Classifications

• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
  • C07K16/46—Hybrid immunoglobulins
  • C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
  • A61P31/12—Antivirals
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P33/00—Antiparasitic agents
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P35/00—Antineoplastic agents
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P37/00—Drugs for immunological or allergic disorders
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P37/00—Drugs for immunological or allergic disorders
  • A61P37/02—Immunomodulators
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P37/00—Drugs for immunological or allergic disorders
  • A61P37/02—Immunomodulators
  • A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P37/00—Drugs for immunological or allergic disorders
  • A61P37/08—Antiallergic agents
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
  • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
  • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
  • C07K16/2809—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
  • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
  • C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
  • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
  • C07K16/2887—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
  • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
  • C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
  • C07K16/3069—Reproductive system, e.g. ovaria, uterus, testes, prostate
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
  • C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
  • C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
  • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
  • C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
  • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
  • C07K2317/622—Single chain antibody (scFv)
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
  • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
  • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
  • C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

• NK natural killer
• CTLs cytotoxic T lymphocytes
• trispecific antigen-binding protein As nucleic acids, recombinant expression vectors and host cells for making such trispecific antigen-binding proteins, and methods of use for the treatment of diseases, disorders, or conditions.
• trispecific antigen-binding proteins wherein said proteins comprise (a) a first domain (A) which specifically binds to human CD3; (b) a second domain (B) which is a half-life extension domain; and (c) a third domain (C) which specifically binds to a target antigen, wherein the domains are linked in the order H 2 N-(A)-(B)- (C)-COOH, H 2 N-(A)-(C)-(B)-COOH, H 2 N-(B)-(A)-(C)-COOH, H 2 N-(B)-(C)-(A)-COOH, H 2 N- (C)-(B)-(A)-COOH, or H 2 N-(C)-(A)-(B)-COOH by linkers LI and L2.
• trispecific antigen-binding proteins wherein said proteins comprise (a) a first domain (A) which specifically binds to human CD3; (b) a second domain (B) which is a half-life extension domain; and (c) a third domain (C) which specifically binds to a target antigen, wherein the domains are linked in the order H 2 N-(A)-(C)- (B)-COOH, H 2 N-(B)-(A)-(C)-COOH, H 2 N-(C)-(B)-(A)-COOH, or by linkers LI and L2.
• trispecific antigen-binding proteins wherein said proteins comprise (a) a first domain (A) which specifically binds to human CD3; (b) a second domain (B) which is a half-life extension domain; and (c) a third domain (C) which specifically binds to a target antigen, wherein the domains are linked in the order H 2 N-(A)-(B)- (C)-COOH, H 2 N-(A)-(C)-(B)-COOH, H 2 N-(B)-(A)-(C)-COOH, H 2 N-(B)-(C)-(A)-COOH, H 2 N- (C)-(B)-(A)-COOH, or H 2 N-(C)-(A)-(B)-COOH by linkers LI and L2, and wherein the first domain binds to human CD3 with a KD of greater than 100 nM.
• trispecific antigen-binding proteins wherein said proteins comprise (a) a first domain (A) which specifically binds to human CD3; (b) a second domain (B) which is a half-life extension domain; and (c) a third domain (C) which specifically binds to a target antigen, wherein the domains are linked in the order H 2 N-(A)-(B)- (C)-COOH, H 2 N-(A)-(C)-(B)-COOH, H 2 N-(B)-(A)-(C)-COOH, H 2 N-(B)-(C)-(A)-COOH, H 2 N- (C)-(B)-(A)-COOH, or H 2 N-(C)-(A)-(B)-COOH by linkers LI and L2, and wherein the protein has a molecular weight of less than 55 kDa.
• trispecific antigen-binding proteins wherein said proteins comprise (a) a first domain (A) which specifically binds to human CD3; (b) a second domain (B) which is a half-life extension domain; and (c) a third domain (c) which specifically binds to a target antigen, wherein the domains are linked in the order H 2 N-(A)-(B)- (C)-COOH, H 2 N-(A)-(C)-(B)-COOH, H 2 N-(B)-(A)-(C)-COOH, H 2 N-(B)-(C)-(A)-COOH, H 2 N- (C)-(B)-(A)-COOH, or H 2 N-(C)-(A)-(B)-COOH by linkers LI and L2, and wherein B comprises a single domain antibody that binds to serum albumin.
• first domain comprises a variable light chain and variable heavy chain each of which is capable of specifically binding to human CD3.
• the variable light chain is a ⁇ (lamda) light chain.
• the variable light chain is a ⁇ (kappa) light chain.
• the first domain comprises a single-chain variable fragment (scFv) specific to human CD3.
• the first domain is specific for CD3s (epsilon).
• the first domain is specific for CD35 (delta).
• the first domain is specific for CD3y (gamma).
• the first domain comprises complementary determining regions (CDRs) selected from the group consisting of muromonab- CD3 (OKT3), otelixizumab (TRX4), teplizumab (MGA031), visilizumab (Nuvion), SP34, X35, VIT3, BMA030 (BW264/56), CLB-T3/3, CRIS7, YTH12.5, Fl 11-409, CLB-T3.4.2, TR-66, WT32, SPv-T3b, 11D8, XIII-141, XIII-46, XIII-87, 12F6, T3/RW2-8C8, T3/RW2-4B6, OKT3D, M-T301, SMC2, F101.01, UCHT-1 and WT-31.
• CDRs complementary determining regions
• the first domain is humanized or human. In some embodiments, the first domain has a KD binding of 1000 nM or less to CD3 on CD3 expressing cells. In some embodiments, the first domain has a KD binding of 100 nM or less to CD3 on CD3 expressing cells. In some embodiments, the first domain has a KD binding of 10 nM or less to CD3 on CD3 expressing cells. In some embodiments, the first domain has crossreactivity with cynomolgus CD3. In some
• the first domain comprises an amino acid sequence provided herein.
• the second domain binds human serum albumin.
• the second domain comprises a scFv, a variable heavy domain (VH), a variable light domain (VL), a single domain antibody, a peptide, a ligand, or a small molecule.
• the second domain comprises a scFv.
• the second domain comprises a VH domain.
• the second domain comprises a VL domain.
• the second domain comprises a single domain antibody.
• the second domain comprises a peptide.
• the second domain comprises a ligand.
• the second domain comprises a small molecule entity.
• the third domain comprises a scFv, a VH domain, a VL domain, a non-Ig domain, a ligand, a knottin, or a small molecule entity that specifically binds to a target antigen.
• the third domain is specific to a cell surface molecule. In some embodiments, the third domain is specific to a tumor antigen.
• linkers LI and L2 are peptide linkers. In some embodiments, linkers LI and L2 independently consist of about 20 or less amino acid residues. In some embodiments, linkers LI and L2 are each independently selected from (GS)n (SEQ ID NO: 49), (GGS)n (SEQ ID NO: 50), (GGGS)n (SEQ ID NO: 51), (GGSG)n (SEQ ID NO: 52),
• linkers LI and L2 are each independently (GGGGS)4 (SEQ ID NO: 55) or (GGGGS)3 (SEQ ID NO: 56). In some embodiments, linkers LI and L2 are chemical linkers.
• the first domain is at the N-terminus of the protein.
• the second domain is at the N-terminus of the protein.
• the third domain is at the N-terminus of the protein.
• the first domain is at the C-terminus of the protein.
• the second domain is at the C-terminus of the protein.
• the third domain is at the C-terminus of the protein.
• the protein is less than about 80 kDa. In some embodiments, the protein is about 50 to about 75 kDa. In some embodiments, the protein is less than about 50 kDa. In some embodiments, the protein is less than about 40 kDa. In some embodiments, the protein is about 20 to about 40 kDa. In some embodiments, the protein has an elimination half- time of at least about 50 hours. In some embodiments, the protein has an elimination half-time of at least about 100 hours. In some embodiments, the protein has increased tissue penetration as compared to an IgG to the same target antigen.
• polynucleotides encoding trispecific antigