domains from different Cas9 homologs; and/or altering the PAM sequence requirement.
- the Cas9 may be used as a generic DNA binding protein.
- Cas9 as a generic DNA binding protein by mutating the two catalytic domains (D10 and H840) responsible for cleaving both strands of the DNA target.
- a transcriptional activation domain VP64
- Other transcriptional activation domains are known.
- transcriptional activation is possible.
- gene repression in this case of the beta-catenin gene
- Cas9 repressor DNA-binding domain
- Cas9 and one or more guide RNA can be delivered using adeno associated virus (AAV), lentivirus, adenovirus or other plasmid or viral vector types, in particular, using formulations and doses from, for example, U.S. Pat. No. 8,454,972 (formulations, doses for adenovirus), U.S. Pat. No. 8,404,658 (formulations, doses for AAV) and U.S. Pat. No. 5,846,946 (formulations, doses for DNA plasmids) and from clinical trials and publications regarding the clinical trials involving lentivirus, AAV and adenovirus.
- AAV the route of administration, formulation and dose can be as in U.S. Pat. No.
- the route of administration, formulation and dose can be as in U.S. Pat. No. 8,404,658 and as in clinical trials involving adenovirus.
- the route of administration, formulation and dose can be as in U.S. Pat. No. 5,846,946 and as in clinical studies involving plasmids.
- Doses may be based on or extrapolated to an average 70 kg individual, and can be adjusted for patients, subjects, mammals of different weight and species. Frequency of administration is within the ambit of the medical or veterinary practitioner (e.g., physician, veterinarian), depending on usual factors including the age, sex, general health, other conditions of the patient or subject and the particular condition or symptoms being addressed.
- the viral vectors can be injected into the tissue of interest.
- the expression of Cas9 can be driven by a cell-type specific promoter.
- liver-specific expression might use the Albumin promoter and neuron-specific expression might use the Synapsin I promoter.
- Transgenic animals are also provided.
- Preferred examples include animals comprising Cas9, in terms of polynucleotides encoding Cas9 or the protein itself. Mice, rats and rabbits are preferred.
- To generate transgenic mice with the constructs as exemplified herein one may inject pure, linear DNA into the pronucleus of a zygote from a pseudo pregnant female, e.g. a CB56 female. Founders may then be identified, genotyped, and backcrossed to CB57 mice. The constructs may then be cloned and optionally verified, for instance by Sanger sequencing. Knock outs are envisaged where for instance one or more genes are knocked out in a model.
- knockins are also envisaged (alone or in combination).
- An example knockin Cas9 mouse was generated and this is exemplified, but Cas9 knockins are preferred.
- To generate a Cas9 knock in mice one may target the same constitutive and conditional constructs to the Rosa26 locus, as described herein ( FIGS. 25A-B and 26 ).
- Methods of US Patent Publication Nos. 20120017290 and 20110265198 assigned to Sangamo BioSciences, Inc. directed to targeting the Rosa locus may be modified to utilize the CRISPR Cas system of the present invention.
- the methods of US Patent Publication No. 20130236946 assigned to Cellectis directed to targeting the Rosa locus may also be modified to utilize the CRISPR Cas system of the present invention.
- conditional Cas9 mouse Applicants have shown in 293 cells that the Cas9 conditional expression construct can be activated by co-expression with Cre. Applicants also show that the correctly targeted R1 mESCs can have active Cas9 when Cre is expressed. Because Cas9 is followed by the P2A peptide cleavage sequence and then EGFP Applicants identify successful expression by observing EGFP. Applicants have shown Cas9 activation in mESCs. This same concept is what makes the conditional Cas9 mouse so useful. Applicants may cross their conditional Cas9 mouse with a mouse that ubiquitously expresses Cre (ACTB-Cre line) and may arrive at a mouse that expresses Cas9 in every cell.
- ACTB-Cre line a mouse that expresses Cas9 in every cell.
- transgenic animals are also provided, as are transgenic plants, especially crops and algae.
- the transgenic plants may be useful in applications outside of providing a disease model. These may include food or feed production through expression of, for instance, higher protein, carbohydrate, nutrient or vitamin levels than would normally be seen in the wildtype.
- transgenic plants especially pulses and tubers, and animals, especially mammals such as livestock (cows, sheep, goats and pigs), but also poultry and edible insects, are preferred.
- Transgenic algae or other plants such as rape may be particularly useful in the production of vegetable oils or biofuels such as alcohols (especially methanol and ethanol), for instance. These may be engineered to express or overexpress high levels of oil or alcohols for use in the oil or biofuel industries.
- alcohols especially methanol and ethanol
- AAV Adeno Associated Virus
- AAV is advantageous over other viral vectors for a couple of reasons:
- AAV has a packaging limit of 4.5 or 4.75 Kb. This means that Cas9 as well as a promoter and transcription terminator have to be all fit into the same viral vector. Constructs larger than 4.5 or 4.75 Kb will lead to significantly reduced virus production. SpCas9 is quite large, the gene itself is over 4.1 Kb, which makes it difficult for packing into AAV. Therefore embodiments of the invention include utilizing homologs of Cas9 that are shorter. For example:
- Promoter-gRNA(N)-terminator up to size limit of vector
- Double virus vector Double virus vector
- Vector 1 containing one expression cassette for driving the expression of Cas9
- Vector 2 containing one more expression cassettes for driving the expression of one or more guideRNAs
- Promoter-gRNA(N)-terminator up to size limit of vector
- an additional vector is used to deliver a homology-direct repair template.
- Promoter used to drive Cas9 coding nucleic acid molecule expression can include:
- AAV1TR can serve as a promoter: this is advantageous for eliminating the need for an additional promoter element (which can take up space in the vector).
- the additional space freed up can be used to drive the expression of additional elements (gRNA, etc.).
- ITR activity is relatively weaker, so can be used to reduce toxicity due to over expression of Cas9.
- promoters CMV, CAG, CBh, PGK, SV40, Ferritin heavy or light chains, etc.
- promoters For brain expression, can use promoters: Synapsinl for all neurons, CaMKllalpha for excitatory neurons, GAD67 or GAD65 or VGAT for GABAergic neurons, etc.
- Albumin promoter For liver expression, can use Albumin promoter.
- ICAM ICAM
- hematopoictic cells can use IFNbeta or CD45.
- Promoter used to drive guide RNA can include:
- Pol III promoters such as U6 or H1
- the AAV can be AAV1, AAV2, AAV5 or any combination thereof.
- AAV8 is useful for delivery to the liver. The above promoters and vectors are preferred individually.
- RNA delivery is also a useful method of in vivo delivery.
- FIG. 27 shows delivery and in vivo mouse brain Cas9 expression data. It is possible to deliver Cas9 and gRNA (and, for instance, HR repair template) into cells using liposomes or nanoparticles.
- delivery of the CRISPR enzyme, such as a Cas9 and/or delivery of the RNAs of the invention may be in RNA form and via microvesicles, liposomes or nanoparticles.
- Cas9 mRNA and gRNA can be packaged into liposomal particles for delivery in vivo.
- Liposomal transfection reagents such as lipofectamine from Life Technologies and other reagents on the market can effectively deliver RNA molecules into the liver.
- NHEJ efficiency is enhanced by co-expressing end-processing enzymes such as Trex2 (Dumitrache et al. Genetics. 2011 August; 188(4): 787-797). It is preferred that HR efficiency is increased by transiently inhibiting NHEJ machineries such as Ku70 and Ku86. HR efficiency can also be increased by co-expressing prokaryotic or eukaryotic homologous recombination enzymes such as RecBCD, RecA.
- the CRISPR enzyme for instance a Cas9, and/or any of the present RNAs, for instance a guide RNA, can be delivered using adeno associated virus (AAV), lentivirus, adenovirus or other viral vector types, or combinations thereof.
- Cas9 and one or more guide RNAs can be packaged into one or more viral vectors.
- the viral vector is delivered to the tissue of interest by, for example, an intramuscular injection, while other times the viral delivery is via intravenous, transdermal, intranasal, oral, mucosal, or other delivery methods. Such delivery may be either via a single dose, or multiple doses.
- the actual dosage to be delivered herein may vary greatly depending upon a variety of factors, such as the vector chose, the target cell, organism, or tissue, the general condition of the subject to be treated, the degree of transformation/modification sought, the administration route, the administration mode, the type of transformation/modification sought, etc.
- Such a dosage may further contain, for example, a carrier (water, saline, ethanol, glycerol, lactose, sucrose, calcium phosphate, gelatin, dextran, agar, pectin, peanut oil, sesame oil, etc.), a diluent, a pharmaceutically-acceptable carrier (e.g., phosphate-buffered saline), a pharmaceutically-acceptable excipient, an adjuvant to enhance antigenicity, an immunostimulatory compound or molecule, and/or other compounds known in the art.
- a carrier water, saline, ethanol, glycerol, lactose, sucrose, calcium phosphate, gelatin, dextran, agar, pectin, peanut oil, sesame oil, etc.
- a pharmaceutically-acceptable carrier e.g., phosphate-buffered saline
- a pharmaceutically-acceptable excipient e.g., an adju
- the adjuvant herein may contain a suspension of minerals (alum, aluminum hydroxide, aluminum phosphate) on which antigen is adsorbed; or water-in-oil emulsion in which antigen solution is emulsified in oil (MF-59, Freund's incomplete adjuvant), sometimes with the inclusion of killed mycobacteria (Freund's complete adjuvant) to further enhance antigenicity (inhibits degradation of antigen and/or causes influx of macrophages).
- Adjuvants also include immunostimulatory molecules, such as cytokines, costimulatory molecules, and for example, immunostimulatory DNA or RNA molecules, such as CpG oligonucleotides. Such a dosage formulation is readily ascertainable by one skilled in the art.
- the dosage may further contain one or more pharmaceutically acceptable salts such as, for example, a mineral acid salt such as a hydrochloride, a hydrobromide, a phosphate, a sulfate, etc.; and the salts of organic acids such as acetates, propionates, malonates, benzoates, etc.
- auxiliary substances such as wetting or emulsifying agents, pH buffering substances, gels or gelling materials, flavorings, colorants, microspheres, polymers, suspension agents, etc. may also be present herein.
- Suitable exemplary ingredients include microcrystalline cellulose, carboxymethylcellulose sodium, polysorbate 80, phenylethyl alcohol, chlorobutanol, potassium sorbate, sorbic acid, sulfur dioxide, propyl gallate, the parabens, ethyl vanillin, glycerin, phenol, parachlorophenol, gelatin, albumin and a combination thereof.
- the delivery is via an adenovirus, which may be at a single booster dose containing at least 1 ⁇ 10 5 particles (also referred to as particle units, pu) of adenoviral vector.
- the dose preferably is at least about 1 ⁇ 10 6 particles (for example, about 1 ⁇ 10 6 -1 ⁇ 10 12 particles), more preferably at least about 1 ⁇ 10 7 particles, more preferably at least about 1 ⁇ 10 8 particles (e.g., about 1 ⁇ 10 3 -1 ⁇ 10 11 particles or about 1 ⁇ 10-1 ⁇ 10 12 particles), and most preferably at least about 1 ⁇ 10 0 particles (e.g., about 1* ⁇ 10 9 -1 ⁇ 10 10 particles or about 1 ⁇ 10 9 -1 ⁇ 10 12 particles), or even at least about 1 ⁇ 10 10 particles (e.g., about 1 ⁇ 10 10 -1 ⁇ 10 12 particles) of the adenoviral vector.
- the dose comprises no more than about 1 ⁇ 10 14 particles, preferably no more than about 1 ⁇ 10 13 particles, even more preferably no more than about 1 ⁇ 10 12 particles, even more preferably no more than about 1 ⁇ 10 11 particles, and most preferably no more than about 1 ⁇ 10 12 particles (e.g., no more than about 1 ⁇ 10 9 articles).
- the dose may contain a single dose of adenoviral vector with, for example, about 1 ⁇ 10 6 particle units (pu), about 2 ⁇ 10 6 pu, about 4 ⁇ 10 6 pu, about 1 ⁇ 10 7 pu, about 2 ⁇ 10 7 pu, about 4 ⁇ 10 7 pu, about 1 ⁇ 10 8 pu, about 2 ⁇ 10 8 pu, about 4 ⁇ 10 8 pu, about 1 ⁇ 10 9 pu, about 2 ⁇ 10 9 pu, about 4 ⁇ 10 9 pu, about 1 ⁇ 10 10 pu, about 2 ⁇ 10 10 pu, about 4 ⁇ 10 10 pu, about 1 ⁇ 10 11 pu, about 2 ⁇ 10 11 pu, about 4 ⁇ 10 11 pu, about 1 ⁇ 10 12 pu, about 2 ⁇ 10 12 pu, or about 4 ⁇ 10 12 pu of adenoviral vector.
- adenoviral vector with, for example, about 1 ⁇ 10 6 particle units (pu), about 2 ⁇ 10 6 pu, about 4 ⁇ 10 6 pu, about 1 ⁇ 10 7 pu, about 2 ⁇ 10 7 pu, about 4 ⁇ 10 7 pu, about 1 ⁇ 10 8 pu, about 2 ⁇ 10 8 pu, about 4 ⁇ 10
- the adenoviral vectors in U.S. Pat. No. 8,454,972 B2 to Nabel, et. al., granted on Jun. 4, 2013; incorporated by reference herein, and the dosages at col 29, lines 36-58 thereof.
- the adenovirus is delivered via multiple doses.
- the delivery is via an AAV.
- a therapeutically effective dosage for in vivo delivery of the AAV to a human is believed to be in the range of from about 20 to about 50 ml of saline solution containing from about 1 ⁇ 10 10 to about 1 ⁇ 10 10 functional AAV/ml solution. The dosage may be adjusted to balance the therapeutic benefit against any side effects.
- the AAV dose is generally in the range of concentrations of from about 1 ⁇ 10 5 to 1 ⁇ 10 50 genomes AAV, from about 1 ⁇ 10 8 to 1 ⁇ 10 20 genomes AAV, from about 1 ⁇ 10 10 to about 1 ⁇ 10 16 genomes, or about 1 ⁇ 10 16 to about 1 ⁇ 10 16 genomes AAV.
- a human dosage may be about 1 ⁇ 10 13 genomes AAV.
- Such concentrations may be delivered in from about 0.001 ml to about 100 ml, about 0.05 to about 50 ml, or about 10 to about 25 ml of a carrier solution.
- Other effective dosages can be readily established by one of ordinary skill in the art through routine trials establishing dose response curves. See, for example, U.S. Pat. No. 8,404,658 B2 to Hajjar, et al., granted on Mar. 26, 2013, at col. 27, lines 45-60.
- the delivery is via a plasmid.
- the dosage should be a sufficient amount of plasmid to elicit a response.
- suitable quantities of plasmid DNA in plasmid compositions can be from about 0.1 to about 2 mg, or from about 1 ⁇ g to about 10 ⁇ g.
- the doses herein are based on an average 70 kg individual.
- the frequency of administration is within the ambit of the medical or veterinary practitioner (e.g., physician, veterinarian), or scientist skilled in the art.
- Lentiviruses are complex retroviruses that have the ability to infect and express their genes in both mitotic and post-mitotic cells.
- the most commonly known lentivirus is the human immunodeficiency virus (HIV), which uses the envelope glycoproteins of other viruses to target a broad range of cell types.
- HIV human immunodeficiency virus
- lentiviral transfer plasmid pCasES10
- pMD2.G VSV-g pseudotype
- psPAX2 gag/pol/rev/tat
- Transfection was done in 4 mL OptiMEM with a cationic lipid delivery agent (50 uL Lipofectamine 2000 and 100 ul Plus reagent). After 6 hours, the media was changed to antibiotic-free DMEM with 10% fetal bovine serum.
- Lentivirus may be purified as follows. Viral supernatants were harvested after 48 hours. Supernatants were first cleared of debris and filtered through a 0.45 um low protein binding (PVDF) filter. They were then spun in a ultracentrifuge for 2 hours at 24,000 rpm. Viral pellets were resuspended in 50 ul of DMEM overnight at 4 C. They were then aliquotted and immediately frozen at ⁇ 80 C.
- PVDF low protein binding
- minimal non-primate lentiviral vectors based on the equine infectious anemia virus are also contemplated, especially for ocular gene therapy (see, e.g., Balagaan, J Gene Med 2006; 8: 275-285, Published online 21 Nov. 2005 in Wiley InterScience (www.interscience.wiley.com). DOI: 10.1002/jgm.845).
- EIAV equine infectious anemia virus
- RetinoStat® an equine infectious anemia virus-based lentiviral gene therapy vector that expresses angiostatic proteins endostain and angiostatin that is delivered via a subretinal injection for the treatment of the web form of age-related macular degeneration is also contemplated (see, e.g., Binley et al., HUMAN GENE THERAPY 23:980-991 (September 2012)) may be modified for the CRISPR-Cas system of the present invention.
- self-inactivating lentiviral vectors with an siRNA targeting a common exon shared by HIV tat/rev, a nucleolar-localizing TAR decoy, and an anti-CCR5-specific hammerhead ribozyme may be used/and or adapted to the CRISPR-Cas system of the present invention.
- a minimum of 2.5 ⁇ 10 6 CD34+ cells per kilogram patient weight may be collected and prestimulated for 16 to 20 hours in X-VIVO 15 medium (Lonza) containing 2 mML-glutamine, stem cell factor (100 ng/ml), Flt-3 ligand (Flt-3L) (100 ng/ml), and thrombopoietin (10 ng/ml) (CellGenix) at a density of 2 ⁇ 10 6 cells/ml.
- Prestimulated cells may be transduced with lentiviral at a multiplicity of infection of 5 for 16 to 24 hours in 75-cm 2 tissue culture flasks coated with fibronectin (25 mg/cm 2 ) (RetroNectin, Takara Bio Inc.).
- Lentiviral vectors have been disclosed as in the treatment for Parkinson's Disease, see, e.g., US Patent Publication No. 20120295960 and U.S. Pat. Nos. 7,303,910 and 7,351,585. Lentiviral vectors have also been disclosed for the treatment of ocular diseases, see e.g., US Patent Publication Nos. 20060281180, 20090007284, US20110117189; US20090017543; US20070054961, US20100317109. Lentiviral vectors have also been disclosed for delivery to the train, see, e.g., US Patent Publication Nos. US20110293571; US20110293571, US20040013648, US20070025970, US20090111106 and U.S. Pat. No. 7,259,015.
- RNA delivery The CRISPR enzyme, for instance a Cas9, and/or any of the present RNAs, for instance a guide RNA, can also be delivered in the form of RNA.
- Cas9 mRNA can be generated using in vitro transcription.
- Cas9 mRNA can be synthesized using a PCR cassette containing the following elements: T7_promoter-kozak sequence (GCCACC)-Cas9-3′ UTR from beta globin-polyA tail (a string of 120 or more adenines).
- the cassette can be used for transcription by T7 polymerase.
- Guide RNAs can also be transcribed using in vitro transcription from a cassette containing T7_promoter-GG-guide RNA sequence.
- the CRISPR enzyme and/or guide RNA can be modified using pseudo-U or 5-Methyl-C.
- mRNA delivery methods are especially promising for liver delivery currently.
- AAV8 is particularly preferred for delivery to the liver.
- CRISPR enzyme mRNA and guide RNA may be delivered simultaneously using nanoparticles or lipid envelopes.
- nanoparticles based on self assembling bioadhesive polymers are contemplated, which may be applied to oral delivery of peptides, intravenous delivery of peptides and nasal delivery of peptides, all to the brain.
- Other embodiments, such as oral absorption and ocular deliver of hydrophobic drugs are also contemplated.
- the molecular envelope technology involves an engineered polymer envelope which is protected and delivered to the site of the disease (see, e.g., Mazza, M. et al. ACSNano, 2013. 7(2): 1016-1026; Siew, A., et al. Mol Pharm, 2012. 9(1):14-28; Lalatsa, A., et al. J Contr Rel, 2012.
- nanoparticles that can deliver RNA to a cancer cell to stop tumor growth developed by Dan Anderson's lab at MIT may be used/and or adapted to the CRISPR Cas system of the present invention.
- the Anderson lab developed fully automated, combinatorial systems for the synthesis, purification, characterization, and formulation of new biomaterials and nanoformulations. See, e.g., Alabi et al., Proc Natl Acad Sci USA. 2013 Aug. 6; 110(32):12881-6; Zhang et al., Adv Mater. 2013 Sep. 6; 25(33):4641-5; Jiang et al., Nano Lett. 2013 Mar.
- US patent application 20110293703 relates to lipidoid compounds are also particularly useful in the administration of polynucleotides, which may be applied to deliver the CRISPR Cas system of the present invention.
- the aminoalcohol lipidoid compounds are combined with an agent to be delivered to a cell or a subject to form microparticles, nanoparticles, liposomes, or micelles.
- the agent to be delivered by the particles, liposomes, or micelles may be in the form of a gas, liquid, or solid, and the agent may be a polynucleotide, protein, peptide, or small molecule.
- the minoalcohol lipidoid compounds may be combined with other aminoalcohol lipidoid compounds, polymers (synthetic or natural), surfactants, cholesterol, carbohydrates, proteins, lipids, etc. to form the particles. These particles may then optionally be combined with a pharmaceutical excipient to form a pharmaceutical composition.
- US Patent Publication No. 0110293703 also provides methods of preparing the aminoalcohol lipidoid compounds.
- One or more equivalents of an amine are allowed to react with one or more equivalents of an epoxide-terminated compound under suitable conditions to form an aminoalcohol lipidoid compound of the present invention.
- all the amino groups of the amine are fully reacted with the epoxide-terminated compound to form tertiary amines.
- all the amino groups of the amine are not fully reacted with the epoxide-terminated compound to form tertiary amines thereby resulting in primary or secondary amines in the aminoalcohol lipidoid compound.
- a diamine or polyamine may include one, two, three, or four epoxide-derived compound tails off the various amino moieties of the molecule resulting in primary, secondary, and tertiary amines. In certain embodiments, all the amino groups are not fully functionalized. In certain embodiments, two of the same types of epoxide-terminated compounds are used. In other embodiments, two or more different epoxide-terminated compounds are used.
- the synthesis of the aminoalcohol lipidoid compounds is performed with or without solvent, and the synthesis may be performed at higher temperatures ranging from 30.-100 C., preferably at approximately 50.-90 C.
- the prepared aminoalcohol lipidoid compounds may be optionally purified.
- the mixture of aminoalcohol lipidoid compounds may be purified to yield an aminoalcohol lipidoid compound with a particular number of epoxide-derived compound tails. Or the mixture may be purified to yield a particular stereo- or regioisomer.
- the aminoalcohol lipidoid compounds may also be alkylated using an alkyl halide (e.g., methyl iodide) or other alkylating agent, and/or they may be acylated.
- US Patent Publication No. 0110293703 also provides libraries of aminoalcohol lipidoid compounds prepared by the inventive methods. These aminoalcohol lipidoid compounds may be prepared and/or screened using high-throughput techniques involving liquid handlers, robots, microtiter plates, computers, etc. In certain embodiments, the aminoalcohol lipidoid compounds are screened for their ability to transfect polynucleotides or other agents (e.g., proteins, peptides, small molecules) into the cell.
- agents e.g., proteins, peptides, small molecules
- US Patent Publication No. 20130302401 relates to a class of poly(beta-amino alcohols) (PBAAs) has been prepared using combinatorial polymerization.
- PBAAs poly(beta-amino alcohols)
- the inventive PBAAs may be used in biotechnology and biomedical applications as coatings (such as coatings of films or multilayer films for medical devices or implants), additives, materials, excipients, non-biofouling agents, micropatterning agents, and cellular encapsulation agents.
- coatings such as coatings of films or multilayer films for medical devices or implants
- additives such as coatings of films or multilayer films for medical devices or implants
- materials such as coatings of films or multilayer films for medical devices or implants
- additives such as coatings of films or multilayer films for medical devices or implants
- materials such as coatings of films or multilayer films for medical devices or implants
- excipients such as coatings of films or multilayer films for medical devices or implants
- these coatings reduce the recruitment of inflammatory cells, and reduce fibrosis, following the subcutaneous implantation of carboxylated polystyrene microparticles.
- These polymers may be used to form polyelectrolyte complex capsules for cell encapsulation.
- the invention may also have many other biological applications such as antimicrobial coatings, DNA or siRNA delivery, and stem cell tissue engineering.
- US Patent Publication No. 20130302401 may be applied to the CRISPR Cas system of the present invention.
- lipid nanoparticles are contemplated.
- an antitransthyretin small interfering RNA encapsulated in lipid nanoparticles may be applied to the CRISPR Cas system of the present invention.
- Doses of about 0.01 to about 1 mg per kg of body weight administered intravenously are contemplated.
- Medications to reduce the risk of infusion-related reactions are contemplated, such as dexamethasone, acetampinophen, diphenhydramine or cetirizine, and ranitidine are contemplated.
- Multiple doses of about 0.3 mg per kilogram every 4 weeks for five doses are also contemplated.
- LNPs have been shown to be highly effective in delivering siRNAs to the liver (see, e.g., Tabemero et al., Cancer Discovery, April 2013, Vol. 3, No. 4, pages 363-470) and are therefore contemplated for delivering CRISPR Cas to the liver.
- a dosage of about four doses of 6 mg/kg of the LNP every two weeks may be contemplated.
- Tabernero et al. demonstrated that tumor regression was observed after the first 2 cycles of LNPs dosed at 0.7 mg/kg, and by the end of 6 cycles the patient had achieved a partial response with complete regression of the lymph node metastasis and substantial shrinkage of the liver tumors.
- the charge of the LNP must be taken into consideration.
- cationic lipids combined with negatively charged lipids to induce nonbilayer structures that facilitate intracellular delivery.
- ionizable cationic lipids with pKa values below 7 were developed (see, e.g., Rosin et al. Molecular Therapy, vol. 19, no. 12, pages 1286-2200, December 2011).
- Negatively charged polymers such as siRNA oligonucleotides may be loaded into LNPs at low pH values (e.g., pH 4) where the ionizable lipids display a positive charge.
- the LNPs exhibit a low surface charge compatible with longer circulation times.
- ionizable cationic lipids Four species of ionizable cationic lipids have been focused upon, namely 1,2-dilineoyl-3-dimethylammonium-propane (DLinDAP), 1,2-dilinoleyloxy-3-N,N-dimethylaminopropane (DLinDMA), 1,2-dilinoleyloxy-keto-N,N-dimethyl-3-aminopropane (DLinKDMA), and 1,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane (DLinKC2-DMA).
- DLinDAP 1,2-dilineoyl-3-dimethylammonium-propane
- DLinDMA 1,2-dilinoleyloxy-3-N,N-dimethylaminopropane
- DLinKDMA 1,2-dilinoleyloxy-keto-N,N-dimethyl-3
- LNP siRNA systems containing these lipids exhibit remarkably different gene silencing properties in hepatocytes in vivo, with potencies varying according to the series DLinKC2-DMA>DLinKDMA>DLinDMA>>DLinDAP employing a Factor VII gene silencing model (see, e.g., Rosin et al, Molecular Therapy, vol. 19, no. 12, pages 1286-2200, December 2011).
- a dosage of 1 ⁇ g/ml levels may be contemplated, especially for a formulation containing DLinKC2-DMA.
- Preparation of LNPs and CRISPR Cas encapsulation may be used/and or adapted from Rosin et al, Molecular Therapy, vol. 19, no. 12, pages 1286-2200, December 2011).
- the cationic lipids 1,2-dilincoyl-3-dimethylammonium-propane (DLinDAP), 1,2-dilinoleyloxy-3-N,N-dimethylaminopropane (DLinDMA), 1,2-dilinoleyloxyketo-N,N-dimethyl-3-aminopropane (DLinK-DMA), 1,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane (DLinKC2-DMA), (3-o-[2′′-(methoxypolyethyleneglycol 2000) succinoyl]-1,2-dimyristoyl-sn-glycol (PEG-S-DMG), and R-3-[( ⁇ -me
- Cholesterol may be purchased from Sigma (St Louis, Mo.).
- the specific CRISPR Cas RNA may be encapsulated in LNPs containing DLinDAP, DLinDMA, DLinK-DMA, and DLinKC2-DMA (cationic lipid:DSPC:CHOL: PEGS-DMG or PEG-C-DOMG at 40:10:40:10 molar ratios).
- 0.2% SP-DiOC18 Invitrogen, Burlington, Canada
- Encapsulation may be performed by dissolving lipid mixtures comprised of cationic lipid:DSPC:cholesterol:PEG-c-DOMG (40:10:40:10 molar ratio) in ethanol to a final lipid concentration of 10 mmol/l.
- This ethanol solution of lipid may be added drop-wise to 50 mmol/l citrate, pH 4.0 to form multilamellar vesicles to produce a final concentration of 30% ethanol vol/vol.
- Large unilamellar vesicles may be formed following extrusion of multilamellar vesicles through two stacked 80 nm Nuclepore polycarbonate filters using the Extruder (Northern Lipids, Vancouver, Canada).
- Encapsulation may be achieved by adding RNA dissolved at 2 mg/ml in 50 mmol/l citrate, pH 4.0 containing 30% ethanol vol/vol drop-wise to extruded preformed large unilamellar vesicles and incubation at 31° C. for 30 minutes with constant mixing to a final RNA/lipid weight ratio of 0.06/1 wt/wt. Removal of ethanol and neutralization of formulation buffer were performed by dialysis against phosphate-buffered saline (PBS), pH 7.4 for 16 hours using Spectra/Por 2 regenerated cellulose dialysis membranes.
- PBS phosphate-buffered saline
- Nanoparticle size distribution may be determined by dynamic light scattering using a NICOMP 370 particle sizer, the vesicle/intensity modes, and Gaussian fitting (Nicomp Particle Sizing. Santa Barbara, Calif.). The particle size for all three LNP systems may be ⁇ 70 nm in diameter.
- siRNA encapsulation efficiency may be determined by removal of free siRNA using VivaPureD MiniH columns (Sartorius Stedim Biotech) from samples collected before and after dialysis. The encapsulated RNA may be extracted from the eluted nanoparticles and quantified at 260 nm.
- siRNA to lipid ratio was determined by measurement of cholesterol content in vesicles using the Cholesterol E enzymatic assay from Wako Chemicals USA (Richmond, Va.).
- Preparation of large LNPs may be used/and or adapted from Rosin et al, Molecular Therapy, vol. 19, no. 12, pages 1286-2200, December 2011.
- a lipid premix solution (20.4 mg/ml total lipid concentration) may be prepared in ethanol containing DLinKC2-DMA, DSPC, and cholesterol at 50:10:38.5 molar ratios.
- Sodium acetate may be added to the lipid premix at a molar ratio of 0.75:1 (sodium acetate:DLinKC2-DMA).
- the lipids may be subsequently hydrated by combining the mixture with 1.85 volumes of citrate buffer (10 mmol/l, pH 3.0) with vigorous stirring, resulting in spontaneous liposome formation in aqueous buffer containing 35% ethanol.
- the liposome solution may be incubated at 37° C. to allow for time-dependent increase in particle size. Aliquots may be removed at various times during incubation to investigate changes in liposome size by dynamic light scattering (Zetasizer Nano ZS, Malvern Instruments, Worcestershire, UK).
- the liposomes should their size, effectively quenching further growth.
- RNA may then be added to the empty liposomes at an siRNA to total lipid ratio of approximately 1:10 (wt:wt), followed by incubation for 30 minutes at 37° C. to form loaded LNPs. The mixture may be subsequently dialyzed overnight in PBS and filtered with a 0.45- ⁇ m syringe filter.
- Spherical Nucleic Acid (SNATM) constructs and other nanoparticles (particularly gold nanoparticles) are also contemplate as a means to delivery CRISPRCas system to intended targets.
- Significant data show that AuraSense Therapeutics' Spherical Nucleic Acid (SNATM) constructs, based upon nucleic acid-functionalized gold nanoparticles, are superior to alternative platforms based on multiple key success factors, such as:
- the constructs demonstrate a transfection efficiency of 99% with no need for carriers or transfection agents.
- Therapeutic targeting The unique target binding affinity and specificity of the constructs allow extremely specificity for matched target sequences (i.e., limited off-target effects).
- the constructs can enter a variety of cultured cells, primary cells, and tissues with no apparent toxicity.
- the constructs elicit minimal changes in global gene expression as measured by whole-genome microarray studies and cytokine-specific protein assays.
- nucleic acid-based therapeutics may be applicable to numerous disease states, including inflammation and infectious disease, cancer, skin disorders and cardiovascular disease.
- Citable literature includes: Cutler et al., J. Am. Chem. Soc. 2011 133:9254-9257, Hao et al., Small. 2011 7:3158-3162, Zhang et al., ACS Nano. 2011 5:6962-6970, Cutler et al., J. Am. Chem. Soc. 2012 134:1376-1391, Young et al., Nano Lett. 2012 12:3867-71, Zheng et al., Proc. Natl. Acad. Sci. USA. 2012 109:11975-80, Mirkin, Nanomedicine 2012 7:635-638 Zhang et al., J. Am. Chem. Soc.
- Self-assembling nanoparticles with siRNA may be constructed with polyethyleneimine (PEI) that is PEGylated with an Arg-Gly-Asp (RGD) peptide ligand attached at the distal end of the polyethylene glycol (PEG), for example, as a means to target tumor neovasculature expressing integrins and used to deliver siRNA inhibiting vascular endothelial growth factor receptor-2 (VEGF R2) expression and thereby tumor angiogenesis (see, e.g., Schiffelers et al., Nucleic Acids Research, 2004, Vol. 32, No. 19).
- PEI polyethyleneimine
- RGD Arg-Gly-Asp
- VEGF R2 vascular endothelial growth factor receptor-2
- Nanoplexes may be prepared by mixing equal volumes of aqueous solutions of cationic polymer and nucleic acid to give a net molar excess of ionizable nitrogen (polymer) to phosphate (nucleic acid) over the range of 2 to 6.
- the electrostatic interactions between cationic polymers and nucleic acid resulted in the formation of polyplexes with average particle size distribution of about 100 nm, hence referred to here as nanoplexes.
- a dosage of about 100 to 200 mg of CRISPR Cas is envisioned for delivery in the self-assembling nanoparticles of Schiffelers et al.
- the nanoplexes of Bartlett et al. may also be applied to the present invention.
- the nanoplexes of Bartlett et al. are prepared by mixing equal volumes of aqueous solutions of cationic polymer and nucleic acid to give a net molar excess of ionizable nitrogen (polymer) to phosphate (nucleic acid) over the range of 2 to 6.
- the electrostatic interactions between cationic polymers and nucleic acid resulted in the formation of polyplexes with average particle size distribution of about 100 nm, hence referred to here as nanoplexes.
- DOTA-NHSester 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid mono(N-hydroxysuccinimide ester)
- DOTA-NHSester 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid mono(N-hydroxysuccinimide ester)
- the DOTA-RNAsense conjugate was ethanol-precipitated, resuspended in water, and annealed to the unmodified antisense strand to yield DOTA-siRNA. All liquids were pretreated with Chelex-100 (Bio-Rad, Hercules, Calif.) to remove trace metal contaminants. Tf-targeted and nontargeted siRNA nanoparticles may be formed by using cyclodextrin-containing polycations. Typically, nanoparticles were formed in water at a charge ratio of 3 (+/ ⁇ ) and an siRNA concentration of 0.5 g/liter.
- adamantane-PEG molecules on the surface of the targeted nanoparticles were modified with Tf (adamantane-PEG-Tf).
- the nanoparticles were suspended in a 5% (wt/vol) glucose carrier solution for injection.
- the nanoparticles consist of a synthetic delivery system containing: (1) a linear, cyclodextrin-based polymer (CDP), (2) a human transferrin protein (TF) targeting ligand displayed on the exterior of the nanoparticle to engage TF receptors (TFR) on the surface of the cancer cells, (3) a hydrophilic polymer (polyethylene glycol (PEG) used to promote nanoparticle stability in biological fluids), and (4) siRNA designed to reduce the expression of the RRM2 (sequence used in the clinic was previously denoted siR2B+5).
- CDP linear, cyclodextrin-based polymer
- TF human transferrin protein
- TFR TF receptors
- siRNA designed to reduce the expression of the RRM2 (sequence used in the clinic was previously denoted siR2B+5).
- the TFR has long been known to be upregulated in malignant cells, and RRM2 is an established anti-cancer target.
- CRISPR Cas system of the present invention Similar doses may also be contemplated for the CRISPR Cas system of the present invention.
- the delivery of the invention may be achieved with nanoparticles containing a linear, cyclodextrin-based polymer (CDP), a human transferrin protein (TF) targeting ligand displayed on the exterior of the nanoparticle to engage TF receptors (TFR) on the surface of the cancer cells and/or a hydrophilic polymer (for example, polyethylene glycol (PEG) used to promote nanoparticle stability in biological fluids).
- CDP linear, cyclodextrin-based polymer
- TF human transferrin protein
- TFR TF receptors
- hydrophilic polymer for example, polyethylene glycol (PEG) used to promote nanoparticle stability in biological fluids
- Exosomes are endogenous nano-vesicles that transport RNAs and proteins which can deliver short interfering (si)RNA to the brain in mice.
- siRNAs and proteins which can deliver short interfering (si)RNA to the brain in mice.
- Alvarez-Erviti et al. 2011, Nat Biotechnol 29: 341
- Lamp2b an exosomal membrane protein, fused to the neuron-specific RVG peptide3.
- Purified exosomes were loaded with exogenous siRNA by electroporation.
- RVG-targeted exosomes delivered GAPDH siRNA specifically to neurons, microglia, oligodendrocytes in the brain, resulting in a specific gene knockdown. Pre-exposure to RVG exosomes did not attenuate knockdown, and non-specific uptake in other tissues was not observed. The therapeutic potential of exosome-mediated siRNA delivery was demonstrated by the strong mRNA (60%) and protein (62%) knockdown of BACE1, a therapeutic target in Alzheimer's disease.
- Alvarez-Erviti et al. harvested bone marrow from inbred C57BL/6 mice with a homogenous major histocompatibility complex (MHC) haplotype.
- MHC major histocompatibility complex
- GM-CSF granulocyte/macrophage-colony stimulating factor
- exosomes produced were physically homogenous, with a size distribution peaking at 80 nm in diameter as determined by nanoparticle tracking analysis (NTA) and electron microscopy.
- NTA nanoparticle tracking analysis
- Alvarez-Erviti et al. obtained 6-12 ⁇ g of exosomes (measured based on protein concentration) per 10 6 cells.
- siRNA-RVG exosomes induced immune responses in vivo by assessing IL-6, IP-10, TNF ⁇ and IFN- ⁇ serum concentrations.
- siRNA-RVG exosome treatment nonsignificant changes in all cytokines were registered similar to siRNA-transfection reagent treatment in contrast to siRNA-RVG-9R, which potently stimulated IL-6 secretion, confirming the immunologically inert profile of the exosome treatment.
- exosomes encapsulate only 20% of siRNA
- delivery with RVG-exosome appears to be more efficient than RVG-9R delivery as comparable mRNA knockdown and greater protein knockdown was achieved with fivefold less siRNA without the corresponding level of immune stimulation.
- This experiment demonstrated the therapeutic potential of RVG-exosome technology, which is potentially suited for long-term silencing of genes related to neurodegenerative diseases.
- the exosome delivery system of Alvarez-Erviti et al. may be applied to deliver the CRISPR-Cas system of the present invention to therapeutic targets, especially neurodegenerative diseases.
- a dosage of about 100 to 1000 mg of CRISPR Cas encapsulated in about 100 to 1000 mg of RVG exosomes may be contemplated for the present invention.
- El-Andaloussi et al. discloses how exosomes derived from cultured cells can be harnessed for delivery of siRNA in vitro and in vivo. This protocol first describes the generation of targeted exosomes through transfection of an expression vector, comprising an exosomal protein fused with a peptide ligand. Next, El-Andaloussi et al. explain how to purify and characterize exosomes from transfected cell supernatant. Next, El-Andaloussi et al. detail crucial steps for loading siRNA into exosomes. Finally, El-Andaloussi et al.
- exosome-mediated siRNA delivery is evaluated by functional assays and imaging.
- the entire protocol takes ⁇ 3 weeks. Delivery or administration according to the invention may be performed using exosomes produced from self-derived dendritic cells.
- Exosomes are nano-sized vesicles (30-90 nm in size) produced by many cell types, including dendritic cells (DC), B cells, T cells, mast cells, epithelial cells and tumor cells. These vesicles are formed by inward budding of late endosomes and are then released to the extracellular environment upon fusion with the plasma membrane. Because exosomes naturally carry RNA between cells, this property might be useful in gene therapy.
- DC dendritic cells
- B cells B cells
- T cells T cells
- mast cells epithelial cells
- tumor cells tumor cells.
- Exosomes from plasma are prepared by centrifugation of buffy coat at 900 g for 20 min to isolate the plasma followed by harvesting cell supernatants, centrifuging at 300 g for 10 min to eliminate cells and at 16 500 g for 30 min followed by filtration through a 0.22 mm filter. Exosomes are pelleted by ultracentrifugation at 120 000 g for 70 min. Chemical transfection of siRNA into exosomes is carried out according to the manufacturer's instructions in RNAi Human/Mouse Starter Kit (Quiagen, Hilden, Germany). siRNA is added to 100 ml PBS at a final concentration of 2 mmol/ml.
- exosomes are re-isolated using aldehyde/sulfate latex beads.
- the chemical transfection of CRISPR Cas into exosomes may be conducted similarly to siRNA.
- the exosomes may be co-cultured with monocytes and lymphocytes isolated from the peripheral blood of healthy donors. Therefore, it may be contemplated that exosomes containing CRISPR Cas may be introduced to monocytes and lymphocytes of and autologously reintroduced into a human. Accordingly, delivery or administration according to the invention may be performed using plasma exosomes.
- Liposomes are spherical vesicle structures composed of a uni- or multilamellar lipid bilayer surrounding internal aqueous compartments and a relatively impermeable outer lipophilic phospholipid bilayer. Liposomes have gained considerable attention as drug delivery carriers because they are biocompatible, nontoxic, can deliver both hydrophilic and lipophilic drug molecules, protect their cargo from degradation by plasma enzymes, and transport their load across biological membranes and the blood brain barrier (BBB) (see, e.g., Spuch and Navarro, Journal of Drug Delivery, vol. 2011, Article ID 469679, 12 pages, 2011. doi:10.1155/2011/469679 for review).
- BBB blood brain barrier
- Liposomes can be made from several different types of lipids; however, phospholipids are most commonly used to generate liposomes as drug carriers. Although liposome formation is spontaneous when a lipid film is mixed with an aqueous solution, it can also be expedited by applying force in the form of shaking by using a homogenizer, sonicator, or an extrusion apparatus (see, e.g., Spuch and Navarro, Journal of Drug Delivery, vol. 2011, Article ID 469679. 12 pages, 2011. doi:10. 1155/2011/469679 for review).
- liposomes may be added to the liposomal mixture in order to help stabilize the liposomal structure and to prevent the leakage of the liposomal inner cargo.
- liposomes are prepared from hydrogenated egg phosphatidylcholine or egg phosphatidylcholine, cholesterol, and dicetyl phosphate, and their mean vesicle sizes were adjusted to about 50 and 100 nm, (see, e.g., Spuch and Navarro, Journal of Drug Delivery, vol. 2011. Article ID 469679, 12 pages, 2011. doi:10.1155/2011/469679 for review).
- Conventional liposome formulation is mainly comprised of natural phospholipids and lipids such as 1,2-distearoryl-sn-glycero-3-phosphatidyl choline (DSPC), sphingomyelin, egg phosphatidylcholines and monosialoganglioside. Since this formulation is made up of phospholipids only, liposomal formulations have encountered many challenges, one of the ones being the instability in plasma. Several attempts to overcome these challenges have been made, specifically in the manipulation of the lipid membrane. One of these attempts focused on the manipulation of cholesterol.
- DSPC 1,2-distearoryl-sn-glycero-3-phosphatidyl choline
- DOPE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine
- Trojan Horse liposomes are desirable and protocols may be found at http://cthprotocols.cshlp.org/content/2010/4/pdb.pmt5407.long. These particles allow delivery of a transgene to the entire brain after an intravascular injection. Without being bound by limitation, it is believed that neutral lipid particles with specific antibodies conjugated to surface allow crossing of the blood brain barrier via endocytosis. Applicant postulates utilizing Trojan Horse Liposomes to deliver the CRISPR family of nucleases to the brain via an intravascular injection, which would allow whole brain transgenic animals without the need for embryonic manipulation. About 1-5 g of DNA may be contemplated for in vivo administration in liposomes.
- the CRISPR Cas system may be administered in liposomes, such as a stable nucleic-acid-lipid particle (SNALP) (see, e.g., Morrissey et al., Nature Biotechnology, Vol. 23, No. 8, August 2005).
- SNALP stable nucleic-acid-lipid particle
- Daily intravenous injections of about 1, 3 or 5 mg/kg/day of a specific CRISPR Cas targeted in a SNALP are contemplated.
- the daily treatment may be over about three days and then weekly for about five weeks.
- a specific CRISPR Cas encapsulated SNALP) administered by intravenous injection to at doses of abpit 1 or 2.5 mg/kg are also contemplated (see, e.g., Zimmerman et at., Nature Letters.
- the SNALP formulation may contain the lipids 3-N-[(wmethoxypoly(ethylene glycol) 2000) carbamoyl]-1,2-dimyristyloxy-propylamine (PEG-C-DMA), 1,2-dilinoleyloxy-N,N-dimethyl-3-aminopropane (DLinDMA), 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC) and cholesterol, in a 2:40:10:48 molar percent ratio (see, e.g., Zimmerman et al., Nature Letters, Vol. 441, 4 May 2006).
- PEG-C-DMA 1,2-dilinoleyloxy-N,N-dimethyl-3-aminopropane
- DSPC 1,2-distearoyl-sn-glycero-3-phosphocholine
- cholesterol in a 2:40:10:48 molar percent ratio (see, e.g., Zimmerman e
- SNALPs stable nucleic-acid-lipid particles
- the SNALP liposomes may be prepared by formulating D-Lin-DMA and PEG-C-DMA with distearoylphosphatidylcholine (DSPC), Cholesterol and siRNA using a 25:1 lipid/siRNA ratio and a 48/40/10/2 molar ratio of Cholesterol/D-Lin-DMA/DSPC/PEG-C-DMA.
- DSPC distearoylphosphatidylcholine
- Cholesterol and siRNA using a 25:1 lipid/siRNA ratio and a 48/40/10/2 molar ratio of Cholesterol/D-Lin-DMA/DSPC/PEG-C-DMA.
- the resulted SNALP liposomes are about 80-100 nm in size.
- a SNALP may comprise synthetic cholesterol (Sigma-Aldrich, St Louis, Mo., USA), dipalmitoylphosphatidylcholine (Avanti Polar Lipids, Alabaster, Ala., USA), 3-N-[(w-methoxy poly(ethylene glycol)2000)carbamoyl]-1,2-dimyrestyloxypropylamine, and cationic 1,2-dilinoleyloxy-3-N,Ndimethylaminopropane (see, e.g., Geisbert et al., Lancet 2010; 375: 1896-905).
- a dosage of about 2 mg/kg total CRISPR Cas per dose administered as, for example, a bolus intravenous infusion may be contemplated.
- a SNALP may comprise synthetic cholesterol (Sigma-Aldrich), 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC; Avanti Polar Lipids Inc.), PEG-cDMA, and 1,2-dilinoleyloxy-3-(N;N-dimethyl)aminopropane (DLinDMA) (see, e.g., Judge, J. Clin. Invest. 119:661-673 (2009)).
- Formulations used for in vivo studies may comprise a final lipid/RNA mass ratio of about 9:1.
- the stability profile of RNAi nanomedicines has been reviewed by Barros and Gollob of Alnylam Pharmaceuticals (see, e.g., Advanced Drug Delivery Reviews 64 (2012) 1730-1737).
- the stable nucleic acid lipid particle is comprised of four different lipids—an ionizable lipid (DLinDMA) that is cationic at low pH, a neutral helper lipid, cholesterol, and a diffusible polyethylene glycol (PEG)-lipid.
- the particle is approximately 80 nm in diameter and is charge-neutral at physiologic pH.
- the ionizable lipid serves to condense lipid with the anionic siRNA during particle formation.
- the ionizable lipid When positively charged under increasingly acidic endosomal conditions, the ionizable lipid also mediates the fusion of SNALP with the endosomal membrane enabling release of siRNA into the cytoplasm.
- the PEG-lipid stabilizes the particle and reduces aggregation during formulation, and subsequently provides a neutral hydrophilic exterior that improves pharmacokinetic properties.
- Tekmira Pharmaceuticals recently completed a phase I single-dose study of SNALP-ApoB in adult volunteers with elevated LDL cholesterol. ApoB is predominantly expressed in the liver and jejunum and is essential for the assembly and secretion of VLDL and LDL. Seventeen subjects received a single dose of SNALP-ApoB (dose escalation across 7 dose levels). There was no evidence of liver toxicity (anticipated as the potential dose-limiting toxicity based on preclinical studies). One (of two) subjects at the highest dose experienced flu-like symptoms consistent with immune system stimulation, and the decision was made to conclude the trial.
- ALN-TTR01 which employs the SNALP technology described above and targets hepatocyte production of both mutant and wild-type TTR to treat TTR amyloidosis (ATTR).
- TTR amyloidosis TTR amyloidosis
- FAP familial amyloidotic polyneuropathy
- FAC familial amyloidotic cardiomyopathy
- SSA senile systemic amyloidosis
- ALN-TTR01 was administered as a 15-minute IV infusion to 31 patients (23 with study drug and 8 with placebo) within a dose range of 0.01 to 1.0 mg/kg (based on siRNA). Treatment was well tolerated with no significant increases in liver function tests. Infusion-related reactions were noted in 3 of 23 patients at >0.4 mg/kg; all responded to slowing of the infusion rate and all continued on study. Minimal and transient elevations of serum cytokines IL-6, IP-10 and IL-Ira were noted in two patients at the highest dose of 1 mg/kg (as anticipated from preclinical and NHP studies). Lowering of serum TTR, the expected pharmacodynamics effect of ALN-TTR01, was observed at 1 mg/kg.
- a SNALP may be made by solubilizing a cationic lipid, DSPC, cholesterol and PEG-lipid were solubilized in ethanol at a molar ratio of 40:10:40:10, respectively (see, Semple et al., Nature Niotechnology, Volume 28 Number 2 Feb. 2010, pp. 172-177).
- the lipid mixture was added to an aqueous buffer (50 mM citrate, pH 4) with mixing to a final ethanol and lipid concentration of 30% (vol/vol) and 6.1 mg/ml, respectively, and allowed to equilibrate at 22° C. for 2 min before extrusion.
- the hydrated lipids were extruded through two stacked 80 nm pore-sized filters (Nuclepore) at 22° C. using a Lipex Extruder (Northern Lipids) until a vesicle diameter of 70-90 nm, as determined by dynamic light scattering analysis, was obtained. This generally required 1-3 passes.
- the siRNA (solubilized in a 50 mM citrate, pH 4 aqueous solution containing 30% ethanol) was added to the pre-equilibrated (35° C.) vesicles at a rate of ⁇ 5 ml/min with mixing.
- siRNA/lipid ratio 0.06 (wt/wt) was reached, the mixture was incubated for a further 30 min at 35° C. to allow vesicle reorganization and encapsulation of the siRNA.
- the ethanol was then removed and the external buffer replaced with PBS (155 mM NaCl, 3 mM Na2HPO4, 1 mM KH2PO4, pH 7.5) by either dialysis or tangential flow diafiltration.
- siRNA were encapsulated in SNALP using a controlled step-wise dilution method process.
- the lipid constituents of KC2-SNALP were DLin-KC2-DMA (cationic lipid), dipalmitoylphosphatidylcholine (DPPC; Avanti Polar Lipids), synthetic cholesterol (Sigma) and PEG-C-DMA used at a molar ratio of 57.1:7.1:34.3:1.4.
- SNALP were dialyzed against PBS and filter sterilized through a 0.2 ⁇ m filter before use.
- Mean particle sizes were 75-85 nm and 90-95% of the siRNA was encapsulated within the lipid particles.
- the final siRNA/lipid ratio in formulations used for in vivo testing was ⁇ 0.15 (wt/wt).
- LNP-siRNA systems containing Factor VII siRNA were diluted to the appropriate concentrations in sterile PBS immediately before use and the formulations were administered intravenously through the lateral tail vein in a total volume of 10 ml/kg. This method may be extrapolated to the CRISPR Cas system of the present invention.
- cationic lipids such as amino lipid 2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA) may be utilized to encapsulate CRISPR Cas similar to SiRNA (see, e.g., Jayaraman, Angew. Chem. Int. Ed. 2012, 51, 8529-8533).
- a preformed vesicle with the following lipid composition may be contemplated: amino lipid, distearoylphosphatidylcholine (DSPC), cholesterol and (R)-2,3-bis(octadecyloxy) propyl-1-(methoxy poly(ethylene glycol)2000)propylcarbamate (PEG-lipid) in the molar ratio 40/10/40/10, respectively, and a FVII siRNA/total lipid ratio of approximately 0.05 (w/w).
- the particles may be extruded up to three times through 80 nm membranes prior to adding the CRISPR Cas RNA.
- Particles containing the highly potent amino lipid 16 may be used, in which the molar ratio of the four lipid components 16, DSPC, cholesterol and PEG-lipid (50/10/38.5/1.5) which may be further optimized to enhance in vivo activity.
- lipids may be formulated with the CRISPR Cas system of the present invention to form lipid nanoparticles (LNPs).
- Lipids include, but are not limited to, DLin-KC2-DMA4, C12-200 and colipids disteroylphosphatidyl choline, cholesterol, and PEG-DMG may be formulated with CRISPR Cas instead of siRNA (see, e.g., Novobrantseva, Molecular Therapy-Nucleic Acids (2012)1, e4; doi:10.1038/mtna.2011.3) using a spontaneous vesicle formation procedure.
- the component molar ratio may be about 50/10/38.5/1.5 (DLin-KC2-DMA or C12-200/disteroylphosphatidyl choline/cholesterol/PEG-DMG).
- the final lipid:siRNA weight ratio may be ⁇ 12:1 and 9:1 in the case of DLin-KC2-DMA and C12-200 lipid nanoparticles (LNPs), respectively.
- the formulations may have mean particle diameters of ⁇ 80 nm with >90% entrapment efficiency. A 3 mg/kg dose may be contemplated.
- Tekmira has a portfolio of approximately 95 patent families, in the U.S. and abroad, that are directed to various aspects of LNPs and LNP formulations (see, e.g., U.S. Pat. Nos. 7,982,027; 7,799,565; 8,058,069; 8,283,333; 7,901,708; 7,745,651; 7,803,397; 8,101,741; 8,188,263; 7,915,399; 8,236,943 and 7,838,658 and European Pat. Nos. 1766035; 1519714; 1781593 and 1664316), all of which may be used/and or adapted to the present invention.
- the CRISPR Cas system may be delivered encapsulated in PLGA Microspheres such as that further described in US published applications 20130252281 and 20130245107 and 20130244279 (assigned to Modema Therapeutics) which relate to aspects of formulation of compositions comprising modified nucleic acid molecules which may encode a protein, a protein precursor, or a partially or fully processed form of the protein or a protein precursor.
- the formulation may have a molar ratio 50:10:38.5:1.5-3.0 (cationic lipid:fusogenic lipid:cholesterol:PEG lipid).
- the PEG lipid may be selected from, but is not limited to PEG-c-DOMG, PEG-DMG.
- the fusogenic lipid may be DSPC. See also, Schrum et al., Delivery and Formulation of Engineered Nucleic Acids, US published application 20120251618.
- Nanomerics' technology addresses bioavailability challenges for a broad range of therapeutics, including low molecular weight hydrophobic drugs, peptides, and nucleic acid based therapeutics (plasmid, siRNA, miRNA).
- Specific administration routes for which the technology has demonstrated clear advantages include the oral route, transport across the blood-brain-barrier, delivery to solid tumours, as well as to the eye. See, e.g., Mazza et al., 2013, ACS Nano. 2013 Feb. 26; 7(2):1016-26; Uchegbu and Siew, 2013, J Pharm Sci. 102(2):305-10 and Lalatsa et al., 2012, J Control Release. 2012 Jul. 20; 161(2):523-36.
- US Patent Publication No. 20050019923 describes cationic dendrimers for delivering bioactive molecules, such as polynucleotide molecules, peptides and polypeptides and/or pharmaceutical agents, to a mammalian body.
- the dendrimers are suitable for targeting the delivery of the bioactive molecules to, for example, the liver, spleen, lung, kidney or heart.
- Dendrimers are synthetic 3-dimensional macromolecules that are prepared in a step-wise fashion from simple branched monomer units, the nature and functionality of which can be easily controlled and varied.
- Dendrimers are synthesised from the repeated addition of building blocks to a multifunctional core (divergent approach to synthesis), or towards a multifunctional core (convergent approach to synthesis) and each addition of a 3-dimensional shell of building blocks leads to the formation of a higher generation of the dendrimers.
- Polypropylenimine dendrimers start from a diaminobutane core to which is added twice the number of amino groups by a double Michael addition of acrylonitrile to the primary amines followed by the hydrogenation of the nitriles. This results in a doubling of the amino groups.
- Polypropylenimine dendrimers contain 100% protonable nitrogens and up to 64 terminal amino groups (generation 5, DAB 64).
- Protonable groups are usually amine groups which are able to accept protons at neutral pH.
- the use of dendrimers as gene delivery agents has largely focused on the use of the polyamidoamine, and phosphorous containing compounds with a mixture of amine/amide or N—P(O 2 )S as the conjugating units respectively with no work being reported on the use of the lower generation polypropylenimine dendrimers for gene delivery.
- Polypropylenimine dendrimers have also been studied as pH sensitive controlled release systems for drug delivery and for their encapsulation of guest molecules when chemically modified by peripheral amino acid groups. The cytotoxicity and interaction of polypropylenimine dendrimers with DNA as well as the transfection efficacy of DAB 64 has also been studied.
- cationic dendrimers such as polypropylenimine dendrimers
- display suitable properties such as specific targeting and low toxicity, for use in the targeted delivery of bioactive molecules, such as genetic material.
- derivatives of the cationic dendrimer also display suitable properties for the targeted delivery of bioactive molecules.
- Bioactive Polymers US published application 20080267903, which discloses “Various polymers, including cationic polyamine polymers and dendrimeric polymers, are shown to possess anti-proliferative activity, and may therefore be useful for treatment of disorders characterised by undesirable cellular proliferation such as neoplasms and tumours, inflammatory disorders (including autoimmune disorders), psoriasis and atherosclerosis.
- the polymers may be used alone as active agents, or as delivery vehicles for other therapeutic agents, such as drug molecules or nucleic acids for gene therapy. In such cases, the polymers' own intrinsic anti-tumour activity may complement the activity of the agent to be delivered.”
- Supercharged proteins are a class of engineered or naturally occurring proteins with unusually high positive or negative net theoretical charge. Both supernegatively and superpositively charged proteins exhibit a remarkable ability to withstand thermally or chemically induced aggregation. Superpositively charged proteins are also able to penetrate mammalian cells. Associating cargo with these proteins, such as plasmid DNA, siRNA, or other proteins, can enable the functional delivery of these macromolecules into mammalian cells both in vitro and in vivo. David Liu's lab reported the creation and characterization of supercharged proteins in 2007 (Lawrence et al., 2007, Journal of the American Chemical Society 129, 10110-10112).
- +36 GFP is an effective plasmid delivery reagent in a range of cells.
- plasmid DNA is a larger cargo than siRNA, proportionately more +36 GFP protein is required to effectively complex plasmids.
- Applicants have developed a variant of +36 GFP bearing a C-terminal HA2 peptide tag, a known endosome-disrupting peptide derived from the influenza virus hemagglutinin protein. The following protocol has been effective in a variety of cells, but as above it is advised that plasmid DNA and supercharged protein doses be optimized for specific cell lines and delivery applications.
- implantable devices are also contemplated for delivery of the CRISPR Cas system.
- US Patent Publication 20110195123 discloses an implantable medical device which elutes a drug locally and in prolonged period is provided, including several types of such a device, the treatment modes of implementation and methods of implantation.
- the device comprising of polymeric substrate, such as a matrix for example, that is used as the device body, and drugs, and in some cases additional scaffolding materials, such as metals or additional polymers, and materials to enhance visibility and imaging.
- RNA interference RNA interference
- si RNA si RNA
- sh RNA sh RNA
- antisense RNA/DNA ribozyme and nucleoside analogs. Therefore, this system may be used/and or adapted to the CRISPR Cas system of the present invention.
- the modes of implantation in some embodiments are existing implantation procedures that are developed and used today for other treatments, including brachytherapy and needle biopsy. In such cases the dimensions of the new implant described in this invention are similar to the original implant. Typically a few devices are implanted during the same treatment procedure.
- a drug delivery implantable or insertable system including systems applicable to a cavity such as the abdominal cavity and/or any other type of administration in which the drug delivery system is not anchored or attached, comprising a biostable and/or degradable and/or bioabsorbable polymeric substrate, which may for example optionally be a matrix.
- insertion also includes implantation.
- the drug delivery system is preferably implemented as a “Loder” as described in US Patent Publication 20110195123.
- the polymer or plurality of polymers are biocompatible, incorporating an agent and/or plurality of agents, enabling the release of agent at a controlled rate, wherein the total volume of the polymeric substrate, such as a matrix for example, in some embodiments is optionally and preferably no greater than a maximum volume that permits a therapeutic level of the agent to be reached. As a non-limiting example, such a volume is preferably within the range of 0.1 m 3 to 1000 mm 3 , as required by the volume for the agent load.
- the Loder may optionally be larger, for example when incorporated with a device whose size is determined by functionality, for example and without limitation, a knee joint, an intra-uterine or cervical ring and the like.
- the drug delivery system (for delivering the composition) is designed in some embodiments to preferably employ degradable polymers, wherein the main release mechanism is bulk erosion; or in some embodiments, non degradable, or slowly degraded polymers are used, wherein the main release mechanism is diffusion rather than bulk erosion, so that the outer part functions as membrane, and its internal part functions as a drug reservoir, which practically is not affected by the surroundings for an extended period (for example from about a week to about a few months). Combinations of different polymers with different release mechanisms may also optionally be used.
- the concentration gradient at the surface is preferably maintained effectively constant during a significant period of the total drug releasing period, and therefore the diffusion rate is effectively constant (termed “zero mode” diffusion).
- constant it is meant a diffusion rate that is preferably maintained above the lower threshold of therapeutic effectiveness, but which may still optionally feature an initial burst and/or fluctuate, for example increasing and decreasing to a certain degree.
- the diffusion rate is preferably so maintained for a prolonged period, and it can be considered constant to a certain level to optimize the therapeutically effective period, for example the effective silencing period.
- the drug delivery system optionally and preferably is designed to shield the nucleotide based therapeutic agent from degradation, whether chemical in nature or due to attack from enzymes and other factors in the body of the subject.
- the drug delivery system as described in US Patent Publication 20110195123 is optionally associated with sensing and/or activation appliances that are operated at and/or after implantation of the device, by non and/or minimally invasive methods of activation and/or acceleration/deceleration, for example optionally including but not limited to thermal heating and cooling, laser beams, and ultrasonic, including focused ultrasound and/or RF (radiofrequency) methods or devices.
- sensing and/or activation appliances that are operated at and/or after implantation of the device, by non and/or minimally invasive methods of activation and/or acceleration/deceleration, for example optionally including but not limited to thermal heating and cooling, laser beams, and ultrasonic, including focused ultrasound and/or RF (radiofrequency) methods or devices.
- RF radiofrequency
- the site for local delivery may optionally include target sites characterized by high abnormal proliferation of cells, and suppressed apoptosis, including tumors, active and or chronic inflammation and infection including autoimmune diseases states, degenerating tissue including muscle and nervous tissue, chronic pain, degenerative sites, and location of bone fractures and other wound locations for enhancement of regeneration of tissue, and injured cardiac, smooth and striated muscle.
- the site for local delivery also may optionally include sites enabling performing preventive activities including pregnancy, prevention of infection and aging.
- the site for implantation of the composition, or target site preferably features a radius, area and/or volume that is sufficiently small for targeted local delivery.
- the target site optionally has a diameter in a range of from about 0.1 mm to about 5 cm.
- the location of the target site is preferably selected for maximum therapeutic efficacy.
- the composition of the drug delivery system (optionally with a device for implantation as described above) is optionally and preferably implanted within or in the proximity of a tumor environment, or the blood supply associated thereof.
- composition (optionally with the device) is optionally implanted within or in the proximity to pancreas, prostate, breast, liver, via the nipple, within the vascular system and so forth.
- the target location is optionally selected from the group consisting of (as non-limiting examples only, as optionally any site within the body may be suitable for implanting a Loder): 1. brain at degenerative sites like in Parkinson or Alzheimer disease at the basal ganglia, white and gray matter; 2. spine as in the case of amyotrophic lateral sclerosis (ALS); 3. uterine cervix to prevent HPV infection; 4. active and chronic inflammatory joints; 5. dermis as in the case of psoriasis; 6. sympathetic and sensoric nervous sites for analgesic effect; 7. Intra osseous implantation; 8. acute and chronic infection sites; 9. Intra vaginal; 10. Inner ear—auditory system, labyrinth of the inner ear, vestibular system; 11.
- insertion of the system is associated with injection of material to the ECM at the target site and the vicinity of that site to affect local pH and/or temperature and/or other biological factors affecting the diffusion of the drug and/or drug kinetics in the ECM, of the target site and the vicinity of such a site.
- the release of said agent could be associated with sensing and/or activation appliances that are operated prior and/or at and/or after insertion, by non and/or minimally invasive and/or else methods of activation and/or acceleration/deceleration, including laser beam, radiation, thermal heating and cooling, and ultrasonic, including focused ultrasound and/or RF (radiofrequency) methods or devices, and chemical activators.
- sensing and/or activation appliances that are operated prior and/or at and/or after insertion, by non and/or minimally invasive and/or else methods of activation and/or acceleration/deceleration, including laser beam, radiation, thermal heating and cooling, and ultrasonic, including focused ultrasound and/or RF (radiofrequency) methods or devices, and chemical activators.
- the drug preferably comprises a gene silencing biological RNAi drug, for example for localized cancer cases in breast, pancreas, brain, kidney, bladder, lung, and prostate as described below.
- RNAi drug for example for localized cancer cases in breast, pancreas, brain, kidney, bladder, lung, and prostate as described below.
- many drugs other than siRNA are applicable to be encapsulated in Loder, and can be used in association with this invention, as long as such drugs can be encapsulated with the Loder substrate, such as a matrix for example.
- Such drugs include approved drugs that are delivered today by methods other than of this invention, including Amphotericin B for fungal infection; antibiotics such as in osteomyelitis; pain killers such as narcotics; anti degenerative such as in Alzheimer or Parkinson diseases in a Loder implanted in the vicinity of the spine in the case of back pain.
- Such a system may be used and/or adapted to deliver the CRISPR Cas system of the present invention.
- the drug may optionally be siRNA that silence smooth muscle cells, including H19 silencing, or a drug selected from the group consisting of taxol, rapamycin and rapamycin-analogs.
- the Loder is preferably either a Drug Eluting Stent (DES), with prolonged release at constant rate, or a dedicated device that is implanted separately, in association to the stent. All of this may be used/and or adapted to the CRISPR Cas system of the present invention.
- DES Drug Eluting Stent
- RNAs may have therapeutic properties for interfering with such abnormal gene expression.
- Local delivery of anti apoptotic, anti inflammatory and anti degenerative drugs including small drugs and macromolecules may also optionally be therapeutic.
- the Loder is applied for prolonged release at constant rate and/or through a dedicated device that is implanted separately. All of this may be used and/or adapted to the CRISPR Cas system of the present invention.
- psychiatric and cognitive disorders are treated with gene modifiers.
- Gene knockdown with silencing RNA is a treatment option.
- Loders locally delivering nucleotide based agents to central nervous system sites are therapeutic options for psychiatric and cognitive disorders including but not limited to psychosis, bi-polar diseases, neurotic disorders and behavioral maladies.
- the Loders could also deliver locally drugs including small drugs and macromolecules upon implantation at specific brain sites. All of this may be used and/or adapted to the CRISPR Cas system of the present invention.
- silencing of innate and/or adaptive immune mediators at local sites enables the prevention of organ transplant rejection.
- Local delivery of silencing RNAs and immunomodulating reagents with the Loder implanted into the transplanted organ and/or the implanted site renders local immune suppression by repelling immune cells such as CD8 activated against the transplanted organ. All of this may be used/and or adapted to the CRISPR Cas system of the present invention.
- vascular growth factors including VEGFs and angiogenin and others are essential for neovascularization.
- Local delivery of the factors, peptides, peptidomimetics, or suppressing their repressors is an important therapeutic modality; silencing the repressors and local delivery of the factors, peptides, macromolecules and small drugs stimulating angiogenesis with the Loder is therapeutic for peripheral, systemic and cardiac vascular disease.
- the method of insertion may optionally already be used for other types of tissue implantation and/or for insertions and/or for sampling tissues, optionally without modifications, or alternatively optionally only with non-major modifications in such methods.
- Such methods optionally include but are not limited to brachytherapy methods, biopsy, endoscopy with and/or without ultrasound, such as ERCP, stereotactic methods into the brain tissue, Laparoscopy, including implantation with a laparoscope into joints, abdominal organs, the bladder wall and body cavities.
- CRISPR enzyme mRNA and guide RNA might also be delivered separately.
- CRISPR enzyme mRNA can be delivered prior to the guide RNA to give time for CRISPR enzyme to be expressed.
- CRISPR enzyme mRNA might be administered 1-12 hours (preferably around 2-6 hours) prior to the administration of guide RNA.
- CRISPR enzyme mRNA and guide RNA can be administered together.
- a second booster dose of guide RNA can be administered 1-12 hours (preferably around 2-6 hours) after the initial administration of CRISPR enzyme mRNA+ guide RNA.
- CRISPR enzyme mRNA and/or guide RNA might be useful to achieve the most efficient levels of genome modification.
- CRISPR enzyme mRNA and guide RNA For minimization of toxicity and off-target effect, it will be important to control the concentration of CRISPR enzyme mRNA and guide RNA delivered.
- Optimal concentrations of CRISPR enzyme mRNA and guide RNA can be determined by testing different concentrations in a cellular or animal model and using deep sequencing the analyze the extent of modification at potential off-target genomic loci.
- deep sequencing can be used to assess the level of modification at the following two off-target loci, 1: 5′-GAGTCCTAGCAGGAGAAGAA-3′ (SEQ ID NO: 4) and 2: 5′-GAGTCTAAGCAGAAGAAGAA-3′ (SEQ ID NO: 5).
- concentration that gives the highest level of on-target modification while minimizing the level of off-target modification should be chosen for in vivo delivery.
- CRISPR enzyme nickase mRNA for example S. pyogenes Cas9 with the D10A mutation
- CRISPR enzyme nickase mRNA can be delivered with a pair of guide RNAs targeting a site of interest.
- the two guide RNAs need to be spaced as follows. Guide sequences in red (single underline) and blue (double underline) respectively (these examples are based on the PAM requirement for Streptococcus pyogenes Cas9).
- the 5′ overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs.
- the 5′ overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs or 1-34 base pairs.
- the first guide sequence directing cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directing cleavage of other strand near the second target sequence results in a blunt cut or a 3′ overhang.
- the 3′ overhang is at most 150, 100 or 25 base pairs or at least 15, 10 or 1 base pairs. In preferred embodiments the 3′ overhang is 1-100 basepairs.
- aspects of the invention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5′ overhangs to reanneal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased.
- the gene product is a protein.
- each guide used in these assays is able to efficiently induce indels when paired with wildtype Cas9, indicating that the relative positions of the guide pairs are the most important parameters in predicting double nicking activity.
- Cas9n and Cas9H840A nick opposite strands of DNA
- substitution of Cas9n with Cas9H840A with a given sgRNA pair should result in the inversion of the overhang type.
- a pair of sgRNAs that will generate a 5′ overhang with Cas9n should in principle generate the corresponding 3′ overhang instead. Therefore, sgRNA pairs that lead to the generation of a 3′ overhang with Cas9n might be used with Cas9H840A to generate a 5′ overhang.
- PCSK9 liver, Proprotein Convertase Subtilisin Kexin 9
- PCSK9 Proprotein convertase subtilisin kexin 9
- PCSK9 is a member of the subtilisin serine protease family.
- PCSK9 is primarily expressed by the liver and is critical for the down regulation of hepatocyte LDL receptor expression. LDL-C levels in plasma are highly elevated in humans with gain of function mutations in PCSK9. classifying them as having severe hypercholesterolemia. Therefore, PCSK9 is an attractive target for CRISPR.
- PCS9K-targeted CRISPR may be formulated in a lipid particle and for example administered at about 15, 45, 90, 150, 250 and 400 ⁇ g/kg intravenously (see, e.g., http://www.alnylam.com/capella/wp-content/uploads/2013/08/ALN-PCS02-001-Protocol-Lancet.pdf).
- Bailey et al. J Mol Med (Berl). 1999 January; 77(1):244-9) discloses insulin delivery by ex-vivo somatic cell gene therapy involves the removal of non-B-cell somatic cells (e.g. fibroblasts) from a diabetic patient, and genetically altering them in vitro to produce and secrete insulin.
- the cells can be grown in culture and returned to the donor as a source of insulin replacement. Cells modified in this way could be evaluated before implantation, and reserve stocks could be cryopreserved.
- the procedure should obviate the need for immunosuppression and overcome the problem of tissue supply, while avoiding a recurrence of cell destruction.
- Ex-vivo somatic cell gene therapy requires an accessible and robust cell type that is amenable to multiple transfections and subject to controlled proliferation.
- Special problems associated with the use of non-B-cell somatic cells include the processing of proinsulin to insulin, and the conferment of sensitivity to glucose-stimulated proinsulin biosynthesis and regulated insulin release.
- Preliminary studies using fibroblasts, pituitary cells, kidney (COS) cells and ovarian (CHO) cells suggest that these challenges could be met, and that ex-vivo somatic cell gene therapy offers a feasible approach to insulin replacement therapy.
- the system of Bailey et al. may be used/and or adapted to the CRISPR Cas system of the present invention for delivery to the liver.
- Cationic liposomes (Lipotrust) containing O,O′-ditetradecanoyl-N-(a-trimethylammonioacetyl) diethanolamine chloride (DC-6-14) as a cationic lipid, cholesterol and dioleoylphosphatidylethanolamine at a molar ratio of 4:3:3 (which has shown high transfection efficiency under serumcontaining conditions for in vitro and in vivo gene delivery) were purchased from Hokkaido System Science. The liposomes were manufactured using a freeze-dried empty liposomes method and prepared at a concentration of 1 mM (DC-16-4) by addition of double-distilled water (DDW) to the lyophilized lipid mixture under vortexing before use.
- DC-6-14 O,O′-ditetradecanoyl-N-(a-trimethylammonioacetyl) diethanolamine chloride
- VA-coupled liposomes 200 nmol of vitamin A (retinol, Sigma) dissolved in DMSO was mixed with the liposome suspensions (100 nmol as DC-16-4) by vortexing in a 1.5 ml tube at 25 1C.
- VA-lip-siRNAgp46 a solution of siRNAgp46 (580 pmol/ml in DDW) was added to the retinol-coupled liposome solution with stirring at 25 C.
- the ratio of siRNA to DC-16-4 was 1:11.5 (mol/mol) and the siRNA to liposome ratio (wt/wt) was 1:1.
- any free vitamin A or siRNA that was not taken up by liposomes were separated from liposomal preparations using a micropartition system (VIVASPIN 2 concentrator 30,000 MWCO PES, VIVASCIENCE).
- the liposomal suspension was added to the filters and centrifuged at 1,500 g for 5 min 3 times at 25° C. Fractions were collected and the material trapped in the filter was reconstituted with PBS to achieve the desired dose for in vitro or in vivo use. Three injections of 0.75 mg/kg siRNA were given every other day to rats.
- the system of Sato et al. may be used/and or adapted to the CRISPR Cas system of the present invention for delivery to the liver by delivering about 0.5 to 1 mg/kg of CRISPR Cas RNA in the liposomes as described by Sato et al. to humans.
- SATA-modified siRNAs are synthesized by reaction of 5′ aminemodified siRNA with I weight equivalents (wt eq) of Nsuccinimidyl-5-acetylthioacetate (SATA) reagent (Pierce) and 0.36 wt eq of NaHCO 3 in water at 4° C. for 16 h.
- the modified siRNAs are then precipitated by the addition of 9 vol of ethanol and incubation at 80° C. for 2 h.
- the precipitate is resuspended in 1 ⁇ siRNA buffer (Dharmacon) and quantified by measuring absorbance at the 260-nm wavelength.
- PBAVE (30 mg/ml in 5 mMTAPS, pH 9) is modified by addition of 1.5 wt % SMPT (Pierce). After a 1-h incubation, 0.8 mg of SMPT-PBAVE was added to 400 ⁇ l of isotonic glucose solution containing 5 mM TAPS (pH 9). To this solution was added 50 ⁇ g of SATA-modified siRNA. For the dose-response experiments where [PBAVE] was constant, different amounts of siRNA are added. The mixture is then incubated for 16 h. To the solution is then added 5.6 mg of Hepes free base followed by a mixture of 3.7 mg of CDM-NAG and 1.9 mg of CDM-PEG.
- CDM-PEG and CDM-NAG are synthesized from the acid chloride generated by using oxalyl chloride.
- To the acid chloride is added 1.1 molar equivalents polyethylene glycol monomethyl ether (molecular weight average of 450) to generate CDM-PEG or (aminoethoxy)ethoxy-2-(acetylamino)-2-deoxy- ⁇ -D-glucopyranoside to generate CDM-NAG.
- the final product is purified by using reverse-phase HPLC with a 0.1% TFA water/acetonitrile gradient. About 25 to 50 ⁇ g of siRNA was delivered to mice.
- the system of Rozema et al. may be applied to the CRISPR (as system of the present invention for delivery to the liver, for example by envisioning a dosage of about 50 to about 200 mg of CRISPR Cas for delivery to a human.
- Delivery options for the brain include encapsulation of CRISPR enzyme and guide RNA in the form of either DNA or RNA into liposomes and conjugating to molecular Trojan horses for trans-blood brain barrier (BBB) delivery.
- BBB trans-blood brain barrier
- Molecular Trojan horses have been shown to be effective for delivery of B-gal expression vectors into the brain of non-human primates.
- the same approach can be used to delivery vectors containing CRISPR enzyme and guide RNA.
- Xia C F and Boado R J, Pardridge W M (“Antibody-mediated targeting of siRNA via the human insulin receptor using avidin-biotin technology.” Mol. Pharm. 2009 May-June; 6(3):747-51.
- siRNA short interfering RNA
- mAb monoclonal antibody
- avidin-biotin a receptor-specific monoclonal antibody
- the authors also report that because the bond between the targeting mAb and the siRNA is stable with avidin-biotin technology, and RNAi effects at distant sites such as brain are observed in vivo following an intravenous administration of the targeted siRNA.
- Zhang et al. (Mol. Ther. 2003 January; 7(1):11-8.)) describe how expression plasmids encoding reporters such as luciferase were encapsulated in the interior of an “artificial virus” comprised of an 85 nm pegylated immunoliposome, which was targeted to the rhesus monkey brain in vivo with a monoclonal antibody (MAb) to the human insulin receptor (HIR).
- MAb monoclonal antibody
- HIR human insulin receptor
- the HIRMAb enables the liposome carrying the exogenous gene to undergo transcytosis across the blood-brain barrier and endocytosis across the neuronal plasma membrane following intravenous injection.
- the level of luciferase gene expression in the brain was 50-fold higher in the rhesus monkey as compared to the rat.
- Widespread neuronal expression of the beta-galactosidase gene in primate brain was demonstrated by both histochemistry and confocal microscopy. The authors indicate that this approach makes feasible reversible adult transgenics in 24 hours. Accordingly, the use of immunoliposome is preferred. These may be used in conjunction with antibodies to target specific tissues or cell surface proteins.
- RNA Ribonucleic acid
- nanoparticles Cho, S., Goldberg, M., Son, S., Xu, Q., Yang, F., Mei, Y., Bogatyrev, S., Langer, R. and Anderson, D., Lipid-like nanoparticles for small interfering RNA delivery to endothelial cells, Advanced Functional Materials, 19: 3112-3118, 2010
- exosomes Schroeder, A., Levins, C., Cortez, C., Langer, R., and Anderson, D., Lipid-based nanotherapeutics for siRNA delivery, Journal of Internal Medicine, 267: 9-21, 2010, PMID: 20059641).
- exosomes have been shown to be particularly useful in delivery siRNA, a system with some parallels to the CRISPR system.
- El-Andaloussi S, et al. (“Exosome-mediated delivery of siRNA in vitro and in vivo.” Nat. Protoc. 2012 December; 7(12):2112-26. doi: 10.1038/nprot.2012.131. Epub 2012 Nov. 15.) describe how exosomes are promising tools for drug delivery across different biological barriers and can be harnessed for delivery of siRNA in vitro and in vivo.
- Their approach is to generate targeted exosomes through transfection of an expression vector, comprising an exosomal protein fused with a peptide ligand. The exosomes are then purify and characterized from transfected cell supernatant, then siRNA is loaded into the exosomes. Delivery or administration according to the invention can be performed with exosomes, in particular but not limited to the brain.
- Vitamin E may be conjugated with CRISPR Cas and delivered to the brain along with high density lipoprotein (HDL), for example in a similar manner as was done by Uno et al. (HUMAN GENE THERAPY 22:711-719 (June 2011)) for delivering short-interfering RNA (siRNA) to the brain.
- Mice were infused via Osmotic minipumps (model 1007D; Alzet. Cupertino, Calif.) filled with phosphate-buffered saline (PBS) or free TocsiBACE or Toc-siBACE/HDL and connected with Brain Infusion Kit 3 (Alzet).
- a brain-infusion cannula was placed about 0.5 mm posterior to the bregma at midline for infusion into the dorsal third ventricle.
- Uno et al. found that as little as 3 nmol of Toc-siRNA with HDL could induce a target reduction in comparable degree by the same ICV infusion method.
- a similar dosage of CRISPR Cas conjugated to ⁇ -tocopherol and co-administered with HDL targeted to the brain may be contemplated for humans in the present invention, for example, about 3 nmol to about 3 ⁇ mol of CRISPR Cas targeted to the brain may becontemplated.
- Zou et al. (HUMAN GENE THERAPY 22:465-475 (April 2011)) describes a method of lentiviral-mediated delivery of short-hairpin RNAs targeting PKC ⁇ for in vivo gene silencing in the spinal cord of rats.
- Zou et al. administered about 10 ⁇ l of a recombinant lentivirus having a titer of 1 ⁇ 10 9 transducing units (TU)/ml by an intrathecal catheter.
- TU transducing units
- a similar dosage of CRISPR Cas expressed in a lentiviral vector targeted to the brain may be contemplated for humans in the present invention, for example, about 10-50 ml of CRISPR Cas targeted to the brain in a lentivirus having a titer of 1 ⁇ 10 9 transducing units (TU)/ml may becontemplated.
- TU transducing units
- Targeted deletion of genes is preferred. Examples are exemplified in Example 18. Preferred are, therefore, genes involved in cholesterol biosynthesis, fatty acid biosynthesis, and other metabolic disorders, genes encoding mis-folded proteins involved in amyloid and other diseases, oncogenes leading to cellular transformation, latent viral genes, and genes leading to dominant-negative disorders, amongst other disorders.
- Applicants prefer gene delivery of a CRISPR-Cas system to the liver, brain, ocular, epithelial, hematopoetic, or another tissue of a subject or a patient in need thereof, suffering from metabolic disorders, amyloidosis and protein-aggregation related diseases, cellular transformation arising from genetic mutations and translocations, dominant negative effects of gene mutations, latent viral infections, and other related symptoms, using either viral or nanoparticle delivery system.
- Therapeutic applications of the CRISPR-Cas system include Glaucoma, Amyloidosis, and Huntington's disease. These are exemplified in Example 20 and the features described therein are preferred alone or in combination.
- AAV spinocerebellar ataxia type 1
- SCA1 spinocerebellar ataxia type 1
- AAV1 and AAV5 vectors are preferred and AAV titers of about 1 ⁇ 10 12 vector genomes/ml are desirable.
- CRISPR-Cas guide RNAs that target the vast majority of the HIV-1 genome while taking into account HIV-1 strain variants for maximal coverage and effectiveness.
- host immune cells could be a) isolated, transduced with CRISPR-Cas, selected, and re-introduced in to the host or b) transduced in vivo by systemic delivery of the CRISPR-Cas system.
- the first approach allows for generation of a resistant immune population whereas the second is more likely to target latent viral reservoirs within the host. This is discussed in more detail in the Examples section.
- US Patent Publication No. 20130171732 assigned to Sangamo BioSciences, Inc. relates to insertion of an anti-HIV transgene into the genome, methods of which may be applied to the CRISPR Cas system of the present invention.
- the CXCR4 gene may be targeted and the TALE system of US Patent Publication No. 20100291048 assigned to Sangamo BioSciences, Inc. may be modified to the CRISPR Cas system of the present invention.
- the method of US Patent Publication Nos. 20130137104 and 20130122591 assigned to Sangamo BioSciences, Inc. and US Patent Publication No. 20100146651 assigned to Cellectis may be more generally applicable for transgene expression as it involves modifying a hypoxanthine-guanine phosphoribosyltransferase (HPRT) locus for increasing the frequency of gene modification.
- HPRT hypoxanthine-guanine phosphoribosyltransferase
- the present invention generates a gene knockout cell library. Each cell may have a single gene knocked out. This is exemplified in Example 23.
- This library is useful for the screening of gene function in cellular processes as well as diseases.
- To make this cell library one may integrate Cas9 driven by an inducible promoter (e.g. doxycycline inducible promoter) into the ES cell.
- an inducible promoter e.g. doxycycline inducible promoter
- To make the ES cell library one may simply mix ES cells with a library of genes encoding guide RNAs targeting each gene in the human genome. One may first introduce a single BxB1 attB site into the AAVS1 locus of the human ES cell.
- each guide RNA gene may be contained on a plasmid that carries of a single attP site. This way BxB1 will recombine the attB site in the genome with the attP site on the guide RNA containing plasmid.
- To generate the cell library one may take the library of cells that have single guide RNAs integrated and induce Cas9 expression. After induction, Cas9 mediates double strand break at sites specified by the guide RNA.
- the immunogenicity of protein drugs can be ascribed to a few immunodominant helper T lymphocyte (HTL) epitopes. Reducing the MHC binding affinity of these HTL epitopes contained within these proteins can generate drugs with lower immunogenicity (Tangri S, et al. (“Rationally engineered therapeutic proteins with reduced immunogenicity” J. Immunol. 2005 Mar. 15; 174(6):3187-96.)
- the immunogenicity of the CRISPR enzyme in particular may be reduced following the approach first set out in Tangri et al with respect to erythropoietin and subsequently developed. Accordingly, directed evolution or rational design may be used to reduce the immunogenicity of the CRISPR enzyme (for instance a Cas9) in the host species (human or other species).
- Example 28 Applicants used 3 guideRNAs of interest and able to visualize efficient DNA cleavage in vivo occurring only in a small subset of cells. Essentially, what Applicants have shown here is targeted in vivo cleavage. In particular, this provides proof of concept that specific targeting in higher organisms such as mammals can also be achieved. It also highlights multiplex aspect in that multiple guide sequences (i.e. separate targets) can be used simultaneously (in the sense of co-delivery). In other words, Applicants used a multiple approach, with several different sequences targeted at the same time, but independently.
- Example 34 A suitable example of a protocol for producing AAV, a preferred vector of the invention is provided in Example 34.
- Trinucleotide repeat disorders are preferred conditions to be treated. These are also exemplified herein.
- Trinucleotide repeat expansion disorders are complex, progressive disorders that involve developmental neurobiology and often affect cognition as well as sensori-motor functions.
- Trinucleotide repeat expansion proteins are a diverse set of proteins associated with susceptibility for developing a trinucleotide repeat expansion disorder, the presence of a trinucleotide repeat expansion disorder, the severity of a trinucleotide repeat expansion disorder or any combination thereof. Trinucleotide repeat expansion disorders are divided into two categories determined by the type of repeat. The most common repeat is the triplet CAG, which, when present in the coding region of a gene, codes for the amino acid glutamine (Q).
- polyglutamine disorders comprise the following diseases: Huntington Disease (HD); Spinobulbar Muscular Atrophy (SBMA); Spinocerebellar Ataxias (SCA types 1, 2, 3, 6, 7, and 17); and Dentatorubro-Pallidoluysian Atrophy (DRPLA).
- the remaining trinucleotide repeat expansion disorders either do not involve the CAG triplet or the CAG triplet is not in the coding region of the gene and are, therefore, referred to as the non-polyglutamine disorders.
- the non-polyglutamine disorders comprise Fragile X Syndrome (FRAXA); Fragile XE Mental Retardation (FRAXE); Friedreich Ataxia (FRDA); Myotonic Dystrophy (DM); and Spinocerebellar Ataxias (SCA types 8, and 12).
- FAAXA Fragile X Syndrome
- FAAXE Fragile XE Mental Retardation
- FRDA Friedreich Ataxia
- DM Myotonic Dystrophy
- SCA types 8, and 12 Spinocerebellar Ataxias
- the proteins associated with trinucleotide repeat expansion disorders are typically selected based on an experimental association of the protein associated with a trinucleotide repeat expansion disorder to a trinucleotide repeat expansion disorder.
- the production rate or circulating concentration of a protein associated with a trinucleotide repeat expansion disorder may be elevated or depressed in a population having a trinucleotide repeat expansion disorder relative to a population lacking the trinucleotide repeat expansion disorder.
- Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry.
- the proteins associated with trinucleotide repeat expansion disorders may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR).
- genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR).
- Non-limiting examples of proteins associated with trinucleotide repeat expansion disorders include AR (androgen receptor), FMR1 (fragile X mental retardation 1), HTT (huntingtin), DMPK (dystrophia myotonica-protein kinase), FXN (frataxin), ATXN2 (ataxin 2), ATN1 (atrophin 1), FEN (flap structure-specific endonuclease 1), TNRC6A (trinucleotide repeat containing 6A), PABPN1 (poly(A) binding protein, nuclear 1), JPH3 (junctophilin 3), MED15 (mediator complex subunit 15), ATXN1 (ataxin 1), ATXN3 (ataxin 3).
- TBP TATA box binding protein
- CACNAIA calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
- ATXN80S ATXN8 opposite strand (non-protein coding)
- PPP2R2B protein phosphatase 2, regulatory subunit B, beta
- ATXN7 ATXN7
- TNRC6B trinucleotide repeat containing 6B
- TNRC6C trinucleotide repeat containing 6C
- CELF3 CUGBP, Elav-like family member 3
- MAB21L1 mab-21-like 1 ( C. elegans )
- MSH2 mutS homolog 2, colon cancer, nonpolyposis type 1 ( E.
- TMEM185A transmembrane protein 185A
- SIX5 SIX homeobox 5
- CNPY3 canopy 3 homolog (zebrafish)
- FRAXE fragmentile site, folic acid type, rare, fra(XXq28) E
- GNB2 guanine nucleotide binding protein (G protein), beta polypeptide 2)
- RPL14 ribosomal protein L14
- ATXN8 ataxin 8
- INSR insulin receptor
- TTR transthyretin
- EP400 EIA binding protein p400
- GIGYF2 GYF protein 2
- OGG1 8-oxoguanine DNA glycosylase
- STC1 sinocalcin 1
- CNDP1 carbnosine dipeptidase 1 (metallopeptidase M20 family)
- C10orf2 chromosome 10 open reading frame 2
- MAML3 mastermind-like 3 Drosophila
- DKC1 diskeratosis congenita 1.
- PAXIP1 PAX interacting (with transcription-activation domain) protein 1
- CASK calcium/calmodulin-dependent serine protein kinase
- MAPT microtubule-associated protein tau
- SP1 Sp1 transcription factor
- POLG polymerase (DNA directed), gamma
- AFF2 AF4/FMR2 family, member 2
- THBS1 thrombospondin 1).
- TP53 tumor protein p53
- ESR1 estrogen receptor 1).
- CGGBP1 CGG triplet repeat binding protein 1
- ABT1 activator of basal transcription 1
- KLK3 kallikrein-related peptidase 3
- PRNP prion protein
- JUN jun oncogene
- KCNN3 potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3
- BAX BCL2-associated X protein
- FRAXA fragmentile site, folic acid type, rare, fra(XXq27.3) A (macroorchidism, mental retardation)
- KBTBD10 kelch repeat and BTB (POZ) domain containing 10
- MBNL1 muscleblind-like (Drosophila)
- RAD51 RAD51 homolog (RecA homolog, E.
- TYR tyrosinase (oculocutaneous albinism IA)
- EGR1 early growth response 1
- UNG uracil-DNA glycosylase
- NUMBL numb homolog (Drosophila)-like
- FABP2 fatty acid binding protein 2, intestinal
- EN2 engaging homeobox 2
- CRYGC crystallin, gamma C
- SRP14 signal recognition particle 14 kDa (homologous Alu RNA binding protein)).
- CRYGB (crystallin, gamma B), PDCD1 (programmed cell death 1), HOXA1 (homeobox A1), ATXN2L (ataxin 2-like), PMS2 (PMS2 postmeiotic segregation increased 2 ( S.
- GLA galactosidase, alpha
- CBL Cas-Br-M (murine) ecotropic retroviral transforming sequence
- FTH1 ferritin, heavy polypeptide 1
- IL2RB2 interleukin 12 receptor, beta 2
- OTX2 orthodenticle homeobox 2
- HOXAS homeobox A5
- POLG2 polymerase (DNA directed), gamma 2, accessory subunit)
- DLX2 distal-less homeobox 2
- SIRPA signal-regulatory protein alpha
- OTX1 orthodenticle homeobox 1
- AHRR aryl-hydrocarbon receptor repressor
- MANF mesencephalic astrocyte-derived neurotrophic factor
- TMEM158 transmembrane protein 158 (gene/pseudogene)
- Preferred proteins associated with trinucleotide repeat expansion disorders include HTT (Huntingtin), AR (androgen receptor). FXN (frataxin), Atxn3 (ataxin), Atxn1 (ataxin). Atxn2 (ataxin), Atxn7 (ataxin), Atxn10 (ataxin), DMPK (dystrophia myotonica-protein kinase), Atnl (atrophin 1), CBP (creb binding protein), VLDLR (very low density lipoprotein receptor), and any combination thereof.
- a method of gene therapy for the treatment of a subject having a mutation in the CFTR gene comprises administering a therapeutically effective amount of a CRISPR-Cas gene therapy particle, optionally via a biocompatible pharmaceutical carrier, to the cells of a subject.
- the target DNA comprises the mutation deltaF508.
- the mutation is repaired to the wildtype.
- the mutation is a deletion of the three nucleotides that comprise the codon for phenylalanine (F) at position 508. Accordingly, repair in this instance requires reintroduction of the missing codon into the mutant.
- an adenovirus/AAV vector system is introduced into the host cell, cells or patient.
- the system comprises a Cas9 (or Cas9 nickase) and the guide RNA along with a adenovirus/AAV vector system comprising the homology repair template containing the F508 residue.
- This may be introduced into the subject via one of the methods of delivery discussed earlier.
- the CRISPR-Cas system may be guided by the CFTRdelta 508 chimeric guide RNA. It targets a specific site of the CFTR genomic locus to be nicked or cleaved.
- the repair template is inserted into the cleavage site via homologous recombination correcting the deletion that results in cystic fibrosis or causes cystic fibrosis related symptoms.
- This strategy to direct delivery and provide systemic introduction of CRISPR systems with appropriate guide RNAs can be employed to target genetic mutations to edit or otherwise manipulate genes that cause metabolic, liver, kidney and protein diseases and disorders such as those in Table B.
- the CRISPR/Cas9 systems of the present invention can be used to correct genetic mutations that were previously attempted with limited success using TALEN and ZFN.
- TALEN and ZFN genetic mutations that were previously attempted with limited success using TALEN and ZFN.
- WO2013163628 A2 Genetic Correction of Mutated Genes, published application of Duke University describes efforts to correct, for example, a frameshift mutation which causes a premature stop codon and a truncated gene product that can be corrected via nuclease mediated non-homologous end joining such as those responsible for Duchenne Muscular Dystrophy, (“DMD”) a recessive, fatal, X-linked disorder that results in muscle degeneration due to mutations in the dystrophin gene.
- DMD Duchenne Muscular Dystrophy
- Dystrophin is a cytoplasmic protein that provides structural stability to the dystroglycan complex of the cell membrane that is responsible for regulating muscle cell integrity and function.
- the dystrophin gene or “DMD gene” as used interchangeably herein is 2.2 megabases at locus Xp21. The primary transcription measures about 2,400 kb with the mature mRNA being about 14 kb. 79 exons code for the protein which is over 3500 amino acids. Exon 51 is frequently adjacent to frame-disrupting deletions in DMD patients and has been targeted in clinical trials for oligonucleotide-based exon skipping.
- the present invention also contemplates delivering the CRISPR-Cas system to the blood.
- the CRISPR Cas system of the present invention is also contemplated to treat hemoglobinopathies, such as thalassemias and sickle cell disease. See, e.g., International Patent Publication No. WO 2013/126794 for potential targets that may be targeted by the CRISPR Cas system of the present invention.
- US Patent Publication Nos. 20110225664, 20110091441, 20100229252, 20090271881 and 20090222937 assigned to Cellectis relates to CREI variants, wherein at least one of the two 1-CreI monomers has at least two substitutions, one in each of the two functional subdomains of the LAGLIDADG core domain (SEQ ID NO: 60) situated respectively from positions 26 to 40 and 44 to 77 of 1-CreI, said variant being able to cleave a DNA target sequence from the human interleukin-2 receptor gamma chain (IL2RG) gene also named common cytokine receptor gamma chain gene or gamma C gene.
- IL2RG human interleukin-2 receptor gamma chain
- the target sequences identified in US Patent Publication Nos. 20110225664, 20110091441, 20100229252, 20090271881 and 20090222937 may be utilized for the CRISPR Cas system of the present invention.
- SCID Severe Combined Immune Deficiency
- IL2RG encodes the gamma C protein (Noguchi, et al., Cell, 1993, 73, 147-157), a common component of at least five interleukin receptor complexes. These receptors activate several targets through the JAK3 kinase (Macchi et al., Nature, 1995, 377, 65-68), which inactivation results in the same syndrome as gamma C inactivation; (ii) mutation in the ADA gene results in a defect in purine metabolism that is lethal for lymphocyte precursors, which in turn results in the quasi absence of B, T and NK cells; (iii) V(D)J recombination is an essential step in the maturation of immunoglobulins and T lymphocytes receptors (TCRs).
- TCRs T lymphocytes receptors
- HSCs Hematopoietic Stem Cells
- US Patent Publication No. 20110182867 assigned to the Children's Medical Center Corporation and the President and Fellows of Harvard College relates to methods and uses of modulating fetal hemoglobin expression (HbF) in a hematopoietic progenitor cells via inhibitors of BCL11A expression or activity, such as RNAi and antibodies.
- the targets disclosed in US Patent Publication No. 20110182867, such as BCL11A may be targeted by the CRISPR Cas system of the present invention for modulating fetal hemoglobin expression. See also Bauer et al. (Science 11 Oct. 2013: Vol. 342 no. 6155 pp. 253-257) and Xu et al. (Science 18 Nov. 2011: Vol. 334 no. 6058 pp. 993-996) for additional BCL I A targets.
- the present invention also contemplates delivering the CRISPR-Cas system to one or both ears.
- cochlear implants are looking into whether gene therapy could be used to aid current deafness treatments-namely, cochlear implants. Deafness is often caused by lost or damaged hair cells that cannot relay signals to auditory neurons. In such cases, cochlear implants may be used to respond to sound and transmit electrical signals to the nerve cells. But these neurons often degenerate and retract from the cochlea as fewer growth factors are released by impaired hair cells.
- US patent application 20120328580 describes injection of a pharmaceutical composition into the ear (e.g., auricular administration), such as into the luminae of the cochlea (e.g., the Scala media, Sc vestibulae, and Sc tympani), e.g., using a syringe, e.g., a single-dose syringe.
- a pharmaceutical composition into the ear (e.g., auricular administration), such as into the luminae of the cochlea (e.g., the Scala media, Sc vestibulae, and Sc tympani), e.g., using a syringe, e.g., a single-dose syringe.
- one or more of the compounds described herein can be administered by intratympanic injection (e.g., into the middle ear), and/or injections into the outer, middle, and/or inner ear.
- intratympanic injection e.g
- Injection can be, for example, through the round window of the ear or through the cochlcar capsule.
- Other inner ear administration methods are known in the art (see, e.g., Salt and Plontke, Drug Discovery Today, 10:1299-1306, 2005).
- the pharmaceutical composition in another mode of administration, can be administered in situ, via a catheter or pump.
- a catheter or pump can, for example, direct a pharmaceutical composition into the cochlear luminae or the round window of the ear and/or the lumen of the colon.
- Exemplary drug delivery apparatus and methods suitable for administering one or more of the compounds described herein into an ear, e.g., a human ear, are described by McKenna et al., (U.S. Publication No. 2006/0030837) and Jacobsen et al., (U.S. Pat. No. 7,206,639).
- a catheter or pump can be positioned, e.g., in the ear (e.g., the outer, middle, and/or inner ear) of a patient during a surgical procedure. In some embodiments, a catheter or pump can be positioned, e.g., in the ear (e.g., the outer, middle, and/or inner ear) of a patient without the need for a surgical procedure.
- one or more of the compounds described herein can be administered in combination with a mechanical device such as a cochlear implant or a hearing aid, which is worn in the outer ear.
- a mechanical device such as a cochlear implant or a hearing aid, which is worn in the outer ear.
- An exemplary cochlear implant that is suitable for use with the present invention is described by Edge et al., (U.S. Publication No. 2007/0093878).
- the modes of administration described above may be combined in any order and can be simultaneous or interspersed.
- the present invention may be administered according to any of the Food and Drug Administration approved methods, for example, as described in CDER Data Standards Manual, version number 004 (which is available at fda.give/cder/dsm/DRG/drg00301.htm).
- the cell therapy methods described in US patent application 20120328580 can be used to promote complete or partial differentiation of a cell to or towards a mature cell type of the inner ear (e.g., a hair cell) in vitro. Cells resulting from such methods can then be transplanted or implanted into a patient in need of such treatment.
- the cell culture methods required to practice these methods including methods for identifying and selecting suitable cell types, methods for promoting complete or partial differentiation of selected cells, methods for identifying complete or partially differentiated cell types, and methods for implanting complete or partially differentiated cells are described below.
- Cells suitable for use in the present invention include, but are not limited to, cells that are capable of differentiating completely or partially into a mature cell of the inner ear, e.g., a hair cell (e.g., an inner and/or outer hair cell), when contacted, e.g., in vitro, with one or more of the compounds described herein.
- a hair cell e.g., an inner and/or outer hair cell
- Exemplary cells that are capable of differentiating into a hair cell include, but are not limited to stem cells (e.g., inner car stem cells, adult stem cells, bone marrow derived stem cells, embryonic stem cells, mesenchymal stem cells, skin stem cells, iPS cells, and fat derived stem cells), progenitor cells (e.g., inner ear progenitor cells), support cells (e.g., Deiters' cells, pillar cells, inner phalangeal cells, tectal cells and Hensen's cells), and/or germ cells.
- stem cells e.g., inner car stem cells, adult stem cells, bone marrow derived stem cells, embryonic stem cells, mesenchymal stem cells, skin stem cells, iPS cells, and fat derived stem cells
- progenitor cells e.g., inner ear progenitor cells
- support cells e.g., Deiters' cells, pillar cells, inner phalangeal cells, tectal cells and Hensen
- Such suitable cells can be identified by analyzing (e.g., qualitatively or quantitatively) the presence of one or more tissue specific genes.
- gene expression can be detected by detecting the protein product of one or more tissue-specific genes.
- Protein detection techniques involve staining proteins (e.g., using cell extracts or whole cells) using antibodies against the appropriate antigen.
- the appropriate antigen is the protein product of the tissue-specific gene expression.
- a first antibody i.e., the antibody that binds the antigen
- a second antibody directed against the first e.g., an anti-IgG
- This second antibody is conjugated either with fluorochromes, or appropriate enzymes for colorimetric reactions, or gold beads (for electron microscopy), or with the biotin-avidin system, so that the location of the primary antibody, and thus the antigen, can be recognized.
- the CRISPR Cas molecules of the present invention may be delivered to the ear by direct application of pharmaceutical composition to the outer ear, with compositions modified from US Published application, 20110142917.
- the pharmaceutical composition is applied to the ear canal. Delivery to the ear may also be referred to as aural or otic delivery.
- RNA molecules of the invention are delivered in liposome or lipofectin formulations and the like and can be prepared by methods well known to those skilled in the art. Such methods are described, for example, in U.S. Pat. Nos. 5,593,972, 5,589,466, and 5,580,859, which are herein incorporated by reference.
- siRNA has recently been successfully used for inhibition of gene expression in primates (see for example. Tolentino et al., Retina 24(4):660 which may also be applied to the present invention.
- Qi et al. discloses methods for efficient siRNA transfection to the inner ear through the intact round window by a novel proteidic delivery technology which may be applied to the CRISPR Cas system of the present invention (see, e.g., Qi et al., Gene Therapy (2013), 1-9).
- TAT-DRBDs TAT double stranded RNA-binding domains
- TAT-DRBDs TAT double stranded RNA-binding domains
- cochlear implant function can be improved by good preservation of the spiral ganglion neurons, which are the target of electrical stimulation by the implant and brain derived neurotrophic factor (BDNF) has previously been shown to enhance spiral ganglion survival in experimentally deafened ears.
- BDNF brain derived neurotrophic factor
- Rejali et al. tested a modified design of the cochlear implant electrode that includes a coating of fibroblast cells transduced by a viral vector with a BDNF gene insert. To accomplish this type of ex vivo gene transfer, Rejali et al.
- transduced guinea pig fibroblasts with an adenovirus with a BDNF gene cassette insert and determined that these cells secreted BDNF and then attached BDNF-secreting cells to the cochlear implant electrode via an agarose gel, and implanted the electrode in the scala tympani.
- Rejali et al. determined that the BDNF expressing electrodes were able to preserve significantly more spiral ganglion neurons in the basal turns of the cochlea after 48 days of implantation when compared to control electrodes and demonstrated the feasibility of combining cochlear implant therapy with ex vivo gene transfer for enhancing spiral ganglion neuron survival.
- Such a system may be applied to the CRISPR Cas system of the present invention for delivery to the ear.
- the present invention also contemplates delivering the CRISPR-Cas system to one or both eyes.
- the CRISPR-Cas system may be used to correct ocular defects that arise from several genetic mutations further described in Genetic Diseases of the Eye, Second Edition, edited by Elias I. Traboulsi, Oxford University Press, 2012.
- lentiviral vectors for administration to the eye, lentiviral vectors, in particular equine infectious anemia viruses (EIAV) are particularly preferred.
- EIAV equine infectious anemia viruses
- minimal non-primate lentiviral vectors based on the equine infectious anemia virus are also contemplated, especially for ocular gene therapy (see, e.g., Balagaan, J Gene Med 2006; 8: 275-285, Published online 21 Nov. 2005 in Wiley InterScience (www.interscience.wiley.com). DOI: 10.1002/jgm.845).
- the vectors are contemplated to have cytomegalovirus (CMV) promoter driving expression of the target gene.
- CMV cytomegalovirus
- Intracameral, subretinal, intraocular and intravitreal injections are all contemplated (see, e.g., Balagaan, J Gene Med 2006; 8: 275-285. Published online 21 Nov.
- Intraocular injections may be performed with the aid of an operating microscope.
- eyes may be prolapsed by gentle digital pressure and fundi visualised using a contact lens system consisting of a drop of a coupling medium solution on the cornea covered with a glass microscope slide coverslip.
- the tip of a 10-mm 34-gauge needle, mounted on a 5- ⁇ l Hamilton syringe may be advanced under direct visualisation through the superior equatorial sclera tangentially towards the posterior pole until the aperture of the needle was visible in the subretinal space.
- 2 ⁇ l of vector suspension may be injected to produce a superior bullous retinal detachment, thus confirming subretinal vector administration.
- This approach creates a self-sealing sclerotomy allowing the vector suspension to be retained in the subretinal space until it is absorbed by the RPE, usually within 48 h of the procedure. This procedure may be repeated in the inferior hemisphere to produce an inferior retinal detachment.
- This technique results in the exposure of approximately 70% of neurosensory retina and RPE to the vector suspension.
- the needle tip may be advanced through the sclera 1 mm posterior to the corneoscleral limbus and 2 ⁇ l of vector suspension injected into the vitreous cavity.
- the needle tip may be advanced through a corneoscleral limbal paracentesis, directed towards the central cornea, and 2 ⁇ l of vector suspension may be injected.
- the needle tip may be advanced through a corneoscleral limbal paracentesis, directed towards the central cornea, and 2 ⁇ l of vector suspension may be injected.
- These vectors may be injected at titres of either 1.0-1.4 ⁇ 10 10 or 1.0-1.4 ⁇ 10 9 transducing units (TU)/ml.
- RetinoStat® an equine infectious anemia virus-based lentiviral gene therapy vector that expresses angiostatic proteins endostain and angiostatin that is delivered via a subretinal injection for the treatment of the web form of age-related macular degeneration is also contemplated (see, e.g., Binley et al., HUMAN GENE THERAPY 23:980-991 (September 2012)).
- Such a vector may be modified for the CRISPR-Cas system of the present invention.
- Each eye may be treated with either RetinoStat® at a dose of 1.1 ⁇ 10 5 transducing units per eye (TU/eye) in a total volume of 1001.
- an E1-, partial E3-, E4-deleted adenoviral vector may be contemplated for delivery to the eye.
- Twenty-eight patients with advanced neovascular age-related macular degeneration (AMD) were given a single intravitreous injection of an E1-, partial E3-, E4-deleted adenoviral vector expressing human pigment ep-ithelium-derived factor (AdPEDF.II) (see, e.g., Campochiaro et al., Human Gene Therapy 17:167-176 (February 2006)).
- AdPEDF.II human pigment ep-ithelium-derived factor
- Adenoviral vector-mediated ocular gene transfer appears to be a viable approach for the treatment of ocular disorders and could be applied to the CRISPR Cas system.
- the sd-rxRNA® system of RXi Pharmaceuticals may be used/and or adapted for delivering CRISPR Cas to the eye.
- a single intravitreal administration of 3 ⁇ g of sd-rxRNA results in sequence-specific reduction of PPIB mRNA levels for 14 days.
- the sd-rxRNA® system may be applied to the CRISPR Cas system of the present invention, contemplating a dose of about 3 to 20 mg of CRISPR administered to a human.
- Millington-Ward et al. (Molecular Therapy, vol. 19 no. 4, 642-649 April 2011) describes adeno-associated virus (AAV) vectors to deliver an RNA interference (RNAi)-based rhodopsin suppressor and a codon-modified rhodopsin replacement gene resistant to suppression due to nucleotide alterations at degenerate positions over the RNAi target site.
- RNAi RNA interference
- An injection of either 6.0 ⁇ 10 8 vp or 1.8 ⁇ 10 10 vp AAV were subretinally injected into the eyes by Millington-Ward et al.
- the AAV vectors of Millington-Ward et al. may be applied to the CRISPR Cas system of the present invention, contemplating a dose of about 2 ⁇ 10 11 to about 6 ⁇ 10 13 vp administered to a human.
- Dalkara et al. also relates to in vivo directed evolution to fashion an AAV vector that delivers wild-type versions of defective genes throughout the retina after noninjurious injection into the eyes' vitreous humor.
- Dalkara describes a a 7mer peptide display library and an AAV library constructed by DNA shuffling of cap genes from AAV1, 2, 4, 5, 6, 8, and 9.
- the rcAAV libraries and rAAV vectors expressing GFP under a CAG or Rho promoter were packaged and deoxyribonuclease-resistant genomic titers were obtained through quantitative PCR.
- the libraries were pooled, and two rounds of evolution were performed, each consisting of initial library diversification followed by three in vivo selection steps.
- P30 rho-GFP mice were intravitreally injected with 2 ml of iodixanol-purified, phosphate-buffered saline (PBS)-dialyzed library with a genomic titer of about 1 ⁇ 10 12 vg/ml.
- PBS phosphate-buffered saline
- the AAV vectors of Dalkara et al. may be applied to the CRISPR Cas system of the present invention, contemplating a dose of about 1 ⁇ 10 15 to about 1 ⁇ 10 16 vg/ml administered to a human.
- the rhodopsin gene may be targeted for the treatment of retinitis pigmentosa (RP), wherein the system of US Patent Publication No. 20120204282 assigned to Sangamo BioSciences, Inc. may be modified in accordance of the CRISPR Cas system of the present invention.
- RP retinitis pigmentosa
- US Patent Publication No. 20130202678 assigned to Academia Sinica relates to methods for treating retinopathies and sight-threatening ophthalmologic disorders relating to delivering of the Puf-A gene (which is expressed in retinal ganglion and pigmented cells of eye tissues and displays a unique anti-apoptotic activity) to the sub-retinal or intravitreal space in the eye.
- desirable targets are zgc:193933, prdmla, spata2, tex10, rbb4, ddx3, zp2.2, Blimp-1 and HtrA2, all of which may be targeted by the CRISPR Cas system of the present invention.
- Wu Cell Stem Cell, 13:659-62, 2013
- a guide RNA that led Cas9 to a single base pair mutation that causes cataracts in mice, where it induced DNA cleavage. Then using either the other wild-type allele or oligos given to the zygotes repair mechanisms corrected the sequence of the broken allele and corrected the cataract-causing genetic defect in mutant mouse.
- Macular degeneration is the primary cause of visual impairment in the elderly, but is also a hallmark symptom of childhood diseases such as Stargardt disease, Sorsby fundus, and fatal childhood neurodegenerative diseases, with an age of onset as young as infancy. Macular degeneration results in a loss of vision in the center of the visual field (the macula) because of damage to the retina.
- Currently existing animal models do not recapitulate major hallmarks of the disease as it is observed in humans.
- the available animal models comprising mutant genes encoding proteins associated with MD also produce highly variable phenotypes, making translations to human disease and therapy development problematic.
- US Patent Publication No. 20120159653 relates to editing of any chromosomal sequences that encode proteins associated with MD which may be applied to the CRISPR Cas system of the present invention.
- the proteins associated with MD are typically selected based on an experimental association of the protein associated with MD to an MD disorder. For example, the production rate or circulating concentration of a protein associated with MD may be elevated or depressed in a population having an MD disorder relative to a population lacking the MD disorder. Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry.
- the proteins associated with MD may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR).
- proteins associated with MD include but are not limited to the following proteins: (ABCA4) ATP-binding cassette, sub-family A (ABC1), member 4 ACHM1 achromatopsia (rod monochromacy) 1 ApoE Apolipoprotein E (ApoE) CIQTNF5 (CTRP5) Clq and tumor necrosis factor related protein 5 (C1QTNF5) C2 Complement component 2 (C2) C3 Complement components (C3) CCL2 Chemokine (C—C motif) Ligand 2 (CCL2) CCR2Chemokine (C—C motif) receptor 2 (CCR2) CD36 Cluster of Differentiation 36 CFB Complement factor B CFH Complement factor CFH H CFHR1 complement factor H-related i CFHR3 complement factor H-related 3 CNGB3 cyclic nucleotide gated channel beta 3 CP ceruloplasmin (CP)CRP C reactive protein (CRP) CST3 cystatin C or cystatin 3 (C
- the proteins associated with MD whose chromosomal sequence is edited may be the ATP-binding cassette, sub-family A (ABC1) member 4 protein (ABCA4) encoded by the ABCR gene, the apolipoprotein E protein (APOE) encoded by the APOE gene, the chemokine (C—C motif) Ligand 2 protein (CCL2) encoded by the CCL2 gene, the chemokine (C—C motif) receptor 2 protein (CCR2) encoded by the CCR2 gene, the ceruloplasmin protein (CP) encoded by the CP gene, the cathepsin D protein (CTSD) encoded by the CTSD gene, or the metalloproteinase inhibitor 3 protein (TIMP3) encoded by the TIMP3 gene.
- ABSC1 sub-family A
- APOE apolipoprotein E protein
- CCR2 chemokine (C—C motif) Ligand 2 protein
- CCR2 chemokine (C—C motif) receptor 2 protein
- CP cerulo
- the genetically modified animal is a rat
- the edited chromosomal sequence encoding the protein associated with MD may be: (ABCA4) ATP-binding cassette, NM — 000350 sub-family A (ABC1), member 4 APOE Apolipoprotein E NM — 138828 (APOE) CCL2 Chemokine (C—C NM — 031530 motif) Ligand 2 (CCL2) CCR2 Chemokine (C—C NM — 021866 motif) receptor 2 (CCR2) CP ceruloplasmin (CP) NM — 012532 CTSD Cathepsin D (CTSD) NM — 134334 TIMP3 Metalloproteinase NM — 012886 inhibitor 3 (TIMP3)
- the animal or cell may comprise 1, 2, 3, 4, 5, 6, 7 or more disrupted chromosomal sequences encoding a protein associated with MD and zero, 1, 2, 3, 4, 5, 6, 7 or more chromosomally integrated sequences encoding
- the edited or integrated chromosomal sequence may be modified to encode an altered protein associated with MD.
- MD-related chromosomal sequences have been associated with MD.
- Non-limiting examples of mutations in chromosomal sequences associated with MD include those that may cause MD including in the ABCR protein, E471K (i.e. glutamate at position 471 is changed to lysine), R1129L (i.e. arginine at position 1129 is changed to leucine), T1428M (i.e. threonine at position 1428 is changed to methionine), R1517S (i.e. arginine at position 1517 is changed to serine), I1562T (i.e.
- isoleucine at position 1562 is changed to threonine
- G1578R i.e. glycine at position 1578 is changed to arginine
- V641 i.e. valine at position 192 is changed to isoleucine
- G969B i.e. glycine at position 969 is changed to asparagine or aspartate
- TIMP3 protein S156C (i.e. serine at position 156 is changed to cysteine), G166C (i.e. glycine at position 166 is changed to cysteine), G167C (i.e. glycine at position 167 is changed to cysteine), Y168C (i.e.
- tyrosine at position 168 is changed to cysteine
- S170C i.e. serine at position 170 is changed to cysteine
- Y172C i.e. tyrosine at position 172 is changed to cysteine
- S181C i.e. serine at position 181 is changed to cysteine
- the present invention also contemplates delivering the CRISPR-Cas system to the heart.
- a myocardium tropic adena-associated virus AAVM
- AAVM41 myocardium tropic adena-associated virus
- Administration may be systemic or local.
- a dosage of about 1-10 ⁇ 10 14 vector genomes are contemplated for systemic administration. See also, e.g., Eulalio et al. (2012) Nature 492: 376 and Somasuntharam et al. (2013) Biomaterials 34: 7790.
- Cardiovascular diseases generally include high blood pressure, heart attacks, heart failure, and stroke and TIA. Any chromosomal sequence involved in cardiovascular disease or the protein encoded by any chromosomal sequence involved in cardiovascular disease may be utilized in the methods described in this disclosure.
- the cardiovascular-related proteins are typically selected based on an experimental association of the cardiovascular-related protein to the development of cardiovascular disease. For example, the production rate or circulating concentration of a cardiovascular-related protein may be elevated or depressed in a population having a cardiovascular disorder relative to a population lacking the cardiovascular disorder.
- Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry.
- the cardiovascular-related proteins may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (SAG E), and quantitative real-time polymerase chain reaction (Q-PCR).
- the chromosomal sequence may comprise, but is not limited to, IL1B (interleukin 1, beta), XDH (xanthine dehydrogenase), TP53 (tumor protein p53), PTGIS (prostaglandin 12 (prostacyclin) synthase), MB (myoglobin), IL4 (interleukin 4), ANGPT (angiopoietin 1), ABCG8 (ATP-binding cassette, sub-family G (WHITE), member 8), CTSK (cathepsin K), PTGIR (prostaglandin 12 (prostacyclin) receptor (IP)), KCNJ11 (potassium inwardly-rectifying channel, subfamily J, member 11).
- IL1B interleukin 1, beta
- XDH xanthine dehydrogenase
- TP53 tumor protein p53
- PTGIS prostaglandin 12 (prostacyclin) synthase
- MB myoglobin
- INS insulin receptor
- PDGFRB platelet-derived growth factor receptor, beta polypeptide
- CCNA2 cyclin A2
- PDGFB platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
- KCNJ5 potassium inwardly-rectifying channel, subfamily J, member 5
- KCNN3 potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3
- CAPN10 calpain 10
- PTGES prostaglandin E synthase
- ADRA2B adrenergic, alpha-2B-, receptor
- ABCG5 ATP-binding cassette, sub-family G (WHITE), member 5
- PRDX2 peroxiredoxin 2
- CAPN5 calpain 5
- PARP14 poly (ADP-ribose) polymerase family, member 14
- MEX3C mex-3 homolog
- ACE angiotensin I converting enzyme peptidyl-dipeptidase A 1)
- TNF tumor necrosis factor
- IL6 interleukin 6 (interferon, beta 2)
- STN statin
- SERPINE1 serotonin peptidase inhibitor
- clade E nonin, plasminogen activator inhibitor type 1
- ALB albumin
- ADIPOQ adiponectin, C1Q and collagen domain containing
- APOB apolipoprotein B (including Ag(x) antigen)
- APOE apolipoprotein E
- LEP laeptin
- MTHFR 5,10-methylenetetrahydrofolate reductase (NADPH)
- APOA1 apolipoprotein A-1
- EDN endothelin 1
- NPPB natriuretic peptide precursor B
- NOS3 nitric oxide synthase 3
- THBD thrombomodulin
- F10 coagulation factor X
- CP ceruloplasmin (fenrroxidase)
- TNFRSF11B tumor necrosis factor receptor superfamily, member 11b
- EDNRA endothelin receptor type A
- EGFR epidermal growth factor receptor (erythroblastic leukemia viral (v-crb-b) oncogene homolog, avian)
- MMP2 matrix metallopeptidase 2 (gelatinase A, 72 kDa gelatinase, 72 kDa type IV collagenase)
- PLG plasmaogen
- NPY neuropeptide Y
- RHOD ras homolog gene family, member D
- MAPK8 mitogen-activated protein kinase 8).
- MYC v-myc myelocytomatosis viral oncogene homolog (avian)).
- FN fibronectin 1
- CMA1 chymase 1, mast cell
- PLAU Plasinogen activator, urokinase
- GNB3 guanine nucleotide binding protein (G protein), beta polypeptide 3
- ADRB2 adrenergic, beta-2-, receptor, surface
- APOA5 apolipoprotein A-V
- SOD2 superoxide dismutase 2, mitochondrial
- F5 coagulation factor V (proaccelerin, labile factor)
- VDR vitamin D (1,25-dihydroxyvitamin D3) receptor
- ALOX5 arachidonate 5-lipoxygenase
- HLA-DRB 1 major histocompatibility complex, class II, DR beta I
- PARP1 poly (ADP-ribose) polymerase 1).
- CD40LG CD40 ligand
- PON2 paraoxonase 2
- AGER advanced glycosylation end product-specific receptor
- IRS1 insulin receptor substrate 1
- PTGS1 prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
- ECE1 endothelin converting enzyme 1
- F7 coagulation factor VII (serum prothrombin conversion accelerator)
- URN interleukin 1 receptor antagonist
- EPHX2 epoxide hydrolase 2, cytoplasmic
- IGFBP1 insulin-like growth factor binding protein 1
- MAPK10 mitogen-activated protein kinase 10
- FAS Fas (TNF receptor superfamily, member 6)
- ABCB1 ATP-binding cassette, sub-family B (MDR/TAP), member 1)
- JUN jun oncogene
- IGFBP3 insulin-like growth factor binding protein 3
- CD14 CD40
- PDE5A phosphodiesterase 5A, cGMP-specific
- AGTR2 angiotensin II receptor, type 2
- CD40 CD40 molecule, TNF receptor superfamily member 5
- LCAT lecithin-cholesterol acyltransferase
- CCR5 chemokine (C—C motif) receptor 5
- MMP1 matrix metallopeptidase I (interstitial collagenase)
- TIMP metallopeptidase inhibitor 1
- ADM adrenomedullin
- DYT10 dystonia 10
- STAT3 signal transducer and activator of transcription 3 (acute-phase response factor)
- MMP3 matrix metallopeptidase 3 (stromelysin 1, progelatinase)
- ELN elastin
- USF1 upstream transcription factor 1
- CFH compact factor H
- HSPA4 heat shock 70 kDa protein 4
- MMP12 matrix metallo
- LIPG lipase, endothelial.
- HIFIA hyperoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)), CXCR4 (chemokine (C—X—C motif) receptor 4), PROC (protein C (inactivator of coagulation factors Va and VIIIa)), SCARB1 (scavenger receptor class B, member 1), CD79A (CD79a molecule, immunoglobulin-associated alpha), PLTP (phospholipid transfer protein), ADD1 (adducin 1 (alpha)), FGG (fibrinogen gamma chain), SAA1 (serum amyloid A1), KCNH2 (potassium voltage-gated channel, subfamily H (eag-related), member 2), DPP4 (dipeptidyl-peptidase 4), G6PD (glucose-6-phosphate dehydrogenase), NPR1 (natriuretic peptide receptor Aiguanylate cycla
- SHBG serine hormone-binding globulin
- HMGB1 high-mobility group box 1
- HSP90B2P heat shock protein 90 kDa beta (Grp94), member 2 (pseudogene)
- CYP3A4 cytochrome P450.
- GJA1 glycosylcholine
- CAV1 caveolin 1, caveolae protein, 22 kDa
- ESR2 estrogen receptor 2 (ER beta)
- LTA lymphotoxin alpha (TNF superfamily, member 1)
- GDF15 growth differentiation factor 15
- BDNF brain-derived neurotrophic factor
- CYP2D6 cytochrome P450, family 2, subfamily D, polypeptide 6
- NGF nerve growth factor (beta polypeptide)
- SP1 Sp1 transcription factor
- TGIF1 TGFB-induced factor homeobox 1
- SRC v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)
- EGF epidermal growth factor (beta-urogastrone)
- PIK3CG phosphoinositide-3-kinase, catalytic, gamma polypeptide
- DMD distrophin
- GATA4 GATA binding protein 4
- F13A1 coagulation factor XIII, A1 polypeptide
- TTR transthyretin
- FABP4 fatty acid binding protein 4, adipocyte
- PON3 paraoxonase 3
- APOC1 apolipoprotein C-1
- INSR insulin receptor
- TNFRSFIB tumor necrosis factor receptor superfamily, member 1B
- HTR2A (5-hydroxytryptamine (serotonin) receptor 2A
- CSF3 colony stimulating factor 3 (granulocyte)
- CYP2C9 cytochrome P450, family 2, subfamily C, polypeptide 9
- TXN thioredoxin
- CYP11B2 cytochrome P450, family 11, subfamily B, polypeptide 2
- PTH parathyroid hormone
- CSF2 colony stimulating factor 2 (granulocyte-macrophage)
- KDR kinase insert domain receptor
- GNRH1 gonadotropin-releasing hormone 1 (luteinizing-releasing hormone)
- PAPPA pregnancy-associated plasma protein A, pappalysin 1
- ARR3 arrestin 3, retinal (X-arrestin)
- NPPC natriuretic peptide precursor C
- AHSP alpha hemoglobin stabilizing protein
- PTK2 PTK2 protein tyrosine kinase 2
- IL13 interleukin 13
- MTOR mechanistic target of rapamycin (serine/threonine kinase)
- ITGB2 integratedin, beta 2 (complement component 3 receptor 3 and 4 subunit)
- GSTT1 glutthione S-transferase theta 1
- IL6ST interleukin 6 signal transducer (gp130, oncostatin M receptor)
- CPB2 carboxypeptidase B2 (plasma)
- CYPIA2 cytochrome P450
- G-protein coupled, 12 RNLS (renalase, FAD-dependent amine oxidase), CREB1 (cAMP responsive element binding protein 1), POMC (proopiomelanocortin), RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)), LMNA (lamin NC), CD59 (CD59 molecule, complement regulatory protein), SCN5A (sodium channel, voltage-gated, type V, alpha subunit), CYPB1 (cytochrome P450, family 1, subfamily B, polypeptide 1), MIF (macrophage migration inhibitory factor (glycosylation-inhibiting factor)), MMP13 (matrix metallopeptidase 13 (collagenase 3)), TIMP2 (TIMP metallopeptidase inhibitor 2), CYP19A1 (cytochrome P450, family 19, subfamily A, polypeptide 1), CYP21A2 (cytochrome P450, family 21, sub
- IGHE immunoglobulin heavy constant epsilon
- KCNE1 potassium voltage-gated channel, Isk-related family, member 1).
- TFRC transferrin receptor (p90, CD71)
- COLIA1 collagen, type I, alpha 1
- COLIA2 collagen, type I, alpha 2
- IL2RB interleukin 2 receptor, beta
- PLA2G10 phospholipase A2, group X
- ANGPT2 angiopoietin 2
- PROCR protein C receptor, endothelial (EPCR)), NOX4 (NADPH oxidase 4), HAMP (hepcidin antimicrobial peptide), PTPN11 (protein tyrosine phosphatase, non-receptor type 11), SLC2A1 (solute carrier family 2 (facilitated glucose transporter), member 1), IL2RA (interleukin 2 receptor, alpha), CCL5 (chemokine (C—C motif) ligand 5), IRF1 (interferon regulatory factor 1), CFLAR (CASP8 and FADD-like apoptosis regulator), CALCA (calcitonin-related polypeptide alpha), EIF4E (eukaryotic translation initiation factor 4E), GSTP1 (glutathione S-transferase pi 1), JAK2 (Janus kinase 2), CYP3A5 (cytochrome P450, family 3, subfamily A, polypeptide 5), HSPG2 (heparan sulfate
- SOATI sterol O-acyltransferase 1
- ADRBK1 adrenergic, beta, receptor kinase 1
- NR4A2 nuclear receptor subfamily 4, group A, member 2
- MMP8 matrix metallopeptidase 8 (neutrophil collagenase)
- NPR2 natriuretic peptide receptor B/guanylate cyclase B (atrionatriuretic peptide receptor B)
- GCH1 GTP cyclohydrolase 1
- EPRS glutamyl-prolyl-tRNA synthetase
- PPARGC1A peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
- F12 coagulation factor XII (Hageman factor)
- PECAM1 plateletiendothelial cell adhesion molecule
- CCL4 chemokine (C—C motif) ligand 4
- SERPINA3 serotonine peptidas
- CAMP cathelicidin antimicrobial peptide
- ZC3H12A zinc finger CCCH-type containing 12A
- AKR1B1 aldo-keto reductase family 1, member B1 (aldose reductase)
- DES desmin
- MMP7 matrix metallopeptidase 7 (matrilysin, uterine)
- AHR aryl hydrocarbon receptor
- CSF1 colony stimulating factor 1 (macrophage)
- HDAC9 histone deacetylase 9
- CTGF connective tissue growth factor
- KCNMA1 potassium large conductance calcium-activated channel, subfamily M, alpha member 1
- UGTIA UDP glucuronosyltransferase 1 family, polypeptide A complex locus
- PRKCA protein kinase C, alpha
- COMT catechol-.beta.-methyltransferase
- S100B S100 calcium binding protein B
- EGR1 early growth response 1)
- PRL prolactin
- IL15 interleukin 15
- DR D4 dopamine receptor D4
- CAMK2G calcium/calmodulin-dependent protein kinase II gamma
- LOC646627 phospholipase inhibitor
- TBXAS1 thromboxane A synthase 1 (platelet)
- CYP2J2 cytochrome P450, family 2, subfamily J, polypeptide 2
- TBXA2R thromboxane A2 receptor
- ADHIC alcohol dehydrogenase 1C (class I), gamma polypeptide), ALOX12 (arachidonate 12-lipoxygenase), AHSG (alpha-2-HS-glycoprotein), BHMT (betaine-homocysteine methyltransferase), GJA4 (gap junction protein, alpha 4, 37 kDa), SLC25A4 (solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4).
- ACLY ATP citrate lyase
- ALOX5AP arachidonate 5-lipoxygenase-activating protein
- NUMA1 nuclear mitotic apparatus protein 1
- CYP27B1 cytochrome P450, family 27, subfamily B, polypeptide 1
- CYSLTR2 cystyl leukotriene receptor 2
- SOD3 superoxide dismutase 3, extracellular
- LTC4S leukotriene C4 synthase
- UCN urocortin
- GHRL ghrelin/obestatin prepropeptide
- APOC2 apolipoprotein C-II
- CLEC4A C-type lectin domain family 4, member A
- KBTBD10 kelch repeat and BTB (POZ) domain containing 10
- TNC tenascin C
- TYMS thymidylate synthetase
- SHC1 SHC (Src homology 2 domain containing) transforming protein 1)
- ATP-binding cassette sub-family B (MDRfIAP)
- RNF123 ring finger protein 123
- PTK2B PTK2B protein tyrosine kinase 2 beta
- NTRK2 neurotrophic tyrosine kinase, receptor, type 2)
- IL6R interleukin 6 receptor
- ACHE acetylcholinesterase (Yt blood group)
- GLP1R glucagon-like peptide I receptor
- GHR growth hormone receptor
- GSR glutthione reductase
- NQO1 NAD(P)H dehydrogenase, quinone 1
- NR5A1 nuclear receptor subfamily 5, group A, member 1)
- GJB2 gap junction protein, beta 2, 26 kDa
- SLC9A1 solute carrier family 9 (sodium/hydrogen exchanger), member 1)
- MAOA monoamine oxidase A
- PCSK9 proprotein convertase subtilis
- TFAP2A transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
- C4BPA complement component 4 binding protein, alpha
- SERPINF2 serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2)
- TYMP thymidine phosphorylase
- ALPP alkaline phosphatase, placental (Regan isozyme)
- CXCR2 chemokine (C—X—C motif) receptor 2
- SLC39A3 solute carrier family 39 (zinc transporter), member 3), ABCG2 (ATP-binding cassette, sub-family G (WHITE), member 2)
- ADA adenosine deaminase
- JAK3 Janus kinase 3
- HSPA1A heat shock 70 kDa protein 1A
- FASN fatty acid synthase
- FGF1 fibroblast growth factor 1 (acidic)
- F11 coagulation
- CEBPB CCAAT/enhancer binding protein (C/EBP), beta), NAGLU (N-acetylglucosaminidase, alpha-), F2RL3 (coagulation factor II (thrombin) receptor-like 3), CX3CL1 (chemokine (C—X3-C motif) ligand 1), BDKRB1 (bradykinin receptor B1), ADAMTS13 (ADAM metallopeptidase with thrombospondin type I motif, 13), ELANE (elastase, neutrophil expressed), ENPP2 (ectonucleotide pyrophosphatase/phosphodiesterase 2).
- CISH cytokine inducible SH2-containing protein
- GAST gastrin
- MYOC myocilin, trabecular meshwork inducible glucocorticoid response
- ATPIA2 ATPase, Na+/K+ transporting, alpha 2 polypeptide
- NF1 neurofibromin 1
- GJB1 gap junction protein, beta 1, 32 kDa
- MEF2A myocyte enhancer factor 2A
- VCL vinculin
- BMPR2 bone morphogenetic protein receptor, type II (serine/threonine kinase)
- TUBB tubulin, beta
- CDC42 cell division cycle 42 (GTP binding protein, 25 kDa)
- KRT18 Keratin 18).
- HSF1 heat shock transcription factor 1
- MYB v-myb myeloblastosis viral oncogene homolog (avian)
- PRKAA2 protein kinase, AMP-activated, alpha 2 catalytic subunit
- ROCK2 Ra-associated, coiled-coil containing protein kinase 2
- TFPI tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)
- PRKG1 protein kinase, cGMP-dependent, type I
- BMP2 bone morphogenetic protein 2
- CTNNDI catenin (cadherin-associated protein), delta 1)
- CTH cystathionase (cystathionine gamma-lyase)
- CTSS cathepsin S
- VAV2 vav 2 guanine nucleotide exchange factor
- NPY2R neuropeptide Y receptor Y2
- IGFBP2 insulin-like growth factor binding protein 2
- PRKCB protein kinase C, beta
- SRD5A1 steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
- HSD11B2 hydroxysteroid (11-beta) dehydrogenase 2)
- CALCRL calcium calcitonin receptor-like
- GALNT2 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2)
- ANGPTL4 angiopoietin-like 4
- KCNN4 potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4
- PIK3C2A phosphoinositide-3-kinase, class 2, alpha polypeptide
- HBEGF heparin-binding EGF-like growth factor
- HLA-DRB5 major histocompatibility complex, class II, DR beta 5
- BNIP3 BCL2/adenovirus E1B 19 kDa interacting protein 3
- GCKR glucokinase (hexokinase 4) regulator
- S100A12 S100 calcium binding protein A12
- PADI4 peptidyl arginine deiminase, type IV
- HSPA14 heat shock 70 kDa protein 14
- CXCR1 chemokine (C—X—C motif) receptor 1
- H19 H19, imprinted maternally expressed transcript (non-protein coding)
- KRTAP 9-3 keratin associated protein 19-3
- IDDM2 insulin-dependent diabetes mellitus 2
- RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
- RYR1 ryanodine receptor 1 (skeletal)
- CLOCK clock homolog
- PRKAG2 protein kinase, AMP-activated, gamma 2 non-catalytic subunit), CHAT (choline acetyltransferase), PTGDS (prostaglandin D2 synthase 21 kDa (brain)), NR1H2 (nuclear receptor subfamily 1, group H, member 2), TEK (TEK tyrosine kinase, endothelial), VEGFB (vascular endothelial growth factor B), MEF2C (myocyte enhancer factor 2C), MAPKAPK2 (mitogen-activated protein kinase-activated protein kinase 2), TNFRSF11A (tumor necrosis factor receptor superfamily, member 11a, NFKB activator), HSPA9 (heat shock 70 kDa protein 9 (mortalin)), CYSLTR1 (cysteinyl leukotriene receptor 1), MAT A (methionine adenosyltransfera
- OPRL1 opioid receptor-like 1
- IMPA1 inositol(myo)-1(or 4)-monophosphatase 1
- CLCN2 chloride channel 2
- DLD dihydrolipoamide dehydrogenase
- PSMA6 proteasome (prosome, macropain) subunit, alpha type, 6
- PSMB8 proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7)
- CHI3L1 chitinase 3-like 1 (cartilage glycoprotein-39)
- ALDH1B1 aldehyde dehydrogenase 1 family, member B1
- PARP2 poly (ADP-ribose) polymerase 2)
- STAR steroidogenic acute regulatory protein
- LBP lipopolysaccharide binding protein
- ABCC6 ATP-binding cassette, sub-family C(CFTR/MRP), member 6
- RGS2 regulatory of G-
- CCR6 chemokine (C—C motif) receptor 6
- GJB3 gap junction protein, beta 3, 31 kDa
- IL1RL1 interleukin 1 receptor-like 1
- ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1
- BBS4 Bardet-Biedl syndrome 4
- CELSR2 cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila )), F11R (F11 receptor), RAPGEF3 (Rap guanine nucleotide exchange factor (GEF) 3), HYAL1 (hyaluronoglucosaminidase 1), ZNF259 (zinc finger protein 259), ATOX1 (ATX1 antioxidant protein 1 homolog (yeast)), ATF6 (activating transcription factor 6), KHK (ketohexokinase (fructokinase)), SAT1 (spermidine/spermine N1-acetyltransferase 1), GGH (gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase)), TIMP4 (TIMP metallopeptidase inhibitor 4), SLC4A4 (solute carrier family 4, sodium bicarbonate cotransporter, member 4), PDE2A (phosphodieste
- FTO fat mass and obesity associated
- GJD2 gap junction protein, delta 2, 36 kDa
- PSRC 1 proline/serine-rich coiled-coil 1
- CASP12 caspase 12 (geneipseudogene)
- GPBAR1 G protein-coupled bile acid receptor 1
- PXK PX domain containing serine/threonine kinase
- IL33 interleukin 33
- TRIB1 tribbles homolog 1 (Drosophila)
- PBX4 pre-B-cell leukemia homeobox 4
- NUPR1 nuclear protein, transcriptional regulator, 1), 15-September (15 kDa selenoprotein
- CILP2 cartilage intermediate layer protein 2)
- TERC telomerase RNA component
- GGT2 gamma-glutamyltransferase 2
- MT-CO1 mitochondrially encoded cytochrome c oxidase 1
- the chromosomal sequence may further be selected from Pon1 (paraoxonase 1), LDLR (LDL receptor), ApoE (Apolipoprotein E), Apo B-100 (Apolipoprotein B-100), ApoA (Apolipoprotein(a)), ApoA1 (Apolipoprotein A1), CBS (Cystathione B-synthase), Glycoprotein IIb/IIb, MTHRF (5,10-methylenetetrahydrofolate reductase (NADPH), and combinations thereof.
- Pon1 paraoxonase 1
- LDLR LDL receptor
- ApoE Apolipoprotein E
- Apo B-100 Apolipoprotein B-100
- ApoA Adoprotein(a)
- ApoA1 Adpolipoprotein A1
- CBS Cystathione B-synthase
- Glycoprotein IIb/IIb Glycoprotein IIb/IIb
- the chromosomal sequences and proteins encoded by chromosomal sequences involved in cardiovascular disease may be chosen from Cacna1C, Sod1, Pten, Ppar(alpha), Apo E, Leptin, and combinations thereof.
- the present invention also contemplates delivering the CRISPR-Cas system to the kidney.
- Delivery strategies to induce cellular uptake of the therapeutic nucleic acid include physical force or vector systems such as viral-, lipid- or complex-based delivery, or nanocarriers. From the initial applications with less possible clinical relevance, when nucleic acids were addressed to renal cells with hydrodynamic high pressure injection systemically, a wide range of gene therapeutic viral and non-viral carriers have been applied already to target posttranscriptional events in different animal kidney disease models in vivo (Csaba Rev6sz and P6ter Hamar (2011). Delivery Methods to Target RNAs in the Kidney, Gene Therapy Applications, Prof.
- Lipid Lipofectamine2000 p53 Acute renal Ischemic and Histological Molitoris et al., J injury cisplatin- scoring, apoptosis Am Soc Nephrol, induced acute (March 2009), Vol. injury 20, No. 8, pp. (1754-1764) Lipid DOTAP/DOPE, COX-2 Breast adeno- MDA-MB- Cell viability, Mikhaylova et al., DOTAP/DOPE/ carcinoma 231 breast uptake Cancer Gene Therapy DOPE- cancer (March 2011), Vol. 16, PEG2000 xenograft- No. 3, pp.
- Yuan et al. (Am Physiol Renal Physiol 295: F605-F617, 2008) investigated whether in vivo delivery of small interfering RNAs (siRNAs) targeting the 12/15-lipoxygenase (12/15-LO) pathway of arachidonate acid metabolism can ameliorate renal injury and diabetic nephropathy (DN) in a streptozotocin injected mouse model of type 1 diabetes.
- siRNAs small interfering RNAs
- DN diabetic nephropathy
- Yuan et al. used double-stranded 12/15-LO siRNA oligonucleotides conjugated with cholesterol. About 400 ⁇ g of siRNA was injected subcutaneously into mice.
- the method of Yuang et al. may be applied to the CRISPR Cas system of the present invention contemplating a 1-2 g subcutaneous injection of CRISPR Cas conjugated with cholesterol to a human for delivery to the kidneys.
- Molitoris et al. (J Am Soc Nephrol 20: 1754-1764, 2009) exploited proximal tubule cells (PTCs), as the site of oligonucleotide reabsorption within the kidney to test the efficacy of siRNA targeted to p53, a pivotal protein in the apoptotic pathway, to prevent kidney injury. Naked synthetic siRNA to p53 injected intravenously 4 h after ischemic injury maximally protected both PTCs and kidney function. Molitoris et al.'s data indicates that rapid delivery of siRNA to proximal tubule cells follows intravenous administration.
- mice were injected with doses of siP53, 0.33; 1, 3, or 5 mg/kg, given at the same four time points, resulting in cumulative doses of 1.32; 4, 12, and 20 mg/kg, respectively. All siRNA doses tested produced a SCr reducing effect on day one with higher doses being effective over approximately five days compared with PBS-treated ischemic control rats. The 12 and 20 mg/kg cumulative doses provided the best protective effect.
- the method of Molitoris et al. may be applied to the CRISPR Cas system of the present invention contemplating 12 and 20 mg/kg cumulative doses to a human for delivery to the kidneys.
- RNA interference pathway to temporarily inhibit expression of the pro-apoptotic protein p53 and is being developed to protect cells from acute ischemia/reperfusion injuries such as acute kidney injury that can occur during major cardiac surgery and delayed graft function that can occur following renal transplantation.
- Shimizu et al. J Am Soc Nephrol 21: 622-633, 2010 developed a system to target delivery of siRNAs to glomeruli via poly(ethylene glycol)-poly(L-lysine)-based vehicles.
- the siRNA/nanocarrier complex was approximately 10 to 20 nm in diameter, a size that would allow it to move across the fenestrated endothelium to access to the mesangium.
- Shimizu et al. detected siRNAs in the blood circulation for a prolonged time.
- CRISPR Cas system of the present invention contemplating a dose of about of 10-20 ⁇ mol CRISPR Cas complexed with nanocarriers in about 1-2 liters to a human for intraperitoneal administration and delivery to the kidneys.
- the present invention also contemplates delivering the CRISPR-Cas system to oneor both lungs.
- AAV-2-based vectors were originally proposed for CFTR delivery to CF airways, other serotypes such as AAV-1, AAV-5, AAV-6, and AAV-9 exhibit improved gene transfer efficiency in a variety of models of the lung epithelium (see, e.g., Li et al., Molecular Therapy, vol. 17 no. 12, 2067-2077 December 2009).
- AAV-1 was demonstrated to be ⁇ 100-fold more efficient than AAV-2 and AAV-5 at transducing human airway epithelial cells in vitro, 5 although AAV-1 transduced murine tracheal airway epithelia in vivo with an efficiency equal to that of AAV-5.
- AAV-5 is 50-fold more efficient than AAV-2 at gene delivery to human airway epithelium (HAE) in vitro and significantly more efficient in the mouse lung airway epithelium in vivo.
- AAV-6 has also been shown to be more efficient than AAV-2 in human airway epithelial cells in vitro and murine airways in vivo.
- AAV-9 was shown to display greater gene transfer efficiency than AAV-5 in murine nasal and alveolar epithelia in vivo with gene expression detected for over 9 months suggesting AAV may enable long-term gene expression in vivo, a desirable property for a CFTR gene delivery vector.
- CF and non-CF HAE cultures may be inoculated on the apical surface with 100 ⁇ l of AAV vectors for hours (see, e.g., Li et al., Molecular Therapy, vol. 17 no. 12, 2067-2077 December 2009).
- the MOI may vary from 1 ⁇ 10 3 to 4 ⁇ 10 5 vector genomes/cell, depending on virus concentration and purposes of the experiments.
- the above cited vectors are contemplated for the delivery and/or administration of the invention.
- Zamora et al. (Am J Respir Crit. Care Med Vol 183. pp 531-538, 2011) reported an example of the application of an RNA interference therapeutic to the treatment of human infectious disease and also a randomized trial of an antiviral drug in respiratory syncytial virus (RSV)-infected lung transplant recipients.
- RSV respiratory syncytial virus
- Zamora et al. performed a randomized, double-blind, placebo controlled trial in LTX recipients with RSV respiratory tract infection. Patients were permitted to receive standard of care for RSV. Aerosolized ALN-RSV01 (0.6 mg/kg) or placebo was administered daily for 3 days. This study demonstrates that an RNAi therapeutic targeting RSV can be safely administered to LTX recipients with RSV infection.
- Three daily doses of ALN-RSV01 did not result in any exacerbation of respiratory tract symptoms or impairment of lung function and did not exhibit any systemic proinflammatory effects, such as induction of cytokines or CRP.
- Pharmacokinetics showed only low, transient systemic exposure after inhalation, consistent with preclinical animal data showing that ALN-RSV01, administered intravenously or by inhalation, is rapidly cleared from the circulation through exonucleasemediated digestion and renal excretion.
- the method of Zamora et al. may be applied to the CRISPR Cas system of the present invention and an aerosolized CRISPR Cas, for example with a dosage of 0.6 mg/kg, may be contemplated for the present invention.
- Example 22 demonstrates gene transfer or gene delivery of a CRISPR-Cas system in airways of subject or a patient in need thereof, suffering from cystic fibrosis or from cystic fibrosis (CF) related symptoms, using adeno-associated virus (AAV) particles.
- AAV adeno-associated virus
- CF cystic fibrosis
- a repair strategy for Cystic Fibrosis delta F508 mutation This type of strategy should apply across all organisms.
- suitable patients may include: Human, non-primate human, canine, feline, bovine, equine and other domestic animals.
- Applicants utilized a CRISPR-Cas system comprising a Cas9 enzyme to target deltaF508 or other CFTR-inducing mutations.
- aerosolized AAV vector system per lung endobronchially delivered while spontaneously breathing.
- aerosolized delivery is preferred for AAV delivery in general.
- An adenovirus or an AAV particle may be used for delivery.
- Suitable gene constructs, each operably linked to one or more regulatory sequences, may be cloned into the delivery vector.
- Cbh or EF1a promoter for Cas9, U6 or H1 promoter for chimeric guide RNA A preferred arrangement is to use a CFTRdelta508 targeting chimeric guide, a repair template for deltaF508 mutation and a codon optimized Cas9 enzyme (preferred Cas9s are those with nuclease or nickase activity) with optionally one or more nuclear localization signal or sequence(s) (NLS(s)), e.g., two (2) NLSs. Constructs without NLS are also envisaged.
- the PAM may contain a NGG or a NNAGAAW motif.
- the present method comprises manipulation of a target sequence in a genomic locus of interest comprising delivering a non-naturally occurring or engineered composition comprising a viral vector system comprising one or more viral vectors operably encoding a composition for expression thereof, wherein the composition comprises:
- a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising I. a first regulatory element operably linked to a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence, wherein the polynucleotide sequence comprises (a) a guide sequence capable of hybridizing to the CF target sequence in a suitable mammalian cell, (b) a tracr mate sequence, and (c) a tracr sequence, and II.
- chiRNA CRISPR-Cas system chimeric RNA
- a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences, wherein (a), (b) and (c) are arranged in a 5′ to 3′ orientation, wherein components I and II are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
- preferred target DNA sequences comprise the CFTRdelta508 mutation.
- a preferred PAM is described above.
- a preferred CRISPR enzyme is any Cas (described herein, but particularly that described in Example 22).
- CF include any genetic disorder and examples of these are well known.
- Another preferred method or use of the invention is for correcting defects in the EMP2A and EMP2B genes that have been identified to be associated with Lafora disease.
- a “guide sequence” may be distinct from “guide RNA”.
- a guide sequence may refer to an approx. 20 bp sequence, within the guide RNA, that specifies the target site.
- the Cas9 is (or is derived from) SpCas9.
- preferred mutations are at any or all or positions 10, 762, 840, 854, 863 and/or 986 of SpCas9 or corresponding positions in other Cas9s (which may be ascertained for instance by standard sequence comparison tools.
- any or all of the following mutations are preferred in SpCas9: D10A, E762A, H840A, N854A. N863A and/or D986A; as well as conservative substitution for any of the replacement amino acids is also envisaged.
- the same (or conservative substitutions of these mutations) at corresponding positions in other Cas9s are also preferred.
- Particularly preferred are D10 and H840 in SpCas9.
- residues corresponding to SpCas9 D10 and H840 are also preferred. These are advantageous as they provide nickase activity.
- Such mutations may be applied to all aspects of the present invention, not only treatment of CF.
- Schwank et al. (Cell Stem Cell, 13:653-58, 2013) used CRISPR/Cas9 to correct a defect associated with cystic fibrosis in human stem cells.
- the team's target was the gene for an ion channel, cystic fibrosis transmembrane conductor receptor (CFTR).
- CFTR cystic fibrosis transmembrane conductor receptor
- a deletion in CFTR causes the protein to misfold in cystic fibrosis patients.
- CFTR cystic fibrosis transmembrane conductor receptor
- Using cultured intestinal stem cells developed from cell samples from two children with cystic fibrosis Schwank et al. were able to correct the defect using CRISPR along with a donor plasmid containing the reparative sequence to be inserted.
- the researchers then grew the cells into intestinal “organoids,” or miniature guts, and showed that they functioned normally. In this case, about half of clonal organoids underwent the proper genetic
- the present invention also contemplates delivering the CRISPR-Cas system to muscle(s).
- Bortolanza et al. (Molecular Therapy vol. 19 no. 11, 2055-2064 November 2011) shows that systemic delivery of RNA interference expression cassettes in the FRG1 mouse, after the onset of facioscapulohumeral muscular dystrophy (FSHD), led to a dose-dependent long-term FRG1 knockdown without signs of toxicity.
- FSHD facioscapulohumeral muscular dystrophy
- Bortolanza et al. found that a single intravenous injection of 5 ⁇ 10 12 vg of rAAV6-sh1FRG1 rescues muscle histopathology and muscle function of FRG1 mice.
- 200 ⁇ l containing 2 ⁇ 10 12 or 5 ⁇ 10 12 vg of vector in physiological solution were injected into the tail vein using a 25-gauge Terumo syringe.
- the method of Bortolanza et al. may be applied to an AAV expressing CRISPR Cas and injected into humans at a dosage of about 2 ⁇ 10 15 or
- Dumonceaux et al. inhibit the myostatin pathway using the technique of RNA interference directed against the myostatin receptor AcvRIIb mRNA (sh-AcvRIIb).
- the restoration of a quasi-dystrophin was mediated by the vectorized U7 exon-skipping technique (U7-DYS).
- Adeno-associated vectors carrying either the sh-AcvrIIb construct alone, the U7-DYS construct alone, or a combination of both constructs were injected in the tibialis anterior (TA) muscle of dystrophic mdx mice. The injections were performed with 10 11 AAV viral genomes.
- the method of Dumonceaux et al. may be applied to an AAV expressing CRISPR Cas and injected into humans, for example, at a dosage of about 10 14 to about 10 15 vg of vector.
- Mst-siRNAs (final concentration, 10 mM) were mixed with ATCOL (final concentration for local administration, 0.5%) (AteloGene, Kohken, Tokyo, Japan) according to the manufacturer's instructions. After anesthesia of mice (20-week-old male C57BL/6) by Nembutal (25 mg/kg, i.p.), the Mst-siRNA/ATCOL complex was injected into the masseter and biceps femoris muscles.
- the method of Kinouchi et al. may be applied to CRISPR Cas and injected into a human, for example, at a dosage of about 500 to 1000 ml of a 40 M solution into the muscle.
- Hagstrom et al. (Molecular Therapy Vol. 10, No. 2, August 2004) describe an intravascular, nonviral methodology that enables efficient and repeatable delivery of nucleic acids to muscle cells (myofibers) throughout the limb muscles of mammals.
- the procedure involves the injection of naked plasmid DNA or siRNA into a distal vein of a limb that is transiently isolated by a tourniquet or blood pressure cuff.
- Nucleic acid delivery to myofibers is facilitated by its rapid injection in sufficient volume to enable extravasation of the nucleic acid solution into muscle tissue.
- High levels of transgene expression in skeletal muscle were achieved in both small and large animals with minimal toxicity.
- Evidence of siRNA delivery to limb muscle was also obtained.
- plasmid DNA intravenous injection into a rhesus monkey a threeway stopcock was connected to two syringe pumps (Model PHD 2000; Harvard Instruments), each loaded with a single syringe.
- pDNA (15.5 to 25.7 mg in 40-100 ml saline) was injected at a rate of 1.7 or 2.0 ml/s. This could be scaled up for plasmid DNA expressing CRISPR Cas of the present invention with an injection of about 300 to 500 mg in 800 to 2000 ml saline for a human.
- adenoviral vector injections into a rat 2 ⁇ 10 9 infectious particles were injected in 3 ml of normal saline solution (NSS). This could be scaled up for an adenoviral vector expressing CRISPR Cas of the present invention with an injection of about 1 ⁇ 10 13 infectious particles were injected in 10 liters of NSS for a human.
- siRNA a rat was injected into the great saphenous vein with 12.5 ⁇ g of a siRNA and a primate was injected injected into the great saphenous vein with 750 ⁇ g of a siRNA.
- This could be scaled up for a CRISPR Cas of the present invention for example, with an injection of about 15 to about 50 mg into the great saphenous vein of a human.
- the present invention also contemplates delivering the CRISPR-Cas system to the skin.
- Hickerson et al. relates to a motorized microneedle array skin delivery device for delivering self-delivery (sd)-siRNA to human and murine skin.
- the primary challenge to translating siRNA-based skin therapeutics to the clinic is the development of effective delivery systems.
- Substantial effort has been invested in a variety of skin delivery technologies with limited success.
- the naked pain associated with the hypodermic needle injection precluded enrollment of additional patients in the trial, highlighting the need for improved, more “patient-friendly” (i.e., little or no pain) delivery approaches.
- Microneedles represent an efficient way to deliver large charged cargos including siRNAs across the primary barrier, the stratum corneum, and are generally regarded as less painful than conventional hypodermic needles.
- Motorized “stamp type” microneedle devices including the motorized microneedle array (MMNA) device used by Hickerson et al., have been shown to be safe in hairless mice studies and cause little or no pain as evidenced by (i) widespread use in the cosmetic industry and (ii) limited testing in which nearly all volunteers found use of the device to be much less painful than a flushot, suggesting siRNA delivery using this device will result in much less pain than was experienced in the previous clinical trial using hypodermic needle injections.
- MMNA motorized microneedle array
- the MMNA device (marketed as Triple-M or Tri-M by Bomtech Electronic Co, Seoul, South Korea) was adapted for delivery of siRNA to mouse and human skin.
- sd-siRNA solution up to 3001 of 0.1 mg/ml RNA
- the disposable Tri-M needle cartridge Bamtech
- deidentified skin obtained immediately following surgical procedures
- All intradermal injections were performed using an insulin syringe with a 28-gauge 0.5-inch needle.
- the MMNA device and method of Hickerson et al. could be used and/or adapted to deliver the CRISPR Cas of the present invention, for example, at a dosage of up to 300 ⁇ l of 0.1 mg/ml CRISPR Cas to the skin.
- Leachman et al. (Molecular Therapy, vol. 18 no. 2, 442-446 February 2010) relates to a phase Ib clinical trial for treatment of a rare skin disorder pachyonychia congenita (PC), an autosomal dominant syndrome that includes a disabling plantar keratoderma, utilizing the first short-interfering RNA (siRNA)-based therapeutic for skin.
- This siRNA called TD101, specifically and potently targets the keratin 6a (K6a) N171K mutant mRNA without affecting wild-type K6a mRNA.
- the dose-escalation schedule is presented below:
- TD101 (mg/ml) TD101 (mg) 1 1-2 1-7 0.1 1.0 0.10 2 3-4 8-14 0.25 1.0 0.25 3 5-6 15-21 0.50 1.0 0.50 4 7-8 22-28 1.0 1.0 1.0 5 9-10 29-35 1.5 1.0 1.5 6 11-12 36-42 2.0 1.0 2.0 7 13-14 43-49 2.0 1.5 3.0 8 15-16 50-56 2.0 2.0 4.0 9 17-18 57-63 2.0 2.5 5.0 10 19-20 64-70 2.0 3.0 6.0 11 21-22 71-77 2.0 3.5 7.0 12 23-24 78-84 2.0 4.0 8.0 13 25-26 85-91 2.0 4.5 9.0 14 27-28 92-98 2.0 5.0 10.0 15 29-30 99-105 2.0 6.0 12.0 16 31-32 106-112 2.0 7.0 14.0 17 33 113-119 2.0 8.5 17.0
- 0.1 ml of a 1.0 mg/ml solution of TD101 or vehicle alone was administered to symmetric calluses.
- Six rising dose-volumes were completed without an adverse reaction to the increases: 0.1, 0.25, 0.5, 1.0, 1.5, and 2.0 ml of a 1.0 mg/ml solution of TD101 solution per injection.
- the concentration of TD101 was then increased each week from 1 mg/ml up to a final concentration of 8.5 mg/ml.
- Similar dosages are contemplated for the administration of a CRISPR Cas that specifically and potently targets the keratin 6a (K6a) N171K mutant mRNA.
- Zheng et al. show that spherical nucleic acid nanoparticle conjugates (SNA-NCs), gold cores surrounded by a dense shell of highly oriented, covalently immobilized siRNA, freely penetrate almost 100% of keratinocytes in vitro, mouse skin, and human epidermis within hours after application.
- SNA-NCs spherical nucleic acid nanoparticle conjugates
- Zheng et al. demonstrated that a single application of 25 nM epidermal growth factor receptor (EGFR) SNA-NCs for 60 h demonstrate effective gene knockdown in human skin.
- EGFR epidermal growth factor receptor
- a similar dosage may be contemplated for CRISPR Cas immobilized in SNA-NCs for administration to the skin.
- the present invention may also be applied to treat hepatitis B virus (HBV).
- HBV hepatitis B virus
- the CRISPR Cas system must be adapted to avoid the shortcomings of RNAi, such as the risk of oversatring endogenous small RNA pathways, by for example, optimizing dose and sequence (see, e.g., Grimm et al., Nature vol. 441, 26 May 2006).
- low doses such as about 1 ⁇ 10 ⁇ 10 14 particles per humane are contemplated.
- the CRISPR Cas system directed against HBV may be administered in liposomes, such as a stable nucleic-acid-lipid particle (SNALP) (see, e.g., Morrissey et al., Nature Biotechnology, Vol. 23, No. 8. August 2005).
- SNALP stable nucleic-acid-lipid particle
- Daily intravenous injections of about 1, 3 or 5 mg/kg/day of CRISPR Cas targeted to HBV RNA in a SNALP are contemplated.
- the daily treatment may be over about three days and then weekly for about five weeks.
- the system of Chen et al. may be used/and or adapted for the CRISPR Cas system of the present invention.
- Chen et al. use a double-stranded adenoassociated virus 8-pseudotyped vector (dsAAV2/8) to deliver shRNA.
- dsAAV2/8 double-stranded adenoassociated virus 8-pseudotyped vector
- a single administration of dsAAV2/8 vector (1 ⁇ 10 12 vector genomes per mouse), carrying HBV-specific shRNA effectively suppressed the steady level of HBV protein, mRNA and replicative DNA in liver of HBV transgenic mice, leading to up to 2-3 log 10 decrease in HBV load in the circulation.
- a CRISPR Cas system directed to HBV may be cloned into an AAV vector, such as a dsAAV2/8 vector and administered to a human, for example, at a dosage of about 1 ⁇ 10 15 vector genomes to about 1 ⁇ 10 16 vector genomes per human.
- Wooddell et al. (Molecular Therapy vol. 21 no. 5, 973-985 May 2013) may be used/and or adapted to the CRISPR Cas system of the present invention.
- Woodell et al. show that simple coinjection of a hepatocyte-targeted, N-acetylgalactosamine-conjugated melittin-like peptide (NAG-MLP) with a liver-tropic cholesterol-conjugated siRNA (chol-siRNA) targeting coagulation factor VII (F7) results in efficient F7 knockdown in mice and nonhuman primates without changes in clinical chemistry or induction of cytokines.
- chol-siRNA liver-tropic cholesterol-conjugated siRNA
- F7 coagulation factor VII
- Intraveinous coinjections for example, of about 6 mg/kg of NAG-MLP and 6 mg/kg of HBV specific CRISPR Cas may be envisioned for the present invention.
- about 3 mg/kg of NAG-MLP and 3 mg/kg of HBV specific CRISPR Cas may be delivered on day one, followed by administration of about 2-3 mg/kg of NAG-MLP and 2-3 mg/kg of HBV specific CRISPR Cas two weeks later.
- the present invention may also be applied to treat hepatitis C virus (HCV).
- HCV hepatitis C virus
- the methods of Roelvinki et al. may be applied to the CRISPR Cas system.
- an AAV vector such as AAV8 may be a contemplated vector and for example a dosage of about 1.25 ⁇ 10 11 to 1.25 ⁇ 10 13 vector genomes per kilogram body weight (vg/kg) may be contemplated.
- RNA interference offers therapeutic potential for this disorder by reducing the expression of HTT, the disease-causing gene of Huntington's disease (see, e.g., McBride et al., Molecular Therapy vol. 19 no. 12 Dec. 2011, pp. 2152-2162), therefore Applicant postulates that it may be used/and or adapted to the CRISPR-Cas system.
- the CRISPR-Cas system may be generated using an algorithm to reduce the off-targeting potential of antisense sequences.
- the CRISPR-Cas sequences may target either a sequence in exon 52 of mouse, rhesus or human huntingtin and expressed in a viral vector, such as AAV.
- Animals, including humans, may be injected with about three microinjections per hemisphere (six injections total): the first 1 mm rostral to the anterior commissure (12 ⁇ l) and the two remaining injections (12 ⁇ l and 10 ⁇ l, respectively) spaced 3 and 6 mm caudal to the first injection with 1e12 vg/ml of AAV at a rate of about 1 ⁇ l/minute, and the needle was left in place for an additional 5 minutes to allow the injectate to diffuse from the needle tip.
- DiFiglia et al. (PNAS, Oct. 23, 2007, vol. 104, no. 43, 17204-17209) observed that single administration into the adult striatum of an siRNA targeting Htt can silence mutant Htt, attenuate neuronal pathology, and delay the abnormal behavioral phenotype observed in a rapid-onset, viral transgenic mouse model of HD.
- a similar dosage of CRISPR Cas targeted to Htt may be contemplated for humans in the present invention, for example, about 5-10 ml of 10 ⁇ M CRISPR Cas targeted to Htt may be injected intrastriatally.
- Boudreau et al. (Molecular Therapy vol. 17 no. 6 june 2009) injects 5 ⁇ l of recombinant AAV serotype 2/1 vectors expressing htt-specific RNAi virus (at 4 ⁇ 10 12 viral genomes/ml) into the straiatum.
- a similar dosage of CRISPR Cas targeted to Htt may be contemplated for humans in the present invention, for example, about 10-20 ml of 4 ⁇ 10 12 viral genomes/ml) CRISPR Cas targeted to Htt may be injected intrastriatally.
- a CRISPR Cas targetd to HTT may be administered continuously (see, e.g., Yu et at., Cell 150, 895-908, Aug. 31, 2012). Yu et al. utilizes osmotic pumps delivering 0.25 ml/hr (Model 2004) to deliver 300 mg/day of ss-siRNA or phosphate-buffered saline (PBS) (Sigma Aldrich) for 28 days, and pumps designed to deliver 0.5 ⁇ l/hr (Model 2002) were used to deliver 75 mg/day of the positive control MOE ASO for 14 days.
- osmotic pumps delivering 0.25 ml/hr (Model 2004) to deliver 300 mg/day of ss-siRNA or phosphate-buffered saline (PBS) (Sigma Aldrich) for 28 days, and pumps designed to deliver 0.5 ⁇ l/hr (Model 2002) were used to deliver 75 mg/day of the positive control MOE ASO for 14 days.
- CRISPR Cas targeted to Htt were filled with ss-siRNA or MOE diluted in sterile PBS and then incubated at 37 C for 24 or 48 (Model 2004) hours prior to implantation. Mice were anesthetized with 2.5% isofluorane, and a midline incision was made at the base of the skull. Using stereotaxic guides, a cannula was implanted into the right lateral ventricle and secured with Loctite adhesive. A catheter attached to an Alzet osmotic mini pump was attached to the cannula, and the pump was placed subcutaneously in the midscapular area. The incision was closed with 5.0 nylon sutures. A similar dosage of CRISPR Cas targeted to Htt may be contemplated for humans in the present invention, for example, about 500 to 1000 g/day CRISPR Cas targeted to Htt may be administered.
- Stiles et al. In another example of continuous infusion, Stiles et al. (Experimental Neurology 233 (2012) 463-471) implanted an intraparenchymal catheter with a titanium needle tip into the right putamen. The catheter was connected to a SynchroMed® II Pump (Medtronic Neurological, Minneapolis, Minn.) subcutaneously implanted in the abdomen. After a 7 day infusion of phosphate buffered saline at 6 ⁇ L/day, pumps were re-filled with test article and programmed for continuous delivery for 7 days. About 2.3 to 11.52 mg/d of siRNA were infused at varying infusion rates of about 0.1 to 0.5 ⁇ L/min. A similar dosage of CRISPR Cas targeted to Htt may be contemplated for humans in the present invention, for example, about 20 to 200 mg/day CRISPR Cas targeted to Htt may be administered.
- US Patent Publication No. 20130253040 assigned to Sangamo may also be also be adapted from TALES to the CRISPR Cas system of the present invention for treating Huntington's Disease.
- the invention uses nucleic acids to bind target DNA sequences. This is advantageous as nucleic acids are much easier and cheaper to produce than proteins, and the specificity can be varied according to the length of the stretch where homology is sought. Complex 3-D positioning of multiple fingers, for example is not required.
- polynucleotide refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
- Polynucleotides may have any three dimensional structure, and may perform any function, known or unknown.
- polynucleotides coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, short interfering RNA (siRNA), short-hairpin RNA (shRNA), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
- loci locus defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, short interfering RNA (siRNA), short-hairpin RNA (shRNA), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branched poly
- a polynucleotide may comprise one or more modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- wild type is a term of the art understood by skilled persons and means the typical form of an organism, strain, gene or characteristic as it occurs in nature as distinguished from mutant or variant forms.
- variable should be taken to mean the exhibition of qualities that have a pattern that deviates from what occurs in nature.
- nucleic acid molecules or polypeptides mean that the nucleic acid molecule or the polypeptide is at least substantially free from at least one other component with which they are naturally associated in nature and as found in nature.
- “Complementarity” refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick base pairing or other non-traditional types.
- a percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%. 60%, 70%, 80%, 90%, and 100% complementary).
- Perfectly complementary means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence.
- “Substantially complementary” as used herein refers to a degree of complementarity that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more nucleotides, or refers to two nucleic acids that hybridize under stringent conditions.
- stringent conditions for hybridization refer to conditions under which a nucleic acid having complementarity to a target sequence predominantly hybridizes with the target sequence, and substantially does not hybridize to non-target sequences. Stringent conditions are generally sequence-dependent, and vary depending on a number of factors. In general, the longer the sequence, the higher the temperature at which the sequence specifically hybridizes to its target sequence. Non-limiting examples of stringent conditions are described in detail in Tijssen (1993), Laboratory Techniques In Biochemistry And Molecular Biology-Hybridization With Nucleic Acid Probes Part I, Second Chapter “Overview of principles of hybridization and the strategy of nucleic acid probe assay”, Elsevier, N.Y.
- complementary or partially complementary sequences are also envisaged. These are preferably capable of hybridising to the reference sequence under highly stringent conditions.
- relatively low-stringency hybridization conditions are selected: about 20 to 25° C. lower than the thermal melting point (T m ).
- T m is the temperature at which 50% of specific target sequence hybridizes to a perfectly complementary probe in solution at a defined ionic strength and pH.
- highly stringent washing conditions are selected to be about 5 to 15° C. lower than the T m .
- moderately-stringent washing conditions are selected to be about 15 to 30° C. lower than the T m .
- Highly permissive (very low stringency) washing conditions may be as low as 50° C. below the T m , allowing a high level of mis-matching between hybridized sequences.
- Other physical and chemical parameters in the hybridization and wash stages can also be altered to affect the outcome of a detectable hybridization signal from a specific level of homology between target and probe sequences.
- Preferred highly stringent conditions comprise incubation in 50% formamide, 5 ⁇ SSC, and 1% SDS at 42° C., or incubation in 5 ⁇ SSC and 1% SDS at 65° C., with wash in 0.2 ⁇ SSC and 0.1% SDS at 65° C.
- Hybridization refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues.
- the hydrogen bonding may occur by Watson Crick base pairing, Hoogstein binding, or in any other sequence specific manner.
- the complex may comprise two strands forming a duplex structure, three or more strands forming a multi stranded complex, a single self-hybridizing strand, or any combination of these.
- a hybridization reaction may constitute a step in a more extensive process, such as the initiation of PCR, or the cleavage of a polynucleotide by an enzyme.
- a sequence capable of hybridizing with a given sequence is referred to as the “complement” of the given sequence.
- genomic locus or “locus” (plural loci) is the specific location of a gene or DNA sequence on a chromosome.
- a “gene” refers to stretches of DNA or RNA that encode a polypeptide or an RNA chain that has functional role to play in an organism and hence is the molecular unit of heredity in living organisms.
- genes include regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences.
- a gene includes, but is not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites and locus control regions.
- expression of a genomic locus is the process by which information from a gene is used in the synthesis of a functional gene product.
- the products of gene expression are often proteins, but in non-protein coding genes such as rRNA genes or tRNA genes, the product is functional RNA.
- the process of gene expression is used by all known life—eukaryotes (including multicellular organisms), prokaryotes (bacteria and archaea) and viruses to generate functional products to survive.
- expression of a gene or nucleic acid encompasses not only cellular gene expression, but also the transcription and translation of nucleic acid(s) in cloning systems and in any other context. As used herein.
- expression also refers to the process by which a polynucleotide is transcribed from a DNA template (such as into and mRNA or other RNA transcript) and/or the process by which a transcribed mRNA is subsequently translated into peptides, polypeptides, or proteins. Transcripts and encoded polypeptides may be collectively referred to as “gene product.” If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell.
- polypeptide refers to polymers of amino acids of any length.
- the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non amino acids.
- the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
- amino acid includes natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics.
- domain refers to a part of a protein sequence that may exist and function independently of the rest of the protein chain.
- sequence identity is related to sequence homology. Homology comparisons may be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs may calculate percent (%) homology between two or more sequences and may also calculate the sequence identity shared by two or more amino acid or nucleic acid sequences.
- the capping region of the dTALEs described herein have sequences that are at least 95% identical or share identity to the capping region amino acid sequences provided herein.
- Sequence homologies may be generated by any of a number of computer programs known in the art, for example BLAST or FASTA, etc.
- a suitable computer program for carrying out such an alignment is the GCG Wisconsin Bestfit package (University of Wisconsin, U.S.A; Devereux et al., 1984, Nucleic Acids Research 12:387).
- Examples of other software than may perform sequence comparisons include, but are not limited to, the BLAST package (see Ausubel et al., 1999 ibid—Chapter 18), FASTA (Atschul et al., 1990, J. Mol. Biol., 403-410) and the GENEWORKS suite of comparison tools. Both BLAST and FASTA are available for offline and online searching (see Ausubel et al., 1999 ibid, pages 7-58 to 7-60). However it is preferred to use the GCG Bestfit program.
- Percentage (%) sequence homology may be calculated over contiguous sequences, i.e., one sequence is aligned with the other sequence and each amino acid or nucleotide in one sequence is directly compared with the corresponding amino acid or nucleotide in the other sequence, one residue at a time. This is called an “ungapped” alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues.
- gaps penalties assign “gap penalties” to each gap that occurs in the alignment so that, for the same number of identical amino acids, a sequence alignment with as few gaps as possible—reflecting higher relatedness between the two compared sequences—may achieve a higher score than one with many gaps.
- “Affinity gap costs” are typically used that charge a relatively high cost for the existence of a gap and a smaller penalty for each subsequent residue in the gap. This is the most commonly used gap scoring system. High gap penalties may, of course, produce optimized alignments with fewer gaps. Most alignment programs allow the gap penalties to be modified. However, it is preferred to use the default values when using such software for sequence comparisons. For example, when using the GCG Wisconsin Bestfit package the default gap penalty for amino acid sequences is ⁇ 12 for a gap and ⁇ 4 for each extension.
- Calculation of maximum % homology therefore first requires the production of an optimal alignment, taking into consideration gap penalties.
- a suitable computer program for carrying out such an alignment is the GCG Wisconsin Bestfit package (Devereux et al., 1984 Nuc. Acids Research 12 p387).
- Examples of other software than may perform sequence comparisons include, but are not limited to, the BLAST package (see Ausubel et al., 1999 Short Protocols in Molecular Biology. 4 th Ed.—Chapter 18), FASTA (Altschul et al., 1990 J. Mol. Biol. 403-410) and the GENEWORKS suite of comparison tools.
- BLAST and FASTA are available for offline and online searching (see Ausubel et al., 1999 , Short Protocols in Molecular Biology , pages 7-58 to 7-60). However, for some applications, it is preferred to use the GCG Bestfit program.
- a new tool, called BLAST 2 Sequences is also available for comparing protein and nucleotide sequences (see FEMS Microbiol Lett. 1999 174(2): 247-50 ; FEMS Microbiol Lett. 1999 177(1): 187-8 and the website of the National Center for Biotechnology information at the website of the National Institutes for Health).
- a scaled similarity score matrix is generally used that assigns scores to each pair-wise comparison based on chemical similarity or evolutionary distance.
- An example of such a matrix commonly used is the BLOSUM62 matrix—the default matrix for the BLAST suite of programs.
- GCG Wisconsin programs generally use either the public default values or a custom symbol comparison table, if supplied (see user manual for further details). For some applications, it is preferred to use the public default values for the GCG package, or in the case of other software, the default matrix, such as BLOSUM62.
- percentage homologies may be calculated using the multiple alignment feature in DNASISTM (Hitachi Software), based on an algorithm, analogous to CLUSTAL (Higgins D G & Sharp P M (1988), Gene 73(1), 237-244).
- DNASISTM Hagachi Software
- CLUSTAL Higgins D G & Sharp P M (1988), Gene 73(1), 237-244
- sequences may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent substance.
- Deliberate amino acid substitutions may be made on the basis of similarity in amino acid properties (such as polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues) and it is therefore useful to group amino acids together in functional groups.
- Amino acids may be grouped together based on the properties of their side chains alone. However, it is more useful to include mutation data as well.
- the sets of amino acids thus derived are likely to be conserved for structural reasons. These sets may be described in the form of a Venn diagram (Livingstone C. D. and Barton G. J.
- Embodiments of the invention include sequences (both polynucleotide or polypeptide) which may comprise homologous substitution (substitution and replacement are both used herein to mean the interchange of an existing amino acid residue or nucleotide, with an alternative residue or nucleotide) that may occur i.e., like-for-like substitution in the case of amino acids such as basic for basic, acidic for acidic, polar for polar, etc.
- Non-homologous substitution may also occur i.e., from one class of residue to another or alternatively involving the inclusion of unnatural amino acids such as ornithine (hereinafter referred to as Z), diaminobutyric acid ornithine (hereinafter referred to as B), norleucine ornithine (hereinafter referred to as O), pyriylalanine, thienylalanine, naphthylalanine and phenylglycine.
- Z ornithine
- B diaminobutyric acid ornithine
- O norleucine ornithine
- pyriylalanine pyriylalanine
- thienylalanine thienylalanine
- naphthylalanine phenylglycine
- Variant amino acid sequences may include suitable spacer groups that may be inserted between any two amino acid residues of the sequence including alkyl groups such as methyl, ethyl or propyl groups in addition to amino acid spacers such as glycine or ⁇ -alanine residues.
- alkyl groups such as methyl, ethyl or propyl groups
- amino acid spacers such as glycine or ⁇ -alanine residues.
- a further form of variation which involves the presence of one or more amino acid residues in peptoid form, may be well understood by those skilled in the art.
- the peptoid form is used to refer to variant amino acid residues wherein the ⁇ -carbon substituent group is on the residue's nitrogen atom rather than the ⁇ -carbon.
- the invention provides for vectors that are used in the engineering and optimization of CRISPR-Cas systems.
- a “vector” is a tool that allows or facilitates the transfer of an entity from one environment to another. It is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment.
- a vector is capable of replication when associated with the proper control elements.
- the term “vector” refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partially double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g.
- vectors refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques.
- viral vector wherein virally-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g. retroviruses, replication defective retroviruses, adenoviruses, replication defective adenoviruses, and adeno-associated viruses (AAVs)).
- viruses e.g. retroviruses, replication defective retroviruses, adenoviruses, replication defective adenoviruses, and adeno-associated viruses (AAVs).
- Viral vectors also include polynucleotides carried by a virus for transfection into a host cell.
- vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as “expression vectors.” Common expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- Recombinant expression vectors can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory elements, which may be selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed.
- “operably linked” is intended to mean that the nucleotide sequence of interest is linked to the regulatory element(s) in a manner that allows for expression of the nucleotide sequence (e.g. in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).
- aspects of the invention relate to bicistronic vectors for chimeric RNA and Cas9.
- Bicistronic expression vectors for chimeric RNA and Cas9 are preferred.
- Cas9 is preferably driven by the CBh promoter.
- the chimeric RNA may preferably be driven by a U6 promoter. Ideally the two are combined.
- the chimeric guide RNA typically consists of a 20 bp guide sequence (Ns) and this may be joined to the tracr sequence (running from the first “U” of the lower strand to the end of the transcript). The tracr sequence may be truncated at various positions as indicated.
- the guide and tracr sequences are separated by the tracr-mate sequence, which may be GUUUUAGAGCUA (SEQ ID NO: 61). This may be followed by the loop sequence GAAA as shown. Both of these are preferred examples.
- Applicants have demonstrated Cas9-mediated indels at the human EMX1 and PVALB loci by SURVEYOR assays. ChiRNAs are indicated by their “+n” designation, and crRNA refers to a hybrid RNA where guide and tracr sequences are expressed as separate transcripts. Throughout this application, chimeric RNA may also be called single guide, or synthetic guide RNA (sgRNA).
- the loop is preferably GAAA, but it is not limited to this sequence or indeed to being only 4 bp in length.
- preferred loop forming sequences for use in hairpin structures are four nucleotides in length, and most preferably have the sequence GAAA. However, longer or shorter loop sequences may be used, as may alternative sequences.
- the sequences preferably include a nucleotide triplet (for example, AAA), and an additional nucleotide (for example C or G). Examples of loop forming sequences include CAAA and AAAG.
- regulatory element is intended to include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences).
- promoters e.g. promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences).
- IRES internal ribosomal entry sites
- regulatory elements e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences.
- Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences).
- a tissue-specific promoter may direct expression primarily in a desired tissue of interest, such as muscle, neuron, bone, skin, blood, specific organs (e.g. liver, pancreas), or particular cell types (e.g. lymphocytes). Regulatory elements may also direct expression in a temporal-dependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific.
- a vector comprises one or more pol III promoter (e.g. 1, 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g. 1, 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g.
- pol III promoters include, but are not limited to, U6 and H1 promoters.
- pol II promoters include, but are not limited to, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) [see, e.g., Boshart et al, Cell, 41:521-530 (1985)], the SV40 promoter, the dihydrofolate reductase promoter, the ⁇ -actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EF1 ⁇ promoter.
- RSV Rous sarcoma virus
- CMV cytomegalovirus
- PGK phosphoglycerol kinase
- enhancer elements such as WPRE; CMV enhancers; the R-U5′ segment in LTR of HTLV-I (Mol. Cell. Biol., Vol. 8(1), p. 466-472, 1988); SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit ⁇ -globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31, 1981).
- WPRE WPRE
- CMV enhancers the R-U5′ segment in LTR of HTLV-I
- SV40 enhancer SV40 enhancer
- the intron sequence between exons 2 and 3 of rabbit ⁇ -globin Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31, 1981.
- a vector can be introduced into host cells to thereby produce transcripts, proteins, or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., clustered regularly interspersed short palindromic repeats (CRISPR) transcripts, proteins, enzymes, mutant forms thereof, fusion proteins thereof, etc.).
- CRISPR clustered regularly interspersed short palindromic repeats
- CRISPR transcripts e.g. nucleic acid transcripts, proteins, or enzymes
- CRISPR transcripts can be expressed in bacterial cells such as Escherichia coli , insect cells (using baculovirus expression vectors), yeast cells, or mammalian cells. Suitable host cells are discussed further in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990).
- the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
- Vectors may be introduced and propagated in a prokaryote or prokaryotic cell.
- a prokaryote is used to amplify copies of a vector to be introduced into a eukaryotic cell or as an intermediate vector in the production of a vector to be introduced into a eukaryotic cell (e.g. amplifying a plasmid as part of a viral vector packaging system).
- a prokaryote is used to amplify copies of a vector and express one or more nucleic acids, such as to provide a source of one or more proteins for delivery to a host cell or host organism.
- Fusion vectors add a number of amino acids to a protein encoded therein, such as to the amino terminus of the recombinant protein.
- Such fusion vectors may serve one or more purposes, such as: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification.
- a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein.
- enzymes, and their cognate recognition sequences include Factor Xa, thrombin and enterokinase.
- Example fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988. Gene 67: 31-40), pMAL (New England Biolabs, Beverly, Mass.) and pRIT5 (Pharmacia. Piscataway, N.J.) that fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein.
- E. coli expression vectors examples include pTrc (Amrann et al., (1988) Gene 69:301-315) and pET 11d (Studier et al., GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press. San Diego, Calif. (1990) 60-89).
- a vector is a yeast expression vector.
- yeast Saccharomyces cerivisae examples include pYepSec1 (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kuijan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al., 1987. Gene 54: 113-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.).
- a vector drives protein expression in insect cells using baculovirus expression vectors.
- Baculovirus vectors available for expression of proteins in cultured insect cells include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
- a vector is capable of driving expression of one or more sequences in mammalian cells using a mammalian expression vector.
- mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J. 6: 187-195).
- the expression vector's control functions are typically provided by one or more regulatory elements.
- commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, simian virus 40, and others disclosed herein and known in the art.
- the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid).
- tissue-specific regulatory elements are known in the art.
- suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al., 1987 . Genes Dev. 1: 268-277), lymphoid-specific promoters (Calame and Eaton, 1988 . Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989 . EMBO J.
- a regulatory element is operably linked to one or more elements of a CRISPR system so as to drive expression of the one or more elements of the CRISPR system.
- CRISPRs Clustered Regularly Interspaced Short Palindromic Repeats
- SPIDRs Sacer Interspersed Direct Repeats
- the CRISPR locus comprises a distinct class of interspersed short sequence repeats (SSRs) that were recognized in E. coli (Ishino et al., J. Bacteriol., 169:5429-5433 [1987]; and Nakata et al., J.
- the CRISPR loci typically differ from other SSRs by the structure of the repeats, which have been termed short regularly spaced repeats (SRSRs) (Janssen et al., OMICS J. Integ. Biol., 6:23-33 [2002]; and Mojica et al., Mol. Microbiol., 36:244-246 [2000]).
- SRSRs short regularly spaced repeats
- the repeats are short elements that occur in clusters that are regularly spaced by unique intervening sequences with a substantially constant length (Mojica et al., [2000], supra).
- the repeat sequences are highly conserved between strains, the number of interspersed repeats and the sequences of the spacer regions typically differ from strain to strain (van Embden et al., J.
- CRISPR loci have been identified in more than 40 prokaryotes (See e.g., Jansen et al., Mol. Microbiol., 43:1565-1575 [2002]; and Mojica et al., [2005]) including, but not limited to Aeropyrum, Pyrobaculum, Sulfolobus, Archaeoglobus, Halocarcula, Methanobacterium, Methanococcus, Methanosarcina, Methanopyrus, Pyrococcus, Picrophilus, Thermoplasma, Corynebacterium, Mycobacterium, Streptomyces, Aquifex, Porphyromonas, Chlorobium, Thermus, Bacillus, Listeria, Staphylococcus, Clostridium, Thermoanacrobacter, Mycoplasma, Fusobacterium, Azarcus, Chromobacterium, Neisseria, Nitrosomona
- CRISPR system refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated (“Cas”) genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g. tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a “direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a “spacer” in the context of an endogenous CRISPR system), or other sequences and transcripts from a CRISPR locus.
- a tracr trans-activating CRISPR
- tracr-mate sequence encompassing a “direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system
- guide sequence also referred to as a “spacer” in the context of an endogenous CRISPR system
- one or more elements of a CRISPR system is derived from a type I, type II, or type III CRISPR system.
- one or more elements of a CRISPR system is derived from a particular organism comprising an endogenous CRISPR system, such as Streptococcus pyogenes .
- a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR system).
- target sequence refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence and a guide sequence promotes the formation of a CRISPR complex.
- a target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides.
- a target sequence is located in the nucleus or cytoplasm of a cell.
- direct repeats may be identified in silico by searching for repetitive motifs that fulfill any or all of the following criteria:
- 2 of these criteria may be used, for instance 1 and 2, 2 and 3, or 1 and 3. In some embodiments, all 3 criteria may be used.
- candidate tracrRNA may be subsequently predicted by sequences that fulfill any or all of the following criteria:
- 2 of these criteria may be used, for instance 1 and 2, 2 and 3, or 1 and 3. In some embodiments, all 3 criteria may be used.
- chimeric synthetic guide RNAs may incorporate at least 12 bp of duplex structure between the direct repeat and tracrRNA.
- the CRISPR system is a type II CRISPR system and the Cas enzyme is Cas9, which catalyzes DNA cleavage.
- the Cas enzyme is Cas9, which catalyzes DNA cleavage.
- Enzymatic action by Cas9 derived from Streptococcus pyogenes or any closely related Cas9 generates double stranded breaks at target site sequences which hybridize to 20 nucleotides of the guide sequence and that have a protospacer-adjacent motif (PAM) sequence (examples include NGG/NRG or a PAM that can be determined as described herein) following the 20 nucleotides of the target sequence.
- PAM protospacer-adjacent motif
- CRISPR activity through Cas9 for site-specific DNA recognition and cleavage is defined by the guide sequence, the tracr sequence that hybridizes in part to the guide sequence and the PAM sequence. More aspects of the CRISPR system are described in Karginov and Hannon, The CRISPR system: small RNA-guided defence in bacteria and archaea, Mole Cell 2010, January 15; 37(1): 7.
- the type II CRISPR locus from Streptococcus pyogenes SF370 which contains a cluster of four genes Cas9, Cas1, Cas2, and Csn1, as well as two non-coding RNA elements, tracrRNA and a characteristic array of repetitive sequences (direct repeats) interspaced by short stretches of non-repetitive sequences (spacers, about 30 bp each).
- DSB targeted DNA double-strand break
- tracrRNA hybridizes to the direct repeats of pre-crRNA, which is then processed into mature crRNAs containing individual spacer sequences.
- the mature crRNA:tracrRNA complex directs Cas9 to the DNA target consisting of the protospacer and the corresponding PAM via heteroduplex formation between the spacer region of the crRNA and the protospacer DNA.
- Cas9 mediates cleavage of target DNA upstream of PAM to create a DSB within the protospacer ( FIG. 2A ).
- FIG. 2B demonstrates the nuclear localization of the codon optimized Cas9.
- the RNA polymerase III-based U6 promoter was selected to drive the expression of tracrRNA ( FIG. 2C ).
- a U6 promoter-based construct was developed to express a pre-crRNA array consisting of a single spacer flanked by two direct repeats (DRs, also encompassed by the term “tracr-mate sequences”; FIG. 2C ).
- the initial spacer was designed to target a 33-base-pair (bp) target site (30-bp protospacer plus a 3-bp CRISPR motif (PAM) sequence satisfying the NGG recognition motif of Cas9) in the human EMX1 locus ( FIG. 2C ), a key gene in the development of the cerebral cortex.
- bp 33-base-pair
- PAM 3-bp CRISPR motif
- a CRISPR complex comprising a guide sequence hybridized to a target sequence and complexed with one or more Cas proteins
- formation of a CRISPR complex results in cleavage of one or both strands in or near (e.g. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or more base pairs from) the target sequence.
- the tracr sequence which may comprise or consist of all or a portion of a wild-type tracr sequence (e.g.
- one or more vectors driving expression of one or more elements of a CRISPR system are introduced into a host cell such that expression of the elements of the CRISPR system direct formation of a CRISPR complex at one or more target sites.
- a Cas enzyme, a guide sequence linked to a tracr-mate sequence, and a tracr sequence could each be operably linked to separate regulatory elements on separate vectors.
- two or more of the elements expressed from the same or different regulatory elements may be combined in a single vector, with one or more additional vectors providing any components of the CRISPR system not included in the first vector.
- CRISPR system elements that are combined in a single vector may be arranged in any suitable orientation, such as one element located 5′ with respect to (“upstream” of) or 3′ with respect to (“downstream” of) a second element.
- the coding sequence of one element may be located on the same or opposite strand of the coding sequence of a second element, and oriented in the same or opposite direction.
- a single promoter drives expression of a transcript encoding a CRISPR enzyme and one or more of the guide sequence, tracr mate sequence (optionally operably linked to the guide sequence), and a tracr sequence embedded within one or more intron sequences (e.g. each in a different intron, two or more in at least one intron, or all in a single intron).
- the CRISPR enzyme, guide sequence, tracr mate sequence, and tracr sequence are operably linked to and expressed from the same promoter.
- a vector comprises one or more insertion sites, such as a restriction endonuclease recognition sequence (also referred to as a “cloning site”).
- one or more insertion sites e.g. about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more insertion sites are located upstream and/or downstream of one or more sequence elements of one or more vectors.
- a vector comprises an insertion site upstream of a tracr mate sequence, and optionally downstream of a regulatory element operably linked to the tracr mate sequence, such that following insertion of a guide sequence into the insertion site and upon expression the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotic cell.
- a vector comprises two or more insertion sites, each insertion site being located between two tracr mate sequences so as to allow insertion of a guide sequence at each site.
- the two or more guide sequences may comprise two or more copies of a single guide sequence, two or more different guide sequences, or combinations of these.
- a single expression construct may be used to target CRISPR activity to multiple different, corresponding target sequences within a cell.
- a single vector may comprise about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or more guide sequences. In some embodiments, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more such guide-sequence-containing vectors may be provided, and optionally delivered to a cell.
- a vector comprises a regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, such as a Cas protein.
- Cas proteins include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5.
- Cas6, Cas7, Cas8, Cas9 also known as Csn1 and Csx12
- Cas10 Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx15, Csf1, Csf2, Csf3, Csf4, homologues thereof, or modified versions thereof.
- the unmodified CRISPR enzyme has DNA cleavage activity, such as Cas9.
- the CRISPR enzyme directs cleavage of one or both strands at the location of a target sequence, such as within the target sequence and/or within the complement of the target sequence. In some embodiments, the CRISPR enzyme directs cleavage of one or both strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence.
- a vector encodes a CRISPR enzyme that is mutated to with respect to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence.
- an aspartate-to-alanine substitution (D10A) in the RuvC I catalytic domain of Cas9 from S. pyogenes converts Cas9 from a nuclease that cleaves both strands to a nickase (cleaves a single strand).
- D10A aspartate-to-alanine substitution
- pyogenes converts Cas9 from a nuclease that cleaves both strands to a nickase (cleaves a single strand).
- Other examples of mutations that render Cas9a nickase include, without limitation. H840A, N854A, and N863A.
- two or more catalytic domains of Cas9 may be mutated to produce a mutated Cas9 substantially lacking all DNA cleavage activity.
- a D10A mutation is combined with one or more of H840A, N854A, or N863A mutations to produce a Cas9 enzyme substantially lacking all DNA cleavage activity.
- a CRISPR enzyme is considered to substantially lack all DNA cleavage activity when the DNA cleavage activity of the mutated enzyme is less than about 25%, 10%, 5%. 1%, 0.1%, 0.01%, or lower with respect to its non-mutated form.
- mutations may be made at any or all residues corresponding to positions 10, 762, 840, 854, 863 and/or 986 of SpCas9 (which may be ascertained for instance by standard sequence comparison tools.
- any or all of the following mutations are preferred in SpCas9: D10A, E762A, H840A, N854A, N863A and/or D986A; as well as conservative substitution for any of the replacement amino acids is also envisaged.
- the same (or conservative substitutions of these mutations) at corresponding positions in other Cas9s are also preferred.
- Particularly preferred are D10 and H840 in SpCas9.
- residues corresponding to SpCas9 D10 and H840 are also preferred.
- a Cas enzyme may be identified Cas9 as this can refer to the general class of enzymes that share homology to the biggest nuclease with multiple nuclease domains from the type II CRISPR system. Most preferably, the Cas9 enzyme is from, or is derived from, spCas9 or saCas9. By derived, Applicants mean that the derived enzyme is largely based, in the sense of having a high degree of sequence homology with, a wildtype enzyme, but that it has been mutated (modified) in some way as described herein.
- Cas and CRISPR enzyme are generally used herein interchangeably, unless otherwise apparent.
- residue numberings used herein refer to the Cas9 enzyme from the type II CRISPR locus in Streptococcus pyogenes .
- this invention includes many more Cas9s from other species of microbes, such as SpCas9, SaCa9, St1Cas9 and so forth.
- codon optimized sequence in this instance optimized for humans (i.e. being optimized for expression in humans) is provided herein, see the SaCas9 human codon optimized sequence. Whilst this is preferred, it will be appreciated that other examples are possible and codon optimization for a host species is known.
- an enzyme coding sequence encoding a CRISPR enzyme is codon optimized for expression in particular cells, such as eukaryotic cells.
- the eukaryotic cells may be those of or derived from a particular organism, such as a mammal, including but not limited to human, mouse, rat, rabbit, dog, or non-human mammal or primate.
- processes for modifying the germ line genetic identity of human beings and/or processes for modifying the genetic identity of animals which are likely to cause them suffering without any substantial medical benefit to man or animal, and also animals resulting from such processes may be excluded.
- codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g. about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence.
- codon bias differs in codon usage between organisms
- mRNA messenger RNA
- tRNA transfer RNA
- Codon usage tables are readily available, for example, at the “Codon Usage Database” available at www.kazusa.orjp/codon/ (visited Jul. 9, 2002), and these tables can be adapted in a number of ways. See Nakamura, Y., et al. “Codon usage tabulated from the international DNA sequence databases: status for the year 2000” Nucl. Acids Res. 28:292 (2000).
- codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; Jacobus, Pa.), are also available.
- one or more codons e.g. 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more, or all codons
- one or more codons in a sequence encoding a CRISPR enzyme correspond to the most frequently used codon for a particular amino acid.
- a vector encodes a CRISPR enzyme comprising one or more nuclear localization sequences (NLSs), such as about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs.
- the CRISPR enzyme comprises about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the amino-terminus, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the carboxy-terminus, or a combination of these (e.g. one or more NLS at the amino-terminus and one or more NLS at the carboxy terminus).
- the CRISPR enzyme comprises at most 6 NLSs.
- an NLS is considered near the N- or C-terminus when the nearest amino acid of the NLS is within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids along the polypeptide chain from the N- or C-terminus.
- Non-limiting examples of NLSs include an NLS sequence derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKRKV (SEQ ID NO: 62); the NLS from nucleoplasmin (e.g.
- the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK (SEQ ID NO: 63)); the c-myc NLS having the amino acid sequence PAAKRVKLD (SEQ ID NO: 64) or RQRRNELKRSP (SEQ ID NO: 65); the hRNPA1 M9 NLS having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO: 66); the sequence RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 67) of the IBB domain from importin-alpha; the sequences VSRKRPRP (SEQ ID NO: 68) and PPKKARED (SEQ ID NO: 69) of the myoma T protein; the sequence PQPKKKPL (SEQ ID NO: 70) of human p53; the sequence SALIKKKKKMAP (SEQ ID NO: 71) of mouse c-
- the one or more NLSs are of sufficient strength to drive accumulation of the CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic cell.
- strength of nuclear localization activity may derive from the number of NLSs in the CRISPR enzyme, the particular NLS(s) used, or a combination of these factors.
- Detection of accumulation in the nucleus may be performed by any suitable technique.
- a detectable marker may be fused to the CRISPR enzyme, such that location within a cell may be visualized, such as in combination with a means for detecting the location of the nucleus (e.g. a stain specific for the nucleus such as DAPI).
- Cell nuclei may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or enzyme activity assay. Accumulation in the nucleus may also be determined indirectly, such as by an assay for the effect of CRISPR complex formation (e.g. assay for DNA cleavage or mutation at the target sequence, or assay for altered gene expression activity affected by CRISPR complex formation and/or CRISPR enzyme activity), as compared to a control no exposed to the CRISPR enzyme or complex, or exposed to a CRISPR enzyme lacking the one or more NLSs.
- an assay for the effect of CRISPR complex formation e.g. assay for DNA cleavage or mutation at the target sequence, or assay for altered gene expression activity affected by CRISPR complex formation and/or CRISPR enzyme activity
- a guide sequence is any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of a CRISPR complex to the target sequence.
- the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more.
- Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting example of which include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g. the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies; available at www.novocraft.com). ELAND (Illumina, San Diego, Calif.), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net).
- any suitable algorithm for aligning sequences non-limiting example of which include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g. the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies; available at www.novocraft.com). ELAND (
- a guide sequence is about or more than about 5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in length. In some embodiments, a guide sequence is less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in length. The ability of a guide sequence to direct sequence-specific binding of a CRISPR complex to a target sequence may be assessed by any suitable assay.
- the components of a CRISPR system sufficient to form a CRISPR complex may be provided to a host cell having the corresponding target sequence, such as by transfection with vectors encoding the components of the CRISPR sequence, followed by an assessment of preferential cleavage within the target sequence, such as by Surveyor assay as described herein.
- cleavage of a target polynucleotide sequence may be evaluated in a test tube by providing the target sequence, components of a CRISPR complex, including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at the target sequence between the test and control guide sequence reactions.
- Other assays are possible, and will occur to those skilled in the art.
- a guide sequence may be selected to target any target sequence.
- the target sequence is a sequence within a genome of a cell.
- Exemplary target sequences include those that are unique in the target genome.
- a unique target sequence in a genome may include a Cas9 target site of the form MMMMMMMMNNNNNNNNNNNNXGG where NNNNNNNNNNXGG (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome.
- a unique target sequence in a genome may include an S.
- a unique target sequence in a genome may include a Cas9 target site of the form MMMMMMMMNNNNNNNNNNNNXAGAAW (SEQ ID NO: 78) where NNNNNNNNNNXXAGAAW (SEQ ID NO: 79) (N is A, G, T, or C; X can be anything; and W is A or T) has a single occurrence in the genome.
- a unique target sequence in a genome may include an S. thermophilus CRISPR1Cas9 target site of the form MMMMMMMMMNNNNNNNNNNNXXAGAAW (SEQ ID NO: 80) where NNNNNNNNNXXAGAAW (SEQ ID NO: 81) (N is A, G, T, or C; X can be anything; and W is A or T) has a single occurrence in the genome.
- S. thermophilus CRISPR1Cas9 target site of the form MMMMMMMMMNNNNNNNNNNNNNXXAGAAW (SEQ ID NO: 80) where NNNNNNNNNXXAGAAW (SEQ ID NO: 81) (N is A, G, T, or C; X can be anything; and W is A or T) has a single occurrence in the genome.
- S. thermophilus CRISPR1Cas9 target site of the form MMMMMMMMMNNNNNNNNNNNXXAGAAW (SEQ ID NO: 80) where N
- a unique target sequence in a genome may include a Cas9 target site of the form MMMMMMMMNNNNNNNNNNNNNNXGGXG where NNNNNNNNNNXGGXG (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome.
- a unique target sequence in a genome may include an S. pyogenes Cas9 target site of the form MMMMMMMMMNNNNNNNNNNNXGGXG where NNNNNNNNNNNXGGXG (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome.
- M may be A, G, T, or C, and need not be considered in identifying a sequence as unique.
- a guide sequence is selected to reduce the degree secondary structure within the guide sequence. In some embodiments, about or less than about 75%, 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 1%, or fewer of the nucleotides of the guide sequence participate in self-complementary base pairing when optimally folded.
- Optimal folding may be determined by any suitable polynucleotide folding algorithm. Some programs are based on calculating the minimal Gibbs free energy. An example of one such algorithm is mFold, as described by Zuker and Stiegler (Nucleic Acids Res. 9 (1981), 133-148).
- Another example folding algorithm is the online webserver RNAfold, developed at Institute for Theoretical Chemistry at the University of Vienna, using the centroid structure prediction algorithm (see e.g. A. R. Gruber et al., 2008 , Cell 106(1): 23-24; and PA Carr and GM Church, 2009 , Nature Biotechnology 27(12): 1151-62).
- a tracr mate sequence includes any sequence that has sufficient complementarity with a tracr sequence to promote one or more of: (1) excision of a guide sequence flanked by tracr mate sequences in a cell containing the corresponding tracr sequence; and (2) formation of a CRISPR complex at a target sequence, wherein the CRISPR complex comprises the tracr mate sequence hybridized to the tracr sequence.
- degree of complementarity is with reference to the optimal alignment of the tracr mate sequence and tract sequence, along the length of the shorter of the two sequences. Optimal alignment may be determined by any suitable alignment algorithm, and may further account for secondary structures, such as self-complementarity within either the tracr sequence or tracr mate sequence.
- the degree of complementarity between the tracr sequence and tract mate sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher.
- the tracr sequence is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more nucleotides in length.
- the tract sequence and tracr mate sequence are contained within a single transcript, such that hybridization between the two produces a transcript having a secondary structure, such as a hairpin.
- the transcript or transcribed polynucleotide sequence has at least two or more hairpins. In preferred embodiments, the transcript has two, three, four or five hairpins. In a further embodiment of the invention, the transcript has at most five hairpins.
- the portion of the sequence 5′ of the final “N” and upstream of the loop corresponds to the tracr mate sequence
- the portion of the sequence 3′ of the loop corresponds to the tracr sequence
- Further non-limiting examples of single polynucleotides comprising a guide sequence, a tracr mate sequence, and a tracr sequence are as follows (listed 5′ to 3′), where “N” represents a base of a guide sequence, the first block of lower case letters represent the tracr mate sequence, and the second block of lower case letters represent the tracr sequence, and the final poly-T sequence represents the transcription terminator: (1) NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNgttttgtactctcaagatttaGAAAtaaatcttgcagaagctacaaagataa ggcttcatgccgaaatcaacaccctgtcatttatggcagggtgttttcg
- sequences (1) to (3) are used in combination with Cas9 from S. thermophilus CRISPR1.
- sequences (4) to (6) are used in combination with Cas9 from S. pyogenes .
- the tracr sequence is a separate transcript from a transcript comprising the tracr mate sequence.
- a recombination template is also provided.
- a recombination template may be a component of another vector as described herein, contained in a separate vector, or provided as a separate polynucleotide.
- a recombination template is designed to serve as a template in homologous recombination, such as within or near a target sequence nicked or cleaved by a CRISPR enzyme as a part of a CRISPR complex.
- a template polynucleotide may be of any suitable length, such as about or more than about 10, 15, 20, 25, 50, 75, 100, 150, 200, 500, 1000, or more nucleotides in length.
- the template polynucleotide is complementary to a portion of a polynucleotide comprising the target sequence.
- a template polynucleotide might overlap with one or more nucleotides of a target sequences (e.g. about or more than about 1, 5, 10, 15, 20, or more nucleotides).
- the nearest nucleotide of the template polynucleotide is within about 1, 5, 10, 15, 20, 25, 50, 75, 100, 200, 300, 400, 500, 1000, 5000, 10000, or more nucleotides from the target sequence.
- the CRISPR enzyme is part of a fusion protein comprising one or more heterologous protein domains (e.g. about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more domains in addition to the CRISPR enzyme).
- a CRISPR enzyme fusion protein may comprise any additional protein sequence, and optionally a linker sequence between any two domains.
- protein domains that may be fused to a CRISPR enzyme include, without limitation, epitope tags, reporter gene sequences, and protein domains having one or more of the following activities: methylase activity, demethylase activity, transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, RNA cleavage activity and nucleic acid binding activity.
- Non-limiting examples of epitope tags include histidine (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags. VSV-G tags, and thioredoxin (Trx) tags.
- reporter genes include, but are not limited to, glutathione-5-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, beta-glucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and autofluorescent proteins including blue fluorescent protein (BFP).
- GST glutathione-5-transferase
- HRP horseradish peroxidase
- CAT chloramphenicol acetyltransferase
- beta-galactosidase beta-galacto
- a CRISPR enzyme may be fused to a gene sequence encoding a protein or a fragment of a protein that bind DNA molecules or bind other cellular molecules, including but not limited to maltose binding protein (MBP), S-tag, Lex A DNA binding domain (DBD) fusions, GAL4 DNA binding domain fusions, and herpes simplex virus (HSV) BP16 protein fusions. Additional domains that may form part of a fusion protein comprising a CRISPR enzyme are described in US20110059502, incorporated herein by reference. In some embodiments, a tagged CRISPR enzyme is used to identify the location of a target sequence.
- MBP maltose binding protein
- DBD Lex A DNA binding domain
- HSV herpes simplex virus
- a CRISPR enzyme may form a component of an inducible system.
- the inducible nature of the system would allow for spatiotemporal control of gene editing or gene expression using a form of energy.
- the form of energy may include but is not limited to electromagnetic radiation, sound energy, chemical energy and thermal energy.
- inducible system include tetracycline inducible promoters (Tet-On or Tet-Off), small molecule two-hybrid transcription activations systems (FKBP, ABA, etc), or light inducible systems (Phytochrome, LOV domains, or cryptochrome).
- the CRISPR enzyme may be a part of a Light Inducible Transcriptional Effector (LITE) to direct changes in transcriptional activity in a sequence-specific manner.
- the components of a light may include a CRISPR enzyme, a light-responsive cytochrome heterodimer (e.g. from Arabidopsis thaliana ), and a transcriptional activation/repression domain.
- LITE Light Inducible Transcriptional Effector
- the invention provides methods comprising delivering one or more polynucleotides, such as or one or more vectors as described herein, one or more transcripts thereof, and/or one or proteins transcribed therefrom, to a host cell.
- the invention further provides cells produced by such methods, and animals comprising or produced from such cells.
- a CRISPR enzyme in combination with (and optionally complexed with) a guide sequence is delivered to a cell.
- Conventional viral and non-viral based gene transfer methods can be used to introduce nucleic acids in mammalian cells or target tissues. Such methods can be used to administer nucleic acids encoding components of a CRISPR system to cells in culture, or in a host organism.
- Non-viral vector delivery systems include DNA plasmids, RNA (e.g. a transcript of a vector described herein), naked nucleic acid, and nucleic acid complexed with a delivery vehicle, such as a liposome.
- Viral vector delivery systems include DNA and RNA viruses, which have either episomal or integrated genomes after delivery to the cell. For a review of gene therapy procedures, see Anderson, Science 256:808-813 (1992); Nabel & Feigner, TIBTECH 11:211-217 (1993); Mitani & Caskey, TIBTECH 11:162-166 (1993); Dillon.
- Methods of non-viral delivery of nucleic acids include lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA.
- Lipofection is described in e.g., U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., TransfectamTM and LipofectinTM).
- Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Felgner, WO 91/17424; WO 91/16024. Delivery can be to cells (e.g. in vitro or ex vivo administration) or target tissues (e.g. in vivo administration).
- lipid:nucleic acid complexes including targeted liposomes such as immunolipid complexes
- the preparation of lipid:nucleic acid complexes, including targeted liposomes such as immunolipid complexes is well known to one of skill in the art (see, e.g., Crystal, Science 270:404-410 (1995); Blaese et al., Cancer Gene Ther. 2:291-297 (1995); Behr et al., Bioconjugate Chem. 5:382-389 (1994); Remy et al., Bioconjugate Chem. 5:647-654 (1994); Gao et al., Gene Therapy 2:710-722 (1995); Ahmad et al., Cancer Res. 52:4817-4820 (1992); U.S. Pat. Nos. 4,186,183, 4,217,344, 4,235,871, 4,261,975, 4,485,054, 4,501,728, 4,774,085, 4,837,028, and 4,946,787).
- RNA or DNA viral based systems for the delivery of nucleic acids take advantage of highly evolved processes for targeting a virus to specific cells in the body and trafficking the viral payload to the nucleus.
- Viral vectors can be administered directly to patients (in vivo) or they can be used to treat cells in vitro, and the modified cells may optionally be administered to patients (ex vivo).
- Conventional viral based systems could include retroviral, lentivirus, adenoviral, adeno-associated and herpes simplex virus vectors for gene transfer. Integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene. Additionally, high transduction efficiencies have been observed in many different cell types and target tissues.
- Lentiviral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and typically produce high viral titers. Selection of a retroviral gene transfer system would therefore depend on the target tissue. Retroviral vectors are comprised of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LTRs are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cell to provide permanent transgene expression.
- Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immuno deficiency virus (SIV), human immuno deficiency virus (HIV), and combinations thereof (see, e.g., Buchscher et al., J. Virol. 66:2731-2739 (1992); Johann et al., J. Virol. 66:1635-1640 (1992); Sommnerfelt et al., Virol. 176:58-59 (1990); Wilson et al., J. Virol. 63:2374-2378 (1989); Miller et al., J. Virol. 65:2220-2224 (1991); PCT/US94/05700).
- MiLV murine leukemia virus
- GaLV gibbon ape leukemia virus
- SIV Simian Immuno deficiency virus
- HAV human immuno deficiency virus
- Cocal vesiculovirus envelope pseudotyped retroviral vector particles are contemplated (see, e.g., US Patent Publication No. 20120164118 assigned to the Fred Hutchinson Cancer Research Center).
- Cocal virus is in the Vesiculovirus genus, and is a causative agent of vesicular stomatitis in mammals.
- Cocal virus was originally isolated from mites in Trimidad (Jonkers et al., Am. J. Vet. Res. 25:236-242 (1964)), and infections have been identified in Trimidad, Brazil, and Argentina from insects, cattle, and horses. Many of the vesiculoviruses that infect mammals have been isolated from naturally infected arthropods, suggesting that they are vector-borne.
- Antibodies to vesiculoviruses are common among people living in rural areas where the viruses are endemic and laboratory-acquired; infections in humans usually result in influenza-like symptoms.
- the Cocal virus envelope glycoprotein shares 71.5% identity at the amino acid level with VSV-G Indiana, and phylogenetic comparison of the envelope gene of vesiculoviruses shows that Cocal virus is serologically distinct from, but most closely related to, VSV-G Indiana strains among the vesiculoviruses. Jonkers et al., Am. J. Vet. Res. 25:236-242 (1964) and Travassos da Rosa et al., Am. J. Tropical Med. & Hygiene 33:999-1006 (1984).
- the Cocal vesiculovirus envelope pseudotyped retroviral vector particles may include for example, lentiviral, alpharetroviral, betaretroviral, gammaretroviral, deltaretroviral, and epsilonretroviral vector particles that may comprise retroviral Gag, Pol, and/or one or more accessory protein(s) and a Cocal vesiculovirus envelope protein.
- the Gag, Pol, and accessory proteins are lentiviral and/or gammaretroviral.
- adenoviral based systems may be used.
- Adenoviral based vectors are capable of very high transduction efficiency in many cell types and do not require cell division. With such vectors, high titer and levels of expression have been obtained. This vector can be produced in large quantities in a relatively simple system.
- Adeno-associated virus (“AAV”) vectors may also be used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and for in vivo and ex vivo gene therapy procedures (see, e.g., West et al., Virology 160:38-47 (1987); U.S. Pat. No. 4,797,368; WO 93/24641; Kotin, Human Gene Therapy 5:793-801 (1994); Muzyczka, J. Clin. Invest. 94:1351 (1994). Construction of recombinant AAV vectors are described in a number of publications, including U.S. Pat. No.
- Packaging cells are typically used to form virus particles that are capable of infecting a host cell. Such cells include 293 cells, which package adenovirus, and ⁇ 2 cells or PA317 cells, which package retrovirus.
- Viral vectors used in gene therapy are usually generated by producer a cell line that packages a nucleic acid vector into a viral particle. The vectors typically contain the minimal viral sequences required for packaging and subsequent integration into a host, other viral sequences being replaced by an expression cassette for the polynucleotide(s) to be expressed. The missing viral functions are typically supplied in trans by the packaging cell line. For example, AAV vectors used in gene therapy typically only possess ITR sequences from the AAV genome which are required for packaging and integration into the host genome.
- Viral DNA is packaged in a cell line, which contains a helper plasmid encoding the other AAV genes, namely rep and cap, but lacking ITR sequences.
- the cell line may also infected with adenovirus as a helper.
- the helper virus promotes replication of the AAV vector and expression of AAV genes from the helper plasmid.
- the helper plasmid is not packaged in significant amounts due to a lack of ITR sequences. Contamination with adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV.
- AAV is considered an ideal candidate for use as a transducing vector.
- Such AAV transducing vectors can comprise sufficient cis-acting functions to replicate in the presence of adenovirus or herpesvirus or poxvirus (e.g., vaccinia virus) helper functions provided in trans.
- Recombinant AAV rAAV
- rAAV Recombinant AAV
- these vectors the AAV cap and/or rep genes are deleted from the viral genome and replaced with a DNA segment of choice.
- Current AAV vectors may accommodate up to 4300 bases of inserted DNA.
- rAAV there are a number of ways to produce rAAV, and the invention provides rAAV and methods for preparing rAAV.
- plasmid(s) containing or consisting essentially of the desired viral construct are transfected into AAV-infected cells.
- a second or additional helper plasmid is cotransfected into these cells to provide the AAV rep and/or cap genes which are obligatory for replication and packaging of the recombinant viral construct. Under these conditions, the rep and/or cap proteins of AAV act in trans to stimulate replication and packaging of the rAAV construct.
- Two to Three days after transfection rAAV is harvested. Traditionally rAAV is harvested from the cells along with adenovirus.
- rAAV is advantageously harvested not from the cells themselves, but from cell supernatant.
- rAAV can be prepared by a method that comprises or consists essentially of: infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, and helper virus (e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus) wherein the rAAV lacks functioning cap and/or rep (and the helper virus (e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus) provides the cap and/or rev function that the rAAV lacks); or infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, wherein the recombinant lacks functioning cap and/or rep, and
- helper virus e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus
- the rAAV can be from an AAV as herein described, and advantageously can be an rAAV1, rAAV2, AAV5 or rAAV having hybrid or capsid which may comprise AAV1, AAV2, AAV5 or any combination thereof.
- the invention provides rAAV that contains or consists essentially of an exogenous nucleic acid molecule encoding a CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) system, e.g., a plurality of cassettes comprising or consisting a first cassette comprising or consisting essentially of a promoter, a nucleic acid molecule encoding a CRISPR-associated (Cas) protein (putative nuclease or helicase proteins), e.g., Cas9 and a terminator, and a two, or more, advantageously up to the packaging size limit of the vector, e.g., in total (including the first cassette) five, cassettes comprising or consisting essentially of a promoter, nucleic acid molecule encoding guide RNA (gRNA) and a terminator (e.g., each cassette schematically represented as Promoter-gRNA 1-terminator, Promoter-gRNA2-terminator .
- CRISPR Clustered Regularly Inter
- Promoter-gRNA(N)-terminator (where N is a number that can be inserted that is at an upper limit of the packaging size limit of the vector), or two or more individual rAAVs, each containing one or more than one cassette of a CRISPR system, e.g., a first rAAV containing the first cassette comprising or consisting essentially of a promoter, a nucleic acid molecule encoding Cas, e.g., Cas9 and a terminator, and a second rAAV containing a plurality, four, cassettes comprising or consisting essentially of a promoter, nucleic acid molecule encoding guide RNA (gRNA) and a terminator (e.g., each cassette schematically represented as Promoter-gRNA1-terminator, Promoter-gRNA2-terminator .
- gRNA nucleic acid molecule encoding guide RNA
- N is a number that can be inserted that is at an upper limit of the packaging size limit of the vector.
- N is a number that can be inserted that is at an upper limit of the packaging size limit of the vector.
- the promoter is in some embodiments advantageously human Synapsin I promoter (hSyn).
- a host cell is transiently or non-transiently transfected with one or more vectors described herein.
- a cell is transfected as it naturally occurs in a subject.
- a cell that is transfected is taken from a subject.
- the cell is derived from cells taken from a subject, such as a cell line. A wide variety of cell lines for tissue culture are known in the art.
- cell lines include, but are not limited to, C8161, CCRF-CEM, MOLT, mIMCD-3, NHDF, HeLa-S3, Huh1, Huh4, Huh7, HUVEC, HASMC, HEKn, HEKa, MiaPaCell, Panc1, PC-3, TFI, CTLL-2, CIR, Rat6, CV1, RPTE, A10, T24, J82, A375, ARH-77, Calu1, SW480, SW620, SKOV3, SK-UT, CaCo2, P388D1, SEM-K2.
- MDA-MB-435 MDCK II, MDCK II, MOR0.2R, MONO-MAC 6, MTD-1A, MyEnd, NCI-H69/CPR, NCI-H69/LX10, NCI-H69/LX20, NCI-H69/LX4.
- THPI cell line U373, U87, U937, VCaP, Vero cells, WM39, WT-49, X63, YAC-1, YAR, and transgenic varieties thereof.
- Cell lines are available from a variety of sources known to those with skill in the art (see, e.g., the American Type Culture Collection (ATCC) (Manassus, Va.)).
- ATCC American Type Culture Collection
- a cell transfected with one or more vectors described herein is used to establish a new cell line comprising one or more vector-derived sequences.
- a cell transiently transfected with the components of a CRISPR system as described herein (such as by transient transfection of one or more vectors, or transfection with RNA), and modified through the activity of a CRISPR complex, is used to establish a new cell line comprising cells containing the modification but lacking any other exogenous sequence.
- cells transiently or non-transiently transfected with one or more vectors described herein, or cell lines derived from such cells are used in assessing one or more test compounds.
- one or more vectors described herein are used to produce a non-human transgenic animal or transgenic plant.
- the transgenic animal is a mammal, such as a mouse, rat, or rabbit.
- Methods for producing transgenic animals and plants are known in the art, and generally begin with a method of cell transfection, such as described herein.
- a fluid delivery device with an array of needles may be contemplated for delivery of CRISPR Cas to solid tissue.
- a device of US Patent Publication No. 20110230839 for delivery of a fluid to a solid tissue may comprise a plurality of needles arranged in an array; a plurality of reservoirs, each in fluid communication with a respective one of the plurality of needles; and a plurality of actuators operatively coupled to respective ones of the plurality of reservoirs and configured to control a fluid pressure within the reservoir.
- each of the plurality of actuators may comprise one of a plurality of plungers, a first end of each of the plurality of plungers being received in a respective one of the plurality of reservoirs, and in certain further embodiments the plungers of the plurality of plungers are operatively coupled together at respective second ends so as to be simultaneously depressable. Certain still further embodiments may comprise a plunger driver configured to depress all of the plurality of plungers at a selectively variable rate. In other embodiments each of the plurality of actuators may comprise one of a plurality of fluid transmission lines having first and second ends, a first end of each of the plurality of fluid transmission lines being coupled to a respective one of the plurality of reservoirs.
- the device may comprise a fluid pressure source, and each of the plurality of actuators comprises a fluid coupling between the fluid pressure source and a respective one of the plurality of reservoirs.
- the fluid pressure source may comprise at least one of a compressor, a vacuum accumulator, a peristaltic pump, a master cylinder, a microfluidic pump, and a valve.
- each of the plurality of needles may comprise a plurality of ports distributed along its length.
- the invention provides for methods of modifying a target polynucleotide in a eukaryotic cell, which may be in vivo, ex vivo or in vitro.
- the method comprises sampling a cell or population of cells from a human or non-human animal, or a plant, and modifying the cell or cells. Culturing may occur at any stage ex vivo.
- the cell or cells may even be re-introduced into the non-human animal or plant. For re-introduced cells it is particularly preferred that the cells are stem cells.
- the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
- the invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell.
- the method comprises allowing a CRISPR complex to bind to the polynucleotide such that said binding results in increased or decreased expression of said polynucleotide; wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
- Similar considerations and conditions apply as above for methods of modifying a target polynucleotide. In fact, these sampling, culturing and re-introduction options apply across the aspects of the present invention.
- the CRISPR complex may comprise a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence, wherein said guide sequence may be linked to a tracr mate sequence which in turn may hybridize to a tracr sequence. Similar considerations and conditions apply as above for methods of modifying a target polynucleotide.
- kits containing any one or more of the elements disclosed in the above methods and compositions. Elements may be provided individually or in combinations, and may be provided in any suitable container, such as a vial, a bottle, or a tube. In some embodiments, the kit includes instructions in one or more languages, for example in more than one language.
- a kit comprises one or more reagents for use in a process utilizing one or more of the elements described herein.
- Reagents may be provided in any suitable container.
- a kit may provide one or more reaction or storage buffers.
- Reagents may be provided in a form that is usable in a particular assay, or in a form that requires addition of one or more other components before use (e.g. in concentrate or lyophilized form).
- a buffer can be any buffer, including but not limited to a sodium carbonate buffer, a sodium bicarbonate buffer, a borate buffer, a Tris buffer, a MOPS buffer, a HEPES buffer, and combinations thereof.
- the buffer is alkaline.
- the buffer has a pH from about 7 to about 10.
- the kit comprises one or more oligonucleotides corresponding to a guide sequence for insertion into a vector so as to operably link the guide sequence and a regulatory element.
- the kit comprises a homologous recombination template polynucleotide.
- the kit comprises one or more of the vectors and/or one or more of the polynucleotides described herein. The kit may advantageously allows to provide all elements of the systems of the invention.
- the invention provides methods for using one or more elements of a CRISPR system.
- the CRISPR complex of the invention provides an effective means for modifying a target polynucleotide.
- the CRISPR complex of the invention has a wide variety of utility including modifying (e.g., deleting, inserting, translocating, inactivating, activating) a target polynucleotide in a multiplicity of cell types.
- the CRISPR complex of the invention has a broad spectrum of applications in, e.g., gene therapy, drug screening, disease diagnosis, and prognosis.
- An exemplary CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within the target polynucleotide.
- the guide sequence is linked to a tracr mate sequence, which in turn hybridizes to a tracr sequence.
- this invention provides a method of cleaving a target polynucleotide.
- the method comprises modifying a target polynucleotide using a CRISPR complex that binds to the target polynucleotide and effect cleavage of said target polynucleotide.
- the CRISPR complex of the invention when introduced into a cell, creates a break (e.g., a single or a double strand break) in the genome sequence.
- the method can be used to cleave a disease gene in a cell.
- the break created by the CRISPR complex can be repaired by a repair processes such as the error prone non-homologous end joining (NHEJ) pathway or the high fidelity homology-directed repair (HDR) ( FIG. 29 ).
- NHEJ error prone non-homologous end joining
- HDR high fidelity homology-directed repair
- an exogenous polynucleotide template can be introduced into the genome sequence.
- the HDR process is used modify genome sequence.
- an exogenous polynucleotide template comprising a sequence to be integrated flanked by an upstream sequence and a downstream sequence is introduced into a cell.
- the upstream and downstream sequences share sequence similarity with either side of the site of integration in the chromosome.
- a donor polynucleotide can be DNA, e.g., a DNA plasmid, a bacterial artificial chromosome (BAC), a yeast artificial chromosome (YAC), a viral vector, a linear piece of DNA, a PCR fragment, a naked nucleic acid, or a nucleic acid complexed with a delivery vehicle such as a liposome or poloxamer.
- DNA e.g., a DNA plasmid, a bacterial artificial chromosome (BAC), a yeast artificial chromosome (YAC), a viral vector, a linear piece of DNA, a PCR fragment, a naked nucleic acid, or a nucleic acid complexed with a delivery vehicle such as a liposome or poloxamer.
- the exogenous polynucleotide template comprises a sequence to be integrated (e.g., a mutated gene).
- the sequence for integration may be a sequence endogenous or exogenous to the cell. Examples of a sequence to be integrated include polynucleotides encoding a protein or a non-coding RNA (e.g., a microRNA).
- the sequence for integration may be operably linked to an appropriate control sequence or sequences.
- the sequence to be integrated may provide a regulatory function.
- the upstream and downstream sequences in the exogenous polynucleotide template are selected to promote recombination between the chromosomal sequence of interest and the donor polynucleotide.
- the upstream sequence is a nucleic acid sequence that shares sequence similarity with the genome sequence upstream of the targeted site for integration.
- the downstream sequence is a nucleic acid sequence that shares sequence similarity with the chromosomal sequence downstream of the targeted site of integration.
- the upstream and downstream sequences in the exogenous polynucleotide template can have 75%, 80%, 85%, 90%, 95%, or 100% sequence identity with the targeted genome sequence.
- the upstream and downstream sequences in the exogenous polynucleotide template have about 95%, 96%, 97%. 98%, 99%, or 100% sequence identity with the targeted genome sequence. In some methods, the upstream and downstream sequences in the exogenous polynucleotide template have about 99% or 100% sequence identity with the targeted genome sequence.
- An upstream or downstream sequence may comprise from about 20 bp to about 2500 bp, for example, about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, or 2500 bp.
- the exemplary upstream or downstream sequence have about 200 bp to about 2000 bp, about 600 bp to about 1000 bp, or more particularly about 700 bp to about 1000 bp.
- the exogenous polynucleotide template may further comprise a marker.
- a marker may make it easy to screen for targeted integrations. Examples of suitable markers include restriction sites, fluorescent proteins, or selectable markers.
- the exogenous polynucleotide template of the invention can be constructed using recombinant techniques (see, for example, Sambrook et al., 2001 and Ausubel et al., 1996).
- a double stranded break is introduced into the genome sequence by the CRISPR complex, the break is repaired via homologous recombination an exogenous polynucleotide template such that the template is integrated into the genome.
- the presence of a double-stranded break facilitates integration of the template.
- this invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell.
- the method comprises increasing or decreasing expression of a target polynucleotide by using a CRISPR complex that binds to the polynucleotide.
- a target polynucleotide can be inactivated to effect the modification of the expression in a cell. For example, upon the binding of a CRISPR complex to a target sequence in a cell, the target polynucleotide is inactivated such that the sequence is not transcribed, the coded protein is not produced, or the sequence does not function as the wild-type sequence does. For example, a protein or microRNA coding sequence may be inactivated such that the protein is not produced.
- control sequence refers to any nucleic acid sequence that effects the transcription, translation, or accessibility of a nucleic acid sequence. Examples of a control sequence include, a promoter, a transcription terminator, and an enhancer are control sequences.
- the inactivated target sequence may include a deletion mutation (i.e., deletion of one or more nucleotides), an insertion mutation (i.e., insertion of one or more nucleotides), or a nonsense mutation (i.e., substitution of a single nucleotide for another nucleotide such that a stop codon is introduced).
- a deletion mutation i.e., deletion of one or more nucleotides
- an insertion mutation i.e., insertion of one or more nucleotides
- a nonsense mutation i.e., substitution of a single nucleotide for another nucleotide such that a stop codon is introduced.
- a method of the invention may be used to create a plant, an animal or cell that may be used as a disease model.
- disease refers to a disease, disorder, or indication in a subject.
- a method of the invention may be used to create an animal or cell that comprises a modification in one or more nucleic acid sequences associated with a disease, or a plant, animal or cell in which the expression of one or more nucleic acid sequences associated with a disease are altered.
- Such a nucleic acid sequence may encode a disease associated protein sequence or may be a disease associated control sequence. Accordingly, it is understood that in embodiments of the invention, a plant, subject, patient, organism or cell can be a non-human subject, patient, organism or cell.
- the invention provides a plant, animal or cell, produced by the present methods, or a progeny thereof.
- the progeny may be a clone of the produced plant or animal, or may result from sexual reproduction by crossing with other individuals of the same species to introgress further desirable traits into their offspring.
- the cell may be in vivo or ex vivo in the cases of multicellular organisms, particularly animals or plants.
- a cell line may be established if appropriate culturing conditions are met and preferably if the cell is suitably adapted for this purpose (for instance a stem cell).
- Bacterial cell lines produced by the invention are also envisaged. Hence, cell lines are also envisaged.
- the disease model can be used to study the effects of mutations on the animal or cell and development and/or progression of the disease using measures commonly used in the study of the disease.
- a disease model is useful for studying the effect of a pharmaceutically active compound on the disease.
- the disease model can be used to assess the efficacy of a potential gene therapy strategy. That is, a disease-associated gene or polynucleotide can be modified such that the disease development and/or progression is inhibited or reduced.
- the method comprises modifying a disease-associated gene or polynucleotide such that an altered protein is produced and, as a result, the animal or cell has an altered response.
- a genetically modified animal may be compared with an animal predisposed to development of the disease such that the effect of the gene therapy event may be assessed.
- this invention provides a method of developing a biologically active agent that modulates a cell signaling event associated with a disease gene.
- the method comprises contacting a test compound with a cell comprising one or more vectors that drive expression of one or more of a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, and a tracr sequence; and detecting a change in a readout that is indicative of a reduction or an augmentation of a cell signaling event associated with, e.g., a mutation in a disease gene contained in the cell.
- a cell model or animal model can be constructed in combination with the method of the invention for screening a cellular function change.
- a model may be used to study the effects of a genome sequence modified by the CRISPR complex of the invention on a cellular function of interest.
- a cellular function model may be used to study the effect of a modified genome sequence on intracellular signaling or extracellular signaling.
- a cellular function model may be used to study the effects of a modified genome sequence on sensory perception.
- one or more genome sequences associated with a signaling biochemical pathway in the model are modified.
- An altered expression of one or more genome sequences associated with a signaling biochemical pathway can be determined by assaying for a difference in the mRNA levels of the corresponding genes between the test model cell and a control cell, when they are contacted with a candidate agent.
- the differential expression of the sequences associated with a signaling biochemical pathway is determined by detecting a difference in the level of the encoded polypeptide or gene product.
- nucleic acid contained in a sample is first extracted according to standard methods in the art.
- mRNA can be isolated using various lytic enzymes or chemical solutions according to the procedures set forth in Sambrook et al. (1989), or extracted by nucleic-acid-binding resins following the accompanying instructions provided by the manufacturers.
- the mRNA contained in the extracted nucleic acid sample is then detected by amplification procedures or conventional hybridization assays (e.g. Northern blot analysis) according to methods widely known in the art or based on the methods exemplified herein.
- amplification means any method employing a primer and a polymerase capable of replicating a target sequence with reasonable fidelity.
- Amplification may be carried out by natural or recombinant DNA polymerases such as TaqGoldTM. T7 DNA polymerase, Klenow fragment of E. coli DNA polymerase, and reverse transcriptase.
- a preferred amplification method is PCR.
- the isolated RNA can be subjected to a reverse transcription assay that is coupled with a quantitative polymerase chain reaction (RT-PCR) in order to quantify the expression level of a sequence associated with a signaling biochemical pathway.
- RT-PCR quantitative polymerase chain reaction
- Detection of the gene expression level can be conducted in real time in an amplification assay.
- the amplified products can be directly visualized with fluorescent DNA-binding agents including but not limited to DNA intercalators and DNA groove binders. Because the amount of the intercalators incorporated into the double-stranded DNA molecules is typically proportional to the amount of the amplified DNA products, one can conveniently determine the amount of the amplified products by quantifying the fluorescence of the intercalated dye using conventional optical systems in the art.
- DNA-binding dye suitable for this application include SYBR green, SYBR blue, DAPI, propidium iodine, Hoeste, SYBR gold, ethidium bromide, acridines, proflavine, acridine orange, acriflavine, fluorcoumanin, ellipticine, daunomycin, chloroquine, distamycin D, chromomycin, homidium, mithramycin, ruthenium polypyridyls, anthramycin, and the like.
- probe-based quantitative amplification relies on the sequence-specific detection of a desired amplified product. It utilizes fluorescent, target-specific probes (e.g., TaqMan) probes) resulting in increased specificity and sensitivity. Methods for performing probe-based quantitative amplification are well established in the art and are taught in U.S. Pat. No. 5,210,015.
- probes are allowed to form stable complexes with the sequences associated with a signaling biochemical pathway contained within the biological sample derived from the test subject in a hybridization reaction.
- antisense used as the probe nucleic acid
- the target polynucleotides provided in the sample are chosen to be complementary to sequences of the antisense nucleic acids.
- the target polynucleotide is selected to be complementary to sequences of the sense nucleic acid.
- Hybridization can be performed under conditions of various stringency. Suitable hybridization conditions for the practice of the present invention are such that the recognition interaction between the probe and sequences associated with a signaling biochemical pathway is both sufficiently specific and sufficiently stable. Conditions that increase the stringency of a hybridization reaction are widely known and published in the art. See, for example, (Sambrook, et al., (1989); Nonradioactive In Situ Hybridization Application Manual, Boehringer Mannheim, second edition).
- the hybridization assay can be formed using probes immobilized on any solid support, including but are not limited to nitrocellulose, glass, silicon, and a variety of gene arrays. A preferred hybridization assay is conducted on high-density gene chips as described in U.S. Pat. No. 5,445,934.
- the nucleotide probes are conjugated to a detectable label.
- Detectable labels suitable for use in the present invention include any composition detectable by photochemical, biochemical, spectroscopic, immunochemical, electrical, optical or chemical means.
- a wide variety of appropriate detectable labels are known in the art, which include fluorescent or chemiluminescent labels, radioactive isotope labels, enzymatic or other ligands.
- a fluorescent label or an enzyme tag such as digoxigenin, ⁇ -galactosidase, urease, alkaline phosphatase or peroxidase, avidin/biotin complex.
- the detection methods used to detect or quantify the hybridization intensity will typically depend upon the label selected above.
- radiolabels may be detected using photographic film or a phosphoimager.
- Fluorescent markers may be detected and quantified using a photodetector to detect emitted light.
- Enzymatic labels are typically detected by providing the enzyme with a substrate and measuring the reaction product produced by the action of the enzyme on the substrate; and finally colorimetric labels are detected by simply visualizing the colored label.
- An agent-induced change in expression of sequences associated with a signaling biochemical pathway can also be determined by examining the corresponding gene products. Determining the protein level typically involves a) contacting the protein contained in a biological sample with an agent that specifically bind to a protein associated with a signaling biochemical pathway, and (b) identifying any agent:protein complex so formed.
- the agent that specifically binds a protein associated with a signaling biochemical pathway is an antibody, preferably a monoclonal antibody.
- the reaction is performed by contacting the agent with a sample of the proteins associated with a signaling biochemical pathway derived from the test samples under conditions that will allow a complex to form between the agent and the proteins associated with a signaling biochemical pathway.
- the formation of the complex can be detected directly or indirectly according to standard procedures in the art.
- the agents are supplied with a detectable label and unreacted agents may be removed from the complex; the amount of remaining label thereby indicating the amount of complex formed.
- an indirect detection procedure may use an agent that contains a label introduced either chemically or enzymatically.
- a desirable label generally does not interfere with binding or the stability of the resulting agent:polypeptide complex.
- the label is typically designed to be accessible to an antibody for an effective binding and hence generating a detectable signal.
- labels suitable for detecting protein levels are known in the art.
- Non-limiting examples include radioisotopes, enzymes, colloidal metals, fluorescent compounds, bioluminescent compounds, and chemiluminescent compounds.
- agent:polypeptide complexes formed during the binding reaction can be quantified by standard quantitative assays. As illustrated above, the formation of agent:polypeptide complex can be measured directly by the amount of label remained at the site of binding.
- the protein associated with a signaling biochemical pathway is tested for its ability to compete with a labeled analog for binding sites on the specific agent. In this competitive assay, the amount of label captured is inversely proportional to the amount of protein sequences associated with a signaling biochemical pathway present in a test sample.
- a number of techniques for protein analysis based on the general principles outlined above are available in the art. They include but are not limited to radioimmunoassays, ELISA (enzyme linked immunoradiometric assays). “sandwich” immunoassays, immunoradiometric assays, in situ immunoassays (using e.g., colloidal gold, enzyme or radioisotope labels), western blot analysis, immunoprecipitation assays, immunofluorescent assays, and SDS-PAGE.
- Antibodies that specifically recognize or bind to proteins associated with a signaling biochemical pathway are preferable for conducting the aforementioned protein analyses.
- antibodies that recognize a specific type of post-translational modifications e.g., signaling biochemical pathway inducible modifications
- Post-translational modifications include but are not limited to glycosylation, lipidation, acetylation, and phosphorylation. These antibodies may be purchased from commercial vendors.
- anti-phosphotyrosine antibodies that specifically recognize tyrosine-phosphorylated proteins are available from a number of vendors including Invitrogen and Perkin Elmer.
- Anti-phosphotyrosine antibodies are particularly useful in detecting proteins that are differentially phosphorylated on their tyrosine residues in response to an ER stress.
- proteins include but are not limited to eukaryotic translation initiation factor 2 alpha (eIF-2 ⁇ ).
- eIF-2 ⁇ eukaryotic translation initiation factor 2 alpha
- these antibodies can be generated using conventional polyclonal or monoclonal antibody technologies by immunizing a host animal or an antibody-producing cell with a target protein that exhibits the desired post-translational modification.
- tissue-specific, cell-specific or subcellular structure specific antibodies capable of binding to protein markers that are preferentially expressed in certain tissues, cell types, or subcellular structures.
- An altered expression of a gene associated with a signaling biochemical pathway can also be determined by examining a change in activity of the gene product relative to a control cell.
- the assay for an agent-induced change in the activity of a protein associated with a signaling biochemical pathway will dependent on the biological activity and/or the signal transduction pathway that is under investigation.
- a change in its ability to phosphorylate the downstream substrate(s) can be determined by a variety of assays known in the art. Representative assays include but are not limited to immunoblotting and immunoprecipitation with antibodies such as anti-phosphotyrosine antibodies that recognize phosphorylated proteins.
- kinase activity can be detected by high throughput chemiluminescent assays such as AlphaScreenTM (available from Perkin Elmer) and eTagTM assay (Chan-Hui, et al. (2003) Clinical Immunology 111: 162-174).
- high throughput chemiluminescent assays such as AlphaScreenTM (available from Perkin Elmer) and eTagTM assay (Chan-Hui, et al. (2003) Clinical Immunology 111: 162-174).
- pH sensitive molecules such as fluorescent pH dyes can be used as the reporter molecules.
- the protein associated with a signaling biochemical pathway is an ion channel
- fluctuations in membrane potential and/or intracellular ion concentration can be monitored.
- Representative instruments include FLIPRTM (Molecular Devices, Inc.) and VIPR (Aurora Biosciences). These instruments are capable of detecting reactions in over 1000 sample wells of a microplate simultaneously, and providing real-time measurement and functional data within a second or even a minisecond.
- a suitable vector can be introduced to a cell or an embryo via one or more methods known in the art, including without limitation, microinjection, electroporation, sonoporation, biolistics, calcium phosphate-mediated transfection, cationic transfection, liposome transfection, dendrimer transfection, heat shock transfection, nucleofection transfection, magnetofection, lipofection, impalefection, optical transfection, proprietary agent-enhanced uptake of nucleic acids, and delivery via liposomes, immunoliposomes, virosomes, or artificial virions.
- the vector is introduced into an embryo by microinjection.
- the vector or vectors may be microinjected into the nucleus or the cytoplasm of the embryo.
- the vector or vectors may be introduced into a cell by nucleofection.
- the target polynucleotide of a CRISPR complex can be any polynucleotide endogenous or exogenous to the eukaryotic cell.
- the target polynucleotide can be a polynucleotide residing in the nucleus of the eukaryotic cell.
- the target polynucleotide can be a sequence coding a gene product (e.g., a protein) or a non-coding sequence (e.g., a regulatory polynucleotide or a junk DNA).
- target polynucleotides include a sequence associated with a signaling biochemical pathway, e.g., a signaling biochemical pathway-associated gene or polynucleotide.
- target polynucleotides include a disease associated gene or polynucleotide.
- a “disease-associated” gene or polynucleotide refers to any gene or polynucleotide which is yielding transcription or translation products at an abnormal level or in an abnormal form in cells derived from a disease-affected tissues compared with tissues or cells of a non disease control.
- a disease-associated gene also refers to a gene possessing mutation(s) or genetic variation that is directly responsible or is in linkage disequilibrium with a gene(s) that is responsible for the etiology of a disease.
- the transcribed or translated products may be known or unknown, and may be at a normal or abnormal level.
- the target polynucleotide of a CRISPR complex can be any polynucleotide endogenous or exogenous to the eukaryotic cell.
- the target polynucleotide can be a polynucleotide residing in the nucleus of the eukaryotic cell.
- the target polynucleotide can be a sequence coding a gene product (e.g., a protein) or a non-coding sequence (e.g., a regulatory polynucleotide or a junk DNA).
- a gene product e.g., a protein
- a non-coding sequence e.g., a regulatory polynucleotide or a junk DNA.
- PAM protospacer adjacent motif
- PAMs are typically 2-5 base pair sequences adjacent the protospacer (that is, the target sequence) Examples of PAM sequences are given in the examples section below, and the skilled person will be able to identify further PAM sequences for use with a given CRISPR enzyme.
- the target polynucleotide of a CRISPR complex may include a number of disease-associated genes and polynucleotides as well as signaling biochemical pathway-associated genes and polynucleotides as listed in U.S. provisional patent applications 61/736,527 and 61/748,427 having Broad reference BI-2011/008/WSGR Docket No. 44063-701.101 and BI-2011/008/WSGR Docket No. 44063-701.102 respectively, both entitled SYSTEMS METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION filed on Dec. 12, 2012 and Jan. 2, 2013, respectively, the contents of all of which are herein incorporated by reference in their entirety.
- target polynucleotides include a sequence associated with a signaling biochemical pathway, e.g., a signaling biochemical pathway-associated gene or polynucleotide.
- target polynucleotides include a disease associated gene or polynucleotide.
- a “disease-associated” gene or polynucleotide refers to any gene or polynucleotide which is yielding transcription or translation products at an abnormal level or in an abnormal form in cells derived from a disease-affected tissues compared with tissues or cells of a non disease control.
- a disease-associated gene also refers to a gene possessing mutation(s) or genetic variation that is directly responsible or is in linkage disequilibrium with a gene(s) that is responsible for the etiology of a disease.
- the transcribed or translated products may be known or unknown, and may be at a normal or abnormal level.
- Examples of disease-associated genes and polynucleotides are listed in Tables A and B. Disease specific information is available from McKusick-Nathans Institute of Genetic Medicine, Johns Hopkins University (Baltimore, Md.) and National Center for Biotechnology Information, National Library of Medicine (Bethesda, Md.), available on the World Wide Web. Examples of signaling biochemical pathway-associated genes and polynucleotides are listed in Table C.
- genes, diseases and proteins can result in production of improper proteins or proteins in improper amounts which affect function.
- genes, diseases and proteins are hereby incorporated by reference from U.S. Provisional application 61/736,527 filed Dec. 12, 2012.
- Such genes, proteins and pathways may be the target polynucleotide of a CRISPR complex.
- Neoplasia PTEN ATM; ATR; EGFR; ERBB2; ERBB3; ERBB4; Notch1; Notch2; Notch3; Notch4; AKT; AKT2; AKT3; HIF; HIF1a; HIF3a; Met; HRG; Bcl2; PPAR alpha; PPAR gamma; WT1 (Wilms Tumor); FGF Receptor Family members (5 members: 1, 2, 3, 4, 5); CDKN2a; APC; RB (retinoblastoma); MEN1; VHL; BRCA1; BRCA2; AR (Androgen Receptor); TSG101; IGF; IGF Receptor; Igf1 (4 variants); Igf2 (3 variants); Igf 1 Receptor; Igf 2 Receptor; Bax; Bcl2; caspases family (9 members: 1, 2, 3, 4, 6, 7, 8, 9, 12); Kras;
- BCL7A BCL7
- Leukemia TAL1 and oncology TCL5, SCL, TAL2, FLT3, NBS1, NBS, ZNFN1A1, IK1, LYF1, diseases and disorders HOXD4, HOX4B, BCR, CML, PHL, ALL, ARNT, KRAS2, RASK2, GMPS, AF10, ARHGEF12, LARG, KIAA0382, CALM, CLTH, CEBPA, CEBP, CHIC2, BTL, FLT3, KIT, PBT, LPP, NPM1, NUP214, D9S46E, CAN, CAIN, RUNX1, CBFA2, AML1, WHSC1L1, NSD3, FLT3, AF1Q, NPM1, NUMA1, ZNF145, PLZF, PML, MYL, STAT5B, AF10, CALM, CLTH, ARL11, ARLTS1, P2RX7,
- Inflammation and AIDS Keratinization and AIDS (KIR3DL1, NKAT3, NKB1, AMB11, KIR3DS1, IFNG, CXCL12, immune related SDF1); Autoimmune lymphoproliferative syndrome (TNFRSF6, APT1, diseases and disorders FAS, CD95, ALPS1A); Combined immunodeficiency, (IL2RG, SCIDX1, SCIDX, IMD4); HIV-1 (CCL5, SCYA5, D17S136E, TCP228), HIV susceptibility or infection (IL10, CSIF, CMKBR2, CCR2, CMKBR5, CCCKR5 (CCR5)); Immunodeficiencies (CD3E, CD3G, AICDA, AID, HIGM2, TNFRSF5, CD40, UNG, DGU, HIGM4, TNFSF5, CD40LG, HIGM1, IGM, FOXP3, IPEX, AIID, XPID, PIDX, TNFRSF14B, TACI
- Muscular/Skeletal Becker muscular dystrophy (DMD, BMD, MYF6), Duchenne Muscular diseases and disorders Dystrophy (DMD, BMD); Emery-Dreifuss muscular dystrophy (LMNA, LMN1, EMD2, FPLD, CMD1A, HGPS, LGMD1B, LMNA, LMN1, EMD2, FPLD, CMD1A); Facioscapulohumeral muscular dystrophy (FSHMD1A, FSHD1A); Muscular dystrophy (FKRP, MDC1C, LGMD2I, LAMA2, LAMM, LARGE, KIAA0609, MDC1D, FCMD, TTID, MYOT, CAPN3, CANP3, DYSF, LGMD2B, SGCG, LGMD2C, DMDA1, SCG3, SGCA, ADL, DAG2, LGMD2D, DMDA2, SGCB, LGMD2E, SGCD, SGD, LGMD2F, C
- Neurological and ALS SOD1, ALS2, STEX, FUS, TARDBP, VEGF (VEGF-a, VEGF-b, neuronal diseases VEGF-c); Alzheimer disease (APP, AAA, CVAP, AD1, APOE, AD2, and disorders PSEN2, AD4, STM2, APBB2, FE65L1, NOS3, PLAU, URK, ACE, DCP1, ACE1, MPO, PACIP1, PAXIP1L, PTIP, A2M, BLMH, BMH, PSEN1, AD3); Autism (Mecp2, BZRAP1, MDGA2, Sema5A, Neurexin 1, GLO1, MECP2, RTT, PPMX, MRX16, MRX79, NLGN3, NLGN4, KIAA1260, AUTSX2); Fragile X Syndrome (FMR2, FXR1, FXR2, mGLUR5); Huntington's disease and disease like disorders (HD, IT15, PRNP, PRIP, JPH3,
- Occular diseases Age-related macular degeneration (Abcr, Ccl2, Cc2, cp (ceruloplasmin), and disorders Timp3, cathepsinD, Vldlr, Ccr2); Cataract (CRYAA, CRYA1, CRYBB2, CRYB2, PITX3, BFSP2, CP49, CP47, CRYAA, CRYA1, PAX6, AN2, MGDA, CRYBA1, CRYB1, CRYGC, CRYG3, CCL, LIM2, MP19, CRYGD, CRYG4, BFSP2, CP49, CP47, HSF4, CTM, HSF4, CTM, MIP, AQP0, CRYAB, CRYA2, CTPP2, CRYBB1, CRYGD, CRYG4, CRYBB2, CRYB2, CRYGC, CRYG3, CCL, CRYAA, CRYA1, GJA8, CX50, CAE1, GJA3, CX46, CZP3, CAE3, CCM1, CAM
- Embodiments of the invention also relate to methods and compositions related to knocking out genes, amplifying genes and repairing particular mutations associated with DNA repeat instability and neurological disorders (Robert D. Wells, Tetsuo Ashizawa, Genetic Instabilities and Neurological Diseases, Second Edition, Academic Press. Oct. 13, 2011-Medical). Specific aspects of tandem repeat sequences have been found to be responsible for more than twenty human diseases (New insights into repeat instability: role of RNA*DNA hybrids. Mclvor E I, Polak U, Napierala M. RNA Biol. 2010 September-October; 7(5):551-8). The CRISPR-Cas system may be harnessed to correct these defects of genomic instability.
- a further aspect of the invention relates to utilizing the CRISPR-Cas system for correcting defects in the EMP2A and EMP2B genes that have been identified to be associated with Lafora disease.
- Lafora disease is an autosomal recessive condition which is characterized by progressive myoclonus epilepsy which may start as epileptic seizures in adolescence.
- a few cases of the disease may be caused by mutations in genes yet to be identified.
- the disease causes seizures, muscle spasms, difficulty walking, dementia, and eventually death. There is currently no therapy that has proven effective against disease progression.
- the genetic brain diseases may include but are not limited to Adrenoleukodystrophy, Agenesis of the Corpus Callosum, Aicardi Syndrome, Alpers' Disease, Alzheimer's Disease, Barth Syndrome, Batten Disease, CADASIL, Cerebellar Degeneration, Fabry's Disease, Gerstmann-Straussler-Scheinker Disease, Huntington's Disease and other Triplet Repeat Disorders, Leigh's Disease, Lesch-Nyhan Syndrome, Menkes Disease, Mitochondrial Myopathies and NINDS Colpocephaly. These diseases are further described on the website of the National Institutes of Health under the subsection Genetic Brain Disorders.
- the condition may be neoplasia. In some embodiments, where the condition is neoplasia, the genes to be targeted are any of those listed in Table A (in this case PTEN and so forth). In some embodiments, the condition may be Age-related Macular Degeneration. In some embodiments, the condition may be a Schizophrenic Disorder. In some embodiments, the condition may be a Trinucleotide Repeat Disorder. In some embodiments, the condition may be Fragile X Syndrome. In some embodiments, the condition may be a Secretase Related Disorder. In some embodiments, the condition may be a Prion—related disorder. In some embodiments, the condition may be ALS. In some embodiments, the condition may be a drug addiction. In some embodiments, the condition may be Autism. In some embodiments, the condition may be Alzheimer's Disease. In some embodiments, the condition may be inflammation. In some embodiments, the condition may be Parkinson's Disease.
- US Patent Publication No. 20110023145 describes use of zinc finger nucleases to genetically modify cells, animals and proteins associated with autism spectrum disorders (ASD).
- ASDs Autism spectrum disorders
- ASDs are a group of disorders characterized by qualitative impairment in social interaction and communication, and restricted repetitive and stereotyped patterns of behavior, interests, and activities.
- the three disorders, autism, Asperger syndrome (AS) and pervasive developmental disorder-not otherwise specified (PDD-NOS) are a continuum of the same disorder with varying degrees of severity, associated intellectual functioning and medical conditions.
- ASDs are predominantly genetically determined disorders with a heritability of around 90%.
- US Patent Publication No. 20110023145 comprises editing of any chromosomal sequences that encode proteins associated with ASD which may be applied to the CRISPR Cas system of the present invention.
- the proteins associated with ASD are typically selected based on an experimental association of the protein associated with ASD to an incidence or indication of an ASD. For example, the production rate or circulating concentration of a protein associated with ASD may be elevated or depressed in a population having an ASD relative to a population lacking the ASD. Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry.
- ELISA enzyme linked immunosorbent assay
- the proteins associated with ASD may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR).
- genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR).
- Non limiting examples of disease states or disorders that may be associated with proteins associated with ASD include autism, Asperger syndrome (AS), pervasive developmental disorder-not otherwise specified (PDD-NOS), Rett's syndrome, tuberous sclerosis, phenylketonuria, Smith-Lemli-Opitz syndrome and fragile X syndrome.
- proteins associated with ASD include but are not limited to the following proteins: ATP10C aminophospholipid-MET MET receptor transporting ATPase tyrosine kinase (ATP10C) BZRAP1 MGLUR5 (GRM5) Metabotropic glutamate receptor 5 (MGLUR5) CDH10 Cadherin-10 MGLUR6 (GRM6) Metabotropic glutamate receptor 6 (MGLUR6) CDH9 Cadherin-9 NLGN1 Neuroligin-1 CNTN4 Contactin-4 NLGN2 Neuroligin-2 CNTNAP2 Contactin-associated SEMA5A Neuroligin-3 protein-like 2 (CNTNAP2) DHCR77-dehydrocholesterol NLGN4X Neuroligin-4X-reductase (DHCR7) linked DOC2A Double C2-like domain-NLGN4Y Neuroligin-4 Y-containing protein alpha linked DPP6 Dipeptidyl NLGN5 Neuroligin-5 aminopeptidase-like protein 6 EN2 engrailed
- the proteins associated with ASD whose chromosomal sequence is edited may be the benzodiazapine receptor (peripheral) associated protein 1 (BZRAP1) encoded by the BZRAP1 gene, the AF4/FMR2 family member 2 protein (AFF2) encoded by the AFF2 gene (also termed MFR2), the fragile X mental retardation autosomal homolog I protein (FXR1) encoded by the FXR1 gene, the fragile X mental retardation autosomal homolog 2 protein (FXR2) encoded by the FXR2 gene, the MAM domain containing glycosylphosphatidylinositol anchor 2 protein (MDGA2) encoded by the MDGA2 gene, the methyl CpG binding protein 2 (MECP2) encoded by the MECP2 gene, the metabotropic glutamate receptor 5 (MGLUR5) encoded by the MGLUR5-1 gene (also
- the genetically modified animal is a rat
- the edited chromosomal sequence encoding the protein associated with ASD is as listed below: BZRAP1 benzodiazapine receptor XM — 002727789, (peripheral) associated XM — 213427, protein 1 (BZRAP 1) XM — 002724533, XM — 001081125 AFF2 (FMR2) AF4/FMR2 family member 2 XM — 219832, (AFF2) XM — 001054673 FXR1Fragile X mental NM — 001012179 retardation, autosomal homolog 1 (FXR1) FXR2Fragile X mental NM — 001100647 retardation, autosomal homolog 2 (FXR2) MDGA2 MAM domain containing NM — 199269 glycosylphosphatidylinositol anchor 2 (MDGA2) MECP2 Methy
- Exemplary animals or cells may comprise one, two, three, four, five, six, seven, eight, or nine or more inactivated chromosomal sequences encoding a protein associated with ASD, and zero, one, two, three, four, five, six, seven, eight, nine or more chromosomally integrated sequences encoding proteins associated with ASD.
- the edited or integrated chromosomal sequence may be modified to encode an altered protein associated with ASD.
- Non-limiting examples of mutations in proteins associated with ASD include the L18Q mutation in neurexin I where the leucine at position 18 is replaced with a glutamine, the R451c mutation in neuroligin 3 where the arginine at position 451 is replaced with a cysteine, the R87W mutation in neuroligin 4 where the arginine at position 87 is replaced with a tryptophan, and the 1425V mutation in serotonin transporter where the isoleucine at position 425 is replaced with a valine.
- a number of other mutations and chromosomal rearrangements in ASD-related chromosomal sequences have been associated with ASD and are known in the art. See, for example, Freitag et al. (2010) Eur. Child. Adolesc. Psychiatry 19:169-178, and Bucan et al. (2009) PLoS Genetics 5: e1000536, the disclosure of which is incorporated by reference herein in its entirety.
- proteins associated with Parkinson's disease include but are not limited to ⁇ -synuclein, DJ-1, LRRK2, PINK1, Parkin, UCHL1, Synphilin-1, and NURR1.
- addiction-related proteins may include ABAT for example.
- inflammation-related proteins may include the monocyte chemoattractant protein-1 (MCP1) encoded by the Ccr2 gene, the C—C chemokine receptor type 5 (CCR5) encoded by the Ccr5 gene, the IgG receptor IIB (FCGR2b, also termed CD32) encoded by the Fcgr2b gene, or the Fe epsilon R1g (FCER1g) protein encoded by the Fcer1g gene, for example.
- MCP1 monocyte chemoattractant protein-1
- CCR5 C—C chemokine receptor type 5
- FCGR2b also termed CD32
- FCER1g Fe epsilon R1g
- cardiovascular diseases associated proteins may include IL1B (interleukin 1, beta), XDH (xanthine dehydrogenase), TP53 (tumor protein p53), PTGIS (prostaglandin 12 (prostacyclin) synthase), MB (myoglobin), IL4 (interleukin 4), ANGPT1 (angiopoietin 1), ABCG8 (ATP-binding cassette, sub-family G (WHITE), member 8), or CTSK (cathepsin K), for example.
- IL1B interleukin 1, beta
- XDH xanthine dehydrogenase
- TP53 tumor protein p53
- PTGIS prostaglandin 12 (prostacyclin) synthase)
- MB myoglobin
- IL4 interleukin 4
- ANGPT1 angiopoietin 1
- ABCG8 ATP-binding cassette, sub-family G (WHITE), member 8
- CTSK
- US Patent Publication No. 20110023153 describes use of zinc finger nucleases to genetically modify cells, animals and proteins associated with Alzheimer's Disease. Once modified cells and animals may be further tested using known methods to study the effects of the targeted mutations on the development and/or progression of AD using measures commonly used in the study of AD—such as, without limitation, learning and memory, anxiety, depression, addiction, and sensory motor functions as well as assays that measure behavioral, functional, pathological, metaboloic and biochemical function.
- measures commonly used in the study of AD such as, without limitation, learning and memory, anxiety, depression, addiction, and sensory motor functions as well as assays that measure behavioral, functional, pathological, metaboloic and biochemical function.
- the present disclosure comprises editing of any chromosomal sequences that encode proteins associated with AD.
- the AD-related proteins are typically selected based on an experimental association of the AD-related protein to an AD disorder. For example, the production rate or circulating concentration of an AD-related protein may be elevated or depressed in a population having an AD disorder relative to a population lacking the AD disorder. Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry.
- the AD-related proteins may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR).
- Examples of Alzheimer's disease associated proteins may include the very low density lipoprotein receptor protein (VLDLR) encoded by the VLDLR gene, the ubiquitin-like modifier activating enzyme 1 (UBA) encoded by the UBA1 gene, or the NEDD8-activating enzyme E1 catalytic subunit protein (UBE1C) encoded by the UBA3 gene, for example.
- VLDLR very low density lipoprotein receptor protein
- UBA ubiquitin-like modifier activating enzyme 1
- UBE1C NEDD8-activating enzyme E1 catalytic subunit protein
- proteins associated with AD include but are not limited to the proteins listed as follows: Chromosomal Sequence Encoded Protein ALAS2 Delta-aminolevulinate synthase 2 (ALAS2) ABCA1 ATP-binding cassette transporter (ABCA) ACE Angiotensin I-converting enzyme (ACE) APOE Apolipoprotein E precursor (APOE) APP amyloid precursor protein (APP) AQP1 aquaporin 1 protein (AQP1) BIN1 Myc box-dependent-interacting protein 1 or bridging integrator 1 protein (BIN1) BDNF brain-derived neurotrophic factor (BDNF) BTNL8 Butyrophilin-like protein 8 (BTNL8) CIORF49 chromosome 1 open reading frame 49 CDH4 Cadherin-4 CHRNB2 Neuronal acetylcholine receptor subunit beta-2 CKLFSF2 CKLF-like MARVEL transmembrane domain-containing protein 2 (CKLFSF2) CLEC4E C-type lectin domain
- the proteins associated with AD whose chromosomal sequence is edited may be the very low density lipoprotein receptor protein (VLDLR) encoded by the VLDLR gene, the ubiquitin-like modifier activating enzyme I (UBA1) encoded by the UBA1 gene, the NEDD8-activating enzyme E1 catalytic subunit protein (UBE1C) encoded by the UBA3 gene, the aquaporin 1 protein (AQP1) encoded by the AQP1 gene, the ubiquitin carboxyl-terminal esterase L1 protein (UCHL) encoded by the UCHL1 gene, the ubiquitin carboxyl-terminal hydrolase isozyme L3 protein (UCHL3) encoded by the UCHL3 gene, the ubiquitin B protein (UBB) encoded by the UBB gene, the microtubule-associated protein tau (MAPT) encoded by the MAPT gene, the protein tyrosine phosphatase receptor type A protein (PTPRA) encoded by the PTP
- VLDLR
- the genetically modified animal is a rat
- the edited chromosomal sequence encoding the protein associated with AD is as as follows: APP amyloid precursor protein (APP) NM — 019288 AQP1 aquaporin 1 protein (AQP1) NM — 012778 BDNF Brain-derived neurotrophic factor NM — 012513 CLU clusterin protein (also known as NM — 053021 apoplipoprotein J) MAPT microtubule-associated protein NM — 017212 tau (MAPT) PICALM phosphatidylinositol binding NM — 053554 clathrin assembly protein (PICALM) PSEN1 presenilin 1 protein (PSEN1) NM — 019163 PSEN2 presenilin 2 protein (PSEN2) NM — 031087 PTPRA protein tyrosine phosphatase NM — 012763 receptor type A protein (PTPRA) SORL1 sortilin-related receptor L
- the animal or cell may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more disrupted chromosomal sequences encoding a protein associated with AD and zero, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more chromosomally integrated sequences encoding a protein associated with AD.
- the edited or integrated chromosomal sequence may be modified to encode an altered protein associated with AD.
- a number of mutations in AD-related chromosomal sequences have been associated with AD.
- the V7171 i.e. valine at position 717 is changed to isoleucine
- missense mutation in APP causes familial AD.
- cysteine at position 410 is changed to tyrosine
- familial Alzheimer's type 3 Mutations in the presenilin-2 protein, such as N141 I (i.e. asparagine at position 141 is changed to isoleucine), M239V (i.e. methionine at position 239 is changed to valine), and D439A (i.e. aspartate at position 439 is changed to alanine) cause familial Alzheimer's type 4.
- N141 I i.e. asparagine at position 141 is changed to isoleucine
- M239V i.e. methionine at position 239 is changed to valine
- D439A i.e. aspartate at position 439 is changed to alanine
- Other associations of genetic variants in AD-associated genes and disease are known in the art. See, for example, Waring et al. (2008) Arch. Neurol. 65:329-334, the disclosure of which is incorporated by reference herein in its entirety.
- proteins associated Autism Spectrum Disorder may include the benzodiazapine receptor (peripheral) associated protein 1 (BZRAP1) encoded by the BZRAP1 gene, the AF4/FMR2 family member 2 protein (AFF2) encoded by the AFF2 gene (also termed MFR2), the fragile X mental retardation autosomal homolog I protein (FXR1) encoded by the FXR1 gene, or the fragile X mental retardation autosomal homolog 2 protein (FXR2) encoded by the FXR2 gene, for example.
- BZRAP1 benzodiazapine receptor (peripheral) associated protein 1
- AFF2 AF4/FMR2 family member 2 protein
- FXR1 fragile X mental retardation autosomal homolog I protein
- FXR2 fragile X mental retardation autosomal homolog 2 protein
- proteins associated Macular Degeneration may include the ATP-binding cassette, sub-family A (ABC1) member 4 protein (ABCA4) encoded by the ABCR gene, the apolipoprotein E protein (APOE) encoded by the APOE gene, or the chemokine (C—C motif) Ligand 2 protein (CCL2) encoded by the CCL2 gene, for example.
- ABC1 sub-family A
- APOE apolipoprotein E protein
- CCL2 Ligand 2 protein
- proteins associated Schizophrenia may include NRG1, ErbB4, CPLX1, TPH 1, TPH2, NRXN1, GSK3A, BDNF, DISC1, GSK3B, and combinations thereof.
- proteins involved in tumor suppression may include ATM (ataxia telangiectasia mutated), ATR (ataxia telangiectasia and Rad3 related), EGFR (epidermal growth factor receptor), ERBB2 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 2), ERBB3 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 3), ERBB4 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 4), Notch 1, Notch2, Notch 3, or Notch 4, for example.
- ATM ataxia telangiectasia mutated
- ATR ataxia telangiectasia and Rad3 related
- EGFR epidermatitise
- ERBB2 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2
- ERBB3 v-erb-b2 erythroblastic leukemia viral on
- proteins associated with a secretase disorder may include PSENEN (presenilin enhancer 2 homolog ( C. elegans )), CTSB (cathepsin B), PSEN1 (presenilin 1), APP (amyloid beta (A4) precursor protein), APHIB (anterior pharynx defective 1 homolog B ( C. elegans )), PSEN2 (presenilin 2 (Alzheimer disease 4)), or BACE1 (beta-site APP-cleaving enzyme 1), for example.
- US Patent Publication No. 20110023146 describes use of zinc finger nucleases to genetically modify cells, animals and proteins associated with secretase-associated disorders.
- Secretases are essential for processing pre-proteins into their biologically active forms. Defects in various components of the secretase pathways contribute to many disorders, particularly those with hallmark amyloidogenesis or amyloid plaques, such as Alzheimer's disease (AD).
- AD Alzheimer's disease
- a secretase disorder and the proteins associated with these disorders are a diverse set of proteins that effect susceptibility for numerous disorders, the presence of the disorder, the severity of the disorder, or any combination thereof.
- the present disclosure comprises editing of any chromosomal sequences that encode proteins associated with a secretase disorder.
- the proteins associated with a secretase disorder are typically selected based on an experimental association of the secretase—related proteins with the development of a secretase disorder. For example, the production rate or circulating concentration of a protein associated with a secretase disorder may be elevated or depressed in a population with a secretase disorder relative to a population without a secretase disorder.
- Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry.
- proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry.
- the protein associated with a secretase disorder may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR).
- proteins associated with a secretase disorder include PSENEN (presenilin enhancer 2 homolog ( C. elegans )), CTSB (cathepsin B), PSEN 1 (presenilin 1), APP (amyloid beta (A4) precursor protein), APH 1B (anterior pharynx defective 1 homolog B ( C.
- elegans elegans
- PSEN2 presenilin 2 (Alzheimer disease 4)
- BACE1 beta-site APP-cleaving enzyme 1
- ITM2B integrated membrane protein 2B
- CTSD cathepsin D
- NOTCH1 Notch homolog 1, translocation-associated (Drosophila)
- TNF tumor necrosis factor
- INS INS
- DYT10 (dystonia 10), ADAM17 (ADAM metallopeptidase domain 17), APOE (apolipoprotein E), ACE (angiotensin I converting enzyme (peptidyl-dipeptidase A) 1), STN (statin), TP53 (tumor protein p53), IL6 (interleukin 6 (interferon, beta 2)), NGFR (nerve growth factor receptor (TNFR superfamily, member 16)), IL1B (interleukin 1, beta), ACHE (acetylcholinesterase (Yt blood group)), CTNNB1 (catenin (cadherin-associated protein), beta 1, 88 kDa).
- IGF1 insulin-like growth factor 1 (somatomedin C)
- IFNG interferon, gamma
- NRG1 neutral receptor 1
- CASP3 caspase 3, apoptosis-related cysteine peptidase
- MAPK1 mitogen-activated protein kinase 1
- CDH1 cadherin 1, type 1, E-cadherin (epithelial)
- APBB1 amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65)
- HMGCR 3-hydroxy-3-methylglutaryl-Coenzyme A reductase
- CREB1 cAMP responsive element binding protein 1
- PTGS2 prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
- HES1 hairy and enhancer of split 1, (Drosophila)
- CAT catalase
- TGFB1 transforming growth factor, beta
- TRAPPC10 trafficking protein particle complex 10
- MAOB monoamine oxidase B
- NGF nerve growth factor (beta polypeptide)
- MMP12 matrix metallopeptidase 12 (macrophage elastase)
- JAG I jagged 1 (Alagille syndrome)
- CD40LG CD40 ligand
- PPARG peroxisome proliferator-activated receptor gamma
- FGF2 fibroblast growth factor 2 (basic)
- IL3 interleukin 3 (colony-stimulating factor, multiple)
- LRP1 low density lipoprotein receptor-related protein 1
- NOTCH4 Notch homolog 4 (Drosophila)
- MAPK8 mitogen-activated protein kinase 8
- PREP prolyl endopeptidase
- NOTCH3 Notch homolog 3 (Drosophila)
- PRNP prion protein
- CTSG cathepsin G
- EGF epidermal growth factor
- REN renin
- CD44 CD44 molecule (Indian blood group)
- SELP selective protein P (granule membrane protein 140 kDa, antigen CD62)
- GHR growth hormone receptor
- ADCYAP1 adenylate cyclase activating polypeptide 1 (pituitary)
- INSR insulin receptor
- GFAP glial fibrillary acidic protein
- MMP3 matrix metallopeptidase 3 (stromelysin 1, progelatinase)
- MAPK10 mitogen-activated protein kinase 10
- SP1 Sp1 transcription factor
- MYC v-myc myelocytomatosis viral oncogene homolog (avian)
- CTSE cathepsin E
- PPARA peroxisome proliferator-activated receptor alpha
- JUN jun oncogene
- TIMP1 TIMP metallopeptidase inhibitor 1
- IL5 interleukin 5 (colony-stimulating
- IL1R1 interleukin 1 receptor, type I
- PROK1 prokincticin 1
- MAPK3 mitogen-activated protein kinase 3
- NTRK1 neurotrophic tyrosine kinase, receptor, type 1
- IL13 interleukin 13
- MME membrane metallo-endopeptidase
- TKT transketolase
- CXCR2 chemokine (C—X—C motif) receptor 2
- IGFIR insulin-like growth factor 1 receptor
- RARA retinoic acid receptor, alpha
- CREBBP CREB binding protein
- PTGS1 prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
- GALT galactose-1-phosphate uridylyltransferase
- CHRM 1 cholinergic receptor, muscarinic 1
- ATXN cholinergic receptor, mus
- CYP46A1 cytochrome P450, family 46, subfamily A, polypeptide 1
- CSNK1 D casein kinase 1, delta
- MAPK14 mitogen-activated protein kinase 14
- PRG2 proteoglycan 2, bone marrow (natural killer cell activator, cosinophil granule major basic protein)
- PRKCA protein kinase C, alpha
- L1 CAM L1 cell adhesion molecule
- CD40 CD40 molecule, TNF receptor superfamily member 5
- NR112 nuclear receptor subfamily 1, group 1, member 2
- JAG2 jagged 2
- CTNNDI catenin (cadherin-associated protein), delta 1)
- CDH2 cadherin 2, type 1, N-cadherin (neuronal)
- CMA1 chymase 1, mast cell
- SORT1 sortilin 1
- DLK1 delta-like 1 homolog (Drosophila)
- THEM4 thioesterase superfamily member 4
- JUP junction plakoglobin
- CD46 CD46 molecule, complement regulatory protein
- CCL11 chemokine (C—C motif) ligand 11
- CAV3 caveolin 3
- RNASE3 ribonuclease.
- RNase A family 3 (eosinophil cationic protein)), HSPA8 (heat shock 70 kDa protein 8), CASP9 (caspase 9, apoptosis-related cysteine peptidase), CYP3A4 (cytochrome P450, family 3, subfamily A, polypeptide 4).
- CCR3 chemokine (C—C motif) receptor 3
- TFAP2A transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
- SCP2 sterol carrier protein 2
- CDK4 cyclin-dependent kinase 4
- HIF1A hyperoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
- TCF7L2 transcription factor 7-like 2 (T-cell specific, HMG-box)
- IL1R2 interleukin I receptor, type II
- B3GALTL beta 1,3-galactosyltransferasc-like
- MDM2 Mdm2 p53 binding protein homolog (mouse)
- RELA v-rel reticuloendotheliosis viral oncogene homolog A (avian)
- CASP7 caspase 7, apoptosis-related cysteine peptidase
- IDE insulin-degrading
- CASK calcium/calmodulin-dependent serine protein kinase (MAGUK family)
- ADCYAP1R1 adenylate cyclase activating polypeptide 1 (pituitary) receptor type I
- ATF4 activating transcription factor 4 (tax-responsive enhancer element B67)
- PDGFA platelet-derived growth factor alpha polypeptide
- C21 or f33 chromosome 21 open reading frame 33
- SCG5 secretogranin V (7B2 protein)
- RNF123 ring finger protein 123
- NFKB1 nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
- ERBB2 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2
- neuro/glioblastoma derived oncogene homolog avian
- CAV1 caveolin 1, caveolae protein, 22 kDa
- MMP7 matrix metallopeptidase 7 (matrilysin
- the genetically modified animal or cell may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more disrupted chromosomal sequences encoding a protein associated with a secretase disorder and zero, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more chromosomally integrated sequences encoding a disrupted protein associated with a secretase disorder.
- proteins associated with Amyotrophic Lateral Sclerosis may include SOD1 (superoxide dismutase 1), ALS2 (amyotrophic lateral sclerosis 2), FUS (fused in sarcoma), TARDBP (TAR DNA binding protein), VAGFA (vascular endothelial growth factor A), VAGFB (vascular endothelial growth factor B), and VAGFC (vascular endothelial growth factor C), and any combination thereof.
- SOD1 superoxide dismutase 1
- ALS2 amotrophic lateral sclerosis 2
- FUS fused in sarcoma
- TARDBP TAR DNA binding protein
- VAGFA vascular endothelial growth factor A
- VAGFB vascular endothelial growth factor B
- VAGFC vascular endothelial growth factor C
- ALS amyotrophyic lateral sclerosis
- Motor neuron disorders and the proteins associated with these disorders are a diverse set of proteins that effect susceptibility for developing a motor neuron disorder, the presence of the motor neuron disorder, the severity of the motor neuron disorder or any combination thereof.
- the present disclosure comprises editing of any chromosomal sequences that encode proteins associated with ALS disease, a specific motor neuron disorder.
- the proteins associated with ALS are typically selected based on an experimental association of ALS—related proteins to ALS. For example, the production rate or circulating concentration of a protein associated with ALS may be elevated or depressed in a population with A LS relative to a population without ALS.
- Differences in protein levels may be assessed using proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry.
- proteomic techniques including but not limited to Western blot, immunohistochemical staining, enzyme linked immunosorbent assay (ELISA), and mass spectrometry.
- the proteins associated with ALS may be identified by obtaining gene expression profiles of the genes encoding the proteins using genomic techniques including but not limited to DNA microarray analysis, serial analysis of gene expression (SAGE), and quantitative real-time polymerase chain reaction (Q-PCR).
- proteins associated with ALS include but are not limited to the following proteins: SOD1 superoxide dismutase 1, ALS3 amyotrophic lateral soluble sclerosis 3 SETX senataxin ALS5 amyotrophic lateral sclerosis 5 FUS fused in sarcoma ALS7 amyotrophic lateral sclerosis 7 ALS2 amyotrophic lateral DPP6 Dipeptidyl-peptidase 6 sclerosis 2 NEFH neurofilament, heavy PTGS1 prostaglandin-polypeptide endoperoxide synthase 1 SLCIA2 solute carrier family 1 TNFRSF10B tumor necrosis factor (glial high affinity receptor superfamily, glutamate transporter), member 10b member 2 PRPH peripherin HSP90AA heat shock protein 90 kDa alpha (cytosolic), class A member 1 GRIA2 glutamate receptor, IFNG interferon, gamma ionotropic, AMPA 2 SOD1 superoxide dismut
- FIG. 4 homolog, SAC1 kinesin binding 2 lipid phosphatase domain containing NIF3L1 NIF3 NGGI interacting INA internexin neuronal factor 3-like 1 intermediate filament protein, alpha PARD3B par-3 partitioning COX8A cytochrome c oxidase defective 3 homolog B subunit VIIIA CDKI5 cyclin-dependent kinase HECW1 HECT, C2 and WW 15 domain containing E3 ubiquitin protein ligase 1 NOS1 nitric oxide synthase 1 MET met proto-oncogene SOD2 superoxide dismutase 2, HSPB 1 heat shock 27 kDa mitochondrial protein 1 NEFL neurofilament, light CTSB cathepsin B polypeptide ANG angiogenin.
- the animal or cell may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more disrupted chromosomal sequences encoding a protein associated with ALS and zero, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more chromosomally integrated sequences encoding the disrupted protein associated with ALS.
- Preferred proteins associated with ALS include SOD1 (superoxide dismutase 1), ALS2 (amyotrophic lateral sclerosis 2), FUS (fused in sarcoma), TARDBP (TAR DNA binding protein), VAGFA (vascular endothelial growth factor A), VAGFB (vascular endothelial growth factor B), and VAGFC (vascular endothelial growth factor C), and any combination thereof.
- proteins associated with prion diseases may include SOD I (superoxide dismutase 1), ALS2 (amyotrophic lateral sclerosis 2), FUS (fused in sarcoma), TARDBP (TAR DNA binding protein), VAGFA (vascular endothelial growth factor A), VAGFB (vascular endothelial growth factor B), and VAGFC (vascular endothelial growth factor C), and any combination thereof.
- proteins related to neurodegenerative conditions in prion disorders may include A2M (Alpha-2-Macroglobulin), AATF (Apoptosis antagonizing transcription factor), ACPP (Acid phosphatase prostate), ACTA2 (Actin alpha 2 smooth muscle aorta), ADAM22 (ADAM metallopeptidase domain), ADORA3 (Adenosine A3 receptor), or ADRA1D (Alpha-1D adrenergic receptor for Alpha-ID adrenoreceptor), for example.
- A2M Alpha-2-Macroglobulin
- AATF Apoptosis antagonizing transcription factor
- ACPP Acid phosphatase prostate
- ACTA2 Actin alpha 2 smooth muscle aorta
- ADAM22 ADAM metallopeptidase domain
- ADORA3 Adrenergic receptor for Alpha-ID adrenoreceptor
- proteins associated with Immunodeficiency may include A2M [alpha-2-macroglobulin]; AANAT [arylalkylamine N-acetyltransferase]; ABCA1 [ATP-binding cassette, sub-family A (ABC 1), member 1], ABCA2 [ATP-binding cassette, sub-family A (ABC), member 2]; or ABCA3 [ATP-binding cassette, sub-family A (ABC1), member 3]; for example.
- proteins associated with Trinucleotide Repeat Disorders include AR (androgen receptor), FMR1 (fragile X mental retardation 1). HTT (huntingtin), or DMPK (dystrophia myotonica-protein kinase), FXN (frataxin), ATXN2 (ataxin 2), for example.
- proteins associated with Neurotransmission Disorders include SST (somatostatin), NOS I (nitric oxide synthase 1 (neuronal)), ADRA2A (adrenergic, alpha-2A-, receptor), ADRA2C (adrenergic, alpha-2C-, receptor), TACR1 (tachykinin receptor 1), or HTR2c (5-hydroxytryptamine (serotonin) receptor 2C), for example.
- neurodevelopmental-associated sequences include A2BPI [ataxin 2-binding protein 1], AADAT [aminoadipate aminotransferase], AANAT [arylalkylamine N-acetyltransferase], ABAT [4-aminobutyrate aminotransferase], ABCA1 [ATP-binding cassette, sub-family A (ABC1), member 1], or ABCA13 [ATP-binding cassette, sub-family A (ABC1), member 13], for example.
- A2BPI ataxin 2-binding protein 1
- AADAT aminoadipate aminotransferase
- AANAT arylalkylamine N-acetyltransferase
- ABAT 4-aminobutyrate aminotransferase
- ABCA1 ATP-binding cassette, sub-family A (ABC1), member 1
- ABCA13 ATP-binding cassette, sub-family A (ABC1), member 13
- preferred conditions treatable with the present system include may be selected from: Aicardi-Goutieres Syndrome; Alexander Disease; Allan-Herndon-Dudley Syndrome; POLG-Related Disorders; Alpha-Mannosidosis (Type II and III); Alström Syndrome; Angelman; Syndrome; Ataxia-Telangiectasia; Neuronal Ceroid-Lipofuscinoses; Beta-Thalassemia; Bilateral Optic Atrophy and (Infantile) Optic Atrophy Type 1; Retinoblastoma (bilateral); Canavan Disease; Cerebrooculofacioskeletal Syndrome 1 [COFS1]; Cerebrotendinous Xanthomatosis; Cornelia de Lange Syndrome; MAPT-Related Disorders; Genetic Prion Diseases; Dravet Syndrome; Early-Onset Familial Alzheimer Disease; Friedreich Ataxia [FRDA]; Fryns Syndrome; Fucosidosis; Fukuyama Congenital Muscular Dystrophy; Galactosialidosis;
- the present system can be used to target any polynucleotide sequence of interest.
- Some examples of conditions or diseases that might be usefully treated using the present system are included in the Tables above and examples of genes currently associated with those conditions are also provided there. However, the genes exemplified are not exhaustive.
- wild type StCas9 refers to wild type Cas9 from S thermophilus , the protein sequence of which is given in the SwissProt database under accession number G3ECR1.
- S pyogenes Cas9 is included in SwissProt under accession number Q99ZW2.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Physics & Mathematics (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Virology (AREA)
- Environmental Sciences (AREA)
- Physical Education & Sports Medicine (AREA)
- Bioinformatics & Computational Biology (AREA)
- Evolutionary Biology (AREA)
- Theoretical Computer Science (AREA)
- Spectroscopy & Molecular Physics (AREA)
- Medical Informatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Analytical Chemistry (AREA)
- Orthopedic Medicine & Surgery (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US14/104,837 US20140179770A1 (en) | 2012-12-12 | 2013-12-12 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US14/183,512 US20140242699A1 (en) | 2012-12-12 | 2014-02-18 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US15/430,260 US20170152528A1 (en) | 2012-12-12 | 2017-02-10 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US18/217,357 US20230399662A1 (en) | 2012-12-12 | 2023-06-30 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US18/217,352 US20240035048A1 (en) | 2012-12-12 | 2023-06-30 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US19/025,611 US20250250589A1 (en) | 2012-12-12 | 2025-01-16 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
Applications Claiming Priority (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201261736527P | 2012-12-12 | 2012-12-12 | |
| US201361748427P | 2013-01-02 | 2013-01-02 | |
| US201361758468P | 2013-01-30 | 2013-01-30 | |
| US201361769046P | 2013-02-25 | 2013-02-25 | |
| US201361802174P | 2013-03-15 | 2013-03-15 | |
| US201361791409P | 2013-03-15 | 2013-03-15 | |
| US201361806375P | 2013-03-28 | 2013-03-28 | |
| US201361814263P | 2013-04-20 | 2013-04-20 | |
| US201361819803P | 2013-05-06 | 2013-05-06 | |
| US201361828130P | 2013-05-28 | 2013-05-28 | |
| US201361835931P | 2013-06-17 | 2013-06-17 | |
| US201361836123P | 2013-06-17 | 2013-06-17 | |
| US201361847537P | 2013-07-17 | 2013-07-17 | |
| US14/104,837 US20140179770A1 (en) | 2012-12-12 | 2013-12-12 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/183,512 Continuation US20140242699A1 (en) | 2012-12-12 | 2014-02-18 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20140179770A1 true US20140179770A1 (en) | 2014-06-26 |
Family
ID=49883289
Family Applications (10)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/104,837 Abandoned US20140179770A1 (en) | 2012-12-12 | 2013-12-12 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US14/183,512 Abandoned US20140242699A1 (en) | 2012-12-12 | 2014-02-18 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US14/481,339 Abandoned US20150020223A1 (en) | 2012-12-12 | 2014-09-09 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US15/349,603 Active US11041173B2 (en) | 2012-12-12 | 2016-11-11 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US15/430,260 Pending US20170152528A1 (en) | 2012-12-12 | 2017-02-10 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US17/245,952 Active 2036-03-11 US12252707B2 (en) | 2012-12-12 | 2021-04-30 | Delivery, Engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US18/217,357 Pending US20230399662A1 (en) | 2012-12-12 | 2023-06-30 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US18/217,352 Pending US20240035048A1 (en) | 2012-12-12 | 2023-06-30 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US19/025,611 Pending US20250250589A1 (en) | 2012-12-12 | 2025-01-16 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US19/079,830 Pending US20250382642A1 (en) | 2012-12-12 | 2025-03-14 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
Family Applications After (9)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/183,512 Abandoned US20140242699A1 (en) | 2012-12-12 | 2014-02-18 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US14/481,339 Abandoned US20150020223A1 (en) | 2012-12-12 | 2014-09-09 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US15/349,603 Active US11041173B2 (en) | 2012-12-12 | 2016-11-11 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US15/430,260 Pending US20170152528A1 (en) | 2012-12-12 | 2017-02-10 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US17/245,952 Active 2036-03-11 US12252707B2 (en) | 2012-12-12 | 2021-04-30 | Delivery, Engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US18/217,357 Pending US20230399662A1 (en) | 2012-12-12 | 2023-06-30 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US18/217,352 Pending US20240035048A1 (en) | 2012-12-12 | 2023-06-30 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US19/025,611 Pending US20250250589A1 (en) | 2012-12-12 | 2025-01-16 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US19/079,830 Pending US20250382642A1 (en) | 2012-12-12 | 2025-03-14 | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
Country Status (15)
| Country | Link |
|---|---|
| US (10) | US20140179770A1 (enExample) |
| EP (5) | EP4549566A3 (enExample) |
| JP (5) | JP2016501531A (enExample) |
| KR (1) | KR20150105956A (enExample) |
| CN (2) | CN105164264B (enExample) |
| AU (4) | AU2013359199C1 (enExample) |
| BR (1) | BR112015013784A2 (enExample) |
| DK (2) | DK3327127T3 (enExample) |
| ES (2) | ES2883590T3 (enExample) |
| IL (2) | IL293526A (enExample) |
| MX (2) | MX389793B (enExample) |
| RU (1) | RU2721275C2 (enExample) |
| SG (3) | SG10201912328UA (enExample) |
| WO (1) | WO2014093622A2 (enExample) |
| ZA (1) | ZA201504132B (enExample) |
Cited By (424)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140342457A1 (en) * | 2012-12-17 | 2014-11-20 | President And Fellows Of Harvard College | RNA-Guided Human Genome Engineering |
| US20140356956A1 (en) * | 2013-06-04 | 2014-12-04 | President And Fellows Of Harvard College | RNA-Guided Transcriptional Regulation |
| CN104293831A (zh) * | 2014-09-28 | 2015-01-21 | 上海云舜生物技术有限公司 | 建立高血压小鼠模型的方法及其用途 |
| US20150024500A1 (en) * | 2013-07-19 | 2015-01-22 | Larix Bioscience, Llc | Methods and compositions for producing double allele knock outs |
| WO2015065964A1 (en) | 2013-10-28 | 2015-05-07 | The Broad Institute Inc. | Functional genomics using crispr-cas systems, compositions, methods, screens and applications thereof |
| WO2015089354A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders |
| WO2015089465A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders |
| WO2015089419A2 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components |
| WO2015089486A2 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Systems, methods and compositions for sequence manipulation with optimized functional crispr-cas systems |
| WO2015089364A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Crystal structure of a crispr-cas system, and uses thereof |
| US20150259684A1 (en) * | 2013-07-10 | 2015-09-17 | President And Fellows Of Harvard College | Orthogonal Cas9 Proteins for RNA-Guided Gene Regulation and Editing |
| US9228208B2 (en) | 2013-12-11 | 2016-01-05 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a genome |
| US9234213B2 (en) | 2013-03-15 | 2016-01-12 | System Biosciences, Llc | Compositions and methods directed to CRISPR/Cas genomic engineering systems |
| US20160040165A1 (en) * | 2013-04-04 | 2016-02-11 | United States Government As Represented By The Department Of Veterans Affairs | Compositions and methods for in vivo excision of hiv-1 proviral dna |
| US9260752B1 (en) | 2013-03-14 | 2016-02-16 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| WO2016025469A1 (en) * | 2014-08-11 | 2016-02-18 | The Board Of Regents Of The University Of Texas System | Prevention of muscular dystrophy by crispr/cas9-mediated gene editing |
| WO2016036754A1 (en) | 2014-09-02 | 2016-03-10 | The Regents Of The University Of California | Methods and compositions for rna-directed target dna modification |
| WO2016049251A1 (en) | 2014-09-24 | 2016-03-31 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling mutations in leukocytes |
| WO2016049163A2 (en) | 2014-09-24 | 2016-03-31 | The Broad Institute Inc. | Use and production of chd8+/- transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder |
| WO2016057755A1 (en) * | 2014-10-09 | 2016-04-14 | Anthrogenesis Corporation | Placenta-derived adherent cell exosomes and uses thereof |
| WO2016057850A1 (en) * | 2014-10-09 | 2016-04-14 | Seattle Children' S Hospital (Dba Seattle Children' S Research Institute) | Long poly (a) plasmids and methods for introduction of long poly (a) sequences into the plasmid |
| WO2016061523A1 (en) * | 2014-10-17 | 2016-04-21 | Howard Hughes Medical Institute | Genomic probes |
| US20160122774A1 (en) * | 2013-05-29 | 2016-05-05 | Cellectis | A method for producing precise dna cleavage using cas9 nickase activity |
| WO2016069591A2 (en) | 2014-10-27 | 2016-05-06 | The Broad Institute Inc. | Compositions, methods and use of synthetic lethal screening |
| WO2016086197A1 (en) | 2014-11-25 | 2016-06-02 | The Brigham And Women's Hospital, Inc. | Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease |
| WO2016086227A2 (en) | 2014-11-26 | 2016-06-02 | The Regents Of The University Of California | Therapeutic compositions comprising transcription factors and methods of making and using the same |
| WO2016094872A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Dead guides for crispr transcription factors |
| WO2016094880A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Delivery, use and therapeutic applications of crispr systems and compositions for genome editing as to hematopoietic stem cells (hscs) |
| WO2016094874A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Escorted and functionalized guides for crispr-cas systems |
| WO2016094867A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Protected guide rnas (pgrnas) |
| WO2016100974A1 (en) | 2014-12-19 | 2016-06-23 | The Broad Institute Inc. | Unbiased identification of double-strand breaks and genomic rearrangement by genome-wide insert capture sequencing |
| WO2016106236A1 (en) | 2014-12-23 | 2016-06-30 | The Broad Institute Inc. | Rna-targeting system |
| WO2016106244A1 (en) | 2014-12-24 | 2016-06-30 | The Broad Institute Inc. | Crispr having or associated with destabilization domains |
| WO2016109840A2 (en) | 2014-12-31 | 2016-07-07 | Synthetic Genomics, Inc. | Compositions and methods for high efficiency in vivo genome editing |
| WO2016108926A1 (en) | 2014-12-30 | 2016-07-07 | The Broad Institute Inc. | Crispr mediated in vivo modeling and genetic screening of tumor growth and metastasis |
| WO2016114972A1 (en) | 2015-01-12 | 2016-07-21 | The Regents Of The University Of California | Heterodimeric cas9 and methods of use thereof |
| US20160215275A1 (en) * | 2015-01-27 | 2016-07-28 | Minghong Zhong | Chemically Ligated RNAs for CRISPR/Cas9-lgRNA Complexes as Antiviral Therapeutic Agents |
| WO2016131009A1 (en) * | 2015-02-13 | 2016-08-18 | University Of Massachusetts | Compositions and methods for transient delivery of nucleases |
| WO2016138488A2 (en) | 2015-02-26 | 2016-09-01 | The Broad Institute Inc. | T cell balance gene expression, compositions of matters and methods of use thereof |
| WO2016138574A1 (en) | 2015-03-02 | 2016-09-09 | Sinai Health System | Homologous recombination factors |
| WO2016141224A1 (en) | 2015-03-03 | 2016-09-09 | The General Hospital Corporation | Engineered crispr-cas9 nucleases with altered pam specificity |
| WO2016154176A1 (en) * | 2015-03-26 | 2016-09-29 | Yale University | Methods and compositions for modifying endothelial cells |
| US20160289637A1 (en) * | 2015-04-03 | 2016-10-06 | Dana-Farber Cancer Institute, Inc. | Composition and methods of genome editing of b-cells |
| WO2016182893A1 (en) | 2015-05-08 | 2016-11-17 | Teh Broad Institute Inc. | Functional genomics using crispr-cas systems for saturating mutagenesis of non-coding elements, compositions, methods, libraries and applications thereof |
| US9512446B1 (en) | 2015-08-28 | 2016-12-06 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| WO2016196655A1 (en) | 2015-06-03 | 2016-12-08 | The Regents Of The University Of California | Cas9 variants and methods of use thereof |
| WO2016205745A2 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Cell sorting |
| WO2016205728A1 (en) | 2015-06-17 | 2016-12-22 | Massachusetts Institute Of Technology | Crispr mediated recording of cellular events |
| WO2016205764A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| US9567604B2 (en) | 2013-03-15 | 2017-02-14 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
| US9580701B2 (en) | 2015-01-28 | 2017-02-28 | Pioneer Hi-Bred International, Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| WO2017040348A1 (en) | 2015-08-28 | 2017-03-09 | The General Hospital Corporation | Engineered crispr-cas9 nucleases |
| US9596835B2 (en) | 2008-05-28 | 2017-03-21 | University Of Massachusetts | Isolation of novel AAV's and uses thereof |
| WO2017069958A2 (en) | 2015-10-09 | 2017-04-27 | The Brigham And Women's Hospital, Inc. | Modulation of novel immune checkpoint targets |
| WO2017070605A1 (en) | 2015-10-22 | 2017-04-27 | The Broad Institute Inc. | Type vi-b crispr enzymes and systems |
| GB2543873A (en) * | 2015-05-29 | 2017-05-03 | Agenovir Corp | Compositions and methods for cell targeted HPV treatment |
| WO2017074788A1 (en) | 2015-10-27 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for targeting cancer-specific sequence variations |
| WO2017075451A1 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting pou2af1 |
| WO2017075465A1 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting gata3 |
| WO2017075294A1 (en) | 2015-10-28 | 2017-05-04 | The Board Institute Inc. | Assays for massively combinatorial perturbation profiling and cellular circuit reconstruction |
| WO2017075478A2 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by use of immune cell gene signatures |
| WO2017083274A1 (en) * | 2015-11-09 | 2017-05-18 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Novel rna-based vector system for transient and stable gene expression |
| WO2017083852A1 (en) | 2015-11-13 | 2017-05-18 | MOORE, Tara | Methods for the treatment of corneal dystrophies |
| WO2017083722A1 (en) * | 2015-11-11 | 2017-05-18 | Greenberg Kenneth P | Crispr compositions and methods of using the same for gene therapy |
| WO2017087708A1 (en) | 2015-11-19 | 2017-05-26 | The Brigham And Women's Hospital, Inc. | Lymphocyte antigen cd5-like (cd5l)-interleukin 12b (p40) heterodimers in immunity |
| WO2017114497A1 (en) | 2015-12-30 | 2017-07-06 | Novartis Ag | Immune effector cell therapies with enhanced efficacy |
| WO2017143071A1 (en) | 2016-02-18 | 2017-08-24 | The Regents Of The University Of California | Methods and compositions for gene editing in stem cells |
| WO2017147196A1 (en) | 2016-02-22 | 2017-08-31 | Massachusetts Institute Of Technology | Methods for identifying and modulating immune phenotypes |
| WO2017161325A1 (en) | 2016-03-17 | 2017-09-21 | Massachusetts Institute Of Technology | Methods for identifying and modulating co-occurant cellular phenotypes |
| WO2017161043A1 (en) | 2016-03-16 | 2017-09-21 | The J. David Gladstone Institutes | Methods and compositions for treating obesity and/or diabetes and for identifying candidate treatment agents |
| US9822370B2 (en) | 2013-04-04 | 2017-11-21 | President And Fellows Of Harvard College | Method of making a deletion in a target sequence in isolated primary cells using Cas9 and two guide RNAs |
| US9834791B2 (en) | 2013-11-07 | 2017-12-05 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| US9834786B2 (en) | 2012-04-25 | 2017-12-05 | Regeneron Pharmaceuticals, Inc. | Nuclease-mediated targeting with large targeting vectors |
| WO2017219027A1 (en) | 2016-06-17 | 2017-12-21 | The Broad Institute Inc. | Type vi crispr orthologs and systems |
| US9850521B2 (en) * | 2014-08-01 | 2017-12-26 | Agilent Technologies, Inc. | In vitro assay buffer for Cas9 |
| US9856497B2 (en) * | 2016-01-11 | 2018-01-02 | The Board Of Trustee Of The Leland Stanford Junior University | Chimeric proteins and methods of regulating gene expression |
| WO2018005445A1 (en) | 2016-06-27 | 2018-01-04 | The Broad Institute, Inc. | Compositions and methods for detecting and treating diabetes |
| WO2018013840A1 (en) | 2016-07-13 | 2018-01-18 | Vertex Pharmaceuticals Incorporated | Methods, compositions and kits for increasing genome editing efficiency |
| US9885026B2 (en) | 2011-12-30 | 2018-02-06 | Caribou Biosciences, Inc. | Modified cascade ribonucleoproteins and uses thereof |
| US9885057B2 (en) | 2011-04-21 | 2018-02-06 | University Of Massachusetts | RAAV-based compositions and methods for treating alpha-1 anti-trypsin deficiencies |
| WO2018035250A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute, Inc. | Methods for identifying class 2 crispr-cas systems |
| WO2018035364A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute Inc. | Product and methods useful for modulating and evaluating immune responses |
| WO2018039145A1 (en) | 2016-08-20 | 2018-03-01 | Avellino Lab Usa, Inc. | Single guide rna, crispr/cas9 systems, and methods of use thereof |
| WO2018047183A1 (en) | 2016-09-11 | 2018-03-15 | Yeda Research And Development Co. Ltd. | Compositions and methods for regulating gene expression for targeted mutagenesis |
| WO2018049025A2 (en) | 2016-09-07 | 2018-03-15 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses |
| WO2018048828A1 (en) | 2016-09-06 | 2018-03-15 | The Children's Medical Center Corporation | Immune cells derived from induced pluripotent stem cell |
| US9926546B2 (en) | 2015-08-28 | 2018-03-27 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| WO2018064371A1 (en) | 2016-09-30 | 2018-04-05 | The Regents Of The University Of California | Rna-guided nucleic acid modifying enzymes and methods of use thereof |
| US9938521B2 (en) | 2014-03-10 | 2018-04-10 | Editas Medicine, Inc. | CRISPR/CAS-related methods and compositions for treating leber's congenital amaurosis 10 (LCA10) |
| WO2018067991A1 (en) | 2016-10-07 | 2018-04-12 | The Brigham And Women's Hospital, Inc. | Modulation of novel immune checkpoint targets |
| WO2018073237A1 (en) | 2016-10-17 | 2018-04-26 | The University Court Of The University Of Edinburgh | Swine comprising modified cd163 and associated methods |
| WO2018083606A1 (en) | 2016-11-01 | 2018-05-11 | Novartis Ag | Methods and compositions for enhancing gene editing |
| US9970030B2 (en) | 2014-08-27 | 2018-05-15 | Caribou Biosciences, Inc. | Methods for increasing CAS9-mediated engineering efficiency |
| US9976144B2 (en) | 2016-01-19 | 2018-05-22 | Mubin I. Syed | Method for controlling obesity using minimally invasive means |
| US20180155715A1 (en) * | 2015-06-18 | 2018-06-07 | Robert D. Bowles | Rna-guided transcriptional regulation and methods of using the same for the treatment of back pain |
| US10000772B2 (en) | 2012-05-25 | 2018-06-19 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US20180171354A1 (en) * | 2015-06-03 | 2018-06-21 | National University Of Singapore | Vectors |
| WO2018112278A1 (en) | 2016-12-14 | 2018-06-21 | Ligandal, Inc. | Methods and compositions for nucleic acid and protein payload delivery |
| US10011850B2 (en) | 2013-06-21 | 2018-07-03 | The General Hospital Corporation | Using RNA-guided FokI Nucleases (RFNs) to increase specificity for RNA-Guided Genome Editing |
| US10035825B2 (en) | 2009-05-28 | 2018-07-31 | University Of Massachusetts | AAV's and uses thereof |
| US10039777B2 (en) | 2012-03-20 | 2018-08-07 | Neuro-Lm Sas | Methods and pharmaceutical compositions of the treatment of autistic syndrome disorders |
| US10072251B2 (en) | 2014-02-19 | 2018-09-11 | University Of Massachusetts | Recombinant AAVS having useful transcytosis properties |
| WO2018170333A1 (en) | 2017-03-15 | 2018-09-20 | The Broad Institute, Inc. | Novel cas13b orthologues crispr enzymes and systems |
| WO2018170515A1 (en) | 2017-03-17 | 2018-09-20 | The Broad Institute, Inc. | Methods for identifying and modulating co-occurant cellular phenotypes |
| WO2018191520A1 (en) | 2017-04-12 | 2018-10-18 | The Broad Institute, Inc. | Respiratory and sweat gland ionocytes |
| WO2018191750A2 (en) | 2017-04-14 | 2018-10-18 | The Broad Institute Inc. | Novel delivery of large payloads |
| WO2018191553A1 (en) | 2017-04-12 | 2018-10-18 | Massachusetts Eye And Ear Infirmary | Tumor signature for metastasis, compositions of matter methods of use thereof |
| WO2018191388A1 (en) | 2017-04-12 | 2018-10-18 | The Broad Institute, Inc. | Novel type vi crispr orthologs and systems |
| WO2018195486A1 (en) | 2017-04-21 | 2018-10-25 | The Broad Institute, Inc. | Targeted delivery to beta cells |
| WO2018195019A1 (en) | 2017-04-18 | 2018-10-25 | The Broad Institute Inc. | Compositions for detecting secretion and methods of use |
| WO2018195545A2 (en) | 2017-04-21 | 2018-10-25 | The General Hospital Corporation | Variants of cpf1 (cas12a) with altered pam specificity |
| US10124042B2 (en) * | 2014-01-31 | 2018-11-13 | Factor Bioscience Inc. | Methods and products for nucleic acid production and delivery |
| WO2018175502A3 (en) * | 2017-03-21 | 2018-11-15 | Shuber Anthony P | Treating cancer with cas endonuclease complexes |
| WO2018218166A1 (en) | 2017-05-25 | 2018-11-29 | The General Hospital Corporation | Using split deaminases to limit unwanted off-target base editor deamination |
| US20180360994A1 (en) * | 2015-07-25 | 2018-12-20 | Habib Frost | System, device and a method for providing a therapy or a cure for cancer and other pathological states |
| WO2019005884A1 (en) | 2017-06-26 | 2019-01-03 | The Broad Institute, Inc. | CRISPR / CAS-ADENINE DEAMINASE COMPOSITIONS, SYSTEMS AND METHODS FOR TARGETED NUCLEIC ACID EDITION |
| WO2019003193A1 (en) | 2017-06-30 | 2019-01-03 | Novartis Ag | METHODS FOR TREATING DISEASES USING GENE EDITING SYSTEMS |
| WO2019018440A1 (en) | 2017-07-17 | 2019-01-24 | The Broad Institute, Inc. | HUMAN COLON CELL ATLAS IN GOOD HEALTH AND WITH HEMORRHAGIC RECTO-COLITIS |
| US20190032090A1 (en) * | 2014-05-30 | 2019-01-31 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and Methods to Treat Latent Viral Infections |
| US10202600B2 (en) | 2010-04-23 | 2019-02-12 | University Of Massachusetts | AAV-based treatment of cholesterol-related disorders |
| US10208319B2 (en) | 2013-07-09 | 2019-02-19 | President And Fellows Of Harvard College | Therapeutic uses of genome editing with CRISPR/Cas systems |
| CN109475646A (zh) * | 2016-03-30 | 2019-03-15 | 因特利亚治疗公司 | 用于crispr/cas成分的脂质纳米颗粒制剂 |
| WO2019060746A1 (en) | 2017-09-21 | 2019-03-28 | The Broad Institute, Inc. | SYSTEMS, METHODS, AND COMPOSITIONS FOR THE TARGETED EDITING OF NUCLEIC ACIDS |
| WO2019067452A1 (en) * | 2017-09-27 | 2019-04-04 | Pioneer Hi-Bred International, Inc. | GROUND APPLICATION OF CROP PROTECTION AGENTS |
| WO2019071054A1 (en) | 2017-10-04 | 2019-04-11 | The Broad Institute, Inc. | METHODS AND COMPOSITIONS FOR MODIFYING THE FUNCTION AND STRUCTURE OF BUCKLES AND / OR CHROMATIN DOMAINS |
| WO2019070755A1 (en) | 2017-10-02 | 2019-04-11 | The Broad Institute, Inc. | METHODS AND COMPOSITIONS FOR DETECTING AND MODULATING A GENETIC SIGNATURE OF IMMUNOTHERAPY RESISTANCE IN CANCER |
| US10280418B2 (en) | 2014-03-18 | 2019-05-07 | Univeristy Of Massachusetts | RAAV-based compositions and methods for treating amyotrophic lateral sclerosis |
| WO2019087113A1 (en) | 2017-11-01 | 2019-05-09 | Novartis Ag | Synthetic rnas and methods of use |
| US10286073B2 (en) * | 2016-02-23 | 2019-05-14 | Ilisa Tech, Inc. | Magnetic control of gene delivery in vivo |
| US10286084B2 (en) | 2014-02-18 | 2019-05-14 | Duke University | Compositions for the inactivation of virus replication and methods of making and using the same |
| WO2019094983A1 (en) | 2017-11-13 | 2019-05-16 | The Broad Institute, Inc. | Methods and compositions for treating cancer by targeting the clec2d-klrb1 pathway |
| US10314297B2 (en) * | 2014-08-14 | 2019-06-11 | Biocytogen Boston Corp | DNA knock-in system |
| US10336807B2 (en) | 2016-01-11 | 2019-07-02 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric proteins and methods of immunotherapy |
| EP3514246A1 (en) | 2014-02-27 | 2019-07-24 | The Broad Institute Inc. | T cell balance gene expression and methods of use thereof |
| WO2019143678A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Dna-pk inhibitors |
| WO2019143675A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Dna-pk inhibitors |
| WO2019143677A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Quinoxalinone compounds, compositions, methods, and kits for increasing genome editing efficiency |
| US10370432B2 (en) | 2014-10-03 | 2019-08-06 | University Of Massachusetts | Heterologous targeting peptide grafted AAVS |
| US10385359B2 (en) | 2013-04-16 | 2019-08-20 | Regeneron Pharmaceuticals, Inc. | Targeted modification of rat genome |
| US10428319B2 (en) | 2017-06-09 | 2019-10-01 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| WO2019195738A1 (en) | 2018-04-06 | 2019-10-10 | Children's Medical Center Corporation | Compositions and methods for somatic cell reprogramming and modulating imprinting |
| CN110352242A (zh) * | 2016-12-23 | 2019-10-18 | 哈佛大学的校长及成员们 | Pcsk9的基因编辑 |
| US10450576B2 (en) | 2015-03-27 | 2019-10-22 | E I Du Pont De Nemours And Company | Soybean U6 small nuclear RNA gene promoters and their use in constitutive expression of small RNA genes in plants |
| WO2019204585A1 (en) | 2018-04-19 | 2019-10-24 | Massachusetts Institute Of Technology | Single-stranded break detection in double-stranded dna |
| US10457960B2 (en) | 2014-11-21 | 2019-10-29 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modification using paired guide RNAs |
| US10457940B2 (en) | 2016-09-22 | 2019-10-29 | University Of Massachusetts | AAV treatment of Huntington's disease |
| EP3560330A1 (en) | 2018-04-24 | 2019-10-30 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
| WO2019210268A2 (en) | 2018-04-27 | 2019-10-31 | The Broad Institute, Inc. | Sequencing-based proteomics |
| WO2019213660A2 (en) | 2018-05-04 | 2019-11-07 | The Broad Institute, Inc. | Compositions and methods for modulating cgrp signaling to regulate innate lymphoid cell inflammatory responses |
| US10471108B2 (en) | 2015-11-20 | 2019-11-12 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US10480011B2 (en) | 2014-10-21 | 2019-11-19 | University Of Massachusetts | Recombinant AAV variants and uses thereof |
| US10485830B2 (en) | 2016-12-12 | 2019-11-26 | 4D Pharma Plc | Compositions comprising bacterial strains |
| US10493112B2 (en) | 2015-06-15 | 2019-12-03 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| WO2019232542A2 (en) | 2018-06-01 | 2019-12-05 | Massachusetts Institute Of Technology | Methods and compositions for detecting and modulating microenvironment gene signatures from the csf of metastasis patients |
| US20190367924A1 (en) * | 2017-02-17 | 2019-12-05 | Temple University - Of The Commonwealth System Of Higher Education | Gene editing therapy for hiv infection via dual targeting of hiv genome and ccr5 |
| US10501794B2 (en) | 2014-06-23 | 2019-12-10 | The General Hospital Corporation | Genomewide unbiased identification of DSBs evaluated by sequencing (GUIDE-seq) |
| US10500237B2 (en) | 2015-06-15 | 2019-12-10 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US10519457B2 (en) | 2013-08-22 | 2019-12-31 | E I Du Pont De Nemours And Company | Soybean U6 polymerase III promoter and methods of use |
| WO2020006036A1 (en) | 2018-06-26 | 2020-01-02 | Massachusetts Institute Of Technology | Crispr effector system based amplification methods, systems, and diagnostics |
| WO2020006049A1 (en) | 2018-06-26 | 2020-01-02 | The Broad Institute, Inc. | Crispr/cas and transposase based amplification compositions, systems and methods |
| US10526589B2 (en) | 2013-03-15 | 2020-01-07 | The General Hospital Corporation | Multiplex guide RNAs |
| WO2020014528A1 (en) | 2018-07-13 | 2020-01-16 | The Regents Of The University Of California | Retrotransposon-based delivery vehicle and methods of use thereof |
| US10544405B2 (en) * | 2013-01-16 | 2020-01-28 | Emory University | Cas9-nucleic acid complexes and uses related thereto |
| WO2020028555A2 (en) | 2018-07-31 | 2020-02-06 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
| WO2020033601A1 (en) | 2018-08-07 | 2020-02-13 | The Broad Institute, Inc. | Novel cas12b enzymes and systems |
| WO2020041380A1 (en) | 2018-08-20 | 2020-02-27 | The Broad Institute, Inc. | Methods and compositions for optochemical control of crispr-cas9 |
| WO2020041387A1 (en) | 2018-08-20 | 2020-02-27 | The Brigham And Women's Hospital, Inc. | Degradation domain modifications for spatio-temporal control of rna-guided nucleases |
| WO2020041456A1 (en) | 2018-08-22 | 2020-02-27 | The Regents Of The University Of California | Variant type v crispr/cas effector polypeptides and methods of use thereof |
| US10583158B2 (en) | 2016-03-04 | 2020-03-10 | 4D Pharma Plc | Compositions comprising bacterial strains |
| WO2020051507A1 (en) | 2018-09-06 | 2020-03-12 | The Broad Institute, Inc. | Nucleic acid assemblies for use in targeted delivery |
| US10610548B2 (en) | 2016-07-13 | 2020-04-07 | 4D Pharma Plc | Compositions comprising bacterial strains |
| US10610550B2 (en) | 2015-11-20 | 2020-04-07 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| WO2020077236A1 (en) | 2018-10-12 | 2020-04-16 | The Broad Institute, Inc. | Method for extracting nuclei or whole cells from formalin-fixed paraffin-embedded tissues |
| WO2020081730A2 (en) | 2018-10-16 | 2020-04-23 | Massachusetts Institute Of Technology | Methods and compositions for modulating microenvironment |
| EP3653229A1 (en) | 2013-12-12 | 2020-05-20 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for genome editing |
| US10669539B2 (en) | 2016-10-06 | 2020-06-02 | Pioneer Biolabs, Llc | Methods and compositions for generating CRISPR guide RNA libraries |
| US10676754B2 (en) | 2014-07-11 | 2020-06-09 | E I Du Pont De Nemours And Company | Compositions and methods for producing plants resistant to glyphosate herbicide |
| US20200188521A1 (en) * | 2017-04-28 | 2020-06-18 | Exicure, Inc. | Synthesis of spherical nucleic acids using lipophilic moieties |
| US10687520B2 (en) | 2017-03-07 | 2020-06-23 | The Board Of Regents Of The University Of Texas System | Generation and correction of a humanized mouse model with a deletion of dystrophin exon 44 |
| US10689653B2 (en) | 2014-06-03 | 2020-06-23 | University Of Massachusetts | Compositions and methods for modulating dysferlin expression |
| WO2020131862A1 (en) | 2018-12-17 | 2020-06-25 | The Broad Institute, Inc. | Crispr-associated transposase systems and methods of use thereof |
| WO2020131586A2 (en) | 2018-12-17 | 2020-06-25 | The Broad Institute, Inc. | Methods for identifying neoantigens |
| US10711270B2 (en) | 2014-10-03 | 2020-07-14 | University Of Massachusetts | High efficiency library-identified AAV vectors |
| EP3686279A1 (en) | 2014-08-17 | 2020-07-29 | The Broad Institute, Inc. | Genome editing using cas9 nickases |
| US10731181B2 (en) | 2012-12-06 | 2020-08-04 | Sigma, Aldrich Co. LLC | CRISPR-based genome modification and regulation |
| US10736926B2 (en) | 2015-06-15 | 2020-08-11 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US10738303B2 (en) | 2015-09-30 | 2020-08-11 | The General Hospital Corporation | Comprehensive in vitro reporting of cleavage events by sequencing (CIRCLE-seq) |
| WO2020163856A1 (en) | 2019-02-10 | 2020-08-13 | The J. David Gladstone Institutes, A Testamentary Trust Established Under The Will Of J. David Gladstone | Modified mitochondrion and methods of use thereof |
| WO2020163396A1 (en) | 2019-02-04 | 2020-08-13 | The General Hospital Corporation | Adenine dna base editor variants with reduced off-target rna editing |
| WO2020146276A3 (en) * | 2019-01-07 | 2020-08-13 | Emendobio Inc. | Crispr compostions and methods for promoting gene editing of adenosine deaminase 2 (ada2) |
| US10767201B2 (en) | 2015-09-10 | 2020-09-08 | Yeda Research And Development Co. Ltd. | CYP76AD1-beta clade polynucleotides, polypeptides, and uses thereof |
| US10780134B2 (en) | 2015-06-15 | 2020-09-22 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| WO2020206036A1 (en) | 2019-04-01 | 2020-10-08 | The Broad Institute, Inc. | Novel nucleic acid modifier |
| WO2020225754A1 (en) | 2019-05-06 | 2020-11-12 | Mcmullen Tara | Crispr gene editing for autosomal dominant diseases |
| WO2020229533A1 (en) | 2019-05-13 | 2020-11-19 | KWS SAAT SE & Co. KGaA | Drought tolerance in corn |
| WO2020236967A1 (en) | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Random crispr-cas deletion mutant |
| WO2020236972A2 (en) | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Non-class i multi-component nucleic acid targeting systems |
| US10851380B2 (en) | 2012-10-23 | 2020-12-01 | Toolgen Incorporated | Methods for cleaving a target DNA using a guide RNA specific for the target DNA and Cas protein-encoding nucleic acid or Cas protein |
| US10851137B2 (en) | 2013-04-10 | 2020-12-01 | 4D Pharma Research Limited | Polypeptide and immune modulation |
| WO2020243661A1 (en) | 2019-05-31 | 2020-12-03 | The Broad Institute, Inc. | Methods for treating metabolic disorders by targeting adcy5 |
| WO2020239680A2 (en) | 2019-05-25 | 2020-12-03 | KWS SAAT SE & Co. KGaA | Haploid induction enhancer |
| US20210032612A1 (en) * | 2018-02-22 | 2021-02-04 | Avellino Lab Usa, Inc. | CRISPR/Cas9 Systems, and Methods of Use Thereof |
| US10912797B2 (en) | 2016-10-18 | 2021-02-09 | Intima Bioscience, Inc. | Tumor infiltrating lymphocytes and methods of therapy |
| US10912833B2 (en) | 2013-09-06 | 2021-02-09 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
| EP3772542A1 (en) | 2019-08-07 | 2021-02-10 | KWS SAAT SE & Co. KGaA | Modifying genetic variation in crops by modulating the pachytene checkpoint protein 2 |
| CN112410377A (zh) * | 2020-02-28 | 2021-02-26 | 中国科学院脑科学与智能技术卓越创新中心 | VI-E型和VI-F型CRISPR-Cas系统及用途 |
| CN112424368A (zh) * | 2018-06-12 | 2021-02-26 | 布利斯脱大学 | 用于调节眼内压和颅内压的材料和方法 |
| US10934536B2 (en) | 2018-12-14 | 2021-03-02 | Pioneer Hi-Bred International, Inc. | CRISPR-CAS systems for genome editing |
| WO2021041922A1 (en) | 2019-08-30 | 2021-03-04 | The Broad Institute, Inc. | Crispr-associated mu transposase systems |
| US10947530B2 (en) | 2016-08-03 | 2021-03-16 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US10954548B2 (en) | 2013-08-09 | 2021-03-23 | President And Fellows Of Harvard College | Nuclease profiling system |
| WO2021055874A1 (en) | 2019-09-20 | 2021-03-25 | The Broad Institute, Inc. | Novel type vi crispr enzymes and systems |
| US10973872B2 (en) | 2014-12-23 | 2021-04-13 | 4D Pharma Research Limited | Pirin polypeptide and immune modulation |
| US10975391B2 (en) | 2014-04-25 | 2021-04-13 | University Of Massachusetts | Recombinant AAV vectors useful for reducing immunity against transgene products |
| WO2021074367A1 (en) | 2019-10-17 | 2021-04-22 | KWS SAAT SE & Co. KGaA | Enhanced disease resistance of crops by downregulation of repressor genes |
| US10987387B2 (en) | 2017-05-24 | 2021-04-27 | 4D Pharma Research Limited | Compositions comprising bacterial strain |
| US20210130832A1 (en) * | 2018-04-30 | 2021-05-06 | Oregon Health & Science University | Methods of gene therapy |
| US11001829B2 (en) | 2014-09-25 | 2021-05-11 | The Broad Institute, Inc. | Functional screening with optimized functional CRISPR-Cas systems |
| US11007233B2 (en) | 2017-06-14 | 2021-05-18 | 4D Pharma Research Limited | Compositions comprising a bacterial strain of the genus Megasphera and uses thereof |
| WO2021102084A1 (en) | 2019-11-22 | 2021-05-27 | President And Fellows Of Harvard College | Ionic liquids for drug delivery |
| US11028429B2 (en) | 2015-09-11 | 2021-06-08 | The General Hospital Corporation | Full interrogation of nuclease DSBs and sequencing (FIND-seq) |
| US11028388B2 (en) | 2014-03-05 | 2021-06-08 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for treating Usher syndrome and retinitis pigmentosa |
| US11046948B2 (en) | 2013-08-22 | 2021-06-29 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
| US11046976B2 (en) * | 2014-07-03 | 2021-06-29 | NanoCav, LLC | Mechanical transfection devices and methods |
| US11046955B2 (en) | 2015-04-24 | 2021-06-29 | University Of Massachusetts | Modified AAV constructs and uses thereof |
| US11053481B2 (en) | 2013-12-12 | 2021-07-06 | President And Fellows Of Harvard College | Fusions of Cas9 domains and nucleic acid-editing domains |
| US11060088B2 (en) | 2016-02-12 | 2021-07-13 | University Of Massachusetts | Anti-angiogenic miRNA therapeutics for inhibiting corneal neovascularization |
| WO2021150919A1 (en) | 2020-01-23 | 2021-07-29 | The Children's Medical Center Corporation | Stroma-free t cell differentiation from human pluripotent stem cells |
| CN113180015A (zh) * | 2021-05-25 | 2021-07-30 | 四川省农业机械研究设计院 | 一种蚕房及三段式流水线养蚕方法 |
| US11078483B1 (en) | 2016-09-02 | 2021-08-03 | KSQ Therapeutics, Inc. | Methods for measuring and improving CRISPR reagent function |
| US11078498B2 (en) * | 2014-02-11 | 2021-08-03 | The Regents Of The University Of Colorado, A Body Corporate | CRISPR enabled multiplexed genome engineering |
| US11078481B1 (en) | 2016-08-03 | 2021-08-03 | KSQ Therapeutics, Inc. | Methods for screening for cancer targets |
| US11092607B2 (en) | 2015-10-28 | 2021-08-17 | The Board Institute, Inc. | Multiplex analysis of single cell constituents |
| US11098325B2 (en) | 2017-06-30 | 2021-08-24 | Intima Bioscience, Inc. | Adeno-associated viral vectors for gene therapy |
| US11111521B2 (en) | 2011-12-22 | 2021-09-07 | President And Fellows Of Harvard College | Compositions and methods for analyte detection |
| EP3877517A1 (en) | 2018-11-09 | 2021-09-15 | Inari Agriculture, Inc. | Rna-guided nucleases and dna binding proteins |
| US11123379B2 (en) | 2017-06-14 | 2021-09-21 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US11123378B2 (en) | 2017-05-22 | 2021-09-21 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US11124796B2 (en) | 2014-09-24 | 2021-09-21 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for modeling competition of multiple cancer mutations in vivo |
| WO2021202938A1 (en) | 2020-04-03 | 2021-10-07 | Creyon Bio, Inc. | Oligonucleotide-based machine learning |
| US11141493B2 (en) | 2014-03-10 | 2021-10-12 | Editas Medicine, Inc. | Compositions and methods for treating CEP290-associated disease |
| US11147837B2 (en) | 2015-07-31 | 2021-10-19 | Regents Of The University Of Minnesota | Modified cells and methods of therapy |
| WO2021216622A1 (en) | 2020-04-21 | 2021-10-28 | Aspen Neuroscience, Inc. | Gene editing of gba1 in stem cells and method of use of cells differentiated therefrom |
| WO2021216623A1 (en) | 2020-04-21 | 2021-10-28 | Aspen Neuroscience, Inc. | Gene editing of lrrk2 in stem cells and method of use of cells differentiated therefrom |
| WO2021224633A1 (en) | 2020-05-06 | 2021-11-11 | Orchard Therapeutics (Europe) Limited | Treatment for neurodegenerative diseases |
| US11180792B2 (en) | 2015-01-28 | 2021-11-23 | The Regents Of The University Of California | Methods and compositions for labeling a single-stranded target nucleic acid |
| US11180793B2 (en) | 2015-04-24 | 2021-11-23 | Editas Medicine, Inc. | Evaluation of Cas9 molecule/guide RNA molecule complexes |
| US11180751B2 (en) | 2015-06-18 | 2021-11-23 | The Broad Institute, Inc. | CRISPR enzymes and systems |
| WO2021239986A1 (en) | 2020-05-29 | 2021-12-02 | KWS SAAT SE & Co. KGaA | Plant haploid induction |
| US11207426B2 (en) | 2016-04-05 | 2021-12-28 | University Of Massachusetts | Compositions and methods for selective inhibition of grainyhead-like protein expression |
| US11214780B2 (en) | 2015-10-23 | 2022-01-04 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US11214800B2 (en) | 2015-08-18 | 2022-01-04 | The Broad Institute, Inc. | Methods and compositions for altering function and structure of chromatin loops and/or domains |
| DE212020000516U1 (de) | 2019-03-07 | 2022-01-17 | The Regents of the University of California | CRISPR-CAS-Effektorpolypeptide |
| US11224620B2 (en) | 2016-07-13 | 2022-01-18 | 4D Pharma Plc | Compositions comprising bacterial strains |
| GB202118058D0 (en) | 2021-12-14 | 2022-01-26 | Univ Warwick | Methods to increase yields in crops |
| US11236313B2 (en) | 2016-04-13 | 2022-02-01 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| US11242525B2 (en) | 2014-03-26 | 2022-02-08 | Editas Medicine, Inc. | CRISPR/CAS-related methods and compositions for treating sickle cell disease |
| US11253576B2 (en) | 2015-10-22 | 2022-02-22 | University Of Massachusetts | Methods and compositions for treating metabolic imbalance in neurodegenerative disease |
| US20220056440A1 (en) * | 2016-08-20 | 2022-02-24 | Tara Moore | Crispr gene editing for autosomal dominant diseases |
| US11266698B2 (en) | 2011-10-07 | 2022-03-08 | 4D Pharma Research Limited | Bacterium for use as a probiotic for nutritional and medical applications |
| US11268082B2 (en) | 2017-03-23 | 2022-03-08 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable DNA binding proteins |
| US11286468B2 (en) | 2017-08-23 | 2022-03-29 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US11299767B2 (en) | 2013-03-12 | 2022-04-12 | President And Fellows Of Harvard College | Method for generating a three-dimensional nucleic acid containing matrix |
| US11299755B2 (en) | 2013-09-06 | 2022-04-12 | President And Fellows Of Harvard College | Switchable CAS9 nucleases and uses thereof |
| US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
| US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11332736B2 (en) | 2017-12-07 | 2022-05-17 | The Broad Institute, Inc. | Methods and compositions for multiplexing single cell and single nuclei sequencing |
| US11339437B2 (en) | 2014-03-10 | 2022-05-24 | Editas Medicine, Inc. | Compositions and methods for treating CEP290-associated disease |
| CN114555813A (zh) * | 2019-05-21 | 2022-05-27 | 国家医疗保健研究所 | 治疗雷特综合征的胆固醇24-水解酶的表达载体 |
| US11352647B2 (en) | 2016-08-17 | 2022-06-07 | The Broad Institute, Inc. | Crispr enzymes and systems |
| US11389493B2 (en) | 2015-06-15 | 2022-07-19 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
| US11407995B1 (en) | 2018-10-26 | 2022-08-09 | Inari Agriculture Technology, Inc. | RNA-guided nucleases and DNA binding proteins |
| US11414657B2 (en) | 2015-06-29 | 2022-08-16 | Ionis Pharmaceuticals, Inc. | Modified CRISPR RNA and modified single CRISPR RNA and uses thereof |
| US11413356B2 (en) | 2016-04-15 | 2022-08-16 | University Of Massachusetts | Methods and compositions for treating metabolic imbalance |
| US11426469B2 (en) | 2015-10-22 | 2022-08-30 | University Of Massachusetts | Prostate-targeting adeno-associated virus serotype vectors |
| US11434477B1 (en) | 2018-11-02 | 2022-09-06 | Inari Agriculture Technology, Inc. | RNA-guided nucleases and DNA binding proteins |
| CN115074343A (zh) * | 2017-07-31 | 2022-09-20 | 瑞泽恩制药公司 | Cas转基因小鼠胚胎干细胞和小鼠及其应用 |
| US11447527B2 (en) | 2018-09-18 | 2022-09-20 | Vnv Newco Inc. | Endogenous Gag-based capsids and uses thereof |
| US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| WO2022204543A1 (en) * | 2021-03-25 | 2022-09-29 | The Regents Of The University Of California | Methods and materials for treating huntington's disease |
| US11466271B2 (en) | 2017-02-06 | 2022-10-11 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
| US11499151B2 (en) | 2017-04-28 | 2022-11-15 | Editas Medicine, Inc. | Methods and systems for analyzing guide RNA molecules |
| US11512311B2 (en) | 2016-03-25 | 2022-11-29 | Editas Medicine, Inc. | Systems and methods for treating alpha 1-antitrypsin (A1AT) deficiency |
| WO2022266652A1 (en) * | 2021-06-18 | 2022-12-22 | Innovative Cellular Therapeutics Holdings, Ltd. | Modified cells targeting tumor ecm and therapy thereof |
| US11542554B2 (en) | 2015-11-03 | 2023-01-03 | President And Fellows Of Harvard College | Method and apparatus for volumetric imaging |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US11547614B2 (en) | 2017-10-31 | 2023-01-10 | The Broad Institute, Inc. | Methods and compositions for studying cell evolution |
| US11549089B2 (en) | 2014-07-03 | 2023-01-10 | NanoCav, LLC | Mechanical transfection devices and methods |
| US11549126B2 (en) | 2015-06-03 | 2023-01-10 | Board Of Regents Of The University Of Nebraska | Treatment methods using DNA editing with single-stranded DNA |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| US11560568B2 (en) | 2014-09-12 | 2023-01-24 | E. I. Du Pont De Nemours And Company | Generation of site-specific-integration sites for complex trait loci in corn and soybean, and methods of use |
| US11566263B2 (en) | 2016-08-02 | 2023-01-31 | Editas Medicine, Inc. | Compositions and methods for treating CEP290 associated disease |
| WO2023006933A1 (en) | 2021-07-30 | 2023-02-02 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
| US11578340B2 (en) | 2016-10-13 | 2023-02-14 | University Of Massachusetts | AAV capsid designs |
| US11578343B2 (en) | 2014-07-30 | 2023-02-14 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US11591601B2 (en) | 2017-05-05 | 2023-02-28 | The Broad Institute, Inc. | Methods for identification and modification of lncRNA associated with target genotypes and phenotypes |
| US11591621B2 (en) | 2017-02-07 | 2023-02-28 | Modalis Therapeutics Corporation | Method of treating diseases associated with elevated KRAS expression using CRISPR-GNDM system |
| US11597924B2 (en) | 2016-03-25 | 2023-03-07 | Editas Medicine, Inc. | Genome editing systems comprising repair-modulating enzyme molecules and methods of their use |
| WO2023059846A1 (en) | 2021-10-08 | 2023-04-13 | President And Fellows Of Harvard College | Ionic liquids for drug delivery |
| WO2023081756A1 (en) | 2021-11-03 | 2023-05-11 | The J. David Gladstone Institutes, A Testamentary Trust Established Under The Will Of J. David Gladstone | Precise genome editing using retrons |
| US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
| WO2023093862A1 (en) | 2021-11-26 | 2023-06-01 | Epigenic Therapeutics Inc. | Method of modulating pcsk9 and uses thereof |
| US11667911B2 (en) | 2015-09-24 | 2023-06-06 | Editas Medicine, Inc. | Use of exonucleases to improve CRISPR/CAS-mediated genome editing |
| US11680268B2 (en) | 2014-11-07 | 2023-06-20 | Editas Medicine, Inc. | Methods for improving CRISPR/Cas-mediated genome-editing |
| US11680296B2 (en) | 2017-10-16 | 2023-06-20 | Massachusetts Institute Of Technology | Mycobacterium tuberculosis host-pathogen interaction |
| EP4198124A1 (en) | 2021-12-15 | 2023-06-21 | Versitech Limited | Engineered cas9-nucleases and method of use thereof |
| WO2023115041A1 (en) | 2021-12-17 | 2023-06-22 | Sana Biotechnology, Inc. | Modified paramyxoviridae attachment glycoproteins |
| WO2023115039A2 (en) | 2021-12-17 | 2023-06-22 | Sana Biotechnology, Inc. | Modified paramyxoviridae fusion glycoproteins |
| WO2023133595A2 (en) | 2022-01-10 | 2023-07-13 | Sana Biotechnology, Inc. | Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses |
| WO2023141602A2 (en) | 2022-01-21 | 2023-07-27 | Renagade Therapeutics Management Inc. | Engineered retrons and methods of use |
| US11713485B2 (en) | 2016-04-25 | 2023-08-01 | President And Fellows Of Harvard College | Hybridization chain reaction methods for in situ molecular detection |
| EP4219699A1 (en) | 2013-12-12 | 2023-08-02 | The Broad Institute, Inc. | Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation |
| WO2023150518A1 (en) | 2022-02-01 | 2023-08-10 | Sana Biotechnology, Inc. | Cd3-targeted lentiviral vectors and uses thereof |
| WO2023150647A1 (en) | 2022-02-02 | 2023-08-10 | Sana Biotechnology, Inc. | Methods of repeat dosing and administration of lipid particles or viral vectors and related systems and uses |
| US11723933B2 (en) | 2014-12-23 | 2023-08-15 | Cj Bioscience, Inc. | Composition of bacteroides thetaiotaomicron for immune modulation |
| US11725228B2 (en) | 2017-10-11 | 2023-08-15 | The General Hospital Corporation | Methods for detecting site-specific and spurious genomic deamination induced by base editing technologies |
| US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US11739156B2 (en) | 2019-01-06 | 2023-08-29 | The Broad Institute, Inc. Massachusetts Institute of Technology | Methods and compositions for overcoming immunosuppression |
| US11739330B2 (en) | 2017-09-22 | 2023-08-29 | University Of Massachusetts | SOD1 dual expression vectors and uses thereof |
| US11795443B2 (en) | 2017-10-16 | 2023-10-24 | The Broad Institute, Inc. | Uses of adenosine base editors |
| US11820969B2 (en) | 2016-12-23 | 2023-11-21 | President And Fellows Of Harvard College | Editing of CCR2 receptor gene to protect against HIV infection |
| US11826433B2 (en) | 2016-02-02 | 2023-11-28 | University Of Massachusetts | Method to enhance the efficiency of systemic AAV gene delivery to the central nervous system |
| US11845987B2 (en) | 2018-04-17 | 2023-12-19 | The General Hospital Corporation | Highly sensitive in vitro assays to define substrate preferences and sites of nucleic acid cleaving agents |
| US11851690B2 (en) | 2017-03-14 | 2023-12-26 | Editas Medicine, Inc. | Systems and methods for the treatment of hemoglobinopathies |
| US11859179B2 (en) | 2017-05-09 | 2024-01-02 | University Of Massachusetts | Methods of treating amyotrophic lateral sclerosis (ALS) |
| WO2024003579A1 (en) | 2022-06-30 | 2024-01-04 | University Of Newcastle Upon Tyne | Preventing disease recurrence in mitochondrial replacement therapy |
| US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
| US11866697B2 (en) | 2017-05-18 | 2024-01-09 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
| WO2024020346A2 (en) | 2022-07-18 | 2024-01-25 | Renagade Therapeutics Management Inc. | Gene editing components, systems, and methods of use |
| US11882815B2 (en) | 2016-06-15 | 2024-01-30 | University Of Massachusetts | Recombinant adeno-associated viruses for delivering gene editing molecules to embryonic cells |
| US11897953B2 (en) | 2017-06-14 | 2024-02-13 | The Broad Institute, Inc. | Compositions and methods targeting complement component 3 for inhibiting tumor growth |
| US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
| US11913075B2 (en) | 2017-04-01 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer |
| WO2024042199A1 (en) | 2022-08-26 | 2024-02-29 | KWS SAAT SE & Co. KGaA | Use of paired genes in hybrid breeding |
| WO2024044723A1 (en) | 2022-08-25 | 2024-02-29 | Renagade Therapeutics Management Inc. | Engineered retrons and methods of use |
| WO2024044655A1 (en) | 2022-08-24 | 2024-02-29 | Sana Biotechnology, Inc. | Delivery of heterologous proteins |
| WO2024064838A1 (en) | 2022-09-21 | 2024-03-28 | Sana Biotechnology, Inc. | Lipid particles comprising variant paramyxovirus attachment glycoproteins and uses thereof |
| US11957695B2 (en) | 2018-04-26 | 2024-04-16 | The Broad Institute, Inc. | Methods and compositions targeting glucocorticoid signaling for modulating immune responses |
| WO2024081820A1 (en) | 2022-10-13 | 2024-04-18 | Sana Biotechnology, Inc. | Viral particles targeting hematopoietic stem cells |
| US11963982B2 (en) | 2017-05-10 | 2024-04-23 | Editas Medicine, Inc. | CRISPR/RNA-guided nuclease systems and methods |
| US11963966B2 (en) | 2017-03-31 | 2024-04-23 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for treating ovarian tumors |
| US11981922B2 (en) | 2019-10-03 | 2024-05-14 | Dana-Farber Cancer Institute, Inc. | Methods and compositions for the modulation of cell interactions and signaling in the tumor microenvironment |
| US11981917B2 (en) | 2013-06-04 | 2024-05-14 | President And Fellows Of Harvard College | RNA-guided transcriptional regulation |
| US11994512B2 (en) | 2018-01-04 | 2024-05-28 | Massachusetts Institute Of Technology | Single-cell genomic methods to generate ex vivo cell systems that recapitulate in vivo biology with improved fidelity |
| WO2024119157A1 (en) | 2022-12-02 | 2024-06-06 | Sana Biotechnology, Inc. | Lipid particles with cofusogens and methods of producing and using the same |
| US12006520B2 (en) | 2011-07-22 | 2024-06-11 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US12031155B2 (en) | 2015-05-08 | 2024-07-09 | President And Fellows Of Harvard College | Universal donor stem cells and related methods |
| US12031132B2 (en) | 2018-03-14 | 2024-07-09 | Editas Medicine, Inc. | Systems and methods for the treatment of hemoglobinopathies |
| US12036240B2 (en) | 2018-06-14 | 2024-07-16 | The Broad Institute, Inc. | Compositions and methods targeting complement component 3 for inhibiting tumor growth |
| US12037601B2 (en) | 2016-03-04 | 2024-07-16 | Indoor Biotechnologies Inc. | Method of inactivating a FEL D1 gene using crispr |
| US12049643B2 (en) | 2017-07-14 | 2024-07-30 | The Broad Institute, Inc. | Methods and compositions for modulating cytotoxic lymphocyte activity |
| US12048720B2 (en) | 2017-06-14 | 2024-07-30 | Cj Bioscience, Inc. | Compositions comprising bacterial strains |
| US12058986B2 (en) | 2017-04-20 | 2024-08-13 | Egenesis, Inc. | Method for generating a genetically modified pig with inactivated porcine endogenous retrovirus (PERV) elements |
| WO2024168265A1 (en) | 2023-02-10 | 2024-08-15 | Possible Medicines Llc | Aav delivery of rna guided recombination system |
| WO2024168253A1 (en) | 2023-02-10 | 2024-08-15 | Possible Medicines Llc | Delivery of an rna guided recombination system |
| US12084676B2 (en) | 2018-02-23 | 2024-09-10 | Pioneer Hi-Bred International, Inc. | Cas9 orthologs |
| US12098425B2 (en) | 2018-10-10 | 2024-09-24 | Readcoor, Llc | Three-dimensional spatial molecular indexing |
| WO2024155830A3 (en) * | 2023-01-18 | 2024-10-03 | Fred Hutchinson Cancer Center | Viral particle producer cells with landing pad-integrated viral vectors |
| US12110545B2 (en) | 2017-01-06 | 2024-10-08 | Editas Medicine, Inc. | Methods of assessing nuclease cleavage |
| US12116210B2 (en) | 2018-11-01 | 2024-10-15 | Corteva Agriscience Llc | Systems and methods for manufacture of controlled release of agricultural cores |
| WO2024220598A2 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Lentiviral vectors with two or more genomes |
| WO2024220560A1 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Engineered protein g fusogens and related lipid particles and methods thereof |
| WO2024220574A1 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Universal protein g fusogens and adapter systems thereof and related lipid particles and uses |
| WO2024243340A1 (en) | 2023-05-23 | 2024-11-28 | Sana Biotechnology, Inc. | Tandem fusogens and related lipid particles |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| US12163129B2 (en) | 2018-06-08 | 2024-12-10 | University Of Massachusetts | Antisense oligonucleotides to restore dysferlin protein expression in dysferlinopathy patient cells |
| US12161694B2 (en) | 2017-03-24 | 2024-12-10 | The Broad Institute, Inc. | Methods and compositions for regulating innate lymphoid cell inflammatory responses |
| US12165743B2 (en) | 2018-11-09 | 2024-12-10 | The Broad Institute, Inc. | Compressed sensing for screening and tissue imaging |
| US12171783B2 (en) | 2017-11-13 | 2024-12-24 | The Broad Institute, Inc. | Methods and compositions for targeting developmental and oncogenic programs in H3K27M gliomas |
| US12180263B2 (en) | 2014-11-06 | 2024-12-31 | President And Fellows Of Harvard College | Cells lacking B2M surface expression and methods for allogeneic administration of such cells |
| US12195802B2 (en) * | 2017-05-12 | 2025-01-14 | President And Fellows Of Harvard College | Universal early cancer diagnostics |
| US12201699B2 (en) | 2014-10-10 | 2025-01-21 | Editas Medicine, Inc. | Compositions and methods for promoting homology directed repair |
| US12203136B2 (en) | 2020-08-17 | 2025-01-21 | Readcoor, Llc | Methods and systems for spatial mapping of genetic variants |
| US12221720B2 (en) | 2017-11-13 | 2025-02-11 | The Broad Institute, Inc. | Methods for determining spatial and temporal gene expression dynamics during adult neurogenesis in single cells |
| US12227578B2 (en) | 2016-11-11 | 2025-02-18 | The Broad Institute, Inc. | Modulation of intestinal epithelial cell differentiation, maintenance and/or function through T cell action |
| US12226479B2 (en) | 2017-05-11 | 2025-02-18 | The General Hospital Corporation | Methods and compositions of use of CD8+ tumor infiltrating lymphocyte subtypes and gene signatures thereof |
| US12227742B2 (en) | 2017-10-23 | 2025-02-18 | The Broad Institute, Inc. | Nucleic acid modifiers |
| US12239646B2 (en) | 2017-07-19 | 2025-03-04 | Dana-Farber Cancer Institute, Inc. | Cancer diagnostic and treatment |
| WO2025049959A2 (en) | 2023-09-01 | 2025-03-06 | Renagade Therapeutics Management Inc. | Gene editing systems, compositions, and methods for treatment of vexas syndrome |
| WO2025054202A1 (en) | 2023-09-05 | 2025-03-13 | Sana Biotechnology, Inc. | Method of screening a sample comprising a transgene with a unique barcode |
| US12258573B2 (en) | 2019-08-21 | 2025-03-25 | Research Institute At Nationwide Children's Hospital | Adeno-associated virus vector delivery of alpha-sarcoglycan and the treatment of muscular dystrophy |
| WO2025064591A1 (en) * | 2023-09-19 | 2025-03-27 | The Regents Of The University Of California | In vivo gene editing of tau locus via liponanoparticle delivery |
| WO2025062150A1 (en) | 2023-09-22 | 2025-03-27 | The University Of Manchester | Methods of producing homoplasmic modified plants or parts thereof |
| WO2025064408A1 (en) | 2023-09-18 | 2025-03-27 | The Broad Institute, Inc. | Compositions and methods for treating cardiovascular disease |
| US12264341B2 (en) | 2020-01-24 | 2025-04-01 | The General Hospital Corporation | CRISPR-Cas enzymes with enhanced on-target activity |
| US12263230B2 (en) | 2018-01-31 | 2025-04-01 | Research Institute At Nationwide Children's Hospital | Gene therapy for limb-girdle muscular dystrophy type 2C |
| WO2025081042A1 (en) | 2023-10-12 | 2025-04-17 | Renagade Therapeutics Management Inc. | Nickase-retron template-based precision editing system and methods of use |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12285497B2 (en) | 2021-10-15 | 2025-04-29 | Research Institute At Nationwide Children's Hospital | Self-complementary adeno-associated virus vector and its use in treatment of muscular dystrophy |
| US12286727B2 (en) | 2016-12-19 | 2025-04-29 | Editas Medicine, Inc. | Assessing nuclease cleavage |
| US12297436B2 (en) | 2017-05-18 | 2025-05-13 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
| US12305204B2 (en) | 2016-08-17 | 2025-05-20 | The Broad Institute, Inc. | CRISPR enzymes and systems |
| US12312613B2 (en) | 2020-01-24 | 2025-05-27 | The General Hospital Corporation | Unconstrained genome targeting with near-PAMless engineered CRISPR-Cas9 variants |
| US12331320B2 (en) | 2018-10-10 | 2025-06-17 | The Research Foundation For The State University Of New York | Genome edited cancer cell vaccines |
| US12331347B2 (en) | 2014-07-11 | 2025-06-17 | President And Fellows Of Harvard College | Methods for high-throughput labelling and detection of biological features in situ using microscopy |
| US12338436B2 (en) | 2018-06-29 | 2025-06-24 | Editas Medicine, Inc. | Synthetic guide molecules, compositions and methods relating thereto |
| US12338444B2 (en) | 2011-03-23 | 2025-06-24 | Pioneer Hi-Bred International, Inc. | Methods for producing a complex transgenic trait locus |
| US12342801B2 (en) | 2016-05-20 | 2025-07-01 | Regeneron Pharmaceuticals, Inc. | Methods for producing antigen-binding proteins against foreign antigens |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| WO2025151838A1 (en) | 2024-01-12 | 2025-07-17 | Sana Biotechnology, Inc. | Safety switches to control in vitro and in vivo proliferation of cell therapy products |
| WO2025155753A2 (en) | 2024-01-17 | 2025-07-24 | Renagade Therapeutics Management Inc. | Improved gene editing system, guides, and methods |
| US12377170B2 (en) | 2019-02-26 | 2025-08-05 | Research Institute At Nationwide Children's Hospital | Adeno-associated virus vector delivery of β-sarcoglycan and the treatment of muscular dystrophy |
| EP4596697A2 (en) | 2021-09-28 | 2025-08-06 | Acrigen Biosciences | Compositions and methods for nucleic acid modifications |
| US12391928B2 (en) | 2018-06-29 | 2025-08-19 | Research Institute At Nationwide Children's Hospital | Recombinant adeno-associated virus products and methods for treating limb girdle muscular dystrophy 2A |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| WO2025174765A1 (en) | 2024-02-12 | 2025-08-21 | Renagade Therapeutics Management Inc. | Lipid nanoparticles comprising coding rna molecules for use in gene editing and as vaccines and therapeutic agents |
| US12402610B2 (en) | 2018-11-09 | 2025-09-02 | The Broad Institute, Inc. | Methods and compositions for modulating innate lymphoid cell pathogenic effectors |
| US12404514B2 (en) | 2016-12-09 | 2025-09-02 | The Broad Institute, Inc. | CRISPR-systems for modifying a trait of interest in a plant |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| WO2025184529A1 (en) | 2024-03-01 | 2025-09-04 | Sana Biotechnology, Inc. | Viral particles with fusogen display and related compositions and methods |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| US12460231B2 (en) * | 2014-04-02 | 2025-11-04 | Editas Medicine, Inc. | Crispr/CAS-related methods and compositions for treating primary open angle glaucoma |
| US12467086B2 (en) | 2011-10-14 | 2025-11-11 | President And Fellows Of Harvard College | Sequencing by structure assembly |
| US12472239B2 (en) | 2015-11-16 | 2025-11-18 | Research Institute At Nationwide Children's Hospital | Guide RNA for repairing a mutant human titin gene using CRISPR technology |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| US12499971B2 (en) | 2016-09-28 | 2025-12-16 | The Broad Institute, Inc. | Systematic screening and mapping of regulatory elements in non-coding genomic regions, methods, compositions, and applications thereof |
| WO2026006542A2 (en) | 2024-06-26 | 2026-01-02 | Yale University | Compositions and methods for crispr/cas9 based reactivation of human angelman syndrome |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
| US12534714B2 (en) | 2019-03-18 | 2026-01-27 | The Broad Institute, Inc. | Type VII CRISPR proteins and systems |
| US12545912B2 (en) | 2021-06-07 | 2026-02-10 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for treating usher syndrome and retinitis pigmentosa |
Families Citing this family (479)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102638971B (zh) | 2009-07-08 | 2015-10-07 | 科马布有限公司 | 动物模型及治疗分子 |
| US9445581B2 (en) | 2012-03-28 | 2016-09-20 | Kymab Limited | Animal models and therapeutic molecules |
| WO2011140441A2 (en) | 2010-05-06 | 2011-11-10 | Children's Hospital Medical Center | Methods and systems for converting precursor cells into intestinal tissues through directed differentiation |
| US9457079B2 (en) | 2010-05-12 | 2016-10-04 | The Trustees Of Columbia University In The City Of New York | Methods for producing enteroendocrine cells that make and secrete insulin |
| JP2014511687A (ja) | 2011-03-31 | 2014-05-19 | モデルナ セラピューティクス インコーポレイテッド | 工学操作された核酸の送達および製剤 |
| EP2758535B1 (en) | 2011-09-19 | 2016-11-09 | Kymab Limited | Antibodies, variable domains&chains tailored for human use |
| WO2013045916A1 (en) | 2011-09-26 | 2013-04-04 | Kymab Limited | Chimaeric surrogate light chains (slc) comprising human vpreb |
| US9253965B2 (en) | 2012-03-28 | 2016-02-09 | Kymab Limited | Animal models and therapeutic molecules |
| US9752113B2 (en) | 2012-03-15 | 2017-09-05 | Flodesign Sonics, Inc. | Acoustic perfusion devices |
| US10704021B2 (en) | 2012-03-15 | 2020-07-07 | Flodesign Sonics, Inc. | Acoustic perfusion devices |
| US9745548B2 (en) | 2012-03-15 | 2017-08-29 | Flodesign Sonics, Inc. | Acoustic perfusion devices |
| US10967298B2 (en) | 2012-03-15 | 2021-04-06 | Flodesign Sonics, Inc. | Driver and control for variable impedence load |
| US9458450B2 (en) | 2012-03-15 | 2016-10-04 | Flodesign Sonics, Inc. | Acoustophoretic separation technology using multi-dimensional standing waves |
| US10322949B2 (en) | 2012-03-15 | 2019-06-18 | Flodesign Sonics, Inc. | Transducer and reflector configurations for an acoustophoretic device |
| US10689609B2 (en) | 2012-03-15 | 2020-06-23 | Flodesign Sonics, Inc. | Acoustic bioreactor processes |
| US9950282B2 (en) | 2012-03-15 | 2018-04-24 | Flodesign Sonics, Inc. | Electronic configuration and control for acoustic standing wave generation |
| US9637739B2 (en) | 2012-03-20 | 2017-05-02 | Vilnius University | RNA-directed DNA cleavage by the Cas9-crRNA complex |
| US10251377B2 (en) | 2012-03-28 | 2019-04-09 | Kymab Limited | Transgenic non-human vertebrate for the expression of class-switched, fully human, antibodies |
| GB2502127A (en) | 2012-05-17 | 2013-11-20 | Kymab Ltd | Multivalent antibodies and in vivo methods for their production |
| US10737953B2 (en) | 2012-04-20 | 2020-08-11 | Flodesign Sonics, Inc. | Acoustophoretic method for use in bioreactors |
| WO2013163628A2 (en) | 2012-04-27 | 2013-10-31 | Duke University | Genetic correction of mutated genes |
| US20130297023A1 (en) * | 2012-05-07 | 2013-11-07 | Hee-Jeong Im Sampen | Methods and Devices For Treating Intervertebral Disc Disease |
| ES2813080T3 (es) | 2012-07-11 | 2021-03-22 | Sangamo Therapeutics Inc | Métodos y composiciones para el tratamiento de enfermedades por almacenamiento lisosomal |
| US10648001B2 (en) | 2012-07-11 | 2020-05-12 | Sangamo Therapeutics, Inc. | Method of treating mucopolysaccharidosis type I or II |
| DK2931898T3 (en) | 2012-12-12 | 2016-06-20 | Massachusetts Inst Technology | CONSTRUCTION AND OPTIMIZATION OF SYSTEMS, PROCEDURES AND COMPOSITIONS FOR SEQUENCE MANIPULATION WITH FUNCTIONAL DOMAINS |
| WO2014093622A2 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| WO2014093701A1 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions, methods, knock out libraries and applications thereof |
| WO2014093595A1 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Crispr-cas component systems, methods and compositions for sequence manipulation |
| EP2931892B1 (en) | 2012-12-12 | 2018-09-12 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof |
| DK3064585T3 (da) | 2012-12-12 | 2020-04-27 | Broad Inst Inc | Konstruering og optimering af forbedrede systemer, fremgangsmåder og enzymsammensætninger til sekvensmanipulation |
| US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| EP2784162B1 (en) | 2012-12-12 | 2015-04-08 | The Broad Institute, Inc. | Engineering of systems, methods and optimized guide compositions for sequence manipulation |
| US11332719B2 (en) * | 2013-03-15 | 2022-05-17 | The Broad Institute, Inc. | Recombinant virus and preparations thereof |
| EP2971161B1 (en) | 2013-03-15 | 2018-12-26 | ModernaTX, Inc. | Ribonucleic acid purification |
| EP2971165A4 (en) | 2013-03-15 | 2016-11-23 | Moderna Therapeutics Inc | DISSOLUTION OF DNA FRAGMENTS IN MRNA MANUFACTURING METHODS |
| US9788534B2 (en) | 2013-03-18 | 2017-10-17 | Kymab Limited | Animal models and therapeutic molecules |
| US9828582B2 (en) | 2013-03-19 | 2017-11-28 | Duke University | Compositions and methods for the induction and tuning of gene expression |
| US9783618B2 (en) | 2013-05-01 | 2017-10-10 | Kymab Limited | Manipulation of immunoglobulin gene diversity and multi-antibody therapeutics |
| US11707056B2 (en) | 2013-05-02 | 2023-07-25 | Kymab Limited | Animals, repertoires and methods |
| US9783593B2 (en) | 2013-05-02 | 2017-10-10 | Kymab Limited | Antibodies, variable domains and chains tailored for human use |
| US9873894B2 (en) * | 2013-05-15 | 2018-01-23 | Sangamo Therapeutics, Inc. | Methods and compositions for treatment of a genetic condition |
| RU2716420C2 (ru) * | 2013-06-17 | 2020-03-11 | Те Брод Инститьют Инк. | Доставка и применение систем crispr-cas, векторов и композиций для целенаправленного воздействия и терапии в печени |
| WO2014204725A1 (en) | 2013-06-17 | 2014-12-24 | The Broad Institute Inc. | Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation |
| WO2014204729A1 (en) * | 2013-06-17 | 2014-12-24 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components |
| EP3725885A1 (en) | 2013-06-17 | 2020-10-21 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions methods, screens and applications thereof |
| AU2014281026B2 (en) | 2013-06-17 | 2020-05-28 | Massachusetts Institute Of Technology | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
| LT3019619T (lt) * | 2013-07-11 | 2021-12-10 | Modernatx, Inc. | Sintetinius polinukleotidus apimančios kompozicijos, koduojančios susijusius su crispr baltymus ir sintetines sgrnas, ir jų naudojimo būdai |
| US11306328B2 (en) * | 2013-07-26 | 2022-04-19 | President And Fellows Of Harvard College | Genome engineering |
| AU2014312123A1 (en) | 2013-08-29 | 2016-03-17 | Temple University Of The Commonwealth System Of Higher Education | Methods and compositions for RNA-guided treatment of HIV infection |
| US9388430B2 (en) | 2013-09-06 | 2016-07-12 | President And Fellows Of Harvard College | Cas9-recombinase fusion proteins and uses thereof |
| US9745569B2 (en) | 2013-09-13 | 2017-08-29 | Flodesign Sonics, Inc. | System for generating high concentration factors for low cell density suspensions |
| TW201542816A (zh) | 2013-09-18 | 2015-11-16 | Kymab Ltd | 方法、細胞與生物體 |
| EP3051942B1 (en) | 2013-10-01 | 2020-09-02 | Kymab Limited | Animal models and therapeutic molecules |
| US10385088B2 (en) | 2013-10-02 | 2019-08-20 | Modernatx, Inc. | Polynucleotide molecules and uses thereof |
| AU2014350051A1 (en) * | 2013-11-18 | 2016-07-07 | Crispr Therapeutics Ag | CRISPR-Cas system materials and methods |
| US10787684B2 (en) * | 2013-11-19 | 2020-09-29 | President And Fellows Of Harvard College | Large gene excision and insertion |
| EP3080279B1 (en) | 2013-12-11 | 2018-09-26 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a genome |
| CA2932439A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute, Inc. | Crispr-cas systems and methods for altering expression of gene products, structural information and inducible modular cas enzymes |
| US9725710B2 (en) | 2014-01-08 | 2017-08-08 | Flodesign Sonics, Inc. | Acoustophoresis device with dual acoustophoretic chamber |
| CA2947270A1 (en) | 2014-04-28 | 2015-11-05 | Rxi Pharmaceuticals Corporation | Methods for treating cancer using nucleic acids targeting mdm2 or mycn |
| US10280419B2 (en) * | 2014-05-09 | 2019-05-07 | UNIVERSITé LAVAL | Reduction of amyloid beta peptide production via modification of the APP gene using the CRISPR/Cas system |
| WO2015178343A1 (ja) * | 2014-05-20 | 2015-11-26 | 国立大学法人北海道大学 | siRNA細胞内送達のための脂質膜構造体 |
| EP3149156B1 (en) | 2014-05-28 | 2021-02-17 | Children's Hospital Medical Center | Methods and systems for converting precursor cells into gastric tissues through directed differentiation |
| RS60359B1 (sr) | 2014-06-06 | 2020-07-31 | Regeneron Pharma | Postupci i kompozicije za modifikovanje ciljanog lokusa |
| US10286086B2 (en) | 2014-06-19 | 2019-05-14 | Modernatx, Inc. | Alternative nucleic acid molecules and uses thereof |
| MX379237B (es) * | 2014-06-23 | 2025-03-10 | Regeneron Pharma | Ensamblaje de adn mediado por nucleasa. |
| WO2015200805A2 (en) | 2014-06-26 | 2015-12-30 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modifications and methods of use |
| EP3160503B1 (en) | 2014-06-26 | 2021-02-17 | The Trustees of Columbia University in the City of New York | Inhibition of serotonin expression in gut enteroendocrine cells results in conversion to insulin-positive cells |
| US9744483B2 (en) | 2014-07-02 | 2017-08-29 | Flodesign Sonics, Inc. | Large scale acoustic separation device |
| EP2966170A1 (en) * | 2014-07-10 | 2016-01-13 | Heinrich-Pette-Institut Leibniz-Institut für experimentelle Virologie-Stiftung bürgerlichen Rechts - | HBV inactivation |
| BR122023024818A2 (pt) * | 2014-07-11 | 2023-12-26 | Pioneer Hi-Bred International, Inc. | Rna guia, polinucleotídeo e complexo de ribonucleoproteínas |
| CA2955238A1 (en) | 2014-07-16 | 2016-01-21 | Moderna Therapeutics, Inc. | Circular polynucleotides |
| EP3204050A4 (en) * | 2014-10-09 | 2018-04-04 | The Regents of The University of California | Targeted disruption of a csf1-dap12 pathway member gene for the treatment of neuropathic pain |
| CN107002042A (zh) | 2014-10-15 | 2017-08-01 | 瑞泽恩制药公司 | 用于产生或维持多能细胞的方法和组合物 |
| JP6804438B2 (ja) | 2014-10-17 | 2020-12-23 | チルドレンズ ホスピタル メディカル センター | 多能性幹細胞を使用するヒト小腸のin vivoモデル、並びにそれを作製、及び使用する方法 |
| US11071790B2 (en) | 2014-10-29 | 2021-07-27 | Massachusetts Eye And Ear Infirmary | Method for efficient delivery of therapeutic molecules in vitro and in vivo |
| WO2016070037A2 (en) * | 2014-10-31 | 2016-05-06 | Massachusetts Institute Of Technology | Massively parallel combinatorial genetics for crispr |
| SG10202007103TA (en) | 2014-11-05 | 2020-09-29 | Voyager Therapeutics Inc | Aadc polynucleotides for the treatment of parkinson's disease |
| MX2017006216A (es) | 2014-11-14 | 2018-08-29 | Voyager Therapeutics Inc | Composiciones y métodos para tratar la esclerosis lateral amiotrófica (ela). |
| IL284949B2 (en) | 2014-11-14 | 2024-06-01 | Voyager Therapeutics Inc | Modulatory polynucleotides |
| GB201421096D0 (en) | 2014-11-27 | 2015-01-14 | Imp Innovations Ltd | Genome editing methods |
| CN107250148B (zh) | 2014-12-03 | 2021-04-16 | 安捷伦科技有限公司 | 具有化学修饰的指导rna |
| JP6830437B2 (ja) | 2014-12-10 | 2021-02-17 | リージェンツ オブ ザ ユニバーシティ オブ ミネソタ | 疾患を処置するための遺伝子改変された細胞、組織および臓器 |
| SG11201704646YA (en) | 2014-12-19 | 2017-07-28 | Regeneron Pharma | Methods and compositions for targeted genetic modification through single-step multiple targeting |
| EP3234111A1 (en) | 2014-12-19 | 2017-10-25 | Regeneron Pharmaceuticals, Inc. | Stem cells for modeling type 2 diabetes |
| EP3256487A4 (en) | 2015-02-09 | 2018-07-18 | Duke University | Compositions and methods for epigenome editing |
| CN104673816A (zh) * | 2015-03-05 | 2015-06-03 | 广东医学院 | 一种pCr-NHEJ载体及其构建方法及其用于细菌基因定点敲除的应用 |
| CN106032540B (zh) * | 2015-03-16 | 2019-10-25 | 中国科学院上海生命科学研究院 | CRISPR/Cas9核酸内切酶体系的腺相关病毒载体构建及其用途 |
| GB2536650A (en) | 2015-03-24 | 2016-09-28 | Augmedics Ltd | Method and system for combining video-based and optic-based augmented reality in a near eye display |
| WO2016161260A1 (en) * | 2015-04-02 | 2016-10-06 | Agenovir Corporation | Gene delivery methods and compositions |
| CN114231527A (zh) | 2015-04-06 | 2022-03-25 | 里兰斯坦福初级大学理事会 | 用于crispr/cas介导的基因调控的化学修饰的引导rna |
| GB201506509D0 (en) | 2015-04-16 | 2015-06-03 | Univ Wageningen | Nuclease-mediated genome editing |
| US11708572B2 (en) | 2015-04-29 | 2023-07-25 | Flodesign Sonics, Inc. | Acoustic cell separation techniques and processes |
| US11021699B2 (en) | 2015-04-29 | 2021-06-01 | FioDesign Sonics, Inc. | Separation using angled acoustic waves |
| US11377651B2 (en) | 2016-10-19 | 2022-07-05 | Flodesign Sonics, Inc. | Cell therapy processes utilizing acoustophoresis |
| WO2016187717A1 (en) * | 2015-05-26 | 2016-12-01 | Exerkine Corporation | Exosomes useful for genome editing |
| US10117911B2 (en) | 2015-05-29 | 2018-11-06 | Agenovir Corporation | Compositions and methods to treat herpes simplex virus infections |
| CA2987927C (en) | 2015-06-01 | 2024-03-19 | Temple University - Of The Commonwealth System Of Higher Education | Methods and compositions for rna-guided treatment of hiv infection |
| US10883103B2 (en) | 2015-06-02 | 2021-01-05 | Monsanto Technology Llc | Compositions and methods for delivery of a polynucleotide into a plant |
| CA2989830A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute, Inc. | Crispr enzyme mutations reducing off-target effects |
| WO2016205759A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Engineering and optimization of systems, methods, enzymes and guide scaffolds of cas9 orthologs and variants for sequence manipulation |
| US10648020B2 (en) | 2015-06-18 | 2020-05-12 | The Broad Institute, Inc. | CRISPR enzymes and systems |
| US9790490B2 (en) | 2015-06-18 | 2017-10-17 | The Broad Institute Inc. | CRISPR enzymes and systems |
| CN108271422A (zh) | 2015-06-25 | 2018-07-10 | 株式会社国际电气通信基础技术研究所 | 基于器官间串扰系统的预测装置及预测程序 |
| US20180171302A1 (en) * | 2015-06-26 | 2018-06-21 | Domenico ACCILI | Genetically Modified IPS Cells That Carry a Marker to Report Expression of Neurogenin3, TPH2, FOXO1 and/or Insulin Genes |
| US20170000743A1 (en) * | 2015-07-02 | 2017-01-05 | Vindico NanoBio Technology Inc. | Compositions and Methods for Delivery of Gene Editing Tools Using Polymeric Vesicles |
| US10456452B2 (en) | 2015-07-02 | 2019-10-29 | Poseida Therapeutics, Inc. | Compositions and methods for improved encapsulation of functional proteins in polymeric vesicles |
| WO2017007825A1 (en) * | 2015-07-06 | 2017-01-12 | Rxi Pharmaceuticals Corporation | Methods for treating neurological disorders using a synergistic small molecule and nucleic acids therapeutic approach |
| US11459540B2 (en) | 2015-07-28 | 2022-10-04 | Flodesign Sonics, Inc. | Expanded bed affinity selection |
| US11474085B2 (en) | 2015-07-28 | 2022-10-18 | Flodesign Sonics, Inc. | Expanded bed affinity selection |
| CN107849562B (zh) * | 2015-07-28 | 2021-10-26 | 丹尼斯科美国公司 | 基因组编辑系统及使用方法 |
| EP4512819A3 (en) | 2015-08-12 | 2025-08-06 | The General Hospital Corporation | Compositions and methods that promote hypoxia or the hypoxia response for treatment and prevention of mitochondrial dysfunction and oxidative stress disorders |
| EP3334746B1 (en) | 2015-08-14 | 2021-11-24 | The University Of Sydney | Connexin 45 inhibition for therapy |
| EP4345455A3 (en) * | 2015-08-25 | 2024-07-17 | Duke University | Compositions and methods of improving specificity in genomic engineering using rna-guided endonucleases |
| JP2018527003A (ja) | 2015-09-17 | 2018-09-20 | モデルナティエックス インコーポレイテッドModernaTX,Inc. | 安定化尾部領域を含むポリヌクレオチド |
| WO2017062754A1 (en) * | 2015-10-07 | 2017-04-13 | New York University | Compositions and methods for enhancing crispr activity by polq inhibition |
| EP4089175A1 (en) | 2015-10-13 | 2022-11-16 | Duke University | Genome engineering with type i crispr systems in eukaryotic cells |
| EP3368054A4 (en) | 2015-10-28 | 2019-07-03 | Voyager Therapeutics, Inc. | REGULATORY EXPRESSION USING THE ADENO-ASSOCIATED VIRUS (AAV) |
| US11905521B2 (en) | 2015-11-17 | 2024-02-20 | The Chinese University Of Hong Kong | Methods and systems for targeted gene manipulation |
| SG11201804372PA (en) | 2015-11-23 | 2018-06-28 | Univ California | Tracking and manipulating cellular rna via nuclear delivery of crispr/cas9 |
| US20210395799A1 (en) * | 2015-11-25 | 2021-12-23 | Integrated Dna Technologies, Inc. | Methods for variant detection |
| CN116064747A (zh) * | 2015-11-25 | 2023-05-05 | 综合基因技术公司 | 用于变体检测的方法 |
| CN108779466B (zh) | 2015-11-30 | 2024-03-29 | 杜克大学 | 用于通过基因编辑修正人肌营养不良蛋白基因的治疗靶标和使用方法 |
| CA3006432A1 (en) | 2015-12-04 | 2017-06-08 | Novartis Ag | Compositions and methods for immunooncology |
| US12110490B2 (en) | 2015-12-18 | 2024-10-08 | The Broad Institute, Inc. | CRISPR enzymes and systems |
| CN105624196A (zh) * | 2015-12-24 | 2016-06-01 | 江苏大学 | 一种建立cyp2c11基因敲除大鼠模型的方法 |
| CN105624191A (zh) * | 2015-12-24 | 2016-06-01 | 江苏大学 | 一种建立cyp2d1基因敲除大鼠模型的方法 |
| CN105548420B (zh) * | 2015-12-30 | 2019-08-02 | 上海泽润生物科技有限公司 | Mops残留量的检测方法 |
| US20190264186A1 (en) | 2016-01-22 | 2019-08-29 | The Broad Institute Inc. | Crystal structure of crispr cpf1 |
| EP3417062B1 (en) * | 2016-02-15 | 2024-06-26 | Temple University - Of The Commonwealth System of Higher Education | Excision of retroviral nucleic acid sequences |
| EP3881857B1 (en) | 2016-02-18 | 2025-04-16 | The Penn State Research Foundation | Generating gabaergic neurons in brains |
| EP3420089B1 (en) * | 2016-02-26 | 2021-12-29 | LanzaTech NZ, Inc. | Crispr/cas systems for c-1 fixing bacteria |
| EP3219799A1 (en) | 2016-03-17 | 2017-09-20 | IMBA-Institut für Molekulare Biotechnologie GmbH | Conditional crispr sgrna expression |
| WO2017170803A1 (ja) * | 2016-03-29 | 2017-10-05 | 株式会社国際電気通信基礎技術研究所 | 医薬組成物又は食品組成物、及び有効成分の体内での効果の評価方法 |
| CN114594268A (zh) | 2016-03-29 | 2022-06-07 | 无限生物制药公司 | 用以预防或治疗肾脏疾病的活性组分的候选物质的筛选装置和筛选方法 |
| US20190127713A1 (en) | 2016-04-13 | 2019-05-02 | Duke University | Crispr/cas9-based repressors for silencing gene targets in vivo and methods of use |
| US12410416B2 (en) * | 2016-04-19 | 2025-09-09 | The Broad Institute, Inc. | CRISPR enzymes and systems with modified pam specificity |
| US20200263190A1 (en) | 2016-04-19 | 2020-08-20 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
| EP3445853A1 (en) | 2016-04-19 | 2019-02-27 | The Broad Institute, Inc. | Cpf1 complexes with reduced indel activity |
| WO2017189542A1 (en) * | 2016-04-26 | 2017-11-02 | University Of Georgia Research Foundation, Inc. | Plants having reduced methylation of cytosine nucleotides and methods of use |
| EP3449004B1 (en) | 2016-04-29 | 2021-02-24 | Poseida Therapeutics, Inc. | Poly(histidine)-based micelles for complexation and delivery of proteins and nucleic acids |
| US11085035B2 (en) | 2016-05-03 | 2021-08-10 | Flodesign Sonics, Inc. | Therapeutic cell washing, concentration, and separation utilizing acoustophoresis |
| US11214789B2 (en) | 2016-05-03 | 2022-01-04 | Flodesign Sonics, Inc. | Concentration and washing of particles with acoustics |
| CN116790476A (zh) | 2016-05-05 | 2023-09-22 | 儿童医院医疗中心 | 用于体外制造胃底组织的方法和与其相关的组合物 |
| EP3458588B1 (en) | 2016-05-18 | 2025-10-29 | Voyager Therapeutics, Inc. | Modulatory polynucleotides |
| US10767175B2 (en) | 2016-06-08 | 2020-09-08 | Agilent Technologies, Inc. | High specificity genome editing using chemically modified guide RNAs |
| JP2019518478A (ja) | 2016-06-24 | 2019-07-04 | ザ リージェンツ オブ ザ ユニバーシティ オブ コロラド,ア ボディー コーポレイトTHE REGENTS OF THE UNIVERSITY OF COLORADO,a body corporate | バーコードを付けたコンビナトリアルライブラリーを生成する方法 |
| US20210222164A1 (en) | 2016-06-29 | 2021-07-22 | The Broad Institute, Inc. | Crispr-cas systems having destabilization domain |
| WO2018017754A1 (en) | 2016-07-19 | 2018-01-25 | Duke University | Therapeutic applications of cpf1-based genome editing |
| US11123409B2 (en) * | 2016-07-28 | 2021-09-21 | Institute For Basic Science | Method of treating or preventing eye disease using Cas9 protein and guide RNA |
| SG11201901305YA (en) | 2016-07-29 | 2019-03-28 | Regeneron Pharma | Mice comprising mutations resulting in expression of c-truncated fibrillin-1 |
| RU2767206C2 (ru) * | 2016-08-12 | 2022-03-16 | Тулджен Инкорпорейтед | Модифицированный иммунорегуляторный элемент и изменение иммунитета посредством этого элемента |
| WO2018035503A1 (en) * | 2016-08-18 | 2018-02-22 | The Regents Of The University Of California | Crispr-cas genome engineering via a modular aav delivery system |
| WO2018053053A1 (en) | 2016-09-13 | 2018-03-22 | The Broad Institute, Inc. | Proximity-dependent biotinylation and uses thereof |
| US20190225974A1 (en) | 2016-09-23 | 2019-07-25 | BASF Agricultural Solutions Seed US LLC | Targeted genome optimization in plants |
| DK3516056T3 (da) * | 2016-09-23 | 2025-02-17 | Dsm Ip Assets Bv | Et guide-rna-ekspressionssystem til en værtscelle |
| EA201990860A1 (ru) | 2016-09-30 | 2019-10-31 | Рнк-направляемые модифицирующие нуклеиновые кислоты ферменты и способы их применения | |
| EP3523427A4 (en) * | 2016-10-07 | 2020-09-02 | Integrated DNA Technologies, Inc. | S. PYOGENES AND POLYPEPTIDES MUTANT CAS9 GENES CODED BY SUCH GENES |
| EP3529347A1 (en) | 2016-10-19 | 2019-08-28 | Flodesign Sonics, Inc. | Affinity cell extraction by acoustics |
| SG11201903697WA (en) | 2016-11-04 | 2019-05-30 | Childrens Hospital Med Ct | Liver organoid compositions and methods of making and using same |
| RU2768043C2 (ru) | 2016-11-14 | 2022-03-23 | Тулджен Инкорпорейтед | Искусственно созданная система управления функцией шк |
| SG10202105768WA (en) | 2016-12-05 | 2021-06-29 | Childrens Hospital Med Ct | Colonic organoids and methods of making and using same |
| PL3551753T3 (pl) | 2016-12-09 | 2022-10-31 | The Broad Institute, Inc. | Diagnostyka oparta na układzie efektorowym crispr |
| WO2018124005A1 (ja) | 2016-12-27 | 2018-07-05 | 中外製薬株式会社 | 被験物質の免疫原性を評価する方法 |
| CN106632693B (zh) * | 2017-01-19 | 2021-05-25 | 上海科技大学 | 具有多个核定位序列的SpyCas9蛋白及其应用 |
| IL268156B2 (en) | 2017-01-23 | 2025-01-01 | Regeneron Pharma | Variants of 17-beta-hydroxysteroid dehydrogenase and their uses |
| GB2574769A (en) * | 2017-03-03 | 2019-12-18 | Univ California | RNA Targeting of mutations via suppressor tRNAs and deaminases |
| US11174515B2 (en) | 2017-03-15 | 2021-11-16 | The Broad Institute, Inc. | CRISPR effector system based diagnostics |
| US11104937B2 (en) | 2017-03-15 | 2021-08-31 | The Broad Institute, Inc. | CRISPR effector system based diagnostics |
| EP3596218B1 (en) | 2017-03-15 | 2023-08-23 | The Broad Institute, Inc. | Crispr effector system based diagnostics for virus detection |
| SG11201907434RA (en) * | 2017-03-22 | 2019-10-30 | Novartis Ag | Compositions and methods for immunooncology |
| US11618928B2 (en) | 2017-04-12 | 2023-04-04 | The Broad Institute, Inc. | CRISPR effector system based diagnostics for malaria detection |
| WO2018191673A1 (en) | 2017-04-14 | 2018-10-18 | Children's Hospital Medical Center | Multi donor stem cell compositions and methods of making same |
| US11913015B2 (en) | 2017-04-17 | 2024-02-27 | University Of Maryland, College Park | Embryonic cell cultures and methods of using the same |
| US11072816B2 (en) | 2017-05-03 | 2021-07-27 | The Broad Institute, Inc. | Single-cell proteomic assay using aptamers |
| EP3618839A4 (en) | 2017-05-05 | 2021-06-09 | Voyager Therapeutics, Inc. | Compositions and methods of treating amyotrophic lateral sclerosis (als) |
| JP7235391B2 (ja) | 2017-05-08 | 2023-03-08 | ツールゲン インコーポレイテッド | 人工的に操作された免疫細胞 |
| WO2018208910A1 (en) | 2017-05-09 | 2018-11-15 | The Broad Institute Inc. | Gut microbiome function predicts response to anti-integrin biologic therapy in inflammatory bowel diseases |
| AU2018265022A1 (en) | 2017-05-10 | 2019-11-21 | The Regents Of The University Of California | Directed editing of cellular RNA via nuclear delivery of CRISPR/Cas9 |
| KR102607330B1 (ko) * | 2017-05-16 | 2023-11-28 | 위스콘신 얼럼나이 리서어치 화운데이션 | 분자 구조들의 일괄 패터닝을 위한 시스템 및 방법 |
| EP3635113A4 (en) | 2017-06-05 | 2021-03-17 | Fred Hutchinson Cancer Research Center | SAFE GENOMIC HAVERS FOR GENETIC THERAPIES IN HUMAN STEM CELLS AND NANOPARTICLES MODIFIED TO ENABLE TARGETED GENETIC THERAPIES |
| JOP20190269A1 (ar) | 2017-06-15 | 2019-11-20 | Voyager Therapeutics Inc | بولي نوكليوتيدات aadc لعلاج مرض باركنسون |
| CA3067842C (en) | 2017-06-23 | 2025-11-04 | University Of Kentucky Research Foundation | METHODS FOR MODULATING THE ALKALOID CONTENT OF A PLANT OR PART OF THAT PLANT |
| US9982279B1 (en) | 2017-06-23 | 2018-05-29 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| US10011849B1 (en) | 2017-06-23 | 2018-07-03 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| CA3068304A1 (en) * | 2017-06-28 | 2019-01-03 | University Of South Florida | Modified ube3a gene for a gene therapy approach for angelman syndrome |
| US11168322B2 (en) | 2017-06-30 | 2021-11-09 | Arbor Biotechnologies, Inc. | CRISPR RNA targeting enzymes and systems and uses thereof |
| US12415000B2 (en) | 2017-07-07 | 2025-09-16 | The Broad Institute, Inc. | CRISPR system based antiviral therapy |
| WO2019017321A1 (ja) * | 2017-07-18 | 2019-01-24 | 国立大学法人京都大学 | 遺伝子変異導入方法 |
| BR102017016440A2 (pt) | 2017-07-31 | 2019-03-19 | Universidade Federal Do Rio Grande Do Sul | Composição para terapia gênica do sistema nervoso central, processo de obtenção e uso da mesma |
| BR112020001996A2 (pt) | 2017-07-31 | 2020-08-18 | Regeneron Pharmaceuticals, Inc. | animal não humano, e, métodos para testar e para otimizar a capacidade de uma crispr/cas nuclease de excisar um ácido nucleico genômico in vivo, para testar a recombinação induzida por crispr/cas de um ácido nucleico genômico com um ácido nucleico de doador exógeno in vivo e para otimizar a capacidade de crispr/cas de induzir a recombinação de um ácido nucleico genômico com um ácido nucleico de doador exógeno in vivo. |
| CN110891419A (zh) | 2017-07-31 | 2020-03-17 | 瑞泽恩制药公司 | 评价crispr/cas-诱导的与外源供体核酸的体内重组 |
| US20190083457A1 (en) * | 2017-09-15 | 2019-03-21 | The Borad Of Trustees Of The Leland Stanford Junior University | Mitochondrial aldehyde dehydrogenase-2 modulators for protecting, expanding and increasing the potency of hematopoietic stem cells |
| CN117180442A (zh) * | 2017-09-28 | 2023-12-08 | 天腾有限公司 | 用于治疗癌症的新型的基于重组质膜的囊泡 |
| WO2019067875A1 (en) | 2017-09-29 | 2019-04-04 | Regeneron Pharmaceuticals, Inc. | NON-HUMAN ANIMALS COMPRISING A HUMANIZED TTR LOCUS AND METHODS OF USE |
| EP3688161A1 (en) | 2017-09-29 | 2020-08-05 | Intellia Therapeutics, Inc. | Compositions and methods for ttr gene editing and treating attr amyloidosis |
| EP3692146A4 (en) | 2017-10-04 | 2021-06-30 | The Broad Institute, Inc. | DIAGNOSTICS BASED ON CRISPR EFFECTOR SYSTEM |
| WO2019071048A1 (en) | 2017-10-04 | 2019-04-11 | The Broad Institute, Inc. | SYSTEMS, METHODS AND COMPOSITIONS FOR TARGETED NUCLEIC ACID EDITION |
| WO2019074793A1 (en) | 2017-10-10 | 2019-04-18 | Children's Hospital Medical Center | OESOPHAGIAN TISSUE COMPOSITIONS AND / OR ORGANOIDS AND METHODS OF MAKING SAME |
| BR112020007823A2 (pt) | 2017-10-20 | 2020-10-27 | Fred Hutchinson Cancer Research Center | sistemas e métodos para produzir células b geneticamente modificadas para expressar anticorpos selecionados |
| US12227753B2 (en) | 2017-11-01 | 2025-02-18 | The Regents Of The University Of California | CasY compositions and methods of use |
| US12054754B2 (en) | 2017-11-02 | 2024-08-06 | Arbor Biotechnologies, Inc. | CRISPR-associated transposon systems and components |
| WO2019099943A1 (en) | 2017-11-16 | 2019-05-23 | Astrazeneca Ab | Compositions and methods for improving the efficacy of cas9-based knock-in strategies |
| US12521201B2 (en) | 2017-12-07 | 2026-01-13 | Augmedics Ltd. | Spinous process clamp |
| US12458411B2 (en) | 2017-12-07 | 2025-11-04 | Augmedics Ltd. | Spinous process clamp |
| KR20220066413A (ko) | 2017-12-14 | 2022-05-24 | 프로디자인 소닉스, 인크. | 음향 트랜스듀서 구동기 및 제어기 |
| US12379372B2 (en) | 2017-12-21 | 2025-08-05 | Children's Hospital Medical Center | Digitalized human organoids and methods of using same |
| US20230193242A1 (en) | 2017-12-22 | 2023-06-22 | The Broad Institute, Inc. | Cas12b systems, methods, and compositions for targeted dna base editing |
| BR112020014168A2 (pt) | 2018-01-12 | 2020-12-08 | Basf Se | Proteína, ácido nucleico isolado, gene recombinante, vetor, célula hospedeira, planta, parte de planta ou semente de trigo, métodos para produzir, produto de trigo, farinha, farelo integral, amido, grânulos de amido ou farelo de trigo e métodos para identificar e/ou selecionar uma planta de trigo |
| EP3740580A4 (en) | 2018-01-19 | 2021-10-20 | Duke University | GENOME ENGINEERING WITH CRISPR-CAS SYSTEMS IN EUKARYONTS |
| EP3746568B1 (en) | 2018-01-29 | 2023-11-15 | The Broad Institute, Inc. | Crispr effector system based diagnostics |
| CN112203676A (zh) * | 2018-02-02 | 2021-01-08 | 宾州研究基金会 | 治疗脑损伤的方法和材料 |
| US20210361693A1 (en) * | 2018-02-09 | 2021-11-25 | Empirico Inc. | Process to inhibit or eliminate eosinophilic diseases of the airway and related conditions |
| JP2021513866A (ja) * | 2018-02-27 | 2021-06-03 | ザ・ユニヴァーシティ・オヴ・ノース・キャロライナ・アト・チャペル・ヒル | アンジェルマン症候群を処置する方法および組成物 |
| DK3765616T3 (da) | 2018-03-14 | 2023-08-21 | Arbor Biotechnologies Inc | Nye enzymer og systemer målrettet crispr dna og rna |
| KR101889683B1 (ko) * | 2018-03-14 | 2018-08-17 | 유병탁 | 철골 구조 시공 방법 |
| ES2952978T3 (es) | 2018-03-14 | 2023-11-07 | Arbor Biotechnologies Inc | Sistemas y enzimas novedosos de direccionamiento a ADN de CRISPR |
| EP3765094A4 (en) | 2018-03-15 | 2021-12-22 | KSQ Therapeutics, Inc. | GENE REGULATORY COMPOSITIONS AND PROCEDURES FOR IMPROVED IMMUNOTHERAPY |
| CN116349651A (zh) | 2018-03-19 | 2023-06-30 | 瑞泽恩制药公司 | 使用crispr/cas系统对动物进行转录调制 |
| US20210017509A1 (en) * | 2018-03-23 | 2021-01-21 | The Trustees Of Columbia University In The City Of New York | Gene Editing for Autosomal Dominant Diseases |
| EP3787543A4 (en) | 2018-05-02 | 2022-01-19 | Augmedics Ltd. | REGISTRATION OF A FIDUCIAL MARKER FOR AN AUGMENTED REALITY SYSTEM |
| AU2019262225B2 (en) * | 2018-05-03 | 2025-08-21 | President And Fellows Of Harvard College | In vivo homology directed repair in heart, skeletal muscle, and muscle stem cells |
| KR102852347B1 (ko) | 2018-05-11 | 2025-09-01 | 빔 테라퓨틱스, 인크. | 프로그래밍가능한 염기 편집기 시스템을 이용하여 병원성 아미노산을 치환하는 방법 |
| MA52631A (fr) | 2018-05-15 | 2021-03-24 | Voyager Therapeutics Inc | Compositions et méthodes pour le traitement de la maladie de parkinson |
| GB2589246A (en) | 2018-05-16 | 2021-05-26 | Synthego Corp | Methods and systems for guide RNA design and use |
| WO2019222555A1 (en) | 2018-05-16 | 2019-11-21 | Arbor Biotechnologies, Inc. | Novel crispr-associated systems and components |
| CN108707628B (zh) * | 2018-05-28 | 2021-11-23 | 上海海洋大学 | 斑马鱼notch2基因突变体的制备方法 |
| SG11202012785VA (en) | 2018-06-26 | 2021-01-28 | Broad Inst Inc | Crispr double nickase based amplification compositions, systems, and methods |
| EP3814369A1 (en) | 2018-06-29 | 2021-05-05 | Stichting Het Nederlands Kanker Instituut- Antoni van Leeuwenhoek Ziekenhuis | Tweak-receptor agonists for use in combination with immunotherapy of a cancer |
| US20210284981A1 (en) * | 2018-07-24 | 2021-09-16 | The Regents Of The University Of California | Rna-guided nucleic acid modifying enzymes and methods of use thereof |
| CN112533619A (zh) | 2018-07-26 | 2021-03-19 | 儿童医院医学中心 | 肝-胆-胰组织和其制备方法 |
| GB201812603D0 (en) | 2018-08-02 | 2018-09-19 | British American Tobacco Investments Ltd | Method |
| KR102103104B1 (ko) | 2018-08-16 | 2020-04-22 | (주)라트바이오 | 유전자 편집된 형질전환 동물 및 형질전환 배아 |
| AU2019326392A1 (en) | 2018-08-18 | 2021-03-11 | Dana-Farber Cancer Institute, Inc. | In situ gene editing |
| US12391685B2 (en) | 2018-08-20 | 2025-08-19 | The Broad Institute, Inc. | Inhibitors of RNA-guided nuclease target binding and uses thereof |
| US12460244B2 (en) | 2018-08-20 | 2025-11-04 | The Broad Institute, Inc. | Inhibitors of RNA-guided nuclease activity and uses thereof |
| EP3849565A4 (en) | 2018-09-12 | 2022-12-28 | Fred Hutchinson Cancer Research Center | REDUCTION OF CD33 EXPRESSION TO SELECTIVELY PROTECT THERAPEUTIC CELLS |
| KR20210057781A (ko) | 2018-09-12 | 2021-05-21 | 칠드런즈 호스피탈 메디칼 센터 | 조혈 줄기세포 및 이의 파생체의 생산을 위한 오르가노이드 조성물 |
| US12467925B2 (en) | 2018-10-03 | 2025-11-11 | The Broad Institute, Inc. | CRISPR effector system based diagnostics for hemorrhagic fever detection |
| US20220401460A1 (en) | 2018-10-10 | 2022-12-22 | Dana-Farber Cancer Institute, Inc. | Modulating resistance to bcl-2 inhibitors |
| CN109295081B (zh) * | 2018-10-17 | 2020-06-12 | 中国人民解放军第四军医大学 | 一种LDLR-Lamp2b融合基因、表达载体及其应用 |
| US20210388389A1 (en) | 2018-10-30 | 2021-12-16 | Yale University | Compositions and methods for rapid and modular generation of chimeric antigen receptor t cells |
| GB201817971D0 (en) | 2018-11-02 | 2018-12-19 | British American Tobacco Investments Ltd | Method |
| CN111172193B (zh) * | 2018-11-13 | 2024-04-23 | 四川横竖生物科技股份有限公司 | 基于hAgRP的基因过表达嵌合动物模型构建方法及其应用 |
| WO2020102610A1 (en) | 2018-11-14 | 2020-05-22 | The Broad Institute, Inc. | Crispr system based droplet diagnostic systems and methods |
| MX2021005702A (es) | 2018-11-14 | 2021-09-21 | Massachusetts Inst Technology | Multiplexión de variantes virales altamente evolutivas con sherlock. |
| GB201818715D0 (en) | 2018-11-16 | 2019-01-02 | British American Tobacco Investments Ltd | Method |
| US11766296B2 (en) | 2018-11-26 | 2023-09-26 | Augmedics Ltd. | Tracking system for image-guided surgery |
| EP3891276A4 (en) * | 2018-12-05 | 2022-07-27 | Fred Hutchinson Cancer Center | PRODUCTION OF GENETICALLY MODIFIED CELLS WITH REDUCED AND MINIMAL MANIPULATION |
| US12258594B2 (en) | 2018-12-05 | 2025-03-25 | The Broad Institute, Inc. | Cas proteins with reduced immunogenicity and methods of screening thereof |
| TW202504886A (zh) * | 2018-12-05 | 2025-02-01 | 美商英特利亞醫療公司 | 經修飾之胺脂質 |
| KR20200071198A (ko) | 2018-12-10 | 2020-06-19 | 네오이뮨텍, 인코퍼레이티드 | Nrf2 발현 조절 기반 T 세포 항암면역치료법 |
| US20250043366A1 (en) | 2018-12-13 | 2025-02-06 | The Broad Institute, Inc. | Tiled assays using crispr-cas based detection |
| US12264323B2 (en) | 2018-12-17 | 2025-04-01 | The Broad Institute, Inc. | CRISPR CPF1 direct repeat variants |
| IL301193A (en) | 2018-12-20 | 2023-05-01 | Regeneron Pharma | Nuclease-mediated repeat expansion |
| WO2020150265A1 (en) | 2019-01-15 | 2020-07-23 | Empirico Inc. | Prodrugs of alox-15 inhibitors and methods of using the same |
| GB201900940D0 (en) | 2019-01-23 | 2019-03-13 | British American Tobacco Investments Ltd | Method |
| WO2020160044A1 (en) | 2019-01-28 | 2020-08-06 | The Broad Institute, Inc. | In-situ spatial transcriptomics |
| US11965159B2 (en) | 2019-01-29 | 2024-04-23 | The Broad Institute, Inc. | Compositions and methods for regulating proteins and nucleic acids activities |
| EP3924481A4 (en) | 2019-02-13 | 2023-01-25 | Beam Therapeutics Inc. | Compositions and methods for treating hemoglobinopathies |
| KR20210125560A (ko) * | 2019-02-13 | 2021-10-18 | 빔 테라퓨틱스, 인크. | 유전성 질환의 치료를 위한 것을 포함하는, 아데노신 데아미나제 염기 편집기를 사용한 질환-관련 유전자의 스플라이스 수용체 부위 파괴 |
| WO2020172343A2 (en) | 2019-02-19 | 2020-08-27 | Massachusetts Institute Of Technology | Methods for treating injuries |
| US12215382B2 (en) | 2019-03-01 | 2025-02-04 | The General Hospital Corporation | Liver protective MARC variants and uses thereof |
| US20220154282A1 (en) | 2019-03-12 | 2022-05-19 | The Broad Institute, Inc. | Detection means, compositions and methods for modulating synovial sarcoma cells |
| US20220154158A1 (en) | 2019-03-12 | 2022-05-19 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | Cas9 variants with enhanced specificity |
| US12419915B2 (en) | 2019-03-13 | 2025-09-23 | The Broad Institute, Inc. | Microglial progenitors for regeneration of functional microglia in the central nervous system and therapeutics uses thereof |
| WO2020186231A2 (en) | 2019-03-14 | 2020-09-17 | The Broad Institute, Inc. | Crispr effector system based multiplex diagnostics |
| US20220154222A1 (en) | 2019-03-14 | 2022-05-19 | The Broad Institute, Inc. | Novel nucleic acid modifiers |
| US20220143148A1 (en) | 2019-03-14 | 2022-05-12 | The Broad Institute, Inc. | Compositions and methods for modulating cgrp signaling to regulate intestinal innate lymphoid cells |
| US20220220546A1 (en) | 2019-03-14 | 2022-07-14 | The Broad Institute, Inc. | Sherlock assays for tick-borne diseases |
| US20220142948A1 (en) | 2019-03-18 | 2022-05-12 | The Broad Institute, Inc. | Compositions and methods for modulating metabolic regulators of t cell pathogenicity |
| US20220152148A1 (en) | 2019-03-18 | 2022-05-19 | The Broad Institute, Inc. | Modulation of type 2 immunity by targeting clec-2 signaling |
| SG11202108091YA (en) | 2019-03-18 | 2021-08-30 | Regeneron Pharma | Crispr/cas screening platform to identify genetic modifiers of tau seeding or aggregation |
| CN113711046B (zh) | 2019-03-18 | 2023-08-29 | 瑞泽恩制药公司 | 用于揭示与Tau聚集相关的基因脆弱性的CRISPR/Cas脱落筛选平台 |
| CN111733225A (zh) * | 2019-03-25 | 2020-10-02 | 北京大学第一医院 | 一种可用于辅助氯吡格雷精准用药的prkg1基因snp标志物 |
| WO2020205681A1 (en) | 2019-03-29 | 2020-10-08 | Massachusetts Institute Of Technology | Constructs for continuous monitoring of live cells |
| US20220175848A1 (en) | 2019-04-01 | 2022-06-09 | The Broad Institute, Inc. | Methods and compositions for cell therapy |
| CN113727603B (zh) | 2019-04-03 | 2024-03-19 | 瑞泽恩制药公司 | 用于将抗体编码序列插入到安全港基因座中的方法和组合物 |
| IL286917B (en) | 2019-04-04 | 2022-09-01 | Regeneron Pharma | Methods for scar-free insertion of targeted modifications into targeted vectors |
| EP3772929B1 (en) | 2019-04-04 | 2023-11-15 | Regeneron Pharmaceuticals, Inc. | Rodents comprising a humanized coagulation factor 12 locus |
| WO2020223539A1 (en) | 2019-04-30 | 2020-11-05 | The Broad Institute, Inc. | Methods and compositions for barcoding nucleic acid libraries and cell populations |
| EP3963062B1 (en) * | 2019-05-03 | 2026-01-07 | Specific Biologics Inc. | Lipid-encapsulated dual-cleaving endonuclease for dna and gene editing |
| WO2020231702A1 (en) * | 2019-05-11 | 2020-11-19 | Youngsuk Yi | Compositions and methods containing exosomes |
| GB201906768D0 (en) | 2019-05-14 | 2019-06-26 | British American Tobacco Investments Ltd | Method |
| WO2020232271A1 (en) | 2019-05-14 | 2020-11-19 | The Broad Institute, Inc. | Compositions and methods for targeting multinucleated cells |
| WO2020243371A1 (en) | 2019-05-28 | 2020-12-03 | Massachusetts Institute Of Technology | Methods and compositions for modulating immune responses |
| WO2020243613A1 (en) | 2019-05-31 | 2020-12-03 | Children's Hospital Medical Center | Methods of generating and expanding hematopoietic stem cells |
| CN114269361A (zh) | 2019-05-31 | 2022-04-01 | 儿童医院医学中心 | 成形类器官组合物及其制备方法 |
| JP7610339B2 (ja) | 2019-06-04 | 2025-01-08 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | ベータスリップ変異を有するヒト化ttr遺伝子座を含む非ヒト動物と使用方法 |
| TW202112229A (zh) | 2019-06-07 | 2021-04-01 | 美商雷傑納榮製藥公司 | 包含人化白蛋白基因座之非人的動物 |
| US12188045B2 (en) | 2019-06-07 | 2025-01-07 | KSQ Therapeutics, Inc. | Guide RNA combinations and methods of use |
| US11845957B2 (en) | 2019-06-14 | 2023-12-19 | Regeneron Pharmaceuticals, Inc. | Models of tauopathy |
| WO2020257514A1 (en) * | 2019-06-21 | 2020-12-24 | Children's Medical Center Corporation | Methods and compositions for allele specific gene editing |
| EP3994270A1 (en) | 2019-07-02 | 2022-05-11 | Fred Hutchinson Cancer Research Center | Recombinant ad35 vectors and related gene therapy improvements |
| GB201909562D0 (en) | 2019-07-03 | 2019-08-14 | British American Tobacco Investments Ltd | Method |
| GB201909563D0 (en) | 2019-07-03 | 2019-08-14 | British American Tobacco Investments Ltd | Method |
| US12178666B2 (en) | 2019-07-29 | 2024-12-31 | Augmedics Ltd. | Fiducial marker |
| US11980506B2 (en) | 2019-07-29 | 2024-05-14 | Augmedics Ltd. | Fiducial marker |
| US20220282333A1 (en) | 2019-08-13 | 2022-09-08 | The General Hospital Corporation | Methods for predicting outcomes of checkpoint inhibition and treatment thereof |
| US12421557B2 (en) | 2019-08-16 | 2025-09-23 | The Broad Institute, Inc. | Methods for predicting outcomes and treating colorectal cancer using a cell atlas |
| WO2021046257A1 (en) | 2019-09-03 | 2021-03-11 | The Broad Institute, Inc. | Crispr effector system based multiplex cancer diagnostics |
| US20220325296A1 (en) | 2019-09-12 | 2022-10-13 | The Broad Institute, Inc. | Engineered adeno-associated virus capsids |
| KR20220062079A (ko) | 2019-09-13 | 2022-05-13 | 리제너론 파마슈티칼스 인코포레이티드 | 지질 나노입자에 의해 전달되는 CRISPR/Cas 시스템을 사용한 동물에서의 전사 조절 |
| US12264367B2 (en) | 2019-09-19 | 2025-04-01 | The Broad Institute, Inc. | Methods of in vivo evaluation of gene function |
| AU2020348872A1 (en) | 2019-09-20 | 2022-04-14 | Massachusetts Institute Of Technology | Compositions and methods for delivering cargo to a target cell |
| GB201913974D0 (en) * | 2019-09-27 | 2019-11-13 | King S College London | Vector |
| US12297426B2 (en) | 2019-10-01 | 2025-05-13 | The Broad Institute, Inc. | DNA damage response signature guided rational design of CRISPR-based systems and therapies |
| US12195725B2 (en) | 2019-10-03 | 2025-01-14 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for modulating and detecting tissue specific TH17 cell pathogenicity |
| US11793787B2 (en) | 2019-10-07 | 2023-10-24 | The Broad Institute, Inc. | Methods and compositions for enhancing anti-tumor immunity by targeting steroidogenesis |
| WO2021077000A1 (en) | 2019-10-16 | 2021-04-22 | The Broad Institute, Inc. | Engineered muscle targeting compositions |
| US11844800B2 (en) | 2019-10-30 | 2023-12-19 | Massachusetts Institute Of Technology | Methods and compositions for predicting and preventing relapse of acute lymphoblastic leukemia |
| US12195723B2 (en) | 2019-11-08 | 2025-01-14 | The Broad Institute, Inc. | Engineered antigen presenting cells and uses thereof |
| CN114746125B (zh) | 2019-11-08 | 2025-08-08 | 瑞泽恩制药公司 | 用于x连锁青少年型视网膜劈裂症疗法的crispr和aav策略 |
| CN110684801A (zh) * | 2019-11-13 | 2020-01-14 | 武汉华美生物工程有限公司 | 转导cas9基因到哺乳动物细胞进行基因编辑的方法 |
| WO2021108363A1 (en) | 2019-11-25 | 2021-06-03 | Regeneron Pharmaceuticals, Inc. | Crispr/cas-mediated upregulation of humanized ttr allele |
| US12241830B2 (en) | 2019-12-06 | 2025-03-04 | Broad Institute, Inc. | Living biosensors |
| EP3835309A1 (en) | 2019-12-13 | 2021-06-16 | KWS SAAT SE & Co. KGaA | Method for increasing cold or frost tolerance in a plant |
| US11382712B2 (en) | 2019-12-22 | 2022-07-12 | Augmedics Ltd. | Mirroring in image guided surgery |
| AU2020412714A1 (en) * | 2019-12-23 | 2022-05-26 | The Regents Of The University Of California | CRISPR-Cas effector polypeptides and methods of use thereof |
| US20230340537A1 (en) | 2020-01-17 | 2023-10-26 | The Broad Institute, Inc. | Small type ii-d cas proteins and methods of use thereof |
| US12165747B2 (en) | 2020-01-23 | 2024-12-10 | The Broad Institute, Inc. | Molecular spatial mapping of metastatic tumor microenvironment |
| CN113281130B (zh) * | 2020-02-20 | 2024-08-23 | 中国科学院上海高等研究院 | 一种用于大尺寸脑组织的高效的高尔基染色方法 |
| EP3872190A1 (en) | 2020-02-26 | 2021-09-01 | Antibodies-Online GmbH | A method of using cut&run or cut&tag to validate crispr-cas targeting |
| JP2023515671A (ja) | 2020-03-04 | 2023-04-13 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | 免疫療法に対する腫瘍細胞の感作のための方法及び組成物 |
| CN111321150B (zh) * | 2020-03-13 | 2020-12-04 | 广西壮族自治区水产科学研究院 | 一种LvCTL4基因及编码的蛋白质、蛋白质的获取方法、表达载体、重组菌和应用 |
| WO2021188734A1 (en) | 2020-03-17 | 2021-09-23 | The Broad Institute, Inc. | Crispr system high throughput diagnostic systems and methods |
| US11639523B2 (en) | 2020-03-23 | 2023-05-02 | The Broad Institute, Inc. | Type V CRISPR-Cas systems and use thereof |
| US20230102342A1 (en) | 2020-03-23 | 2023-03-30 | Regeneron Pharmaceuticals, Inc. | Non-human animals comprising a humanized ttr locus comprising a v30m mutation and methods of use |
| CN115698278B (zh) | 2020-03-31 | 2025-10-17 | 阿伯生物技术公司 | 包含Cas12i2变体多肽的组合物及其用途 |
| KR20220165764A (ko) | 2020-04-09 | 2022-12-15 | 아아르. 제이. 레날드즈 토바코 캄파니 | 니코티아나 타바쿰에서 니코틴 수준을 조절하는 방법 |
| WO2021211734A1 (en) * | 2020-04-15 | 2021-10-21 | The Regents Of The University Of California | Compositions and methods for treatment |
| CA3178591A1 (en) * | 2020-05-12 | 2021-11-18 | Courtney Young | Immunosuppressive agents and viral delivery re-dosing methods for gene therapy |
| CN111521826A (zh) * | 2020-05-21 | 2020-08-11 | 江海松 | 外周血外泌体中Notch3蛋白作为分子标记的应用及一种检测试剂盒 |
| WO2021243289A1 (en) * | 2020-05-29 | 2021-12-02 | The General Hospital Corporation | Systems and methods for stable and heritable alteration by precision editing (shape) |
| US11389252B2 (en) | 2020-06-15 | 2022-07-19 | Augmedics Ltd. | Rotating marker for image guided surgery |
| KR102687692B1 (ko) * | 2020-07-08 | 2024-07-24 | 경상국립대학교산학협력단 | 미세상동성 기반 말단 결합을 통한 유전자 교정에 이용되는 공여자 핵산 및 이의 용도 |
| WO2022011356A2 (en) * | 2020-07-10 | 2022-01-13 | President And Fellows Of Harvard College | Aav vector delivery systems |
| CN111979241B (zh) * | 2020-07-23 | 2021-10-01 | 上海市第一人民医院 | 制备视网膜色素变性非人哺乳动物模型的方法 |
| WO2022018667A1 (en) | 2020-07-24 | 2022-01-27 | Pfizer Inc. | Combination therapies using cdk2 and cdc25a inhibitors |
| EP4192486A4 (en) | 2020-08-07 | 2024-05-01 | The Broad Institute, Inc. | THERAPEUTIC TARGETING OF PHOSPHATE DISREGULATION IN CANCER VIA THE XPR1 PROTEIN COMPLEX: KIDINS220 |
| US12502163B2 (en) | 2020-09-09 | 2025-12-23 | Augmedics Ltd. | Universal tool adapter for image-guided surgery |
| US12239385B2 (en) | 2020-09-09 | 2025-03-04 | Augmedics Ltd. | Universal tool adapter |
| WO2022056139A1 (en) | 2020-09-10 | 2022-03-17 | Monsanto Technology Llc | Increasing gene editing and site-directed integration events utilizing meiotic and germline promoters |
| CN114250228A (zh) * | 2020-09-22 | 2022-03-29 | 广州瑞风生物科技有限公司 | 靶向CTGF基因的gRNA及其应用 |
| WO2022188039A1 (en) | 2021-03-09 | 2022-09-15 | Huigene Therapeutics Co., Ltd. | Engineered crispr/cas13 system and uses thereof |
| WO2022068912A1 (en) | 2020-09-30 | 2022-04-07 | Huigene Therapeutics Co., Ltd. | Engineered crispr/cas13 system and uses thereof |
| AR123777A1 (es) | 2020-10-15 | 2023-01-11 | Hoffmann La Roche | Constructos de ácido nucleico para transcripción de arn va |
| RU2749307C1 (ru) * | 2020-10-30 | 2021-06-08 | Федеральное государственное бюджетное научное учреждение "Всероссийский научно-исследовательский институт сельскохозяйственной биотехнологии" (ФГБНУ ВНИИСБ) | Новая компактная нуклеаза CAS9 II типа из Anoxybacillus flavithermus |
| EP4001429A1 (en) | 2020-11-16 | 2022-05-25 | Antibodies-Online GmbH | Analysis of crispr-cas binding and cleavage sites followed by high-throughput sequencing (abc-seq) |
| US20240002839A1 (en) | 2020-12-02 | 2024-01-04 | Decibel Therapeutics, Inc. | Crispr sam biosensor cell lines and methods of use thereof |
| CA3207525A1 (en) | 2021-02-11 | 2022-08-18 | Shaorong Chong | Compositions comprising a variant cas12i4 polypeptide and uses thereof |
| CN112997966A (zh) * | 2021-03-08 | 2021-06-22 | 国家卫生健康委科学技术研究所 | 一种基于CRISPR/Cas9技术敲入miRNA-125a的小鼠模型及构建方法 |
| WO2022188797A1 (en) | 2021-03-09 | 2022-09-15 | Huigene Therapeutics Co., Ltd. | Engineered crispr/cas13 system and uses thereof |
| WO2022240846A1 (en) | 2021-05-10 | 2022-11-17 | Sqz Biotechnologies Company | Methods for delivering genome editing molecules to the nucleus or cytosol of a cell and uses thereof |
| JP2024522112A (ja) | 2021-05-27 | 2024-06-11 | 中国科学院動物研究所 | エンジニアリングされたCas12iヌクレアーゼ、エフェクタータンパク質及びその用途 |
| WO2022251644A1 (en) | 2021-05-28 | 2022-12-01 | Lyell Immunopharma, Inc. | Nr4a3-deficient immune cells and uses thereof |
| KR20240027676A (ko) | 2021-06-02 | 2024-03-04 | 라이엘 이뮤노파마, 인크. | Nr4a3-결핍 면역 세포 및 이의 용도 |
| US11896445B2 (en) | 2021-07-07 | 2024-02-13 | Augmedics Ltd. | Iliac pin and adapter |
| CA3225121A1 (en) | 2021-07-20 | 2023-01-26 | Benjamin DEVERMAN | Engineered targeting compositions for endothelial cells of the central nervous system vasculature and methods of use thereof |
| WO2023004422A2 (en) | 2021-07-22 | 2023-01-26 | Arbor Biotechnologies, Inc. | Crispr-associated transposon systems and methods of using same |
| US12150821B2 (en) | 2021-07-29 | 2024-11-26 | Augmedics Ltd. | Rotating marker and adapter for image-guided surgery |
| CN113607963B (zh) * | 2021-08-11 | 2024-05-24 | 河南省人民医院 | 一种预测视网膜衰老进程的蛋白标志物、筛选方法及其应用 |
| US20240352434A1 (en) | 2021-08-12 | 2024-10-24 | Arbor Biotechnologies, Inc. | Compositions comprising a variant cas12i3 polypeptide and uses thereof |
| CN113373178A (zh) * | 2021-08-13 | 2021-09-10 | 上海南方模式生物科技股份有限公司 | 一种tlr8基因人源化动物模型的构建方法及应用 |
| US20240382283A1 (en) | 2021-08-18 | 2024-11-21 | Augmedics Ltd. | Augmented reality assistance for osteotomy and discectomy |
| JP7125727B1 (ja) | 2021-09-07 | 2022-08-25 | 国立大学法人千葉大学 | 核酸配列改変用組成物および核酸配列の標的部位を改変する方法 |
| CA3230927A1 (en) | 2021-09-10 | 2023-03-16 | Agilent Technologies, Inc. | Guide rnas with chemical modification for prime editing |
| CN113913428A (zh) * | 2021-10-14 | 2022-01-11 | 南通大学 | 靶向Tfap2a基因的小干扰RNA及其在制备治疗慢性疼痛药物方面的应用 |
| EP4405463A1 (en) | 2021-10-14 | 2024-07-31 | Lonza Sales AG | Modified producer cells for extracellular vesicle production |
| EP4423271A2 (en) | 2021-10-28 | 2024-09-04 | Regeneron Pharmaceuticals, Inc. | Crispr/cas-related methods and compositions for knocking out c5 |
| IL312452A (en) | 2021-11-01 | 2024-06-01 | Tome Biosciences Inc | A transformant has a single structure for the simultaneous transfer of a gene editing mechanism and a nucleic acid cargo |
| CN114015674B (zh) | 2021-11-02 | 2024-08-30 | 辉大(上海)生物科技有限公司 | 一种CRISPR-Cas12i系统 |
| CA3238939A1 (en) | 2021-12-08 | 2023-06-15 | Gaurang Patel | Mutant myocilin disease model and uses thereof |
| CN114107231B (zh) * | 2021-12-13 | 2023-08-18 | 重庆大学 | 实现全脑突触后神经元胞体标记的重组腺相关病毒及其应用 |
| WO2023108430A1 (zh) * | 2021-12-14 | 2023-06-22 | 中国医学科学院药用植物研究所 | 基于全基因组分析与基因组编辑的植物物种鉴定方法与应用 |
| US20250057980A1 (en) | 2021-12-22 | 2025-02-20 | Tome Biosciences, Inc. | Co-Delivery of a Gene Editor Construct and a Donor Template |
| CN119325508A (zh) | 2021-12-29 | 2025-01-17 | 百时美施贵宝公司 | 着陆垫细胞系的生成 |
| WO2023150181A1 (en) | 2022-02-01 | 2023-08-10 | President And Fellows Of Harvard College | Methods and compositions for treating cancer |
| AU2023216314A1 (en) | 2022-02-02 | 2024-08-22 | Inscripta, Inc. | Nucleic acid-guided nickase fusion proteins |
| US20250032642A1 (en) | 2022-02-02 | 2025-01-30 | Regeneron Pharmaceuticals, Inc. | Crispr-mediated transgene insertion in neonatal cells |
| EP4472407A1 (en) | 2022-02-03 | 2024-12-11 | Nicoventures Trading Limited | Method of modulating alkaloid content in tobacco plants |
| EP4472406A1 (en) | 2022-02-03 | 2024-12-11 | Nicoventures Trading Limited | Method of modulating alkaloid content in tobacco plants |
| WO2023148475A1 (en) | 2022-02-04 | 2023-08-10 | Nicoventures Trading Limited | Method of modulating alkaloid content in tobacco plants |
| CN114480497B (zh) * | 2022-02-28 | 2023-09-15 | 湖南师范大学 | 一种ep400基因敲除斑马鱼心力衰竭模型的构建及其应用的方法 |
| EP4487875A4 (en) | 2022-02-28 | 2025-07-30 | National Univ Corporation Tokai National Higher Education And Research System | MEDICINE FOR A DISEASE CAUSED BY A FRAME-SHIFT MUTATION |
| WO2023196818A1 (en) | 2022-04-04 | 2023-10-12 | The Regents Of The University Of California | Genetic complementation compositions and methods |
| GB202205148D0 (en) | 2022-04-07 | 2022-05-25 | Nicoventures Trading Ltd | Method |
| GB202205149D0 (en) | 2022-04-07 | 2022-05-25 | Nicoventures Trading Ltd | Method |
| GB202205561D0 (en) | 2022-04-14 | 2022-06-01 | Nicoventures Trading Ltd | Method |
| GB202205562D0 (en) | 2022-04-14 | 2022-06-01 | Nicoventures Trading Ltd | Method |
| WO2023205744A1 (en) | 2022-04-20 | 2023-10-26 | Tome Biosciences, Inc. | Programmable gene insertion compositions |
| WO2023203521A1 (en) | 2022-04-21 | 2023-10-26 | Augmedics Ltd. | Systems and methods for medical image visualization |
| GB202206109D0 (en) | 2022-04-27 | 2022-06-08 | Nicoventures Trading Ltd | Method |
| GB202206107D0 (en) | 2022-04-27 | 2022-06-08 | Nicoventures Trading Ltd | Method |
| EP4514981A2 (en) | 2022-04-29 | 2025-03-05 | Regeneron Pharmaceuticals, Inc. | Identification of tissue-specific extragenic safe harbors for gene therapy approaches |
| WO2023215831A1 (en) | 2022-05-04 | 2023-11-09 | Tome Biosciences, Inc. | Guide rna compositions for programmable gene insertion |
| CN119604610A (zh) | 2022-05-09 | 2025-03-11 | 瑞泽恩制药公司 | 用于体内抗体产生的载体和方法 |
| EP4526324A1 (en) | 2022-05-18 | 2025-03-26 | The Broad Institute, Inc. | Engineered viral capsids with increased stability and methods of use thereof |
| KR20250027283A (ko) | 2022-05-19 | 2025-02-25 | 라이엘 이뮤노파마, 인크. | nr4a3을 표적하는 폴리뉴클레오타이드 및 이의 용도 |
| WO2023225670A2 (en) | 2022-05-20 | 2023-11-23 | Tome Biosciences, Inc. | Ex vivo programmable gene insertion |
| WO2023235726A2 (en) | 2022-05-31 | 2023-12-07 | Regeneron Pharmaceuticals, Inc. | Crispr interference therapeutics for c9orf72 repeat expansion disease |
| WO2023235725A2 (en) | 2022-05-31 | 2023-12-07 | Regeneron Pharmaceuticals, Inc. | Crispr-based therapeutics for c9orf72 repeat expansion disease |
| AU2023289696A1 (en) | 2022-06-24 | 2025-01-16 | Tune Therapeutics, Inc. | Compositions, systems, and methods for reducing low-density lipoprotein through targeted gene repression |
| CN115053861A (zh) * | 2022-06-30 | 2022-09-16 | 南方医科大学南方医院 | 一种基于免疫激活的精神分裂症动物模型的构建方法和应用 |
| EP4554961A2 (en) | 2022-07-14 | 2025-05-21 | The Broad Institute, Inc. | Aav capsids that enable cns-wide gene delivery through interactions with the transferrin receptor |
| US20240035010A1 (en) | 2022-07-22 | 2024-02-01 | Arbor Biotechnologies, Inc. | Compositions comprising a variant polypeptide and uses thereof |
| WO2024020557A1 (en) | 2022-07-22 | 2024-01-25 | Arbor Biotechnologies, Inc. | Compositions comprising a variant nuclease and uses thereof |
| WO2024020587A2 (en) | 2022-07-22 | 2024-01-25 | Tome Biosciences, Inc. | Pleiopluripotent stem cell programmable gene insertion |
| CN115109799A (zh) * | 2022-07-26 | 2022-09-27 | 华中科技大学同济医学院附属协和医院 | 一种小分子肽的融合质粒及其在抗肿瘤药物中的应用 |
| CA3261203A1 (en) | 2022-07-29 | 2024-02-01 | Regeneron Pharmaceuticals, Inc. | COMPOSITIONS AND METHODS OF ADMINISTRATION MEDIATED BY THE TRANSFERRIN RECEPTOR (TFR) TO THE BRAIN AND MUSCLE |
| WO2024031053A1 (en) | 2022-08-05 | 2024-02-08 | Regeneron Pharmaceuticals, Inc. | Aggregation-resistant variants of tdp-43 |
| CN115247149B (zh) * | 2022-08-22 | 2023-06-16 | 华域生物科技(天津)有限公司 | 适用于nk细胞的培养基组合物及培养方法 |
| EP4587881A1 (en) | 2022-09-13 | 2025-07-23 | Augmedics Ltd. | Augmented reality eyewear for image-guided medical intervention |
| WO2024064958A1 (en) | 2022-09-23 | 2024-03-28 | Lyell Immunopharma, Inc. | Methods for culturing nr4a-deficient cells |
| WO2024064952A1 (en) | 2022-09-23 | 2024-03-28 | Lyell Immunopharma, Inc. | Methods for culturing nr4a-deficient cells overexpressing c-jun |
| EP4593872A1 (en) | 2022-09-28 | 2025-08-06 | Regeneron Pharmaceuticals, Inc. | Antibody resistant modified receptors to enhance cell-based therapies |
| WO2024077174A1 (en) | 2022-10-05 | 2024-04-11 | Lyell Immunopharma, Inc. | Methods for culturing nr4a-deficient cells |
| WO2024098002A1 (en) | 2022-11-04 | 2024-05-10 | Regeneron Pharmaceuticals, Inc. | Calcium voltage-gated channel auxiliary subunit gamma 1 (cacng1) binding proteins and cacng1-mediated delivery to skeletal muscle |
| JP2025538220A (ja) | 2022-11-14 | 2025-11-26 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | アストロサイトへの線維芽細胞増殖因子受容体3媒介送達のための組成物および方法 |
| WO2024124044A1 (en) | 2022-12-07 | 2024-06-13 | The Brigham And Women’S Hospital, Inc. | Compositions and methods targeting sat1 for enhancing anti¬ tumor immunity during tumor progression |
| EP4638766A1 (en) | 2022-12-20 | 2025-10-29 | NanoCell Therapeutics Holdings B.V. | Integrating and self-inactivating viral vectors and constructs and uses thereof |
| WO2024138194A1 (en) | 2022-12-22 | 2024-06-27 | Tome Biosciences, Inc. | Platforms, compositions, and methods for in vivo programmable gene insertion |
| WO2024155597A1 (en) | 2023-01-17 | 2024-07-25 | Inscripta, Inc. | Methods and compositions of co-expression of t7rna polymerase and inhibitory rna aptamers |
| GB202300905D0 (en) | 2023-01-20 | 2023-03-08 | Nicoventures Trading Ltd | Method |
| IL321908A (en) | 2023-01-27 | 2025-09-01 | Regeneron Pharma | Different rhabdomyovirus glycoproteins and their use |
| WO2024163842A2 (en) | 2023-02-03 | 2024-08-08 | The Broad Institute, Inc. | Delivering genes to the brain endothelium to treat lysosomal storage disorder-derived neuropathology |
| GB202303077D0 (en) | 2023-03-02 | 2023-04-19 | Univ Oslo | Brassica plants with improved seed retention |
| WO2024192141A1 (en) | 2023-03-13 | 2024-09-19 | Dana-Farber Cancer Institute, Inc. | Treatment of cancers having a drug-resistant mesenchymal cell state |
| WO2024197065A2 (en) * | 2023-03-20 | 2024-09-26 | Verve Therapeutics, Inc. | In vivo nickase-based editing of the lpa gene for treatment of cardiovascular disease |
| WO2024197185A1 (en) | 2023-03-21 | 2024-09-26 | The Broad Institute, Inc. | Methods and compositions for dissecting organelle physiology |
| CN121013904A (zh) | 2023-03-30 | 2025-11-25 | 儿童医院医学中心 | 临床级类器官 |
| WO2024220741A1 (en) | 2023-04-19 | 2024-10-24 | Flagship Pioneering Innovations Vii, Llc | Compositions and methods for the production of libraries |
| WO2024226838A2 (en) | 2023-04-25 | 2024-10-31 | The Brigham And Women's Hospital, Inc. | Treatment of autoimmune diseases having a pathogenic t cell state |
| WO2024227131A1 (en) * | 2023-04-27 | 2024-10-31 | Rensselaer Polytechnic Institute | Recombinant enzyme for the accurate insertion of dna sequences in eukaryotic cells |
| WO2024234006A1 (en) | 2023-05-11 | 2024-11-14 | Tome Biosciences, Inc. | Systems, compositions, and methods for targeting liver sinusodial endothelial cells (lsecs) |
| WO2024238817A2 (en) * | 2023-05-16 | 2024-11-21 | Fallon Jim Deceased | Systems and methods for an intranasal drug delivery system |
| WO2024238977A2 (en) | 2023-05-18 | 2024-11-21 | Children's Hospital Medical Center | Liver organoids with intrahepatic sympathetic nerves, and methods of use thereof |
| WO2024236547A1 (en) | 2023-05-18 | 2024-11-21 | Inceptor Bio, Llc | Modified phagocytic cells expressing chimeric antigen receptors comprising a herpes virus entry mediator (hvem) co-stimulatory domain and uses thereof |
| WO2024259309A1 (en) | 2023-06-15 | 2024-12-19 | Regeneron Pharmaceuticals, Inc. | Gene therapy for hearing disorders |
| AU2024302561A1 (en) | 2023-06-16 | 2026-01-29 | Epigenic Therapeutics Pte. Ltd. | Epigenetic editing tool for targeting hepatitis b virus gene |
| WO2024263961A2 (en) | 2023-06-23 | 2024-12-26 | Children's Hospital Medical Center | Methods of matrix-free suspension culture |
| US20240425868A1 (en) | 2023-06-26 | 2024-12-26 | Flagship Pioneering Innovations Vii, Llc | Engineered plasmodia and related methods |
| AU2024309884A1 (en) | 2023-06-30 | 2025-12-18 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for increasing homology-directed repair |
| AU2024315073A1 (en) | 2023-07-28 | 2026-01-22 | Regeneron Pharmaceuticals, Inc. | Use of bgh-sv40l tandem polya to enhance transgene expression during unidirectional gene insertion |
| AU2024317508A1 (en) | 2023-07-28 | 2026-01-29 | Regeneron Pharmaceuticals, Inc. | Anti-tfr: acid sphingomyelinase for treatment of acid sphingomyelinase deficiency |
| AU2024317483A1 (en) | 2023-07-28 | 2026-01-29 | Regeneron Pharmaceuticals, Inc. | Anti-tfr:gaa and anti-cd63:gaa insertion for treatment of pompe disease |
| WO2025038750A2 (en) | 2023-08-14 | 2025-02-20 | President And Fellows Of Harvard College | Methods and compositions for treating cancer |
| WO2025049524A1 (en) | 2023-08-28 | 2025-03-06 | Regeneron Pharmaceuticals, Inc. | Cxcr4 antibody-resistant modified receptors |
| WO2025049788A1 (en) | 2023-08-29 | 2025-03-06 | The Broad Institute, Inc. | Optical genetic screens of intracellular and intercellular transcriptional circuits with perturb-fish |
| WO2025046513A1 (en) | 2023-08-29 | 2025-03-06 | Inceptor Bio, Llc | Methods of manufacturing myeloid-derived cells from hematopoietic stem cells and compositions and uses thereof |
| WO2025050069A1 (en) | 2023-09-01 | 2025-03-06 | Tome Biosciences, Inc. | Programmable gene insertion using engineered integration enzymes |
| WO2025059533A1 (en) | 2023-09-13 | 2025-03-20 | The Broad Institute, Inc. | Crispr enzymes and systems |
| WO2025072383A1 (en) | 2023-09-25 | 2025-04-03 | The Broad Institute, Inc. | Viral open reading frames, uses thereof, and methods of detecting the same |
| WO2025072803A1 (en) | 2023-09-29 | 2025-04-03 | Children's Hospital Medical Center | Ntrk2 signaling-mediated alveolar capillary injury and repair |
| WO2025075911A1 (en) | 2023-10-02 | 2025-04-10 | Inscripta, Inc. | Engineered gpp synthases |
| WO2025085423A1 (en) | 2023-10-19 | 2025-04-24 | The Broad Institute, Inc. | Method of multi-locus crispri targeting with a single truncated guide |
| WO2025097055A2 (en) | 2023-11-02 | 2025-05-08 | The Broad Institute, Inc. | Compositions and methods of use of t cells in immunotherapy |
| WO2025096916A1 (en) | 2023-11-03 | 2025-05-08 | The Broad Institute, Inc. | Multi-site editing in living cells |
| WO2025117544A1 (en) | 2023-11-29 | 2025-06-05 | The Broad Institute, Inc. | Engineered omega guide molecule and iscb compositions, systems, and methods of use thereof |
| WO2025129158A1 (en) | 2023-12-15 | 2025-06-19 | The Broad Institute, Inc. | Engineered arc delivery vesicles and uses thereof |
| WO2025155923A1 (en) | 2024-01-17 | 2025-07-24 | The Broad Institute, Inc. | Aav capsid modifications that enable improved cns-wide gene delivery through interactions with the transferrin receptor |
| WO2025160155A1 (en) | 2024-01-22 | 2025-07-31 | The Broad Institute, Inc. | Epigenetic targeting of prion diseases |
| WO2025166152A1 (en) | 2024-02-02 | 2025-08-07 | The Broad Institute, Inc. | Multiplexed perturbation and decoding in pooled genetic screens |
| WO2025184567A1 (en) | 2024-03-01 | 2025-09-04 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for re-dosing aav using anti-cd40 antagonistic antibody to suppress host anti-aav antibody response |
| WO2025212920A1 (en) | 2024-04-03 | 2025-10-09 | Children's Hospital Medical Center | Multi-zonal liver organoids |
| WO2025217202A1 (en) | 2024-04-08 | 2025-10-16 | Children's Hospital Medical Center | Bile duct organoid |
| WO2025217163A2 (en) | 2024-04-08 | 2025-10-16 | The Broad Institute, Inc. | Novel aav capsids binding to human cd59 |
| WO2025217174A1 (en) | 2024-04-08 | 2025-10-16 | The Broad Institute, Inc. | Aav capsid modifications that enable improved cns-wide gene delivery through interactions with carbonic anhydrase iv |
| WO2025217398A1 (en) | 2024-04-10 | 2025-10-16 | Lyell Immunopharma, Inc. | Methods for culturing cells with improved culture medium |
| WO2025224107A1 (en) | 2024-04-22 | 2025-10-30 | Basecamp Research Ltd | Method and compositions for detecting off-target editing |
| WO2025224182A2 (en) | 2024-04-23 | 2025-10-30 | Basecamp Research Ltd | Single construct platform for simultaneous delivery of gene editing machinery and nucleic acid cargo |
| WO2025235388A1 (en) | 2024-05-06 | 2025-11-13 | Regeneron Pharmaceuticals, Inc. | Transgene genomic identification by nuclease-mediated long read sequencing |
| CN118376795B (zh) * | 2024-05-10 | 2025-10-31 | 厦门大学 | 尿液中n-糖基化蛋白组合作为靶标在早期诊断阿尔茨海默病中的应用 |
| WO2025244671A1 (en) | 2024-05-22 | 2025-11-27 | The Scripps Research Institute | Compositions for use in treating haploinsufficiency diseases |
| WO2025250808A1 (en) | 2024-05-29 | 2025-12-04 | The Brigham And Women’S Hospital, Inc. | Anti-crispr delivery compositions and methods |
| WO2025259669A1 (en) | 2024-06-10 | 2025-12-18 | Regeneron Pharmaceuticals, Inc. | Methods and systems for characterizing modified oligonucleotides |
| US20250388890A1 (en) | 2024-06-20 | 2025-12-25 | Regeneron Pharmaceuticals, Inc. | ASS1 Gene Insertion For The Treatment Of Citrullinemia Type I |
| CN119570025A (zh) * | 2024-11-19 | 2025-03-07 | 中国药科大学 | 一种聚乙烯亚胺衍生物及其作为基因药物载体应用 |
| CN121276067A (zh) * | 2025-12-08 | 2026-01-06 | 首都医科大学附属北京地坛医院 | 一种预测乙型肝炎相关肝衰竭患者继发感染的蛋白质组合、试剂盒及系统 |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8895308B1 (en) * | 2012-12-12 | 2014-11-25 | The Broad Institute Inc. | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US20160013060A1 (en) * | 2014-01-27 | 2016-01-14 | Boe Technology Group Co., Ltd. | Thin film transistor and manufacturing method thereof, array substrate and manufacturing method thereof, and display device |
Family Cites Families (260)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US303910A (en) | 1884-08-19 | Enbaker | ||
| US4217344A (en) | 1976-06-23 | 1980-08-12 | L'oreal | Compositions containing aqueous dispersions of lipid spheres |
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4186183A (en) | 1978-03-29 | 1980-01-29 | The United States Of America As Represented By The Secretary Of The Army | Liposome carriers in chemotherapy of leishmaniasis |
| US4261975A (en) | 1979-09-19 | 1981-04-14 | Merck & Co., Inc. | Viral liposome particle |
| US4485054A (en) | 1982-10-04 | 1984-11-27 | Lipoderm Pharmaceuticals Limited | Method of encapsulating biologically active materials in multilamellar lipid vesicles (MLV) |
| US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
| US5049386A (en) | 1985-01-07 | 1991-09-17 | Syntex (U.S.A.) Inc. | N-ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)Alk-1-YL-N,N,N-tetrasubstituted ammonium lipids and uses therefor |
| US4946787A (en) | 1985-01-07 | 1990-08-07 | Syntex (U.S.A.) Inc. | N-(ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor |
| US4897355A (en) | 1985-01-07 | 1990-01-30 | Syntex (U.S.A.) Inc. | N[ω,(ω-1)-dialkyloxy]- and N-[ω,(ω-1)-dialkenyloxy]-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor |
| US4797368A (en) | 1985-03-15 | 1989-01-10 | The United States Of America As Represented By The Department Of Health And Human Services | Adeno-associated virus as eukaryotic expression vector |
| US4774085A (en) | 1985-07-09 | 1988-09-27 | 501 Board of Regents, Univ. of Texas | Pharmaceutical administration systems containing a mixture of immunomodulators |
| DE122007000007I1 (de) | 1986-04-09 | 2007-05-16 | Genzyme Corp | Genetisch transformierte Tiere, die ein gewünschtes Protein in Milch absondern |
| JPS6395765U (enExample) | 1986-12-11 | 1988-06-21 | ||
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US4783989A (en) | 1987-03-05 | 1988-11-15 | Atlantic Richfield Company | Vapor pressure measurement apparatus and method |
| US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
| US5703055A (en) | 1989-03-21 | 1997-12-30 | Wisconsin Alumni Research Foundation | Generation of antibodies through lipid mediated DNA delivery |
| US5143854A (en) | 1989-06-07 | 1992-09-01 | Affymax Technologies N.V. | Large scale photolithographic solid phase synthesis of polypeptides and receptor binding screening thereof |
| US5264618A (en) | 1990-04-19 | 1993-11-23 | Vical, Inc. | Cationic lipids for intracellular delivery of biologically active molecules |
| AU7979491A (en) | 1990-05-03 | 1991-11-27 | Vical, Inc. | Intracellular delivery of biologically active substances by means of self-assembling lipid complexes |
| US5593970A (en) | 1990-06-11 | 1997-01-14 | Biochem Pharma Inc. | Heterocyclic anthracycline analogs |
| US5210015A (en) | 1990-08-06 | 1993-05-11 | Hoffman-La Roche Inc. | Homogeneous assay system using the nuclease activity of a nucleic acid polymerase |
| US5173414A (en) | 1990-10-30 | 1992-12-22 | Applied Immune Sciences, Inc. | Production of recombinant adeno-associated virus vectors |
| US7150982B2 (en) | 1991-09-09 | 2006-12-19 | Third Wave Technologies, Inc. | RNA detection assays |
| US5587308A (en) | 1992-06-02 | 1996-12-24 | The United States Of America As Represented By The Department Of Health & Human Services | Modified adeno-associated virus vector capable of expression from a novel promoter |
| US5593972A (en) | 1993-01-26 | 1997-01-14 | The Wistar Institute | Genetic immunization |
| US7745416B2 (en) | 1995-04-11 | 2010-06-29 | The Regents Of The University Of California | Method for in vivo regulation of cardiac muscle contractility |
| JPH10510433A (ja) | 1995-06-06 | 1998-10-13 | アイシス・ファーマシューティカルス・インコーポレーテッド | 高いキラル純度のホスホロチオエート結合を有するオリゴヌクレオチド |
| WO1997000321A1 (en) | 1995-06-14 | 1997-01-03 | Commonwealth Scientific And Industrial Research Organisation | Immune response modulators and uses therefor |
| US5985662A (en) | 1995-07-13 | 1999-11-16 | Isis Pharmaceuticals Inc. | Antisense inhibition of hepatitis B virus replication |
| US5622856A (en) | 1995-08-03 | 1997-04-22 | Avigen | High efficiency helper system for AAV vector production |
| US5846946A (en) | 1996-06-14 | 1998-12-08 | Pasteur Merieux Serums Et Vaccins | Compositions and methods for administering Borrelia DNA |
| GB9907461D0 (en) | 1999-03-31 | 1999-05-26 | King S College London | Neurite regeneration |
| US6251677B1 (en) | 1997-08-25 | 2001-06-26 | The Trustees Of The University Of Pennsylvania | Hybrid adenovirus-AAV virus and methods of use thereof |
| GB9720465D0 (en) | 1997-09-25 | 1997-11-26 | Oxford Biomedica Ltd | Dual-virus vectors |
| EP1025217B1 (en) | 1997-10-24 | 2006-10-04 | Invitrogen Corporation | Recombinational cloning using nucleic acids having recombination sites |
| US6750059B1 (en) | 1998-07-16 | 2004-06-15 | Whatman, Inc. | Archiving of vectors |
| US6534261B1 (en) | 1999-01-12 | 2003-03-18 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US7868149B2 (en) | 1999-07-20 | 2011-01-11 | Monsanto Technology Llc | Plant genome sequence and uses thereof |
| US6479808B1 (en) | 1999-07-07 | 2002-11-12 | The United States Of America As Represented By The Administrator Of The National Aeronautics And Space Administration | Method and systems for collecting data from multiple fields of view |
| US6603061B1 (en) | 1999-07-29 | 2003-08-05 | Monsanto Company | Agrobacterium-mediated plant transformation method |
| GB0024550D0 (enExample) | 2000-10-06 | 2000-11-22 | Oxford Biomedica Ltd | |
| JP3454818B1 (ja) * | 2001-03-16 | 2003-10-06 | 直哉 小林 | 肝臓細胞の増殖方法、該方法により得られる肝臓細胞、およびその用途 |
| ES2404689T3 (es) | 2001-04-05 | 2013-05-28 | The Johns Hopkins University | Vacunas quiméricas que comprenden el dominio lumenal de LAMP-1 o LAMP-2 |
| CA2921821A1 (en) | 2001-07-12 | 2003-01-23 | University Of Massachusetts | In vivo production of small interfering rnas that mediate gene silencing |
| AU2002327430A1 (en) | 2001-08-08 | 2003-02-24 | Genzyme Corporation | Methods for treating diabetes and other blood sugar disorders |
| WO2003016338A1 (en) | 2001-08-15 | 2003-02-27 | Parker Hughes Institute | Crystal structure of the btk kinase domain |
| US7776321B2 (en) | 2001-09-26 | 2010-08-17 | Mayo Foundation For Medical Education And Research | Mutable vaccines |
| GB0125216D0 (en) | 2001-10-19 | 2001-12-12 | Univ Strathclyde | Dendrimers for use in targeted delivery |
| US20090100536A1 (en) | 2001-12-04 | 2009-04-16 | Monsanto Company | Transgenic plants with enhanced agronomic traits |
| CN1620508A (zh) | 2001-12-21 | 2005-05-25 | 牛津生物医学(英国)有限公司 | 转基因生物 |
| US7206639B2 (en) | 2002-03-15 | 2007-04-17 | Sarcos Investments Lc | Cochlear drug delivery system and method |
| WO2003087993A2 (en) | 2002-04-09 | 2003-10-23 | Beattie Kenneth L | Oligonucleotide probes for genosensor chips |
| WO2003104414A2 (en) | 2002-06-11 | 2003-12-18 | The Scripps Research Institute | Artificial transcription factors |
| US7867193B2 (en) | 2004-01-29 | 2011-01-11 | The Charles Stark Draper Laboratory, Inc. | Drug delivery apparatus |
| CA2491164C (en) | 2002-06-28 | 2012-05-08 | Cory Giesbrecht | Method and apparatus for producing liposomes |
| GB0220467D0 (en) | 2002-09-03 | 2002-10-09 | Oxford Biomedica Ltd | Composition |
| CA2499188A1 (en) | 2002-09-27 | 2004-04-08 | Cold Spring Harbor Laboratory | Cell-based rna interference and related methods and compositions |
| WO2004046321A2 (en) * | 2002-11-15 | 2004-06-03 | Trustees Of Boston University | Cis/trans riboregulators |
| US20060178297A1 (en) | 2003-01-28 | 2006-08-10 | Troy Carol M | Systems and methods for silencing expression of a gene in a cell and uses thereof |
| EP1644534A4 (en) | 2003-07-03 | 2006-08-09 | Univ California | GENOMKARTING OF FUNCTIONAL DNA ELEMENTS AND CELLULAR PROTEINS |
| KR101168440B1 (ko) | 2003-07-16 | 2012-07-27 | 프로티바 바이오쎄라퓨틱스, 인코포레이티드 | 지질 캡슐화된 간섭 rna |
| US8409861B2 (en) | 2003-08-08 | 2013-04-02 | Sangamo Biosciences, Inc. | Targeted deletion of cellular DNA sequences |
| AU2004263865B2 (en) | 2003-08-08 | 2007-05-17 | Sangamo Therapeutics, Inc. | Methods and compositions for targeted cleavage and recombination |
| KR101164256B1 (ko) | 2003-09-15 | 2012-07-10 | 프로티바 바이오쎄라퓨틱스, 인코포레이티드 | 폴리에틸렌글리콜 개질된 지질 화합물 및 그의 용도 |
| GB0325379D0 (en) | 2003-10-30 | 2003-12-03 | Oxford Biomedica Ltd | Vectors |
| US8673634B2 (en) | 2003-11-13 | 2014-03-18 | Massachusetts Eye & Ear Infirmary | Method for the treatment of hearing loss |
| FR2862659B1 (fr) | 2003-11-21 | 2006-02-10 | Pasteur Institut | Genome de legionella pneumophila souche paris- applications diagnostiques et epidemiologiques |
| US8053232B2 (en) | 2004-01-23 | 2011-11-08 | Virxsys Corporation | Correction of alpha-1-antitrypsin genetic defects using spliceosome mediated RNA trans splicing |
| US20070244031A1 (en) | 2004-01-27 | 2007-10-18 | Quan Lu | Methods and Compositions for Homozygous Gene Inactivation Using Collections of Pre-Defined Nucleotide Sequences Complementary Chromosomal Transcripts |
| US20050220796A1 (en) | 2004-03-31 | 2005-10-06 | Dynan William S | Compositions and methods for modulating DNA repair |
| ATE537263T1 (de) | 2004-06-07 | 2011-12-15 | Protiva Biotherapeutics Inc | Kationische lipide und verwendungsverfahren |
| WO2005121348A1 (en) | 2004-06-07 | 2005-12-22 | Protiva Biotherapeutics, Inc. | Lipid encapsulated interfering rna |
| FR2872170B1 (fr) | 2004-06-25 | 2006-11-10 | Centre Nat Rech Scient Cnrse | Lentivirus non interactif et non replicatif, preparation et utilisations |
| CA2573702C (en) | 2004-07-16 | 2013-10-15 | The Government Of The United States Of America As Represented By The Sec Retary Of The Department Of Health And Human Services | Vaccine constructs and combination of vaccines designed to improve the breadth of the immune response to diverse strains and clades of hiv |
| GB0422877D0 (en) | 2004-10-14 | 2004-11-17 | Univ Glasgow | Bioactive polymers |
| US7404969B2 (en) | 2005-02-14 | 2008-07-29 | Sirna Therapeutics, Inc. | Lipid nanoparticle based compositions and methods for the delivery of biologically active molecules |
| WO2006116756A1 (en) * | 2005-04-28 | 2006-11-02 | Benitec, Limited. | Multiple-rnai expression cassettes for simultaneous delivery of rnai agents related to heterozygotic expression patterns |
| US7892224B2 (en) | 2005-06-01 | 2011-02-22 | Brainlab Ag | Inverse catheter planning |
| KR101419729B1 (ko) | 2005-07-26 | 2014-07-17 | 상가모 바이오사이언스 인코포레이티드 | 외래 핵산 서열의 표적화된 통합 및 발현 |
| EP3284833B1 (en) | 2005-08-26 | 2021-12-01 | DuPont Nutrition Biosciences ApS | Use of crispr associated genes (cas) |
| US9265933B2 (en) | 2005-09-08 | 2016-02-23 | Massachusetts Eye And Ear Infirmary | Cochlear implants containing biological cells and uses thereof |
| WO2007048046A2 (en) | 2005-10-20 | 2007-04-26 | Protiva Biotherapeutics, Inc. | Sirna silencing of filovirus gene expression |
| AU2006308765B2 (en) | 2005-11-02 | 2013-09-05 | Arbutus Biopharma Corporation | Modified siRNA molecules and uses thereof |
| GB0526211D0 (en) | 2005-12-22 | 2006-02-01 | Oxford Biomedica Ltd | Viral vectors |
| WO2007091269A2 (en) | 2006-02-08 | 2007-08-16 | Quark Pharmaceuticals, Inc. | NOVEL TANDEM siRNAS |
| WO2007093836A1 (en) | 2006-02-13 | 2007-08-23 | Cellectis | Meganuclease variants cleaving a dna target sequence from a xp gene and uses thereof |
| US9677123B2 (en) | 2006-03-15 | 2017-06-13 | Siemens Healthcare Diagnostics Inc. | Degenerate nucleobase analogs |
| EP2835429B1 (en) | 2006-05-11 | 2017-12-13 | Alnylam Pharmaceuticals Inc. | Compositions and methods for inhibiting expression of the PCSK9 gene |
| WO2008054544A2 (en) | 2006-05-22 | 2008-05-08 | Immune Disease Institute, Inc. | Method for delivery across the blood brain barrier |
| US7915399B2 (en) | 2006-06-09 | 2011-03-29 | Protiva Biotherapeutics, Inc. | Modified siRNA molecules and uses thereof |
| WO2008010009A1 (en) | 2006-07-18 | 2008-01-24 | Cellectis | Meganuclease variants cleaving a dna target sequence from a rag gene and uses thereof |
| CA2669313A1 (en) | 2006-11-14 | 2008-05-22 | Cellectis | Meganuclease variants cleaving a dna target sequence from the hprt gene and uses thereof |
| WO2008093152A1 (en) | 2007-02-01 | 2008-08-07 | Cellectis | Obligate heterodimer meganucleases and uses thereof |
| US8173792B2 (en) | 2007-02-09 | 2012-05-08 | The Board Of Trustees Of The Leland Stanford Junior University | Method for regulating protein function in cells using synthetic small molecules |
| ES2541693T3 (es) | 2007-03-02 | 2015-07-23 | Dupont Nutrition Biosciences Aps | Cultivos con resistencia mejorada a fagos |
| PE20090064A1 (es) | 2007-03-26 | 2009-03-02 | Novartis Ag | Acido ribonucleico de doble cadena para inhibir la expresion del gen e6ap humano y composicion farmaceutica que lo comprende |
| WO2008146289A2 (en) | 2007-05-29 | 2008-12-04 | Celine Tezartes-Strauss | Garment with built-in protecting pads |
| WO2008149176A1 (en) | 2007-06-06 | 2008-12-11 | Cellectis | Meganuclease variants cleaving a dna target sequence from the mouse rosa26 locus and uses thereof |
| WO2009013559A1 (en) | 2007-07-23 | 2009-01-29 | Cellectis | Meganuclease variants cleaving a dna target sequence from the human hemoglobin beta gene and uses thereof |
| WO2009019528A1 (en) | 2007-08-03 | 2009-02-12 | Cellectis | Meganuclease variants cleaving a dna target sequence from the human interleukin-2 receptor gamma chain gene and uses thereof |
| CN103083794B (zh) | 2007-08-14 | 2016-03-02 | 弗雷德哈钦森癌症研究中心 | 用于递送治疗药物的针阵列组件和方法 |
| CA2711179A1 (en) | 2007-12-31 | 2009-07-16 | Nanocor Therapeutics, Inc. | Rna interference for the treatment of heart failure |
| EP2732819B1 (en) | 2008-02-07 | 2019-10-16 | Massachusetts Eye & Ear Infirmary | Compounds that enhance Atoh-1 expression |
| WO2009105690A2 (en) | 2008-02-21 | 2009-08-27 | Targeted Genetics Corporation | Devices and methods for delivering polynucleotides into retinal cells of the macula and fovea |
| CN102119217B (zh) | 2008-04-15 | 2015-06-03 | 普洛体维生物治疗公司 | 用于核酸递送的新型制剂 |
| US20090280262A1 (en) | 2008-05-08 | 2009-11-12 | Chung Yuan Christian University | Method for forming composite membrane with porous coating layer and apparatus thereof |
| US8431692B2 (en) | 2008-06-06 | 2013-04-30 | Quark Pharmaceuticals, Inc. | Compositions and methods for treatment of ear disorders |
| US8999945B2 (en) | 2008-06-30 | 2015-04-07 | Silenseed Ltd | Methods, compositions and systems for local delivery of drugs |
| US20110117189A1 (en) | 2008-07-08 | 2011-05-19 | S.I.F.I. Societa' Industria Farmaceutica Italiana S.P.A. | Ophthalmic compositions for treating pathologies of the posterior segment of the eye |
| WO2010011961A2 (en) | 2008-07-25 | 2010-01-28 | University Of Georgia Research Foundation, Inc. | Prokaryotic rnai-like system and methods of use |
| WO2010014218A2 (en) | 2008-07-29 | 2010-02-04 | Academia Sinica | Puf-a and related compounds for treatment of retinopathies and sight-threatening ophthalmologic disorders |
| WO2010026443A1 (en) | 2008-09-08 | 2010-03-11 | Cellectis | Meganuclease variants cleaving a dna target sequence from a glutamine synthetase gene and uses thereof |
| MX2011002731A (es) | 2008-09-15 | 2011-04-26 | Childrens Medical Center | Modulacion de bcl11a para tratamiento de hemoglobinopatias. |
| US20100076057A1 (en) * | 2008-09-23 | 2010-03-25 | Northwestern University | TARGET DNA INTERFERENCE WITH crRNA |
| MX344354B (es) | 2008-10-20 | 2016-12-14 | Alnylam Pharmaceuticals Inc | Composiciones y metodos para inhibir la expresion de transtiretina. |
| WO2010053518A2 (en) | 2008-10-29 | 2010-05-14 | Sangamo Biosciences, Inc. | Methods and compositions for inactivating glutamine synthetase gene expression |
| WO2010054108A2 (en) | 2008-11-06 | 2010-05-14 | University Of Georgia Research Foundation, Inc. | Cas6 polypeptides and methods of use |
| JP6087504B2 (ja) | 2008-11-07 | 2017-03-01 | マサチューセッツ インスティテュート オブ テクノロジー | アミノアルコールリピドイドおよびその使用 |
| US20110023145A1 (en) | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genomic editing of genes involved in autism spectrum disorders |
| CN102625655B (zh) * | 2008-12-04 | 2016-07-06 | 桑格摩生物科学股份有限公司 | 使用锌指核酸酶在大鼠中进行基因组编辑 |
| US20110023139A1 (en) | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genomic editing of genes involved in cardiovascular disease |
| US20120159653A1 (en) | 2008-12-04 | 2012-06-21 | Sigma-Aldrich Co. | Genomic editing of genes involved in macular degeneration |
| US20110016540A1 (en) | 2008-12-04 | 2011-01-20 | Sigma-Aldrich Co. | Genome editing of genes associated with trinucleotide repeat expansion disorders in animals |
| US20110023144A1 (en) | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genomic editing of genes involved in amyotrophyic lateral sclerosis disease |
| US20110023153A1 (en) | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genomic editing of genes involved in alzheimer's disease |
| US20110023146A1 (en) | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genomic editing of genes involved in secretase-associated disorders |
| EP2373382B1 (en) | 2008-12-10 | 2017-02-15 | Alnylam Pharmaceuticals, Inc. | Gnaq targeted dsrna compositions and methods for inhibiting expression |
| WO2010075424A2 (en) | 2008-12-22 | 2010-07-01 | The Regents Of University Of California | Compositions and methods for downregulating prokaryotic genes |
| EP2206723A1 (en) | 2009-01-12 | 2010-07-14 | Bonas, Ulla | Modular DNA-binding domains |
| US20110239315A1 (en) | 2009-01-12 | 2011-09-29 | Ulla Bonas | Modular dna-binding domains and methods of use |
| JP5932632B2 (ja) | 2009-03-20 | 2016-06-15 | サンガモ バイオサイエンシーズ, インコーポレイテッド | 改変された亜鉛フィンガータンパク質を使用したcxcr4の修飾 |
| TWI576432B (zh) | 2009-04-07 | 2017-04-01 | 陶氏農業科學公司 | 序列特異性核酸酶之奈米粒子媒介式遞送技術 |
| EP2427577A4 (en) | 2009-05-04 | 2013-10-23 | Hutchinson Fred Cancer Res | PSEUDOTYPED RETROVIRAL VECTORS WITH COCAL VESICULOVIRUS SHELL |
| WO2011036510A1 (en) | 2009-09-24 | 2011-03-31 | Cellectis | Meganuclease variants cleaving the genome of the herpes simplex virus and uses thereof |
| WO2010143917A2 (en) | 2009-06-11 | 2010-12-16 | Toolgen Incorporation | Targeted genomic rearrangements using site-specific nucleases |
| US8515378B2 (en) | 2009-06-15 | 2013-08-20 | Agc Automotive Americas R&D, Inc. | Antenna system and method for mitigating multi-path effect |
| JP5766188B2 (ja) | 2009-07-01 | 2015-08-19 | プロチバ バイオセラピューティクス インコーポレイティッド | 固形腫瘍に治療剤を送達するための脂質製剤 |
| WO2011000108A1 (en) | 2009-07-01 | 2011-01-06 | Protiva Biotherapeutics, Inc. | Compositions and methods for silencing apolipoprotein b |
| SG177711A1 (en) * | 2009-07-24 | 2012-02-28 | Sigma Aldrich Co Llc | Method for genome editing |
| CA2769262C (en) | 2009-07-28 | 2019-04-30 | Sangamo Biosciences, Inc. | Methods and compositions for treating trinucleotide repeat disorders |
| US8927807B2 (en) | 2009-09-03 | 2015-01-06 | The Regents Of The University Of California | Nitrate-responsive promoter |
| US8889394B2 (en) | 2009-09-07 | 2014-11-18 | Empire Technology Development Llc | Multiple domain proteins |
| US8956828B2 (en) | 2009-11-10 | 2015-02-17 | Sangamo Biosciences, Inc. | Targeted disruption of T cell receptor genes using engineered zinc finger protein nucleases |
| DE112010004582T5 (de) * | 2009-11-27 | 2012-11-29 | Basf Plant Science Company Gmbh | Optimierte Endonukleasen und Anwendungen davon |
| KR102110725B1 (ko) | 2009-12-10 | 2020-05-13 | 리전츠 오브 더 유니버스티 오브 미네소타 | Tal 이펙터-매개된 dna 변형 |
| CA2784547A1 (en) | 2009-12-23 | 2011-06-30 | Max-Planck-Gesellschaft Zur Foerderung Der Wissenschaften E.V. | Influenza targets |
| AU2011215557B2 (en) | 2010-02-09 | 2016-03-10 | Sangamo Therapeutics, Inc. | Targeted genomic modification with partially single-stranded donor molecules |
| US10087431B2 (en) | 2010-03-10 | 2018-10-02 | The Regents Of The University Of California | Methods of generating nucleic acid fragments |
| SG185367A1 (en) | 2010-04-26 | 2012-12-28 | Sangamo Biosciences Inc | Genome editing of a rosa locus using zinc-finger nucleases |
| US8927514B2 (en) | 2010-04-30 | 2015-01-06 | City Of Hope | Recombinant adeno-associated vectors for targeted treatment |
| CN103038338B (zh) | 2010-05-10 | 2017-03-08 | 加利福尼亚大学董事会 | 核糖核酸内切酶组合物及其使用方法 |
| WO2011141825A1 (en) | 2010-05-12 | 2011-11-17 | Cellectis | Meganuclease variants cleaving a dna target sequence from the rhodopsin gene and uses thereof |
| CA2799095A1 (en) | 2010-05-12 | 2011-11-17 | Cellectis | Meganuclease variants cleaving a dna target sequence from the dystrophin gene and uses thereof |
| CA2798988C (en) * | 2010-05-17 | 2020-03-10 | Sangamo Biosciences, Inc. | Tal-effector (tale) dna-binding polypeptides and uses thereof |
| EP2575894B1 (en) | 2010-05-28 | 2015-02-25 | Oxford Biomedica (UK) Ltd | Delivery of lentiviral vectors to the brain |
| SG187075A1 (en) | 2010-07-23 | 2013-03-28 | Sigma Aldrich Co Llc | Genome editing using targeting endonucleases and single-stranded nucleic acids |
| DK2601611T3 (da) | 2010-08-02 | 2021-02-01 | Integrated Dna Tech Inc | Fremgangsmåder til forudsigelse af stabilitet og smeltetemperaturer for nukleinsyreduplekser |
| WO2012027675A2 (en) | 2010-08-26 | 2012-03-01 | Massachusetts Institute Of Technology | Poly(beta-amino alcohols), their preparation, and uses thereof |
| US9549901B2 (en) | 2010-09-03 | 2017-01-24 | The Brigham And Women's Hospital, Inc. | Lipid-polymer hybrid particles |
| RU2608643C2 (ru) | 2010-10-12 | 2017-01-23 | Дзе Чилдрен`З Хоспитал Оф Филадельфия | Способы и композиции для лечения гемофилии в |
| US9405700B2 (en) | 2010-11-04 | 2016-08-02 | Sonics, Inc. | Methods and apparatus for virtualization in an integrated circuit |
| WO2012106725A2 (en) | 2011-02-04 | 2012-08-09 | Sangamo Biosciences, Inc. | Methods and compositions for treating occular disorders |
| JP2014511687A (ja) | 2011-03-31 | 2014-05-19 | モデルナ セラピューティクス インコーポレイテッド | 工学操作された核酸の送達および製剤 |
| CN105755044A (zh) | 2011-04-22 | 2016-07-13 | 加利福尼亚大学董事会 | 具有变异衣壳的腺相关病毒病毒体及其使用方法 |
| AU2012249390B2 (en) | 2011-04-27 | 2017-03-30 | Amyris, Inc. | Methods for genomic modification |
| US20120295960A1 (en) | 2011-05-20 | 2012-11-22 | Oxford Biomedica (Uk) Ltd. | Treatment regimen for parkinson's disease |
| WO2012164565A1 (en) * | 2011-06-01 | 2012-12-06 | Yeda Research And Development Co. Ltd. | Compositions and methods for downregulating prokaryotic genes |
| AU2012312260B2 (en) | 2011-09-21 | 2017-08-31 | Sangamo Therapeutics, Inc. | Methods and compositions for regulation of transgene expression |
| AU2012318562A1 (en) | 2011-10-06 | 2014-04-10 | Sangamo Therapeutics, Inc. | Methods and compositions for regulating HIV infection |
| JP6188703B2 (ja) | 2011-10-27 | 2017-08-30 | サンガモ セラピューティクス, インコーポレイテッド | Hprt遺伝子座を修飾するための方法および組成物 |
| US20130122096A1 (en) | 2011-11-14 | 2013-05-16 | Silenseed Ltd. | Compositions for drug delivery and methods of manufacturing and using same |
| CA2855653A1 (en) | 2011-11-18 | 2013-05-23 | Universite Laval | Methods and products for increasing frataxin levels and uses thereof |
| US10640785B2 (en) | 2011-11-22 | 2020-05-05 | The Children's Hospital Of Philadelphia | Virus vectors for highly efficient transgene delivery |
| US8450107B1 (en) | 2011-11-30 | 2013-05-28 | The Broad Institute Inc. | Nucleotide-specific recognition sequences for designer TAL effectors |
| US20130137173A1 (en) | 2011-11-30 | 2013-05-30 | Feng Zhang | Nucleotide-specific recognition sequences for designer tal effectors |
| PL2791160T3 (pl) | 2011-12-16 | 2022-06-20 | Modernatx, Inc. | Kompozycje zmodyfikowanego mrna |
| GB201122458D0 (en) | 2011-12-30 | 2012-02-08 | Univ Wageningen | Modified cascade ribonucleoproteins and uses thereof |
| KR101833589B1 (ko) | 2012-02-24 | 2018-03-02 | 프레드 헛친슨 켄서 리서치 센터 | 이상혈색소증 치료를 위한 조성물 및 방법 |
| MX374399B (es) | 2012-02-29 | 2025-03-06 | Sangamo Biosciences Inc | Composiciones y sus usos para tratar y prevenir la enfermedad de huntington. |
| US9637739B2 (en) | 2012-03-20 | 2017-05-02 | Vilnius University | RNA-directed DNA cleavage by the Cas9-crRNA complex |
| WO2013141680A1 (en) | 2012-03-20 | 2013-09-26 | Vilnius University | RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX |
| WO2013151665A2 (en) | 2012-04-02 | 2013-10-10 | modeRNA Therapeutics | Modified polynucleotides for the production of proteins associated with human disease |
| AU2013204327B2 (en) | 2012-04-20 | 2016-09-01 | Aviagen | Cell transfection method |
| WO2013163628A2 (en) | 2012-04-27 | 2013-10-31 | Duke University | Genetic correction of mutated genes |
| EP4570908A3 (en) | 2012-05-25 | 2025-10-22 | The Regents of the University of California | Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription |
| CA2874828A1 (en) | 2012-06-01 | 2013-12-05 | Drexel University | Modulation of hepatitis b virus cccdna transcription |
| FR2993379B1 (fr) | 2012-07-10 | 2015-09-04 | Morpho | Procede de traitement comparatif securise |
| FR2995325B1 (fr) | 2012-09-11 | 2015-03-13 | Ct Tech De L Ind Des Papiers Cartons Et Celluloses | Procede de fabrication d'un support fibreux multicouche par fractionnement et stratification |
| US9597357B2 (en) | 2012-10-10 | 2017-03-21 | Sangamo Biosciences, Inc. | T cell modifying compounds and uses thereof |
| CN116064532A (zh) | 2012-10-23 | 2023-05-05 | 基因工具股份有限公司 | 用于切割靶dna的组合物及其用途 |
| SG11201503824SA (en) * | 2012-12-06 | 2015-06-29 | Sigma Aldrich Co Llc | Crispr-based genome modification and regulation |
| WO2014093479A1 (en) | 2012-12-11 | 2014-06-19 | Montana State University | Crispr (clustered regularly interspaced short palindromic repeats) rna-guided control of gene regulation |
| WO2014093595A1 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Crispr-cas component systems, methods and compositions for sequence manipulation |
| WO2014093622A2 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| WO2014093694A1 (en) * | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Crispr-cas nickase systems, methods and compositions for sequence manipulation in eukaryotes |
| US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| PT2784162E (pt) | 2012-12-12 | 2015-08-27 | Broad Inst Inc | Engenharia de sistemas, métodos e composições guia otimizadas para a manipulação de sequências |
| EP2784162B1 (en) | 2012-12-12 | 2015-04-08 | The Broad Institute, Inc. | Engineering of systems, methods and optimized guide compositions for sequence manipulation |
| EP2931892B1 (en) | 2012-12-12 | 2018-09-12 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof |
| WO2014093701A1 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions, methods, knock out libraries and applications thereof |
| DK2931898T3 (en) | 2012-12-12 | 2016-06-20 | Massachusetts Inst Technology | CONSTRUCTION AND OPTIMIZATION OF SYSTEMS, PROCEDURES AND COMPOSITIONS FOR SEQUENCE MANIPULATION WITH FUNCTIONAL DOMAINS |
| IL308158A (en) | 2012-12-17 | 2023-12-01 | Harvard College | Rna-guided human genome engineering |
| US10544405B2 (en) | 2013-01-16 | 2020-01-28 | Emory University | Cas9-nucleic acid complexes and uses related thereto |
| US10660943B2 (en) | 2013-02-07 | 2020-05-26 | The Rockefeller University | Sequence specific antimicrobials |
| US11135273B2 (en) | 2013-02-07 | 2021-10-05 | The Rockefeller University | Sequence specific antimicrobials |
| US9163837B2 (en) | 2013-02-27 | 2015-10-20 | Siemens Aktiengesellschaft | Flow conditioner in a combustor of a gas turbine engine |
| EP2971167B1 (en) | 2013-03-14 | 2019-07-31 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| KR102405549B1 (ko) | 2013-03-15 | 2022-06-08 | 더 제너럴 하스피탈 코포레이션 | Rna-안내 게놈 편집을 위해 특이성을 증가시키기 위한 절단된 안내 rna(tru-grnas)의 이용 |
| US9234213B2 (en) | 2013-03-15 | 2016-01-12 | System Biosciences, Llc | Compositions and methods directed to CRISPR/Cas genomic engineering systems |
| SG11201507838QA (en) | 2013-03-27 | 2015-10-29 | Wilco Ag | Method of inline inspecting and/or testing devices and apparatus to perform such method |
| EP2981612B1 (en) | 2013-04-04 | 2019-07-03 | Trustees of Dartmouth College | Compositions and methods for in vivo excision of hiv-1 proviral dna |
| CN105518146B (zh) | 2013-04-04 | 2022-07-15 | 哈佛学院校长同事会 | 利用CRISPR/Cas系统的基因组编辑的治疗性用途 |
| US9873894B2 (en) | 2013-05-15 | 2018-01-23 | Sangamo Therapeutics, Inc. | Methods and compositions for treatment of a genetic condition |
| JP7065564B2 (ja) | 2013-05-29 | 2022-05-12 | セレクティス | Cas9ニッカーゼ活性を用いて正確なdna切断をもたらすための方法 |
| SG10201913068PA (en) | 2013-06-04 | 2020-02-27 | Harvard College | Rna-guided transcriptional regulation |
| US20140356956A1 (en) | 2013-06-04 | 2014-12-04 | President And Fellows Of Harvard College | RNA-Guided Transcriptional Regulation |
| JP7085716B2 (ja) | 2013-06-05 | 2022-06-17 | デューク ユニバーシティ | Rnaガイド遺伝子編集及び遺伝子調節 |
| WO2014204729A1 (en) | 2013-06-17 | 2014-12-24 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components |
| KR20160019553A (ko) | 2013-06-17 | 2016-02-19 | 더 브로드 인스티튜트, 인코퍼레이티드 | 유사분열 후 세포의 질병 및 장애를 표적화하고 모델링하기 위한 시스템, 방법 및 조성물의 전달, 유전자 조작 및 최적화 |
| AU2014281026B2 (en) | 2013-06-17 | 2020-05-28 | Massachusetts Institute Of Technology | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
| WO2014204725A1 (en) | 2013-06-17 | 2014-12-24 | The Broad Institute Inc. | Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation |
| RU2716420C2 (ru) | 2013-06-17 | 2020-03-11 | Те Брод Инститьют Инк. | Доставка и применение систем crispr-cas, векторов и композиций для целенаправленного воздействия и терапии в печени |
| EP3725885A1 (en) | 2013-06-17 | 2020-10-21 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions methods, screens and applications thereof |
| CN103343120B (zh) | 2013-07-04 | 2015-03-04 | 中国科学院遗传与发育生物学研究所 | 一种小麦基因组定点改造方法 |
| LT3019619T (lt) | 2013-07-11 | 2021-12-10 | Modernatx, Inc. | Sintetinius polinukleotidus apimančios kompozicijos, koduojančios susijusius su crispr baltymus ir sintetines sgrnas, ir jų naudojimo būdai |
| CN103388006B (zh) | 2013-07-26 | 2015-10-28 | 华东师范大学 | 一种基因定点突变的构建方法 |
| AU2014312123A1 (en) | 2013-08-29 | 2016-03-17 | Temple University Of The Commonwealth System Of Higher Education | Methods and compositions for RNA-guided treatment of HIV infection |
| US9526784B2 (en) | 2013-09-06 | 2016-12-27 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
| US9388430B2 (en) | 2013-09-06 | 2016-07-12 | President And Fellows Of Harvard College | Cas9-recombinase fusion proteins and uses thereof |
| WO2015048577A2 (en) | 2013-09-27 | 2015-04-02 | Editas Medicine, Inc. | Crispr-related methods and compositions |
| WO2015048690A1 (en) | 2013-09-27 | 2015-04-02 | The Regents Of The University Of California | Optimized small guide rnas and methods of use |
| WO2015065964A1 (en) | 2013-10-28 | 2015-05-07 | The Broad Institute Inc. | Functional genomics using crispr-cas systems, compositions, methods, screens and applications thereof |
| ES2670983T3 (es) | 2013-11-07 | 2018-06-04 | Editas Medicine, Inc. | Métodos y composiciones relacionados con CRISPR con ARNg rectores |
| AU2014350051A1 (en) | 2013-11-18 | 2016-07-07 | Crispr Therapeutics Ag | CRISPR-Cas system materials and methods |
| WO2015089364A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Crystal structure of a crispr-cas system, and uses thereof |
| CA2932436A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute, Inc. | Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders |
| CA2932439A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute, Inc. | Crispr-cas systems and methods for altering expression of gene products, structural information and inducible modular cas enzymes |
| EP3470089A1 (en) | 2013-12-12 | 2019-04-17 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components |
| CN103668472B (zh) | 2013-12-31 | 2014-12-24 | 北京大学 | 利用CRISPR/Cas9系统构建真核基因敲除文库的方法 |
| WO2015113063A1 (en) | 2014-01-27 | 2015-07-30 | Georgia Tech Research Corporation | Methods and systems for identifying crispr/cas off-target sites |
| WO2015191693A2 (en) | 2014-06-10 | 2015-12-17 | Massachusetts Institute Of Technology | Method for gene editing |
| JP6323228B2 (ja) | 2014-07-18 | 2018-05-16 | 富士電機株式会社 | 電力変換装置 |
| WO2016022866A1 (en) | 2014-08-07 | 2016-02-11 | Agilent Technologies, Inc. | Cis-blocked guide rna |
| EP3686279B1 (en) | 2014-08-17 | 2023-01-04 | The Broad Institute, Inc. | Genome editing using cas9 nickases |
| WO2016049024A2 (en) * | 2014-09-24 | 2016-03-31 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling competition of multiple cancer mutations in vivo |
| DE102014221482A1 (de) | 2014-10-22 | 2016-04-28 | Ford Global Technologies, Llc | Verfahren zur Ansteuerung einer Spannungsquelle zum Laden einer Batterie eines Kraftfahrzeugs |
| WO2016073955A2 (en) | 2014-11-06 | 2016-05-12 | President And Fellows Of Harvard College | Cells lacking b2m surface expression and methods for allogeneic administration of such cells |
| KR20230156800A (ko) | 2015-03-03 | 2023-11-14 | 더 제너럴 하스피탈 코포레이션 | 변경된 PAM 특이성을 갖는 조작된 CRISPR-Cas9 뉴클레아제 |
| EP3291679B1 (en) | 2015-05-06 | 2021-12-15 | SNIPR Technologies Limited | Altering microbial populations & modifying microbiota |
| WO2016205759A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Engineering and optimization of systems, methods, enzymes and guide scaffolds of cas9 orthologs and variants for sequence manipulation |
| CA2989830A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute, Inc. | Crispr enzyme mutations reducing off-target effects |
| US9926546B2 (en) | 2015-08-28 | 2018-03-27 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US9512446B1 (en) | 2015-08-28 | 2016-12-06 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| JP6186470B2 (ja) | 2016-04-20 | 2017-08-23 | パイオニア株式会社 | 音響装置、音量制御方法、音量制御プログラム及び記録媒体 |
| EP3585898A1 (en) | 2017-02-22 | 2020-01-01 | CRISPR Therapeutics AG | Materials and methods for treatment of spinocerebellar ataxia type 1 (sca1) and other spinocerebellar ataxia type 1 protein (atxn1) gene related conditions or disorders |
| KR102085165B1 (ko) | 2017-11-10 | 2020-03-05 | 주식회사 엘지화학 | 유기 금속 화합물 및 이를 포함하는 유기 발광 소자 |
| WO2020150320A1 (en) | 2019-01-17 | 2020-07-23 | Georgia Tech Research Corporation | Drug delivery systems containing oxidized cholesterols |
| CN114502542A (zh) | 2019-07-29 | 2022-05-13 | 佐治亚技术研究公司 | 包含限制性脂质的纳米材料及其用途 |
-
2013
- 2013-12-12 WO PCT/US2013/074667 patent/WO2014093622A2/en not_active Ceased
- 2013-12-12 EP EP25158109.6A patent/EP4549566A3/en active Pending
- 2013-12-12 KR KR1020157018653A patent/KR20150105956A/ko active Pending
- 2013-12-12 IL IL293526A patent/IL293526A/en unknown
- 2013-12-12 MX MX2015007550A patent/MX389793B/es unknown
- 2013-12-12 RU RU2015128057A patent/RU2721275C2/ru active
- 2013-12-12 SG SG10201912328UA patent/SG10201912328UA/en unknown
- 2013-12-12 ES ES17199166T patent/ES2883590T3/es active Active
- 2013-12-12 CN CN201380072752.2A patent/CN105164264B/zh active Active
- 2013-12-12 SG SG10201707569YA patent/SG10201707569YA/en unknown
- 2013-12-12 EP EP17199166.4A patent/EP3327127B1/en active Active
- 2013-12-12 JP JP2015547543A patent/JP2016501531A/ja active Pending
- 2013-12-12 EP EP15179123.3A patent/EP3031921B1/en active Active
- 2013-12-12 AU AU2013359199A patent/AU2013359199C1/en active Active
- 2013-12-12 CN CN201910837608.2A patent/CN110872583A/zh active Pending
- 2013-12-12 US US14/104,837 patent/US20140179770A1/en not_active Abandoned
- 2013-12-12 ES ES13814362.3T patent/ES2658401T3/es active Active
- 2013-12-12 BR BR112015013784A patent/BR112015013784A2/pt not_active Application Discontinuation
- 2013-12-12 IL IL239317A patent/IL239317B/en unknown
- 2013-12-12 SG SG11201504523UA patent/SG11201504523UA/en unknown
- 2013-12-12 EP EP23192255.0A patent/EP4299741A3/en active Pending
- 2013-12-12 DK DK17199166.4T patent/DK3327127T3/da active
- 2013-12-12 EP EP13814362.3A patent/EP2931897B1/en active Active
- 2013-12-12 DK DK13814362.3T patent/DK2931897T3/en active
-
2014
- 2014-02-18 US US14/183,512 patent/US20140242699A1/en not_active Abandoned
- 2014-09-09 US US14/481,339 patent/US20150020223A1/en not_active Abandoned
-
2015
- 2015-06-08 ZA ZA2015/04132A patent/ZA201504132B/en unknown
- 2015-06-12 MX MX2022001378A patent/MX2022001378A/es unknown
-
2016
- 2016-11-11 US US15/349,603 patent/US11041173B2/en active Active
-
2017
- 2017-02-10 US US15/430,260 patent/US20170152528A1/en active Pending
-
2019
- 2019-03-05 JP JP2019039953A patent/JP7013406B2/ja active Active
- 2019-12-18 AU AU2019283878A patent/AU2019283878B2/en active Active
-
2021
- 2021-04-30 US US17/245,952 patent/US12252707B2/en active Active
-
2022
- 2022-01-19 JP JP2022006048A patent/JP7228059B2/ja active Active
- 2022-06-01 AU AU2022203759A patent/AU2022203759B2/en active Active
-
2023
- 2023-02-10 JP JP2023018822A patent/JP7736729B2/ja active Active
- 2023-06-30 US US18/217,357 patent/US20230399662A1/en active Pending
- 2023-06-30 US US18/217,352 patent/US20240035048A1/en active Pending
-
2025
- 2025-01-16 US US19/025,611 patent/US20250250589A1/en active Pending
- 2025-03-14 US US19/079,830 patent/US20250382642A1/en active Pending
- 2025-05-22 AU AU2025203782A patent/AU2025203782A1/en active Pending
- 2025-08-28 JP JP2025142590A patent/JP2025181841A/ja active Pending
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8895308B1 (en) * | 2012-12-12 | 2014-11-25 | The Broad Institute Inc. | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US20160013060A1 (en) * | 2014-01-27 | 2016-01-14 | Boe Technology Group Co., Ltd. | Thin film transistor and manufacturing method thereof, array substrate and manufacturing method thereof, and display device |
Non-Patent Citations (4)
| Title |
|---|
| Ran et al, Genome engineering using the CRISPR-Cas9 system, November 2013, Nat Protoc, v.8, 11: 2281-2308 * |
| US Application 15/160 ,710 * |
| US Application 15/349 ,603 * |
| US Application 15/838 ,064 * |
Cited By (789)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9596835B2 (en) | 2008-05-28 | 2017-03-21 | University Of Massachusetts | Isolation of novel AAV's and uses thereof |
| US10905776B2 (en) | 2008-05-28 | 2021-02-02 | University Of Massachusetts | Isolation of novel AAV's and uses thereof |
| US10166297B2 (en) | 2008-05-28 | 2019-01-01 | University Of Massachusetts | Isolation of novel AAV's and uses thereof |
| US10300146B2 (en) | 2008-05-28 | 2019-05-28 | University Of Massachusetts | Isolation of novel AAV's and uses thereof |
| US11834474B2 (en) | 2009-05-28 | 2023-12-05 | University Of Massachusetts | AAV's and uses thereof |
| US10689420B2 (en) | 2009-05-28 | 2020-06-23 | University Of Massachusetts | AAV's and uses thereof |
| US10035825B2 (en) | 2009-05-28 | 2018-07-31 | University Of Massachusetts | AAV's and uses thereof |
| US11421230B2 (en) | 2010-04-23 | 2022-08-23 | University Of Massachusetts | AAV-based treatment of cholesterol-related disorders |
| US10731158B2 (en) | 2010-04-23 | 2020-08-04 | University Of Massachusetts | AAV-based treatment of cholesterol-related disorders |
| US10202600B2 (en) | 2010-04-23 | 2019-02-12 | University Of Massachusetts | AAV-based treatment of cholesterol-related disorders |
| US12338444B2 (en) | 2011-03-23 | 2025-06-24 | Pioneer Hi-Bred International, Inc. | Methods for producing a complex transgenic trait locus |
| US11254939B2 (en) | 2011-04-21 | 2022-02-22 | University Of Massachusetts | RAAV-based compositions and methods |
| US9885057B2 (en) | 2011-04-21 | 2018-02-06 | University Of Massachusetts | RAAV-based compositions and methods for treating alpha-1 anti-trypsin deficiencies |
| US11920133B2 (en) | 2011-04-21 | 2024-03-05 | University Of Massachusetts | RAAV-based compositions and methods |
| US10597656B2 (en) | 2011-04-21 | 2020-03-24 | University Of Massachusetts | RAAV-based compositions and methods |
| US10077452B2 (en) | 2011-04-21 | 2018-09-18 | University Of Massachusetts | rAAV-based compositions and methods |
| US12006520B2 (en) | 2011-07-22 | 2024-06-11 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US11266698B2 (en) | 2011-10-07 | 2022-03-08 | 4D Pharma Research Limited | Bacterium for use as a probiotic for nutritional and medical applications |
| US12467086B2 (en) | 2011-10-14 | 2025-11-11 | President And Fellows Of Harvard College | Sequencing by structure assembly |
| US11566277B2 (en) | 2011-12-22 | 2023-01-31 | President And Fellows Of Harvard College | Compositions and methods for analyte detection |
| US11111521B2 (en) | 2011-12-22 | 2021-09-07 | President And Fellows Of Harvard College | Compositions and methods for analyte detection |
| US11639518B2 (en) | 2011-12-22 | 2023-05-02 | President And Fellows Of Harvard College | Compositions and methods for analyte detection |
| US11293052B2 (en) | 2011-12-22 | 2022-04-05 | President And Fellows Of Harvard College | Compositions and methods for analyte detection |
| US11566276B2 (en) | 2011-12-22 | 2023-01-31 | President And Fellows Of Harvard College | Compositions and methods for analyte detection |
| US11549136B2 (en) | 2011-12-22 | 2023-01-10 | President And Fellows Of Harvard College | Compositions and methods for analyte detection |
| US11293051B2 (en) | 2011-12-22 | 2022-04-05 | President And Fellows Of Harvard College | Compositions and methods for analyte detection |
| US11976318B2 (en) | 2011-12-22 | 2024-05-07 | President And Fellows Of Harvard College | Compositions and methods for analyte detection |
| US10711257B2 (en) | 2011-12-30 | 2020-07-14 | Caribou Biosciences, Inc. | Modified cascade ribonucleoproteins and uses thereof |
| US11939604B2 (en) | 2011-12-30 | 2024-03-26 | Caribou Biosciences, Inc. | Modified cascade ribonucleoproteins and uses thereof |
| US10954498B2 (en) | 2011-12-30 | 2021-03-23 | Caribou Biosciences, Inc. | Modified cascade ribonucleoproteins and uses thereof |
| US10435678B2 (en) | 2011-12-30 | 2019-10-08 | Caribou Biosciences, Inc. | Modified cascade ribonucleoproteins and uses thereof |
| US9885026B2 (en) | 2011-12-30 | 2018-02-06 | Caribou Biosciences, Inc. | Modified cascade ribonucleoproteins and uses thereof |
| US10039777B2 (en) | 2012-03-20 | 2018-08-07 | Neuro-Lm Sas | Methods and pharmaceutical compositions of the treatment of autistic syndrome disorders |
| US9834786B2 (en) | 2012-04-25 | 2017-12-05 | Regeneron Pharmaceuticals, Inc. | Nuclease-mediated targeting with large targeting vectors |
| US10301646B2 (en) | 2012-04-25 | 2019-05-28 | Regeneron Pharmaceuticals, Inc. | Nuclease-mediated targeting with large targeting vectors |
| US10577631B2 (en) | 2012-05-25 | 2020-03-03 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10385360B2 (en) | 2012-05-25 | 2019-08-20 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11634730B2 (en) | 2012-05-25 | 2023-04-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10308961B2 (en) | 2012-05-25 | 2019-06-04 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10982231B2 (en) | 2012-05-25 | 2021-04-20 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10982230B2 (en) | 2012-05-25 | 2021-04-20 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10227611B2 (en) | 2012-05-25 | 2019-03-12 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10988780B2 (en) | 2012-05-25 | 2021-04-27 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10988782B2 (en) | 2012-05-25 | 2021-04-27 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11549127B2 (en) | 2012-05-25 | 2023-01-10 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10266850B2 (en) | 2012-05-25 | 2019-04-23 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11001863B2 (en) | 2012-05-25 | 2021-05-11 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11008589B2 (en) | 2012-05-25 | 2021-05-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11008590B2 (en) | 2012-05-25 | 2021-05-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10113167B2 (en) | 2012-05-25 | 2018-10-30 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10900054B2 (en) | 2012-05-25 | 2021-01-26 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11028412B2 (en) | 2012-05-25 | 2021-06-08 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11674159B2 (en) | 2012-05-25 | 2023-06-13 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10301651B2 (en) | 2012-05-25 | 2019-05-28 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10513712B2 (en) | 2012-05-25 | 2019-12-24 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10526619B2 (en) | 2012-05-25 | 2020-01-07 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10612045B2 (en) | 2012-05-25 | 2020-04-07 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10793878B1 (en) | 2012-05-25 | 2020-10-06 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10337029B2 (en) | 2012-05-25 | 2019-07-02 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10774344B1 (en) | 2012-05-25 | 2020-09-15 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10351878B2 (en) | 2012-05-25 | 2019-07-16 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10358658B2 (en) | 2012-05-25 | 2019-07-23 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11814645B2 (en) | 2012-05-25 | 2023-11-14 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10358659B2 (en) | 2012-05-25 | 2019-07-23 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11479794B2 (en) | 2012-05-25 | 2022-10-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10752920B2 (en) | 2012-05-25 | 2020-08-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10533190B2 (en) | 2012-05-25 | 2020-01-14 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11473108B2 (en) | 2012-05-25 | 2022-10-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11332761B2 (en) | 2012-05-25 | 2022-05-17 | The Regenis of Wie University of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10519467B2 (en) | 2012-05-25 | 2019-12-31 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11186849B2 (en) | 2012-05-25 | 2021-11-30 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10676759B2 (en) | 2012-05-25 | 2020-06-09 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10400253B2 (en) | 2012-05-25 | 2019-09-03 | The Regents Of The University Of California | Methods and compositions or RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10669560B2 (en) | 2012-05-25 | 2020-06-02 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10407697B2 (en) | 2012-05-25 | 2019-09-10 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US12215343B2 (en) | 2012-05-25 | 2025-02-04 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10640791B2 (en) | 2012-05-25 | 2020-05-05 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10626419B2 (en) | 2012-05-25 | 2020-04-21 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10000772B2 (en) | 2012-05-25 | 2018-06-19 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US12180503B2 (en) | 2012-05-25 | 2024-12-31 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11242543B2 (en) | 2012-05-25 | 2022-02-08 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US12180504B2 (en) | 2012-05-25 | 2024-12-31 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10597680B2 (en) | 2012-05-25 | 2020-03-24 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10415061B2 (en) | 2012-05-25 | 2019-09-17 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11274318B2 (en) | 2012-05-25 | 2022-03-15 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10421980B2 (en) | 2012-05-25 | 2019-09-24 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10428352B2 (en) | 2012-05-25 | 2019-10-01 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10570419B2 (en) | 2012-05-25 | 2020-02-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10563227B2 (en) | 2012-05-25 | 2020-02-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11293034B2 (en) | 2012-05-25 | 2022-04-05 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US12123015B2 (en) | 2012-05-25 | 2024-10-22 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10550407B2 (en) | 2012-05-25 | 2020-02-04 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10443076B2 (en) | 2012-05-25 | 2019-10-15 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11401532B2 (en) | 2012-05-25 | 2022-08-02 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11970711B2 (en) | 2012-05-25 | 2024-04-30 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10487341B2 (en) | 2012-05-25 | 2019-11-26 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10851380B2 (en) | 2012-10-23 | 2020-12-01 | Toolgen Incorporated | Methods for cleaving a target DNA using a guide RNA specific for the target DNA and Cas protein-encoding nucleic acid or Cas protein |
| US12473559B2 (en) | 2012-10-23 | 2025-11-18 | Toolgen Incorporated | Cas9/RNA complexes for inducing modifications of target endogenous nucleic acid sequences in nucleuses of eukaryotic cells |
| US10731181B2 (en) | 2012-12-06 | 2020-08-04 | Sigma, Aldrich Co. LLC | CRISPR-based genome modification and regulation |
| US10745716B2 (en) | 2012-12-06 | 2020-08-18 | Sigma-Aldrich Co. Llc | CRISPR-based genome modification and regulation |
| US10717990B2 (en) * | 2012-12-17 | 2020-07-21 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US12018272B2 (en) | 2012-12-17 | 2024-06-25 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US10435708B2 (en) * | 2012-12-17 | 2019-10-08 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US20140342456A1 (en) * | 2012-12-17 | 2014-11-20 | President And Fellows Of Harvard College | RNA-Guided Human Genome Engineering |
| US9970024B2 (en) | 2012-12-17 | 2018-05-15 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US10273501B2 (en) | 2012-12-17 | 2019-04-30 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US20160160210A1 (en) * | 2012-12-17 | 2016-06-09 | President And Fellows Of Harvard College | RNA-Guided Human Genome Engineering |
| US11535863B2 (en) | 2012-12-17 | 2022-12-27 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US20160304907A1 (en) * | 2012-12-17 | 2016-10-20 | President And Fellows Of Harvard College | RNA-Guided Human Genome Engineering |
| US20150259704A1 (en) * | 2012-12-17 | 2015-09-17 | President And Fellows Of Harvard College | RNA-Guided Human Genome Engineering |
| US11512325B2 (en) | 2012-12-17 | 2022-11-29 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US20150232833A1 (en) * | 2012-12-17 | 2015-08-20 | President And Fellows Of Harvard College | RNA-Guided Human Genome Engineering |
| US11359211B2 (en) | 2012-12-17 | 2022-06-14 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US9260723B2 (en) | 2012-12-17 | 2016-02-16 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US20140342457A1 (en) * | 2012-12-17 | 2014-11-20 | President And Fellows Of Harvard College | RNA-Guided Human Genome Engineering |
| US11365429B2 (en) | 2012-12-17 | 2022-06-21 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US11236359B2 (en) * | 2012-12-17 | 2022-02-01 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US10544405B2 (en) * | 2013-01-16 | 2020-01-28 | Emory University | Cas9-nucleic acid complexes and uses related thereto |
| US11312945B2 (en) | 2013-01-16 | 2022-04-26 | Emory University | CAS9-nucleic acid complexes and uses related thereto |
| US12264358B2 (en) | 2013-03-12 | 2025-04-01 | President And Fellows Of Harvard College | Method of selectively sequencing amplicons in a biological sample |
| US11299767B2 (en) | 2013-03-12 | 2022-04-12 | President And Fellows Of Harvard College | Method for generating a three-dimensional nucleic acid containing matrix |
| US9803194B2 (en) | 2013-03-14 | 2017-10-31 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US9909122B2 (en) | 2013-03-14 | 2018-03-06 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US11312953B2 (en) * | 2013-03-14 | 2022-04-26 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US10125361B2 (en) | 2013-03-14 | 2018-11-13 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US9725714B2 (en) | 2013-03-14 | 2017-08-08 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US9410198B2 (en) | 2013-03-14 | 2016-08-09 | Caribou Biosciences, Inc. | Compostions and methods of nucleic acid-targeting nucleic acids |
| US9809814B1 (en) | 2013-03-14 | 2017-11-07 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US9260752B1 (en) | 2013-03-14 | 2016-02-16 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US20170051276A1 (en) * | 2013-03-14 | 2017-02-23 | Caribou Biosciences, Inc. | Compositions And Methods Of Nucleic Acid-Targeting Nucleic Acids |
| US10526589B2 (en) | 2013-03-15 | 2020-01-07 | The General Hospital Corporation | Multiplex guide RNAs |
| US9567604B2 (en) | 2013-03-15 | 2017-02-14 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
| US11634731B2 (en) | 2013-03-15 | 2023-04-25 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
| US12065668B2 (en) | 2013-03-15 | 2024-08-20 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
| US10138476B2 (en) | 2013-03-15 | 2018-11-27 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
| US10544433B2 (en) | 2013-03-15 | 2020-01-28 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
| US10378027B2 (en) | 2013-03-15 | 2019-08-13 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
| US11168338B2 (en) | 2013-03-15 | 2021-11-09 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
| US10760064B2 (en) | 2013-03-15 | 2020-09-01 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
| US10202619B2 (en) | 2013-03-15 | 2019-02-12 | System Biosciences, Llc | Compositions and methods directed to CRISPR/Cas genomic engineering systems |
| US9567603B2 (en) | 2013-03-15 | 2017-02-14 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
| US11920152B2 (en) | 2013-03-15 | 2024-03-05 | The General Hospital Corporation | Increasing specificity for RNA-guided genome editing |
| US10415059B2 (en) | 2013-03-15 | 2019-09-17 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
| US9738908B2 (en) | 2013-03-15 | 2017-08-22 | System Biosciences, Llc | CRISPR/Cas systems for genomic modification and gene modulation |
| US11098326B2 (en) | 2013-03-15 | 2021-08-24 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
| US10844403B2 (en) | 2013-03-15 | 2020-11-24 | The General Hospital Corporation | Increasing specificity for RNA-guided genome editing |
| US10119133B2 (en) | 2013-03-15 | 2018-11-06 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
| US9234213B2 (en) | 2013-03-15 | 2016-01-12 | System Biosciences, Llc | Compositions and methods directed to CRISPR/Cas genomic engineering systems |
| US9885033B2 (en) | 2013-03-15 | 2018-02-06 | The General Hospital Corporation | Increasing specificity for RNA-guided genome editing |
| US9822370B2 (en) | 2013-04-04 | 2017-11-21 | President And Fellows Of Harvard College | Method of making a deletion in a target sequence in isolated primary cells using Cas9 and two guide RNAs |
| US20160040165A1 (en) * | 2013-04-04 | 2016-02-11 | United States Government As Represented By The Department Of Veterans Affairs | Compositions and methods for in vivo excision of hiv-1 proviral dna |
| US11274305B2 (en) * | 2013-04-04 | 2022-03-15 | Trustees Of Dartmouth College | Compositions and methods for in vivo excision of HIV-1 proviral DNA |
| US10851137B2 (en) | 2013-04-10 | 2020-12-01 | 4D Pharma Research Limited | Polypeptide and immune modulation |
| US11414463B2 (en) | 2013-04-10 | 2022-08-16 | 4D Pharma Research Limited | Polypeptide and immune modulation |
| US10975390B2 (en) | 2013-04-16 | 2021-04-13 | Regeneron Pharmaceuticals, Inc. | Targeted modification of rat genome |
| US12037596B2 (en) | 2013-04-16 | 2024-07-16 | Regeneron Pharmaceuticals, Inc. | Targeted modification of rat genome |
| US10385359B2 (en) | 2013-04-16 | 2019-08-20 | Regeneron Pharmaceuticals, Inc. | Targeted modification of rat genome |
| US20180327761A1 (en) * | 2013-05-29 | 2018-11-15 | Cellectis | Method for producing precise dna cleavage using cas9 nickase activity |
| AU2014273082B2 (en) * | 2013-05-29 | 2018-11-08 | Cellectis | A method for producing precise DNA cleavage using Cas9 nickase activity |
| US20160122774A1 (en) * | 2013-05-29 | 2016-05-05 | Cellectis | A method for producing precise dna cleavage using cas9 nickase activity |
| US20160237456A1 (en) * | 2013-06-04 | 2016-08-18 | President And Fellows Of Harvard College | RNA-Guided Transcriptional Regulation |
| US20140356956A1 (en) * | 2013-06-04 | 2014-12-04 | President And Fellows Of Harvard College | RNA-Guided Transcriptional Regulation |
| US10767194B2 (en) * | 2013-06-04 | 2020-09-08 | President And Fellows Of Harvard College | RNA-guided transcriptional regulation |
| US11981917B2 (en) | 2013-06-04 | 2024-05-14 | President And Fellows Of Harvard College | RNA-guided transcriptional regulation |
| US10640789B2 (en) * | 2013-06-04 | 2020-05-05 | President And Fellows Of Harvard College | RNA-guided transcriptional regulation |
| US10011850B2 (en) | 2013-06-21 | 2018-07-03 | The General Hospital Corporation | Using RNA-guided FokI Nucleases (RFNs) to increase specificity for RNA-Guided Genome Editing |
| US10208319B2 (en) | 2013-07-09 | 2019-02-19 | President And Fellows Of Harvard College | Therapeutic uses of genome editing with CRISPR/Cas systems |
| US10329587B2 (en) * | 2013-07-10 | 2019-06-25 | President And Fellows Of Harvard College | Orthogonal Cas9 proteins for RNA-guided gene regulation and editing |
| US20160222416A1 (en) * | 2013-07-10 | 2016-08-04 | President And Fellows Of Harvard College | Orthogonal Cas9 Proteins for RNA-Guided Gene Regulation and Editing |
| US9587252B2 (en) * | 2013-07-10 | 2017-03-07 | President And Fellows Of Harvard College | Orthogonal Cas9 proteins for RNA-guided gene regulation and editing |
| US11649469B2 (en) | 2013-07-10 | 2023-05-16 | President And Fellows Of Harvard College | Orthogonal Cas9 proteins for RNA-guided gene regulation and editing |
| US20150259684A1 (en) * | 2013-07-10 | 2015-09-17 | President And Fellows Of Harvard College | Orthogonal Cas9 Proteins for RNA-Guided Gene Regulation and Editing |
| US20150024500A1 (en) * | 2013-07-19 | 2015-01-22 | Larix Bioscience, Llc | Methods and compositions for producing double allele knock outs |
| US9663782B2 (en) * | 2013-07-19 | 2017-05-30 | Larix Bioscience Llc | Methods and compositions for producing double allele knock outs |
| US11920181B2 (en) | 2013-08-09 | 2024-03-05 | President And Fellows Of Harvard College | Nuclease profiling system |
| US10954548B2 (en) | 2013-08-09 | 2021-03-23 | President And Fellows Of Harvard College | Nuclease profiling system |
| US11046948B2 (en) | 2013-08-22 | 2021-06-29 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
| US11773400B2 (en) | 2013-08-22 | 2023-10-03 | E.I. Du Pont De Nemours And Company | Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof |
| US10519457B2 (en) | 2013-08-22 | 2019-12-31 | E I Du Pont De Nemours And Company | Soybean U6 polymerase III promoter and methods of use |
| US12428645B2 (en) | 2013-08-22 | 2025-09-30 | Pioneer Hi-Bred International, Inc. | Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof |
| US12378566B2 (en) | 2013-08-22 | 2025-08-05 | Pioneer Hi-Bred International, Inc. | Plant genome modification using guide RNA/Cas endonuclease systems and methods of use |
| US20220177900A1 (en) * | 2013-08-22 | 2022-06-09 | Pioneer Hi-Bred International, Inc. | Genome modification using guide polynucleotide/cas endonuclease systems and methods of use |
| US10912833B2 (en) | 2013-09-06 | 2021-02-09 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
| US12473573B2 (en) | 2013-09-06 | 2025-11-18 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US11299755B2 (en) | 2013-09-06 | 2022-04-12 | President And Fellows Of Harvard College | Switchable CAS9 nucleases and uses thereof |
| WO2015065964A1 (en) | 2013-10-28 | 2015-05-07 | The Broad Institute Inc. | Functional genomics using crispr-cas systems, compositions, methods, screens and applications thereof |
| US11149267B2 (en) | 2013-10-28 | 2021-10-19 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof |
| US11390887B2 (en) | 2013-11-07 | 2022-07-19 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| US9834791B2 (en) | 2013-11-07 | 2017-12-05 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| US10640788B2 (en) | 2013-11-07 | 2020-05-05 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAs |
| US10190137B2 (en) | 2013-11-07 | 2019-01-29 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| US11820997B2 (en) | 2013-12-11 | 2023-11-21 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a genome |
| US10711280B2 (en) | 2013-12-11 | 2020-07-14 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a mouse ES cell genome |
| US9546384B2 (en) | 2013-12-11 | 2017-01-17 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a mouse genome |
| US10208317B2 (en) | 2013-12-11 | 2019-02-19 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a mouse embryonic stem cell genome |
| US9228208B2 (en) | 2013-12-11 | 2016-01-05 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a genome |
| EP3470089A1 (en) | 2013-12-12 | 2019-04-17 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components |
| WO2015089364A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Crystal structure of a crispr-cas system, and uses thereof |
| EP3653703A1 (en) | 2013-12-12 | 2020-05-20 | The Broad Institute, Inc. | Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders |
| EP3653704A1 (en) | 2013-12-12 | 2020-05-20 | The Broad Institute, Inc. | Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders |
| WO2015089354A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders |
| EP4219699A1 (en) | 2013-12-12 | 2023-08-02 | The Broad Institute, Inc. | Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation |
| WO2015089351A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders |
| WO2015089419A2 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components |
| WO2015089465A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders |
| US11053481B2 (en) | 2013-12-12 | 2021-07-06 | President And Fellows Of Harvard College | Fusions of Cas9 domains and nucleic acid-editing domains |
| US11124782B2 (en) | 2013-12-12 | 2021-09-21 | President And Fellows Of Harvard College | Cas variants for gene editing |
| WO2015089486A2 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Systems, methods and compositions for sequence manipulation with optimized functional crispr-cas systems |
| EP3653229A1 (en) | 2013-12-12 | 2020-05-20 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for genome editing |
| US12215365B2 (en) | 2013-12-12 | 2025-02-04 | President And Fellows Of Harvard College | Cas variants for gene editing |
| EP4183876A1 (en) | 2013-12-12 | 2023-05-24 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders |
| EP3540051A1 (en) | 2013-12-12 | 2019-09-18 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders |
| US10124042B2 (en) * | 2014-01-31 | 2018-11-13 | Factor Bioscience Inc. | Methods and products for nucleic acid production and delivery |
| US11795479B2 (en) | 2014-02-11 | 2023-10-24 | The Regents Of The University Of Colorado | CRISPR enabled multiplexed genome engineering |
| US11078498B2 (en) * | 2014-02-11 | 2021-08-03 | The Regents Of The University Of Colorado, A Body Corporate | CRISPR enabled multiplexed genome engineering |
| US11345933B2 (en) | 2014-02-11 | 2022-05-31 | The Regents Of The University Of Colorado | CRISPR enabled multiplexed genome engineering |
| US11639511B2 (en) | 2014-02-11 | 2023-05-02 | The Regents Of The University Of Colorado, A Body Corporate | CRISPR enabled multiplexed genome engineering |
| US11702677B2 (en) | 2014-02-11 | 2023-07-18 | The Regents Of The University Of Colorado | CRISPR enabled multiplexed genome engineering |
| US10286084B2 (en) | 2014-02-18 | 2019-05-14 | Duke University | Compositions for the inactivation of virus replication and methods of making and using the same |
| US10894949B2 (en) | 2014-02-19 | 2021-01-19 | University Of Massachusetts | Recombinant AAVS having useful transcytosis properties |
| US10072251B2 (en) | 2014-02-19 | 2018-09-11 | University Of Massachusetts | Recombinant AAVS having useful transcytosis properties |
| US11209440B2 (en) | 2014-02-27 | 2021-12-28 | The Broad Institute, Inc. | T cell balance gene expression, compositions of matters and methods of use thereof |
| EP3514246A1 (en) | 2014-02-27 | 2019-07-24 | The Broad Institute Inc. | T cell balance gene expression and methods of use thereof |
| US11028388B2 (en) | 2014-03-05 | 2021-06-08 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for treating Usher syndrome and retinitis pigmentosa |
| US9938521B2 (en) | 2014-03-10 | 2018-04-10 | Editas Medicine, Inc. | CRISPR/CAS-related methods and compositions for treating leber's congenital amaurosis 10 (LCA10) |
| US11141493B2 (en) | 2014-03-10 | 2021-10-12 | Editas Medicine, Inc. | Compositions and methods for treating CEP290-associated disease |
| US11268086B2 (en) | 2014-03-10 | 2022-03-08 | Editas Medicine, Inc. | CRISPR/CAS-related methods and compositions for treating Leber's Congenital Amaurosis 10 (LCA10) |
| US12234449B2 (en) | 2014-03-10 | 2025-02-25 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for treating Leber's congenital amaurosis 10 (LCA10) |
| US10253312B2 (en) | 2014-03-10 | 2019-04-09 | Editas Medicine, Inc. | CRISPR/CAS-related methods and compositions for treating Leber's Congenital Amaurosis 10 (LCA10) |
| US11339437B2 (en) | 2014-03-10 | 2022-05-24 | Editas Medicine, Inc. | Compositions and methods for treating CEP290-associated disease |
| US10711274B2 (en) | 2014-03-18 | 2020-07-14 | University Of Massachusetts | RAAV-based compositions and methods for treating amyotrophic lateral sclerosis |
| US11760999B2 (en) | 2014-03-18 | 2023-09-19 | University Of Massachusetts | RAAV-based compositions and methods for treating amyotrophic lateral sclerosis |
| US10280418B2 (en) | 2014-03-18 | 2019-05-07 | Univeristy Of Massachusetts | RAAV-based compositions and methods for treating amyotrophic lateral sclerosis |
| US10851375B2 (en) | 2014-03-18 | 2020-12-01 | University Of Massachusetts | RAAV-based compositions and methods for treating amyotrophic lateral sclerosis |
| US10954518B2 (en) | 2014-03-18 | 2021-03-23 | University Of Massachusetts | RAAV-based compositions and methods for treating amyotrophic lateral sclerosis |
| US11242525B2 (en) | 2014-03-26 | 2022-02-08 | Editas Medicine, Inc. | CRISPR/CAS-related methods and compositions for treating sickle cell disease |
| US12460231B2 (en) * | 2014-04-02 | 2025-11-04 | Editas Medicine, Inc. | Crispr/CAS-related methods and compositions for treating primary open angle glaucoma |
| US12467063B2 (en) | 2014-04-25 | 2025-11-11 | University Of Massachusetts | Recombinant AAV vectors useful for reducing immunity against transgene products |
| US10975391B2 (en) | 2014-04-25 | 2021-04-13 | University Of Massachusetts | Recombinant AAV vectors useful for reducing immunity against transgene products |
| US20190032090A1 (en) * | 2014-05-30 | 2019-01-31 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and Methods to Treat Latent Viral Infections |
| US10689653B2 (en) | 2014-06-03 | 2020-06-23 | University Of Massachusetts | Compositions and methods for modulating dysferlin expression |
| US11827886B2 (en) | 2014-06-03 | 2023-11-28 | University Of Massachusetts | Compositions and methods for modulating dysferlin expression |
| US10501794B2 (en) | 2014-06-23 | 2019-12-10 | The General Hospital Corporation | Genomewide unbiased identification of DSBs evaluated by sequencing (GUIDE-seq) |
| US12104207B2 (en) | 2014-06-23 | 2024-10-01 | The General Hospital Corporation | Genomewide unbiased identification of DSBs evaluated by sequencing (GUIDE-Seq) |
| US11549089B2 (en) | 2014-07-03 | 2023-01-10 | NanoCav, LLC | Mechanical transfection devices and methods |
| US11046976B2 (en) * | 2014-07-03 | 2021-06-29 | NanoCav, LLC | Mechanical transfection devices and methods |
| US12331347B2 (en) | 2014-07-11 | 2025-06-17 | President And Fellows Of Harvard College | Methods for high-throughput labelling and detection of biological features in situ using microscopy |
| US10676754B2 (en) | 2014-07-11 | 2020-06-09 | E I Du Pont De Nemours And Company | Compositions and methods for producing plants resistant to glyphosate herbicide |
| US11578343B2 (en) | 2014-07-30 | 2023-02-14 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US12398406B2 (en) | 2014-07-30 | 2025-08-26 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US9850521B2 (en) * | 2014-08-01 | 2017-12-26 | Agilent Technologies, Inc. | In vitro assay buffer for Cas9 |
| CN106714845A (zh) * | 2014-08-11 | 2017-05-24 | 得克萨斯州大学系统董事会 | 通过crispr/cas9介导的基因编辑预防肌营养不良 |
| WO2016025469A1 (en) * | 2014-08-11 | 2016-02-18 | The Board Of Regents Of The University Of Texas System | Prevention of muscular dystrophy by crispr/cas9-mediated gene editing |
| US10314297B2 (en) * | 2014-08-14 | 2019-06-11 | Biocytogen Boston Corp | DNA knock-in system |
| US11071289B2 (en) | 2014-08-14 | 2021-07-27 | Biocytogen Boston Corp | DNA knock-in system |
| EP3686279A1 (en) | 2014-08-17 | 2020-07-29 | The Broad Institute, Inc. | Genome editing using cas9 nickases |
| US9970030B2 (en) | 2014-08-27 | 2018-05-15 | Caribou Biosciences, Inc. | Methods for increasing CAS9-mediated engineering efficiency |
| WO2016036754A1 (en) | 2014-09-02 | 2016-03-10 | The Regents Of The University Of California | Methods and compositions for rna-directed target dna modification |
| US12173294B2 (en) | 2014-09-12 | 2024-12-24 | Corteva Agriscience Llc | Generation of site specific integration sites for complex trait loci in corn and soybean, and methods of use |
| US11560568B2 (en) | 2014-09-12 | 2023-01-24 | E. I. Du Pont De Nemours And Company | Generation of site-specific-integration sites for complex trait loci in corn and soybean, and methods of use |
| US11124796B2 (en) | 2014-09-24 | 2021-09-21 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for modeling competition of multiple cancer mutations in vivo |
| US11459557B2 (en) | 2014-09-24 | 2022-10-04 | The Broad Institute, Inc. | Use and production of CHD8+/− transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder |
| US11197467B2 (en) | 2014-09-24 | 2021-12-14 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-cas systems and compositions for modeling mutations in leukocytes |
| WO2016049251A1 (en) | 2014-09-24 | 2016-03-31 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling mutations in leukocytes |
| WO2016049163A2 (en) | 2014-09-24 | 2016-03-31 | The Broad Institute Inc. | Use and production of chd8+/- transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder |
| US11001829B2 (en) | 2014-09-25 | 2021-05-11 | The Broad Institute, Inc. | Functional screening with optimized functional CRISPR-Cas systems |
| CN104293831A (zh) * | 2014-09-28 | 2015-01-21 | 上海云舜生物技术有限公司 | 建立高血压小鼠模型的方法及其用途 |
| US12291719B2 (en) | 2014-10-03 | 2025-05-06 | University Of Massachusetts | Heterologous targeting peptide grafted AAVs |
| US10711270B2 (en) | 2014-10-03 | 2020-07-14 | University Of Massachusetts | High efficiency library-identified AAV vectors |
| US11014976B2 (en) | 2014-10-03 | 2021-05-25 | University Of Massachusetts | Heterologous targeting peptide grafted AAVS |
| US10370432B2 (en) | 2014-10-03 | 2019-08-06 | University Of Massachusetts | Heterologous targeting peptide grafted AAVS |
| US12091659B2 (en) | 2014-10-03 | 2024-09-17 | University Of Massachusetts | High efficiency library-identified AAV vectors |
| WO2016057850A1 (en) * | 2014-10-09 | 2016-04-14 | Seattle Children' S Hospital (Dba Seattle Children' S Research Institute) | Long poly (a) plasmids and methods for introduction of long poly (a) sequences into the plasmid |
| EP4553081A1 (en) * | 2014-10-09 | 2025-05-14 | Seattle Children's Hospital, dba Seattle Children's Research Institute | Long poly(a) plasmids and methods for introduction of long poly(a) sequences into the plasmid |
| US9943612B2 (en) | 2014-10-09 | 2018-04-17 | Seattle Children's Hospital | Long poly(A) plasmids and methods for introduction of long poly(A) sequences into the plasmid |
| WO2016057755A1 (en) * | 2014-10-09 | 2016-04-14 | Anthrogenesis Corporation | Placenta-derived adherent cell exosomes and uses thereof |
| US11400169B2 (en) | 2014-10-09 | 2022-08-02 | Seattle Children's Hospital | Long poly(A) plasmids and methods for introduction of long poly(A) sequences into the plasmid |
| US11173182B1 (en) | 2014-10-09 | 2021-11-16 | Celularity Inc. | Placenta-derived adherent cell exosomes and uses thereof |
| US12201699B2 (en) | 2014-10-10 | 2025-01-21 | Editas Medicine, Inc. | Compositions and methods for promoting homology directed repair |
| CN107208086A (zh) * | 2014-10-17 | 2017-09-26 | 霍华德休斯医学研究所 | 基因组探针 |
| WO2016061523A1 (en) * | 2014-10-17 | 2016-04-21 | Howard Hughes Medical Institute | Genomic probes |
| US11174507B2 (en) | 2014-10-17 | 2021-11-16 | Howard Hughes Medical Institute | Genomic probes |
| US11174506B2 (en) * | 2014-10-17 | 2021-11-16 | Howard Hughes Medical Institute | Genomic probes |
| US10480011B2 (en) | 2014-10-21 | 2019-11-19 | University Of Massachusetts | Recombinant AAV variants and uses thereof |
| US11542525B2 (en) | 2014-10-21 | 2023-01-03 | University Of Massachusetts | Recombinant AAV variants and uses thereof |
| WO2016069591A2 (en) | 2014-10-27 | 2016-05-06 | The Broad Institute Inc. | Compositions, methods and use of synthetic lethal screening |
| US12180263B2 (en) | 2014-11-06 | 2024-12-31 | President And Fellows Of Harvard College | Cells lacking B2M surface expression and methods for allogeneic administration of such cells |
| US11680268B2 (en) | 2014-11-07 | 2023-06-20 | Editas Medicine, Inc. | Methods for improving CRISPR/Cas-mediated genome-editing |
| US10457960B2 (en) | 2014-11-21 | 2019-10-29 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modification using paired guide RNAs |
| US11697828B2 (en) | 2014-11-21 | 2023-07-11 | Regeneran Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modification using paired guide RNAs |
| EP3626832A2 (en) | 2014-11-25 | 2020-03-25 | The Brigham and Women's Hospital, Inc. | Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease |
| WO2016086197A1 (en) | 2014-11-25 | 2016-06-02 | The Brigham And Women's Hospital, Inc. | Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease |
| WO2016086227A2 (en) | 2014-11-26 | 2016-06-02 | The Regents Of The University Of California | Therapeutic compositions comprising transcription factors and methods of making and using the same |
| US20170349914A1 (en) * | 2014-12-12 | 2017-12-07 | The Broad Institute Inc. | DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF CRISPR SYSTEMS AND COMPOSITIONS FOR GENOME EDITING AS TO HEMATOPOIETIC STEM CELLS (HSCs) |
| WO2016094867A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Protected guide rnas (pgrnas) |
| WO2016094872A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Dead guides for crispr transcription factors |
| EP3889260A1 (en) | 2014-12-12 | 2021-10-06 | The Broad Institute, Inc. | Protected guide rnas (pgrnas) |
| EP3985115A1 (en) | 2014-12-12 | 2022-04-20 | The Broad Institute, Inc. | Protected guide rnas (pgrnas) |
| WO2016094880A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Delivery, use and therapeutic applications of crispr systems and compositions for genome editing as to hematopoietic stem cells (hscs) |
| WO2016094874A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Escorted and functionalized guides for crispr-cas systems |
| WO2016100974A1 (en) | 2014-12-19 | 2016-06-23 | The Broad Institute Inc. | Unbiased identification of double-strand breaks and genomic rearrangement by genome-wide insert capture sequencing |
| US12215326B2 (en) * | 2014-12-23 | 2025-02-04 | The Broad Institute, Inc. | RNA-targeting system |
| US10973872B2 (en) | 2014-12-23 | 2021-04-13 | 4D Pharma Research Limited | Pirin polypeptide and immune modulation |
| WO2016106236A1 (en) | 2014-12-23 | 2016-06-30 | The Broad Institute Inc. | Rna-targeting system |
| US11723933B2 (en) | 2014-12-23 | 2023-08-15 | Cj Bioscience, Inc. | Composition of bacteroides thetaiotaomicron for immune modulation |
| WO2016106244A1 (en) | 2014-12-24 | 2016-06-30 | The Broad Institute Inc. | Crispr having or associated with destabilization domains |
| EP3702456A1 (en) | 2014-12-24 | 2020-09-02 | The Broad Institute, Inc. | Crispr having or associated with destabilization domains |
| WO2016108926A1 (en) | 2014-12-30 | 2016-07-07 | The Broad Institute Inc. | Crispr mediated in vivo modeling and genetic screening of tumor growth and metastasis |
| US12116619B2 (en) | 2014-12-30 | 2024-10-15 | The Broad Institute, Inc. | CRISPR mediated in vivo modeling and genetic screening of tumor growth and metastasis |
| US12043836B2 (en) | 2014-12-31 | 2024-07-23 | Viridos, Inc. | RNA-guided endonuclease expressing algal strain for high efficiency in vivo genome editing |
| WO2016109840A3 (en) * | 2014-12-31 | 2016-10-13 | Synthetic Genomics, Inc. | Compositions and methods for high efficiency in vivo genome editing |
| US11339399B2 (en) | 2014-12-31 | 2022-05-24 | Viridos, Inc. | Compositions and methods for high efficiency in vivo genome editing |
| WO2016109840A2 (en) | 2014-12-31 | 2016-07-07 | Synthetic Genomics, Inc. | Compositions and methods for high efficiency in vivo genome editing |
| WO2016114972A1 (en) | 2015-01-12 | 2016-07-21 | The Regents Of The University Of California | Heterodimeric cas9 and methods of use thereof |
| US20160215275A1 (en) * | 2015-01-27 | 2016-07-28 | Minghong Zhong | Chemically Ligated RNAs for CRISPR/Cas9-lgRNA Complexes as Antiviral Therapeutic Agents |
| US11667914B2 (en) | 2015-01-27 | 2023-06-06 | Minghong Zhong | Chemically ligated RNAs for CRISPR/Cas9-1gRNA complexes as antiviral therapeutic agents |
| US10059940B2 (en) * | 2015-01-27 | 2018-08-28 | Minghong Zhong | Chemically ligated RNAs for CRISPR/Cas9-lgRNA complexes as antiviral therapeutic agents |
| US11459588B2 (en) | 2015-01-28 | 2022-10-04 | Caribou Biosciences, Inc. | Methods of use of CRISPR CPF1 hybrid DNA/RNA polynucleotides |
| US10988781B2 (en) | 2015-01-28 | 2021-04-27 | Caribou Biosciences, Inc. | Method of target cleaving using CRISPR hybrid DNA/RNA polynucleotides |
| US9688972B2 (en) | 2015-01-28 | 2017-06-27 | Pioneer Hi-Bred International, Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| US11236364B2 (en) | 2015-01-28 | 2022-02-01 | Caribou Biosciences, Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| US9650617B2 (en) | 2015-01-28 | 2017-05-16 | Pioneer Hi-Bred International. Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| US10519468B2 (en) | 2015-01-28 | 2019-12-31 | Pioneer Hi-Bred International, Inc. | Cells containing CRISPR hybrid DNA/RNA polynucleotides |
| US9580701B2 (en) | 2015-01-28 | 2017-02-28 | Pioneer Hi-Bred International, Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| US11180792B2 (en) | 2015-01-28 | 2021-11-23 | The Regents Of The University Of California | Methods and compositions for labeling a single-stranded target nucleic acid |
| US9868962B2 (en) | 2015-01-28 | 2018-01-16 | Pioneer Hi-Bred International, Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| US9771601B2 (en) | 2015-01-28 | 2017-09-26 | Pioneer Hi-Bred International. Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| WO2016131009A1 (en) * | 2015-02-13 | 2016-08-18 | University Of Massachusetts | Compositions and methods for transient delivery of nucleases |
| US11920168B2 (en) | 2015-02-13 | 2024-03-05 | University Of Massachusetts | Compositions and methods for transient delivery of nucleases |
| US20180037877A1 (en) * | 2015-02-13 | 2018-02-08 | University Of Massachusetts | Compositions and methods for transient delivery of nucleases |
| US10584321B2 (en) * | 2015-02-13 | 2020-03-10 | University Of Massachusetts | Compositions and methods for transient delivery of nucleases |
| US11427869B2 (en) | 2015-02-26 | 2022-08-30 | The Broad Institute, Inc. | T cell balance gene expression, compositions of matters and methods of use thereof |
| WO2016138488A2 (en) | 2015-02-26 | 2016-09-01 | The Broad Institute Inc. | T cell balance gene expression, compositions of matters and methods of use thereof |
| WO2016138574A1 (en) | 2015-03-02 | 2016-09-09 | Sinai Health System | Homologous recombination factors |
| US10808233B2 (en) | 2015-03-03 | 2020-10-20 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| EP3858990A1 (en) | 2015-03-03 | 2021-08-04 | The General Hospital Corporation | Engineered crispr-cas9 nucleases with altered pam specificity |
| US10202589B2 (en) | 2015-03-03 | 2019-02-12 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US12180520B2 (en) | 2015-03-03 | 2024-12-31 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US9752132B2 (en) | 2015-03-03 | 2017-09-05 | The General Hospital Corporation | Engineered CRISPR-CAS9 nucleases with altered PAM specificity |
| US11220678B2 (en) | 2015-03-03 | 2022-01-11 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US11859220B2 (en) | 2015-03-03 | 2024-01-02 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| WO2016141224A1 (en) | 2015-03-03 | 2016-09-09 | The General Hospital Corporation | Engineered crispr-cas9 nucleases with altered pam specificity |
| US10767168B2 (en) | 2015-03-03 | 2020-09-08 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US9944912B2 (en) | 2015-03-03 | 2018-04-17 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US10479982B2 (en) | 2015-03-03 | 2019-11-19 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US9926545B2 (en) | 2015-03-03 | 2018-03-27 | The General Hospital Corporation | Engineered CRISPR-CAS9 nucleases with altered PAM specificity |
| WO2016154176A1 (en) * | 2015-03-26 | 2016-09-29 | Yale University | Methods and compositions for modifying endothelial cells |
| US10450576B2 (en) | 2015-03-27 | 2019-10-22 | E I Du Pont De Nemours And Company | Soybean U6 small nuclear RNA gene promoters and their use in constitutive expression of small RNA genes in plants |
| US20230407251A1 (en) * | 2015-04-03 | 2023-12-21 | Dana-Farber Cancer Institute, Inc. | Composition and methods of genome editing of b-cells |
| US20160289637A1 (en) * | 2015-04-03 | 2016-10-06 | Dana-Farber Cancer Institute, Inc. | Composition and methods of genome editing of b-cells |
| US11180793B2 (en) | 2015-04-24 | 2021-11-23 | Editas Medicine, Inc. | Evaluation of Cas9 molecule/guide RNA molecule complexes |
| US11046955B2 (en) | 2015-04-24 | 2021-06-29 | University Of Massachusetts | Modified AAV constructs and uses thereof |
| US12054715B2 (en) | 2015-04-24 | 2024-08-06 | University Of Massachusetts | Modified AAV constructs and uses thereof |
| US12497590B2 (en) | 2015-05-08 | 2025-12-16 | President And Fellows Of Harvard College | Universal donor stem cells and related methods |
| US12110500B2 (en) | 2015-05-08 | 2024-10-08 | President And Fellows Of Harvard College | Universal donor stem cells and related methods |
| WO2016182893A1 (en) | 2015-05-08 | 2016-11-17 | Teh Broad Institute Inc. | Functional genomics using crispr-cas systems for saturating mutagenesis of non-coding elements, compositions, methods, libraries and applications thereof |
| US12031155B2 (en) | 2015-05-08 | 2024-07-09 | President And Fellows Of Harvard College | Universal donor stem cells and related methods |
| US12421493B2 (en) | 2015-05-08 | 2025-09-23 | President And Fellows Of Harvard College | Universal donor stem cells and related methods |
| US12031154B2 (en) | 2015-05-08 | 2024-07-09 | President And Fellows Of Harvard College | Universal donor stem cells and related methods |
| US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
| GB2543873A (en) * | 2015-05-29 | 2017-05-03 | Agenovir Corp | Compositions and methods for cell targeted HPV treatment |
| US11549126B2 (en) | 2015-06-03 | 2023-01-10 | Board Of Regents Of The University Of Nebraska | Treatment methods using DNA editing with single-stranded DNA |
| US11555208B2 (en) | 2015-06-03 | 2023-01-17 | Board Of Regents Of The University Of Nebraska | DNA editing using relatively long single-stranded DNA and CRISPR/Cas9 to increase success rate in methods for preparing transgenic embryos and animals |
| US20180171354A1 (en) * | 2015-06-03 | 2018-06-21 | National University Of Singapore | Vectors |
| WO2016196655A1 (en) | 2015-06-03 | 2016-12-08 | The Regents Of The University Of California | Cas9 variants and methods of use thereof |
| US11725216B2 (en) * | 2015-06-03 | 2023-08-15 | National University Of Singapore | Vectors |
| US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
| US11273185B2 (en) | 2015-06-15 | 2022-03-15 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US10500237B2 (en) | 2015-06-15 | 2019-12-10 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US10864236B2 (en) | 2015-06-15 | 2020-12-15 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US10736926B2 (en) | 2015-06-15 | 2020-08-11 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US11040075B2 (en) | 2015-06-15 | 2021-06-22 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US11433106B2 (en) | 2015-06-15 | 2022-09-06 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US11331352B2 (en) | 2015-06-15 | 2022-05-17 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US10744167B2 (en) | 2015-06-15 | 2020-08-18 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US10493112B2 (en) | 2015-06-15 | 2019-12-03 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US11389493B2 (en) | 2015-06-15 | 2022-07-19 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US10780134B2 (en) | 2015-06-15 | 2020-09-22 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| WO2016205728A1 (en) | 2015-06-17 | 2016-12-22 | Massachusetts Institute Of Technology | Crispr mediated recording of cellular events |
| US11643669B2 (en) | 2015-06-17 | 2023-05-09 | Massachusetts Institute Of Technology | CRISPR mediated recording of cellular events |
| US11180751B2 (en) | 2015-06-18 | 2021-11-23 | The Broad Institute, Inc. | CRISPR enzymes and systems |
| EP3666895A1 (en) | 2015-06-18 | 2020-06-17 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
| US11060115B2 (en) | 2015-06-18 | 2021-07-13 | The Broad Institute, Inc. | CRISPR enzymes and systems |
| WO2016205745A2 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Cell sorting |
| US11773412B2 (en) | 2015-06-18 | 2023-10-03 | The Broad Institute, Inc. | Crispr enzymes and systems |
| WO2016205764A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| US20180155715A1 (en) * | 2015-06-18 | 2018-06-07 | Robert D. Bowles | Rna-guided transcriptional regulation and methods of using the same for the treatment of back pain |
| US10954513B2 (en) * | 2015-06-18 | 2021-03-23 | University Of Utah Research Foundation | RNA-guided transcriptional regulation and methods of using the same for the treatment of back pain |
| EP4159856A1 (en) | 2015-06-18 | 2023-04-05 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
| US11421250B2 (en) | 2015-06-18 | 2022-08-23 | The Broad Institute, Inc. | CRISPR enzymes and systems |
| US11236327B2 (en) | 2015-06-18 | 2022-02-01 | The Broad Institute, Inc. | Cell sorting |
| US11414657B2 (en) | 2015-06-29 | 2022-08-16 | Ionis Pharmaceuticals, Inc. | Modified CRISPR RNA and modified single CRISPR RNA and uses thereof |
| US20180360994A1 (en) * | 2015-07-25 | 2018-12-20 | Habib Frost | System, device and a method for providing a therapy or a cure for cancer and other pathological states |
| US11642374B2 (en) | 2015-07-31 | 2023-05-09 | Intima Bioscience, Inc. | Intracellular genomic transplant and methods of therapy |
| US11903966B2 (en) | 2015-07-31 | 2024-02-20 | Regents Of The University Of Minnesota | Intracellular genomic transplant and methods of therapy |
| US11642375B2 (en) * | 2015-07-31 | 2023-05-09 | Intima Bioscience, Inc. | Intracellular genomic transplant and methods of therapy |
| US11147837B2 (en) | 2015-07-31 | 2021-10-19 | Regents Of The University Of Minnesota | Modified cells and methods of therapy |
| US11583556B2 (en) | 2015-07-31 | 2023-02-21 | Regents Of The University Of Minnesota | Modified cells and methods of therapy |
| US11214800B2 (en) | 2015-08-18 | 2022-01-04 | The Broad Institute, Inc. | Methods and compositions for altering function and structure of chromatin loops and/or domains |
| US10633642B2 (en) | 2015-08-28 | 2020-04-28 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US11060078B2 (en) | 2015-08-28 | 2021-07-13 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| WO2017040348A1 (en) | 2015-08-28 | 2017-03-09 | The General Hospital Corporation | Engineered crispr-cas9 nucleases |
| US10093910B2 (en) | 2015-08-28 | 2018-10-09 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| EP4036236A1 (en) | 2015-08-28 | 2022-08-03 | The General Hospital Corporation | Engineered crispr-cas9 nucleases |
| US10526591B2 (en) | 2015-08-28 | 2020-01-07 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US9512446B1 (en) | 2015-08-28 | 2016-12-06 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US9926546B2 (en) | 2015-08-28 | 2018-03-27 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US11932887B2 (en) | 2015-09-10 | 2024-03-19 | Yeda Research And Development Co. Ltd. | CYP76AD1-beta clade polynucleotides, polypeptides, and uses thereof |
| US10767201B2 (en) | 2015-09-10 | 2020-09-08 | Yeda Research And Development Co. Ltd. | CYP76AD1-beta clade polynucleotides, polypeptides, and uses thereof |
| US12529083B2 (en) | 2015-09-10 | 2026-01-20 | Rada Research And Development Co. Ltd. | CYP76AD1-beta clade polynucleotides, polypeptides, and methods for producing betalains |
| US11028429B2 (en) | 2015-09-11 | 2021-06-08 | The General Hospital Corporation | Full interrogation of nuclease DSBs and sequencing (FIND-seq) |
| US11667911B2 (en) | 2015-09-24 | 2023-06-06 | Editas Medicine, Inc. | Use of exonucleases to improve CRISPR/CAS-mediated genome editing |
| US10738303B2 (en) | 2015-09-30 | 2020-08-11 | The General Hospital Corporation | Comprehensive in vitro reporting of cleavage events by sequencing (CIRCLE-seq) |
| WO2017069958A2 (en) | 2015-10-09 | 2017-04-27 | The Brigham And Women's Hospital, Inc. | Modulation of novel immune checkpoint targets |
| US11426469B2 (en) | 2015-10-22 | 2022-08-30 | University Of Massachusetts | Prostate-targeting adeno-associated virus serotype vectors |
| WO2017070605A1 (en) | 2015-10-22 | 2017-04-27 | The Broad Institute Inc. | Type vi-b crispr enzymes and systems |
| US11253576B2 (en) | 2015-10-22 | 2022-02-22 | University Of Massachusetts | Methods and compositions for treating metabolic imbalance in neurodegenerative disease |
| US12215318B2 (en) | 2015-10-22 | 2025-02-04 | The Broad Institute, Inc. | Crispr enzymes and systems |
| US12234454B2 (en) | 2015-10-22 | 2025-02-25 | The Broad Institute, Inc. | Crispr enzymes and systems |
| US12491235B2 (en) | 2015-10-22 | 2025-12-09 | University Of Massachusetts | Methods and compositions for treating metabolic imbalance in neurodegenerative disease |
| US12043852B2 (en) | 2015-10-23 | 2024-07-23 | President And Fellows Of Harvard College | Evolved Cas9 proteins for gene editing |
| US12344869B2 (en) | 2015-10-23 | 2025-07-01 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US11214780B2 (en) | 2015-10-23 | 2022-01-04 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| WO2017074788A1 (en) | 2015-10-27 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for targeting cancer-specific sequence variations |
| US11186825B2 (en) | 2015-10-28 | 2021-11-30 | The Broad Institute, Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting POU2AF1 |
| US11092607B2 (en) | 2015-10-28 | 2021-08-17 | The Board Institute, Inc. | Multiplex analysis of single cell constituents |
| US11180730B2 (en) | 2015-10-28 | 2021-11-23 | The Broad Institute, Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting GATA3 |
| WO2017075465A1 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting gata3 |
| WO2017075478A2 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by use of immune cell gene signatures |
| WO2017075451A1 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting pou2af1 |
| WO2017075294A1 (en) | 2015-10-28 | 2017-05-04 | The Board Institute Inc. | Assays for massively combinatorial perturbation profiling and cellular circuit reconstruction |
| US11542554B2 (en) | 2015-11-03 | 2023-01-03 | President And Fellows Of Harvard College | Method and apparatus for volumetric imaging |
| WO2017083274A1 (en) * | 2015-11-09 | 2017-05-18 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Novel rna-based vector system for transient and stable gene expression |
| WO2017083722A1 (en) * | 2015-11-11 | 2017-05-18 | Greenberg Kenneth P | Crispr compositions and methods of using the same for gene therapy |
| EP4036228A1 (en) | 2015-11-13 | 2022-08-03 | Avellino Lab USA, Inc. | Methods for the treatment of corneal dystrophies |
| WO2017083852A1 (en) | 2015-11-13 | 2017-05-18 | MOORE, Tara | Methods for the treatment of corneal dystrophies |
| US11987809B2 (en) | 2015-11-13 | 2024-05-21 | Avellino Lab Usa, Inc. | Methods for the treatment of corneal dystrophies |
| US12472239B2 (en) | 2015-11-16 | 2025-11-18 | Research Institute At Nationwide Children's Hospital | Guide RNA for repairing a mutant human titin gene using CRISPR technology |
| US11884717B2 (en) | 2015-11-19 | 2024-01-30 | The Brigham And Women's Hospital, Inc. | Method of treating autoimmune disease with lymphocyte antigen CD5-like (CD5L) protein |
| WO2017087708A1 (en) | 2015-11-19 | 2017-05-26 | The Brigham And Women's Hospital, Inc. | Lymphocyte antigen cd5-like (cd5l)-interleukin 12b (p40) heterodimers in immunity |
| US11001622B2 (en) | 2015-11-19 | 2021-05-11 | The Brigham And Women's Hospital, Inc. | Method of treating autoimmune disease with lymphocyte antigen CD5-like (CD5L) protein |
| US10610550B2 (en) | 2015-11-20 | 2020-04-07 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US11058732B2 (en) | 2015-11-20 | 2021-07-13 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US10471108B2 (en) | 2015-11-20 | 2019-11-12 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| EP4219689A2 (en) | 2015-12-30 | 2023-08-02 | Novartis AG | Immune effector cell therapies with enhanced efficacy |
| WO2017114497A1 (en) | 2015-12-30 | 2017-07-06 | Novartis Ag | Immune effector cell therapies with enhanced efficacy |
| US11111287B2 (en) | 2016-01-11 | 2021-09-07 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric proteins and methods of immunotherapy |
| US10457961B2 (en) | 2016-01-11 | 2019-10-29 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric proteins and methods of regulating gene expression |
| US9856497B2 (en) * | 2016-01-11 | 2018-01-02 | The Board Of Trustee Of The Leland Stanford Junior University | Chimeric proteins and methods of regulating gene expression |
| US10336807B2 (en) | 2016-01-11 | 2019-07-02 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric proteins and methods of immunotherapy |
| US11773411B2 (en) | 2016-01-11 | 2023-10-03 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric proteins and methods of regulating gene expression |
| US10053693B2 (en) | 2016-01-19 | 2018-08-21 | Mubin I. Syed | Method for controlling obesity using minimally invasive means |
| US9976144B2 (en) | 2016-01-19 | 2018-05-22 | Mubin I. Syed | Method for controlling obesity using minimally invasive means |
| US10208311B2 (en) | 2016-01-19 | 2019-02-19 | Mubin I. Syed | Method for controlling obesity using minimally invasive means |
| US11826433B2 (en) | 2016-02-02 | 2023-11-28 | University Of Massachusetts | Method to enhance the efficiency of systemic AAV gene delivery to the central nervous system |
| US11060088B2 (en) | 2016-02-12 | 2021-07-13 | University Of Massachusetts | Anti-angiogenic miRNA therapeutics for inhibiting corneal neovascularization |
| US11851657B2 (en) | 2016-02-12 | 2023-12-26 | University Of Massachusetts | Anti-angiogenic miRNA therapeutics for inhibiting corneal neovascularization |
| WO2017143071A1 (en) | 2016-02-18 | 2017-08-24 | The Regents Of The University Of California | Methods and compositions for gene editing in stem cells |
| WO2017147196A1 (en) | 2016-02-22 | 2017-08-31 | Massachusetts Institute Of Technology | Methods for identifying and modulating immune phenotypes |
| US10286073B2 (en) * | 2016-02-23 | 2019-05-14 | Ilisa Tech, Inc. | Magnetic control of gene delivery in vivo |
| US12037601B2 (en) | 2016-03-04 | 2024-07-16 | Indoor Biotechnologies Inc. | Method of inactivating a FEL D1 gene using crispr |
| US10583158B2 (en) | 2016-03-04 | 2020-03-10 | 4D Pharma Plc | Compositions comprising bacterial strains |
| WO2017161043A1 (en) | 2016-03-16 | 2017-09-21 | The J. David Gladstone Institutes | Methods and compositions for treating obesity and/or diabetes and for identifying candidate treatment agents |
| US11427861B2 (en) | 2016-03-17 | 2022-08-30 | Massachusetts Institute Of Technology | Methods for identifying and modulating co-occurant cellular phenotypes |
| WO2017161325A1 (en) | 2016-03-17 | 2017-09-21 | Massachusetts Institute Of Technology | Methods for identifying and modulating co-occurant cellular phenotypes |
| US11512311B2 (en) | 2016-03-25 | 2022-11-29 | Editas Medicine, Inc. | Systems and methods for treating alpha 1-antitrypsin (A1AT) deficiency |
| US11597924B2 (en) | 2016-03-25 | 2023-03-07 | Editas Medicine, Inc. | Genome editing systems comprising repair-modulating enzyme molecules and methods of their use |
| CN109475646A (zh) * | 2016-03-30 | 2019-03-15 | 因特利亚治疗公司 | 用于crispr/cas成分的脂质纳米颗粒制剂 |
| US11207426B2 (en) | 2016-04-05 | 2021-12-28 | University Of Massachusetts | Compositions and methods for selective inhibition of grainyhead-like protein expression |
| US12049651B2 (en) | 2016-04-13 | 2024-07-30 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| US11236313B2 (en) | 2016-04-13 | 2022-02-01 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| US11413356B2 (en) | 2016-04-15 | 2022-08-16 | University Of Massachusetts | Methods and compositions for treating metabolic imbalance |
| US11713485B2 (en) | 2016-04-25 | 2023-08-01 | President And Fellows Of Harvard College | Hybridization chain reaction methods for in situ molecular detection |
| US12342801B2 (en) | 2016-05-20 | 2025-07-01 | Regeneron Pharmaceuticals, Inc. | Methods for producing antigen-binding proteins against foreign antigens |
| US11882815B2 (en) | 2016-06-15 | 2024-01-30 | University Of Massachusetts | Recombinant adeno-associated viruses for delivering gene editing molecules to embryonic cells |
| US11788083B2 (en) | 2016-06-17 | 2023-10-17 | The Broad Institute, Inc. | Type VI CRISPR orthologs and systems |
| WO2017219027A1 (en) | 2016-06-17 | 2017-12-21 | The Broad Institute Inc. | Type vi crispr orthologs and systems |
| WO2018005445A1 (en) | 2016-06-27 | 2018-01-04 | The Broad Institute, Inc. | Compositions and methods for detecting and treating diabetes |
| US10610548B2 (en) | 2016-07-13 | 2020-04-07 | 4D Pharma Plc | Compositions comprising bacterial strains |
| WO2018013840A1 (en) | 2016-07-13 | 2018-01-18 | Vertex Pharmaceuticals Incorporated | Methods, compositions and kits for increasing genome editing efficiency |
| US11224620B2 (en) | 2016-07-13 | 2022-01-18 | 4D Pharma Plc | Compositions comprising bacterial strains |
| US10967010B2 (en) | 2016-07-13 | 2021-04-06 | 4D Pharma Plc | Compositions comprising bacterial strains |
| US10610549B2 (en) | 2016-07-13 | 2020-04-07 | 4D Pharma Plc | Composition comprising bacterial strains |
| US12031150B2 (en) | 2016-07-13 | 2024-07-09 | Vertex Pharmaceuticals Incorporated | Methods, compositions and kits for increasing genome editing efficiency |
| EP4219462A1 (en) | 2016-07-13 | 2023-08-02 | Vertex Pharmaceuticals Incorporated | Methods, compositions and kits for increasing genome editing efficiency |
| US10960031B2 (en) | 2016-07-13 | 2021-03-30 | 4D Pharma Plc | Compositions comprising bacterial strains |
| US11566263B2 (en) | 2016-08-02 | 2023-01-31 | Editas Medicine, Inc. | Compositions and methods for treating CEP290 associated disease |
| US11999947B2 (en) | 2016-08-03 | 2024-06-04 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US11702651B2 (en) | 2016-08-03 | 2023-07-18 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US11078481B1 (en) | 2016-08-03 | 2021-08-03 | KSQ Therapeutics, Inc. | Methods for screening for cancer targets |
| US10947530B2 (en) | 2016-08-03 | 2021-03-16 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US11912987B2 (en) | 2016-08-03 | 2024-02-27 | KSQ Therapeutics, Inc. | Methods for screening for cancer targets |
| US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
| WO2018035364A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute Inc. | Product and methods useful for modulating and evaluating immune responses |
| US12305204B2 (en) | 2016-08-17 | 2025-05-20 | The Broad Institute, Inc. | CRISPR enzymes and systems |
| US11630103B2 (en) | 2016-08-17 | 2023-04-18 | The Broad Institute, Inc. | Product and methods useful for modulating and evaluating immune responses |
| WO2018035250A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute, Inc. | Methods for identifying class 2 crispr-cas systems |
| US11352647B2 (en) | 2016-08-17 | 2022-06-07 | The Broad Institute, Inc. | Crispr enzymes and systems |
| US12431216B2 (en) | 2016-08-17 | 2025-09-30 | Broad Institute, Inc. | Methods for identifying class 2 crispr-cas systems |
| WO2018039145A1 (en) | 2016-08-20 | 2018-03-01 | Avellino Lab Usa, Inc. | Single guide rna, crispr/cas9 systems, and methods of use thereof |
| US20220056440A1 (en) * | 2016-08-20 | 2022-02-24 | Tara Moore | Crispr gene editing for autosomal dominant diseases |
| US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US12084663B2 (en) | 2016-08-24 | 2024-09-10 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US11078483B1 (en) | 2016-09-02 | 2021-08-03 | KSQ Therapeutics, Inc. | Methods for measuring and improving CRISPR reagent function |
| US11946163B2 (en) | 2016-09-02 | 2024-04-02 | KSQ Therapeutics, Inc. | Methods for measuring and improving CRISPR reagent function |
| WO2018048828A1 (en) | 2016-09-06 | 2018-03-15 | The Children's Medical Center Corporation | Immune cells derived from induced pluripotent stem cell |
| WO2018049025A2 (en) | 2016-09-07 | 2018-03-15 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses |
| US11104910B2 (en) | 2016-09-11 | 2021-08-31 | Yeda Research And Development Co. Ltd. | Compositions and methods for regulating gene expression for targeted mutagenesis |
| WO2018047183A1 (en) | 2016-09-11 | 2018-03-15 | Yeda Research And Development Co. Ltd. | Compositions and methods for regulating gene expression for targeted mutagenesis |
| US10457940B2 (en) | 2016-09-22 | 2019-10-29 | University Of Massachusetts | AAV treatment of Huntington's disease |
| US11773392B2 (en) | 2016-09-22 | 2023-10-03 | University Of Massachusetts | AAV treatment of Huntington's disease |
| US11046957B2 (en) | 2016-09-22 | 2021-06-29 | University Of Massachusetts | AAV treatment of Huntington's disease |
| US12522824B2 (en) | 2016-09-22 | 2026-01-13 | University Of Massachusetts | AAV treatment of Huntington's disease |
| US12499971B2 (en) | 2016-09-28 | 2025-12-16 | The Broad Institute, Inc. | Systematic screening and mapping of regulatory elements in non-coding genomic regions, methods, compositions, and applications thereof |
| WO2018064371A1 (en) | 2016-09-30 | 2018-04-05 | The Regents Of The University Of California | Rna-guided nucleic acid modifying enzymes and methods of use thereof |
| US10669539B2 (en) | 2016-10-06 | 2020-06-02 | Pioneer Biolabs, Llc | Methods and compositions for generating CRISPR guide RNA libraries |
| WO2018067991A1 (en) | 2016-10-07 | 2018-04-12 | The Brigham And Women's Hospital, Inc. | Modulation of novel immune checkpoint targets |
| US12447213B2 (en) | 2016-10-07 | 2025-10-21 | The Broad Institute, Inc. | Modulation of novel immune checkpoint targets |
| US11578340B2 (en) | 2016-10-13 | 2023-02-14 | University Of Massachusetts | AAV capsid designs |
| US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
| WO2018073237A1 (en) | 2016-10-17 | 2018-04-26 | The University Court Of The University Of Edinburgh | Swine comprising modified cd163 and associated methods |
| US11154574B2 (en) | 2016-10-18 | 2021-10-26 | Regents Of The University Of Minnesota | Tumor infiltrating lymphocytes and methods of therapy |
| US10912797B2 (en) | 2016-10-18 | 2021-02-09 | Intima Bioscience, Inc. | Tumor infiltrating lymphocytes and methods of therapy |
| WO2018083606A1 (en) | 2016-11-01 | 2018-05-11 | Novartis Ag | Methods and compositions for enhancing gene editing |
| US12227578B2 (en) | 2016-11-11 | 2025-02-18 | The Broad Institute, Inc. | Modulation of intestinal epithelial cell differentiation, maintenance and/or function through T cell action |
| US12404514B2 (en) | 2016-12-09 | 2025-09-02 | The Broad Institute, Inc. | CRISPR-systems for modifying a trait of interest in a plant |
| US10485830B2 (en) | 2016-12-12 | 2019-11-26 | 4D Pharma Plc | Compositions comprising bacterial strains |
| WO2018112278A1 (en) | 2016-12-14 | 2018-06-21 | Ligandal, Inc. | Methods and compositions for nucleic acid and protein payload delivery |
| US10975388B2 (en) | 2016-12-14 | 2021-04-13 | Ligandal, Inc. | Methods and compositions for nucleic acid and protein payload delivery |
| US12123012B2 (en) | 2016-12-14 | 2024-10-22 | Ligandal, Inc. | Methods and compositions for nucleic acid and protein payload delivery |
| US12286727B2 (en) | 2016-12-19 | 2025-04-29 | Editas Medicine, Inc. | Assessing nuclease cleavage |
| GB2572918B (en) * | 2016-12-23 | 2023-02-15 | Harvard College | Gene editing of PCSK9 |
| CN110352242A (zh) * | 2016-12-23 | 2019-10-18 | 哈佛大学的校长及成员们 | Pcsk9的基因编辑 |
| IL267500B1 (en) * | 2016-12-23 | 2025-03-01 | Harvard College | PCKS9 genomic editing, and related methods, compositions, and uses |
| IL267500B2 (en) * | 2016-12-23 | 2025-07-01 | Harvard College | Gene editing of pcsk9 and related methods, compositions, and uses thereof |
| US11820969B2 (en) | 2016-12-23 | 2023-11-21 | President And Fellows Of Harvard College | Editing of CCR2 receptor gene to protect against HIV infection |
| US12110545B2 (en) | 2017-01-06 | 2024-10-08 | Editas Medicine, Inc. | Methods of assessing nuclease cleavage |
| US11466271B2 (en) | 2017-02-06 | 2022-10-11 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
| US11591621B2 (en) | 2017-02-07 | 2023-02-28 | Modalis Therapeutics Corporation | Method of treating diseases associated with elevated KRAS expression using CRISPR-GNDM system |
| US20190367924A1 (en) * | 2017-02-17 | 2019-12-05 | Temple University - Of The Commonwealth System Of Higher Education | Gene editing therapy for hiv infection via dual targeting of hiv genome and ccr5 |
| US10687520B2 (en) | 2017-03-07 | 2020-06-23 | The Board Of Regents Of The University Of Texas System | Generation and correction of a humanized mouse model with a deletion of dystrophin exon 44 |
| US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US12516308B2 (en) | 2017-03-09 | 2026-01-06 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| US12435331B2 (en) | 2017-03-10 | 2025-10-07 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11851690B2 (en) | 2017-03-14 | 2023-12-26 | Editas Medicine, Inc. | Systems and methods for the treatment of hemoglobinopathies |
| US11739308B2 (en) | 2017-03-15 | 2023-08-29 | The Broad Institute, Inc. | Cas13b orthologues CRISPR enzymes and systems |
| EP4361261A2 (en) | 2017-03-15 | 2024-05-01 | The Broad Institute Inc. | Novel cas13b orthologues crispr enzymes and systems |
| WO2018170333A1 (en) | 2017-03-15 | 2018-09-20 | The Broad Institute, Inc. | Novel cas13b orthologues crispr enzymes and systems |
| WO2018170515A1 (en) | 2017-03-17 | 2018-09-20 | The Broad Institute, Inc. | Methods for identifying and modulating co-occurant cellular phenotypes |
| US12180546B2 (en) | 2017-03-17 | 2024-12-31 | Massachusetts Institute Of Technology | Methods for identifying and modulating co-occurant cellular phenotypes |
| WO2018175502A3 (en) * | 2017-03-21 | 2018-11-15 | Shuber Anthony P | Treating cancer with cas endonuclease complexes |
| US11268082B2 (en) | 2017-03-23 | 2022-03-08 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable DNA binding proteins |
| US12161694B2 (en) | 2017-03-24 | 2024-12-10 | The Broad Institute, Inc. | Methods and compositions for regulating innate lymphoid cell inflammatory responses |
| US11963966B2 (en) | 2017-03-31 | 2024-04-23 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for treating ovarian tumors |
| US11913075B2 (en) | 2017-04-01 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer |
| WO2018191553A1 (en) | 2017-04-12 | 2018-10-18 | Massachusetts Eye And Ear Infirmary | Tumor signature for metastasis, compositions of matter methods of use thereof |
| WO2018191520A1 (en) | 2017-04-12 | 2018-10-18 | The Broad Institute, Inc. | Respiratory and sweat gland ionocytes |
| WO2018191388A1 (en) | 2017-04-12 | 2018-10-18 | The Broad Institute, Inc. | Novel type vi crispr orthologs and systems |
| US12331319B2 (en) | 2017-04-12 | 2025-06-17 | The Broad Institute, Inc. | Respiratory and sweat gland ionocytes |
| US12350368B2 (en) | 2017-04-14 | 2025-07-08 | The Broad Institute, Inc. | Delivery of large payloads |
| WO2018191750A2 (en) | 2017-04-14 | 2018-10-18 | The Broad Institute Inc. | Novel delivery of large payloads |
| WO2018195019A1 (en) | 2017-04-18 | 2018-10-25 | The Broad Institute Inc. | Compositions for detecting secretion and methods of use |
| US12058986B2 (en) | 2017-04-20 | 2024-08-13 | Egenesis, Inc. | Method for generating a genetically modified pig with inactivated porcine endogenous retrovirus (PERV) elements |
| EP4481049A2 (en) | 2017-04-21 | 2024-12-25 | The General Hospital Corporation | Variants of cpf1 (cas12a) with altered pam specificity |
| WO2018195545A2 (en) | 2017-04-21 | 2018-10-25 | The General Hospital Corporation | Variants of cpf1 (cas12a) with altered pam specificity |
| WO2018195486A1 (en) | 2017-04-21 | 2018-10-25 | The Broad Institute, Inc. | Targeted delivery to beta cells |
| US11499151B2 (en) | 2017-04-28 | 2022-11-15 | Editas Medicine, Inc. | Methods and systems for analyzing guide RNA molecules |
| US20200188521A1 (en) * | 2017-04-28 | 2020-06-18 | Exicure, Inc. | Synthesis of spherical nucleic acids using lipophilic moieties |
| US11696954B2 (en) * | 2017-04-28 | 2023-07-11 | Exicure Operating Company | Synthesis of spherical nucleic acids using lipophilic moieties |
| US11591601B2 (en) | 2017-05-05 | 2023-02-28 | The Broad Institute, Inc. | Methods for identification and modification of lncRNA associated with target genotypes and phenotypes |
| US11859179B2 (en) | 2017-05-09 | 2024-01-02 | University Of Massachusetts | Methods of treating amyotrophic lateral sclerosis (ALS) |
| US12529051B2 (en) | 2017-05-09 | 2026-01-20 | University Of Massachusetts | Methods of treating amyotrophic lateral sclerosis (ALS) |
| US11963982B2 (en) | 2017-05-10 | 2024-04-23 | Editas Medicine, Inc. | CRISPR/RNA-guided nuclease systems and methods |
| US12226479B2 (en) | 2017-05-11 | 2025-02-18 | The General Hospital Corporation | Methods and compositions of use of CD8+ tumor infiltrating lymphocyte subtypes and gene signatures thereof |
| US12195802B2 (en) * | 2017-05-12 | 2025-01-14 | President And Fellows Of Harvard College | Universal early cancer diagnostics |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| US11866697B2 (en) | 2017-05-18 | 2024-01-09 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
| US12297436B2 (en) | 2017-05-18 | 2025-05-13 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
| US11376284B2 (en) | 2017-05-22 | 2022-07-05 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US11123378B2 (en) | 2017-05-22 | 2021-09-21 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US11382936B2 (en) | 2017-05-22 | 2022-07-12 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US10987387B2 (en) | 2017-05-24 | 2021-04-27 | 4D Pharma Research Limited | Compositions comprising bacterial strain |
| WO2018218206A1 (en) | 2017-05-25 | 2018-11-29 | The General Hospital Corporation | Bipartite base editor (bbe) architectures and type-ii-c-cas9 zinc finger editing |
| WO2018218166A1 (en) | 2017-05-25 | 2018-11-29 | The General Hospital Corporation | Using split deaminases to limit unwanted off-target base editor deamination |
| US11098297B2 (en) | 2017-06-09 | 2021-08-24 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US12297466B2 (en) | 2017-06-09 | 2025-05-13 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US10428319B2 (en) | 2017-06-09 | 2019-10-01 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US12048720B2 (en) | 2017-06-14 | 2024-07-30 | Cj Bioscience, Inc. | Compositions comprising bacterial strains |
| US11007233B2 (en) | 2017-06-14 | 2021-05-18 | 4D Pharma Research Limited | Compositions comprising a bacterial strain of the genus Megasphera and uses thereof |
| US11897953B2 (en) | 2017-06-14 | 2024-02-13 | The Broad Institute, Inc. | Compositions and methods targeting complement component 3 for inhibiting tumor growth |
| US11779613B2 (en) | 2017-06-14 | 2023-10-10 | Cj Bioscience, Inc. | Compositions comprising a bacterial strain of the genus Megasphera and uses thereof |
| US11123379B2 (en) | 2017-06-14 | 2021-09-21 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| US11660319B2 (en) | 2017-06-14 | 2023-05-30 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| WO2019005884A1 (en) | 2017-06-26 | 2019-01-03 | The Broad Institute, Inc. | CRISPR / CAS-ADENINE DEAMINASE COMPOSITIONS, SYSTEMS AND METHODS FOR TARGETED NUCLEIC ACID EDITION |
| US11098325B2 (en) | 2017-06-30 | 2021-08-24 | Intima Bioscience, Inc. | Adeno-associated viral vectors for gene therapy |
| WO2019003193A1 (en) | 2017-06-30 | 2019-01-03 | Novartis Ag | METHODS FOR TREATING DISEASES USING GENE EDITING SYSTEMS |
| US12049643B2 (en) | 2017-07-14 | 2024-07-30 | The Broad Institute, Inc. | Methods and compositions for modulating cytotoxic lymphocyte activity |
| US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
| WO2019018440A1 (en) | 2017-07-17 | 2019-01-24 | The Broad Institute, Inc. | HUMAN COLON CELL ATLAS IN GOOD HEALTH AND WITH HEMORRHAGIC RECTO-COLITIS |
| US12105089B2 (en) | 2017-07-17 | 2024-10-01 | The Broad Institute, Inc. | Cell atlas of the healthy and ulcerative colitis human colon |
| US12239646B2 (en) | 2017-07-19 | 2025-03-04 | Dana-Farber Cancer Institute, Inc. | Cancer diagnostic and treatment |
| US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US12359218B2 (en) | 2017-07-28 | 2025-07-15 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| CN115074343A (zh) * | 2017-07-31 | 2022-09-20 | 瑞泽恩制药公司 | Cas转基因小鼠胚胎干细胞和小鼠及其应用 |
| US11286468B2 (en) | 2017-08-23 | 2022-03-29 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US11624058B2 (en) | 2017-08-23 | 2023-04-11 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US12241096B2 (en) | 2017-08-23 | 2025-03-04 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US11932884B2 (en) | 2017-08-30 | 2024-03-19 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| WO2019060746A1 (en) | 2017-09-21 | 2019-03-28 | The Broad Institute, Inc. | SYSTEMS, METHODS, AND COMPOSITIONS FOR THE TARGETED EDITING OF NUCLEIC ACIDS |
| US11739330B2 (en) | 2017-09-22 | 2023-08-29 | University Of Massachusetts | SOD1 dual expression vectors and uses thereof |
| US12312587B2 (en) | 2017-09-22 | 2025-05-27 | University Of Massachusetts | SOD1 dual expression vectors and uses thereof |
| WO2019067452A1 (en) * | 2017-09-27 | 2019-04-04 | Pioneer Hi-Bred International, Inc. | GROUND APPLICATION OF CROP PROTECTION AGENTS |
| US11864555B2 (en) | 2017-09-27 | 2024-01-09 | Pioneer Hi-Bred International, Inc. | Soil application of crop protection agents |
| WO2019070755A1 (en) | 2017-10-02 | 2019-04-11 | The Broad Institute, Inc. | METHODS AND COMPOSITIONS FOR DETECTING AND MODULATING A GENETIC SIGNATURE OF IMMUNOTHERAPY RESISTANCE IN CANCER |
| US12043870B2 (en) | 2017-10-02 | 2024-07-23 | The Broad Institute, Inc. | Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer |
| WO2019071054A1 (en) | 2017-10-04 | 2019-04-11 | The Broad Institute, Inc. | METHODS AND COMPOSITIONS FOR MODIFYING THE FUNCTION AND STRUCTURE OF BUCKLES AND / OR CHROMATIN DOMAINS |
| US11725228B2 (en) | 2017-10-11 | 2023-08-15 | The General Hospital Corporation | Methods for detecting site-specific and spurious genomic deamination induced by base editing technologies |
| US11795443B2 (en) | 2017-10-16 | 2023-10-24 | The Broad Institute, Inc. | Uses of adenosine base editors |
| US11680296B2 (en) | 2017-10-16 | 2023-06-20 | Massachusetts Institute Of Technology | Mycobacterium tuberculosis host-pathogen interaction |
| US12227742B2 (en) | 2017-10-23 | 2025-02-18 | The Broad Institute, Inc. | Nucleic acid modifiers |
| US12433803B2 (en) | 2017-10-31 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for studying cell evolution |
| US11547614B2 (en) | 2017-10-31 | 2023-01-10 | The Broad Institute, Inc. | Methods and compositions for studying cell evolution |
| WO2019087113A1 (en) | 2017-11-01 | 2019-05-09 | Novartis Ag | Synthetic rnas and methods of use |
| US12171783B2 (en) | 2017-11-13 | 2024-12-24 | The Broad Institute, Inc. | Methods and compositions for targeting developmental and oncogenic programs in H3K27M gliomas |
| US12221720B2 (en) | 2017-11-13 | 2025-02-11 | The Broad Institute, Inc. | Methods for determining spatial and temporal gene expression dynamics during adult neurogenesis in single cells |
| WO2019094983A1 (en) | 2017-11-13 | 2019-05-16 | The Broad Institute, Inc. | Methods and compositions for treating cancer by targeting the clec2d-klrb1 pathway |
| US11332736B2 (en) | 2017-12-07 | 2022-05-17 | The Broad Institute, Inc. | Methods and compositions for multiplexing single cell and single nuclei sequencing |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| US11994512B2 (en) | 2018-01-04 | 2024-05-28 | Massachusetts Institute Of Technology | Single-cell genomic methods to generate ex vivo cell systems that recapitulate in vivo biology with improved fidelity |
| US12121524B2 (en) | 2018-01-17 | 2024-10-22 | Vertex Pharmaceuticals Incorporated | DNA-PK inhibitors |
| US12269804B2 (en) | 2018-01-17 | 2025-04-08 | Vertex Pharmaceuticals Incorporated | Quinoxalinone compounds, compositions, methods, and kits for increasing genome editing efficiency |
| WO2019143675A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Dna-pk inhibitors |
| US12005127B2 (en) | 2018-01-17 | 2024-06-11 | Vertex Pharmaceuticals Incorporated | DNA-PK inhibitors |
| WO2019143677A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Quinoxalinone compounds, compositions, methods, and kits for increasing genome editing efficiency |
| WO2019143678A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Dna-pk inhibitors |
| US12263230B2 (en) | 2018-01-31 | 2025-04-01 | Research Institute At Nationwide Children's Hospital | Gene therapy for limb-girdle muscular dystrophy type 2C |
| US20210032612A1 (en) * | 2018-02-22 | 2021-02-04 | Avellino Lab Usa, Inc. | CRISPR/Cas9 Systems, and Methods of Use Thereof |
| US12084676B2 (en) | 2018-02-23 | 2024-09-10 | Pioneer Hi-Bred International, Inc. | Cas9 orthologs |
| US12031132B2 (en) | 2018-03-14 | 2024-07-09 | Editas Medicine, Inc. | Systems and methods for the treatment of hemoglobinopathies |
| WO2019195738A1 (en) | 2018-04-06 | 2019-10-10 | Children's Medical Center Corporation | Compositions and methods for somatic cell reprogramming and modulating imprinting |
| US11976324B2 (en) | 2018-04-17 | 2024-05-07 | The General Hospital Corporation | Highly sensitive in vitro assays to define substrate preferences and sites of nucleic-acid binding, modifying, and cleaving agents |
| US11898203B2 (en) | 2018-04-17 | 2024-02-13 | The General Hospital Corporation | Highly sensitive in vitro assays to define substrate preferences and sites of nucleic-acid binding, modifying, and cleaving agents |
| US11845987B2 (en) | 2018-04-17 | 2023-12-19 | The General Hospital Corporation | Highly sensitive in vitro assays to define substrate preferences and sites of nucleic acid cleaving agents |
| WO2019204585A1 (en) | 2018-04-19 | 2019-10-24 | Massachusetts Institute Of Technology | Single-stranded break detection in double-stranded dna |
| EP3560330A1 (en) | 2018-04-24 | 2019-10-30 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
| US12180490B2 (en) | 2018-04-24 | 2024-12-31 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
| WO2019206927A1 (en) | 2018-04-24 | 2019-10-31 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
| US11957695B2 (en) | 2018-04-26 | 2024-04-16 | The Broad Institute, Inc. | Methods and compositions targeting glucocorticoid signaling for modulating immune responses |
| WO2019210268A2 (en) | 2018-04-27 | 2019-10-31 | The Broad Institute, Inc. | Sequencing-based proteomics |
| US20210130832A1 (en) * | 2018-04-30 | 2021-05-06 | Oregon Health & Science University | Methods of gene therapy |
| WO2019213660A2 (en) | 2018-05-04 | 2019-11-07 | The Broad Institute, Inc. | Compositions and methods for modulating cgrp signaling to regulate innate lymphoid cell inflammatory responses |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| WO2019232542A2 (en) | 2018-06-01 | 2019-12-05 | Massachusetts Institute Of Technology | Methods and compositions for detecting and modulating microenvironment gene signatures from the csf of metastasis patients |
| US12163129B2 (en) | 2018-06-08 | 2024-12-10 | University Of Massachusetts | Antisense oligonucleotides to restore dysferlin protein expression in dysferlinopathy patient cells |
| CN112424368A (zh) * | 2018-06-12 | 2021-02-26 | 布利斯脱大学 | 用于调节眼内压和颅内压的材料和方法 |
| US12036240B2 (en) | 2018-06-14 | 2024-07-16 | The Broad Institute, Inc. | Compositions and methods targeting complement component 3 for inhibiting tumor growth |
| WO2020006036A1 (en) | 2018-06-26 | 2020-01-02 | Massachusetts Institute Of Technology | Crispr effector system based amplification methods, systems, and diagnostics |
| WO2020006049A1 (en) | 2018-06-26 | 2020-01-02 | The Broad Institute, Inc. | Crispr/cas and transposase based amplification compositions, systems and methods |
| US12391928B2 (en) | 2018-06-29 | 2025-08-19 | Research Institute At Nationwide Children's Hospital | Recombinant adeno-associated virus products and methods for treating limb girdle muscular dystrophy 2A |
| US12338436B2 (en) | 2018-06-29 | 2025-06-24 | Editas Medicine, Inc. | Synthetic guide molecules, compositions and methods relating thereto |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
| WO2020014528A1 (en) | 2018-07-13 | 2020-01-16 | The Regents Of The University Of California | Retrotransposon-based delivery vehicle and methods of use thereof |
| WO2020028555A2 (en) | 2018-07-31 | 2020-02-06 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
| WO2020033601A1 (en) | 2018-08-07 | 2020-02-13 | The Broad Institute, Inc. | Novel cas12b enzymes and systems |
| US12421507B2 (en) | 2018-08-20 | 2025-09-23 | The Broad Institute, Inc. | Methods and compositions for optochemical control of CRISPR-CAS9 |
| WO2020041380A1 (en) | 2018-08-20 | 2020-02-27 | The Broad Institute, Inc. | Methods and compositions for optochemical control of crispr-cas9 |
| WO2020041387A1 (en) | 2018-08-20 | 2020-02-27 | The Brigham And Women's Hospital, Inc. | Degradation domain modifications for spatio-temporal control of rna-guided nucleases |
| WO2020041456A1 (en) | 2018-08-22 | 2020-02-27 | The Regents Of The University Of California | Variant type v crispr/cas effector polypeptides and methods of use thereof |
| WO2020051507A1 (en) | 2018-09-06 | 2020-03-12 | The Broad Institute, Inc. | Nucleic acid assemblies for use in targeted delivery |
| US11505578B2 (en) | 2018-09-18 | 2022-11-22 | Vnv Newco Inc. | Endogenous Gag-based capsids and uses thereof |
| US11447527B2 (en) | 2018-09-18 | 2022-09-20 | Vnv Newco Inc. | Endogenous Gag-based capsids and uses thereof |
| US12098425B2 (en) | 2018-10-10 | 2024-09-24 | Readcoor, Llc | Three-dimensional spatial molecular indexing |
| US12331320B2 (en) | 2018-10-10 | 2025-06-17 | The Research Foundation For The State University Of New York | Genome edited cancer cell vaccines |
| WO2020077236A1 (en) | 2018-10-12 | 2020-04-16 | The Broad Institute, Inc. | Method for extracting nuclei or whole cells from formalin-fixed paraffin-embedded tissues |
| WO2020081730A2 (en) | 2018-10-16 | 2020-04-23 | Massachusetts Institute Of Technology | Methods and compositions for modulating microenvironment |
| US11407995B1 (en) | 2018-10-26 | 2022-08-09 | Inari Agriculture Technology, Inc. | RNA-guided nucleases and DNA binding proteins |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12116210B2 (en) | 2018-11-01 | 2024-10-15 | Corteva Agriscience Llc | Systems and methods for manufacture of controlled release of agricultural cores |
| US11434477B1 (en) | 2018-11-02 | 2022-09-06 | Inari Agriculture Technology, Inc. | RNA-guided nucleases and DNA binding proteins |
| US12071641B2 (en) | 2018-11-02 | 2024-08-27 | Inari Agriculture Technology, Inc. | RNA-guided nucleases and DNA binding proteins |
| US12402610B2 (en) | 2018-11-09 | 2025-09-02 | The Broad Institute, Inc. | Methods and compositions for modulating innate lymphoid cell pathogenic effectors |
| US12165743B2 (en) | 2018-11-09 | 2024-12-10 | The Broad Institute, Inc. | Compressed sensing for screening and tissue imaging |
| EP3877517A1 (en) | 2018-11-09 | 2021-09-15 | Inari Agriculture, Inc. | Rna-guided nucleases and dna binding proteins |
| US12460189B2 (en) | 2018-11-09 | 2025-11-04 | Inari Agriculture Technology, Inc. | RNA-guided nucleases and DNA binding proteins |
| US11807878B2 (en) | 2018-12-14 | 2023-11-07 | Pioneer Hi-Bred International, Inc. | CRISPR-Cas systems for genome editing |
| US12215364B2 (en) | 2018-12-14 | 2025-02-04 | Pioneer Hi-Bred International, Inc. | CRISPR-cas systems for genome editing |
| US12365888B2 (en) | 2018-12-14 | 2025-07-22 | Pioneer Hi-Bred International, Inc. | CRISPR-Cas systems for genome editing |
| US10934536B2 (en) | 2018-12-14 | 2021-03-02 | Pioneer Hi-Bred International, Inc. | CRISPR-CAS systems for genome editing |
| WO2020131862A1 (en) | 2018-12-17 | 2020-06-25 | The Broad Institute, Inc. | Crispr-associated transposase systems and methods of use thereof |
| WO2020131586A2 (en) | 2018-12-17 | 2020-06-25 | The Broad Institute, Inc. | Methods for identifying neoantigens |
| US11384344B2 (en) | 2018-12-17 | 2022-07-12 | The Broad Institute, Inc. | CRISPR-associated transposase systems and methods of use thereof |
| US11739156B2 (en) | 2019-01-06 | 2023-08-29 | The Broad Institute, Inc. Massachusetts Institute of Technology | Methods and compositions for overcoming immunosuppression |
| WO2020146276A3 (en) * | 2019-01-07 | 2020-08-13 | Emendobio Inc. | Crispr compostions and methods for promoting gene editing of adenosine deaminase 2 (ada2) |
| US20220064635A1 (en) * | 2019-01-07 | 2022-03-03 | Emendobio Inc. | Crispr compositions and methods for promoting gene editing of adenosine deaminase 2 (ada2) |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| WO2020163396A1 (en) | 2019-02-04 | 2020-08-13 | The General Hospital Corporation | Adenine dna base editor variants with reduced off-target rna editing |
| WO2020163856A1 (en) | 2019-02-10 | 2020-08-13 | The J. David Gladstone Institutes, A Testamentary Trust Established Under The Will Of J. David Gladstone | Modified mitochondrion and methods of use thereof |
| US12377170B2 (en) | 2019-02-26 | 2025-08-05 | Research Institute At Nationwide Children's Hospital | Adeno-associated virus vector delivery of β-sarcoglycan and the treatment of muscular dystrophy |
| DE212020000516U1 (de) | 2019-03-07 | 2022-01-17 | The Regents of the University of California | CRISPR-CAS-Effektorpolypeptide |
| EP4219700A1 (en) | 2019-03-07 | 2023-08-02 | The Regents of the University of California | Crispr-cas effector polypeptides and methods of use thereof |
| US12534714B2 (en) | 2019-03-18 | 2026-01-27 | The Broad Institute, Inc. | Type VII CRISPR proteins and systems |
| US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12281303B2 (en) | 2019-03-19 | 2025-04-22 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11643652B2 (en) | 2019-03-19 | 2023-05-09 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12509680B2 (en) | 2019-03-19 | 2025-12-30 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11795452B2 (en) | 2019-03-19 | 2023-10-24 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| WO2020206036A1 (en) | 2019-04-01 | 2020-10-08 | The Broad Institute, Inc. | Novel nucleic acid modifier |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| WO2020225754A1 (en) | 2019-05-06 | 2020-11-12 | Mcmullen Tara | Crispr gene editing for autosomal dominant diseases |
| WO2020229533A1 (en) | 2019-05-13 | 2020-11-19 | KWS SAAT SE & Co. KGaA | Drought tolerance in corn |
| WO2020236967A1 (en) | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Random crispr-cas deletion mutant |
| WO2020236972A2 (en) | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Non-class i multi-component nucleic acid targeting systems |
| CN114555813A (zh) * | 2019-05-21 | 2022-05-27 | 国家医疗保健研究所 | 治疗雷特综合征的胆固醇24-水解酶的表达载体 |
| WO2020239680A2 (en) | 2019-05-25 | 2020-12-03 | KWS SAAT SE & Co. KGaA | Haploid induction enhancer |
| WO2020243661A1 (en) | 2019-05-31 | 2020-12-03 | The Broad Institute, Inc. | Methods for treating metabolic disorders by targeting adcy5 |
| EP3772542A1 (en) | 2019-08-07 | 2021-02-10 | KWS SAAT SE & Co. KGaA | Modifying genetic variation in crops by modulating the pachytene checkpoint protein 2 |
| US12258573B2 (en) | 2019-08-21 | 2025-03-25 | Research Institute At Nationwide Children's Hospital | Adeno-associated virus vector delivery of alpha-sarcoglycan and the treatment of muscular dystrophy |
| WO2021041922A1 (en) | 2019-08-30 | 2021-03-04 | The Broad Institute, Inc. | Crispr-associated mu transposase systems |
| WO2021055874A1 (en) | 2019-09-20 | 2021-03-25 | The Broad Institute, Inc. | Novel type vi crispr enzymes and systems |
| US11981922B2 (en) | 2019-10-03 | 2024-05-14 | Dana-Farber Cancer Institute, Inc. | Methods and compositions for the modulation of cell interactions and signaling in the tumor microenvironment |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| WO2021074367A1 (en) | 2019-10-17 | 2021-04-22 | KWS SAAT SE & Co. KGaA | Enhanced disease resistance of crops by downregulation of repressor genes |
| WO2021102084A1 (en) | 2019-11-22 | 2021-05-27 | President And Fellows Of Harvard College | Ionic liquids for drug delivery |
| WO2021150919A1 (en) | 2020-01-23 | 2021-07-29 | The Children's Medical Center Corporation | Stroma-free t cell differentiation from human pluripotent stem cells |
| US12264341B2 (en) | 2020-01-24 | 2025-04-01 | The General Hospital Corporation | CRISPR-Cas enzymes with enhanced on-target activity |
| US12312613B2 (en) | 2020-01-24 | 2025-05-27 | The General Hospital Corporation | Unconstrained genome targeting with near-PAMless engineered CRISPR-Cas9 variants |
| CN116590257A (zh) * | 2020-02-28 | 2023-08-15 | 辉大(上海)生物科技有限公司 | VI-E型和VI-F型CRISPR-Cas系统及其用途 |
| CN112410377A (zh) * | 2020-02-28 | 2021-02-26 | 中国科学院脑科学与智能技术卓越创新中心 | VI-E型和VI-F型CRISPR-Cas系统及用途 |
| US12454690B2 (en) | 2020-02-28 | 2025-10-28 | Huidagene Therapeutics (Singapore) Pte. Ltd. | Type VI-E and type VI-F CRISPR-Cas system and uses thereof |
| US12057197B2 (en) | 2020-04-03 | 2024-08-06 | Creyon Bio, Inc. | Oligonucleotide-based machine learning |
| US12400739B2 (en) | 2020-04-03 | 2025-08-26 | Creyon Bio, Inc. | Oligonucleotide-based machine learning |
| WO2021202938A1 (en) | 2020-04-03 | 2021-10-07 | Creyon Bio, Inc. | Oligonucleotide-based machine learning |
| WO2021216622A1 (en) | 2020-04-21 | 2021-10-28 | Aspen Neuroscience, Inc. | Gene editing of gba1 in stem cells and method of use of cells differentiated therefrom |
| WO2021216623A1 (en) | 2020-04-21 | 2021-10-28 | Aspen Neuroscience, Inc. | Gene editing of lrrk2 in stem cells and method of use of cells differentiated therefrom |
| WO2021224633A1 (en) | 2020-05-06 | 2021-11-11 | Orchard Therapeutics (Europe) Limited | Treatment for neurodegenerative diseases |
| US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US12031126B2 (en) | 2020-05-08 | 2024-07-09 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| WO2021239986A1 (en) | 2020-05-29 | 2021-12-02 | KWS SAAT SE & Co. KGaA | Plant haploid induction |
| US12203136B2 (en) | 2020-08-17 | 2025-01-21 | Readcoor, Llc | Methods and systems for spatial mapping of genetic variants |
| WO2022204543A1 (en) * | 2021-03-25 | 2022-09-29 | The Regents Of The University Of California | Methods and materials for treating huntington's disease |
| CN113180015A (zh) * | 2021-05-25 | 2021-07-30 | 四川省农业机械研究设计院 | 一种蚕房及三段式流水线养蚕方法 |
| US12545912B2 (en) | 2021-06-07 | 2026-02-10 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for treating usher syndrome and retinitis pigmentosa |
| WO2022266652A1 (en) * | 2021-06-18 | 2022-12-22 | Innovative Cellular Therapeutics Holdings, Ltd. | Modified cells targeting tumor ecm and therapy thereof |
| WO2023006933A1 (en) | 2021-07-30 | 2023-02-02 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
| EP4596697A2 (en) | 2021-09-28 | 2025-08-06 | Acrigen Biosciences | Compositions and methods for nucleic acid modifications |
| EP4596696A2 (en) | 2021-09-28 | 2025-08-06 | Acrigen Biosciences | Compositions and methods for nucleic acid modifications |
| US12385025B2 (en) | 2021-09-28 | 2025-08-12 | Acrigen Biosciences | Compositions and methods for nucleic acid modifications |
| WO2023059846A1 (en) | 2021-10-08 | 2023-04-13 | President And Fellows Of Harvard College | Ionic liquids for drug delivery |
| US12285497B2 (en) | 2021-10-15 | 2025-04-29 | Research Institute At Nationwide Children's Hospital | Self-complementary adeno-associated virus vector and its use in treatment of muscular dystrophy |
| WO2023081756A1 (en) | 2021-11-03 | 2023-05-11 | The J. David Gladstone Institutes, A Testamentary Trust Established Under The Will Of J. David Gladstone | Precise genome editing using retrons |
| WO2023093862A1 (en) | 2021-11-26 | 2023-06-01 | Epigenic Therapeutics Inc. | Method of modulating pcsk9 and uses thereof |
| GB202118058D0 (en) | 2021-12-14 | 2022-01-26 | Univ Warwick | Methods to increase yields in crops |
| WO2023111541A1 (en) | 2021-12-14 | 2023-06-22 | The University Of Warwick | Methods to increase yields in crops |
| EP4198124A1 (en) | 2021-12-15 | 2023-06-21 | Versitech Limited | Engineered cas9-nucleases and method of use thereof |
| WO2023115041A1 (en) | 2021-12-17 | 2023-06-22 | Sana Biotechnology, Inc. | Modified paramyxoviridae attachment glycoproteins |
| WO2023115039A2 (en) | 2021-12-17 | 2023-06-22 | Sana Biotechnology, Inc. | Modified paramyxoviridae fusion glycoproteins |
| WO2023133595A2 (en) | 2022-01-10 | 2023-07-13 | Sana Biotechnology, Inc. | Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses |
| WO2023141602A2 (en) | 2022-01-21 | 2023-07-27 | Renagade Therapeutics Management Inc. | Engineered retrons and methods of use |
| WO2023150518A1 (en) | 2022-02-01 | 2023-08-10 | Sana Biotechnology, Inc. | Cd3-targeted lentiviral vectors and uses thereof |
| WO2023150647A1 (en) | 2022-02-02 | 2023-08-10 | Sana Biotechnology, Inc. | Methods of repeat dosing and administration of lipid particles or viral vectors and related systems and uses |
| WO2024003579A1 (en) | 2022-06-30 | 2024-01-04 | University Of Newcastle Upon Tyne | Preventing disease recurrence in mitochondrial replacement therapy |
| WO2024020346A2 (en) | 2022-07-18 | 2024-01-25 | Renagade Therapeutics Management Inc. | Gene editing components, systems, and methods of use |
| WO2024044655A1 (en) | 2022-08-24 | 2024-02-29 | Sana Biotechnology, Inc. | Delivery of heterologous proteins |
| WO2024044723A1 (en) | 2022-08-25 | 2024-02-29 | Renagade Therapeutics Management Inc. | Engineered retrons and methods of use |
| WO2024042199A1 (en) | 2022-08-26 | 2024-02-29 | KWS SAAT SE & Co. KGaA | Use of paired genes in hybrid breeding |
| WO2024064838A1 (en) | 2022-09-21 | 2024-03-28 | Sana Biotechnology, Inc. | Lipid particles comprising variant paramyxovirus attachment glycoproteins and uses thereof |
| WO2024081820A1 (en) | 2022-10-13 | 2024-04-18 | Sana Biotechnology, Inc. | Viral particles targeting hematopoietic stem cells |
| WO2024119157A1 (en) | 2022-12-02 | 2024-06-06 | Sana Biotechnology, Inc. | Lipid particles with cofusogens and methods of producing and using the same |
| WO2024155830A3 (en) * | 2023-01-18 | 2024-10-03 | Fred Hutchinson Cancer Center | Viral particle producer cells with landing pad-integrated viral vectors |
| WO2024168265A1 (en) | 2023-02-10 | 2024-08-15 | Possible Medicines Llc | Aav delivery of rna guided recombination system |
| WO2024168253A1 (en) | 2023-02-10 | 2024-08-15 | Possible Medicines Llc | Delivery of an rna guided recombination system |
| WO2024220560A1 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Engineered protein g fusogens and related lipid particles and methods thereof |
| WO2024220598A2 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Lentiviral vectors with two or more genomes |
| WO2024220574A1 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Universal protein g fusogens and adapter systems thereof and related lipid particles and uses |
| WO2024243340A1 (en) | 2023-05-23 | 2024-11-28 | Sana Biotechnology, Inc. | Tandem fusogens and related lipid particles |
| WO2025049959A2 (en) | 2023-09-01 | 2025-03-06 | Renagade Therapeutics Management Inc. | Gene editing systems, compositions, and methods for treatment of vexas syndrome |
| WO2025054202A1 (en) | 2023-09-05 | 2025-03-13 | Sana Biotechnology, Inc. | Method of screening a sample comprising a transgene with a unique barcode |
| WO2025064408A1 (en) | 2023-09-18 | 2025-03-27 | The Broad Institute, Inc. | Compositions and methods for treating cardiovascular disease |
| WO2025064591A1 (en) * | 2023-09-19 | 2025-03-27 | The Regents Of The University Of California | In vivo gene editing of tau locus via liponanoparticle delivery |
| WO2025062150A1 (en) | 2023-09-22 | 2025-03-27 | The University Of Manchester | Methods of producing homoplasmic modified plants or parts thereof |
| WO2025081042A1 (en) | 2023-10-12 | 2025-04-17 | Renagade Therapeutics Management Inc. | Nickase-retron template-based precision editing system and methods of use |
| WO2025151838A1 (en) | 2024-01-12 | 2025-07-17 | Sana Biotechnology, Inc. | Safety switches to control in vitro and in vivo proliferation of cell therapy products |
| WO2025155753A2 (en) | 2024-01-17 | 2025-07-24 | Renagade Therapeutics Management Inc. | Improved gene editing system, guides, and methods |
| WO2025174765A1 (en) | 2024-02-12 | 2025-08-21 | Renagade Therapeutics Management Inc. | Lipid nanoparticles comprising coding rna molecules for use in gene editing and as vaccines and therapeutic agents |
| WO2025184529A1 (en) | 2024-03-01 | 2025-09-04 | Sana Biotechnology, Inc. | Viral particles with fusogen display and related compositions and methods |
| WO2026006542A2 (en) | 2024-06-26 | 2026-01-02 | Yale University | Compositions and methods for crispr/cas9 based reactivation of human angelman syndrome |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12252707B2 (en) | Delivery, Engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications | |
| US20210361779A1 (en) | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components | |
| US20200340015A1 (en) | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components | |
| EP3011032B1 (en) | Delivery, engineering and optimization of systems, methods and compositions for targeting and modeling diseases and disorders of post mitotic cells | |
| US20200392541A1 (en) | Delivery and use of the crispr-cas systems, vectors and compositions for hepatic targeting and therapy | |
| HK1252619B (en) | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications | |
| HK1220725B (en) | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications | |
| HK1215048B (en) | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: THE BROAD INSTITUTE, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:ZHANG, FENG;REEL/FRAME:031964/0624 Effective date: 20131210 Owner name: MASSACHUSETTS INSTITUTE OF TECHNOLOGY, MASSACHUSET Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:ZHANG, FENG;REEL/FRAME:031964/0624 Effective date: 20131210 |
|
| AS | Assignment |
Owner name: PRESIDENT AND FELLOWS OF HARVARD COLLEGE, MASSACHU Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:RAN, FEI;REEL/FRAME:034124/0526 Effective date: 20141102 |
|
| AS | Assignment |
Owner name: NATIONAL INSTITUTES OF HEALTH (NIH), U.S. DEPT. OF Free format text: CONFIRMATORY LICENSE;ASSIGNOR:BROAD INSTITUTE, INC.;REEL/FRAME:035704/0772 Effective date: 20150507 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STCV | Information on status: appeal procedure |
Free format text: NOTICE OF APPEAL FILED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |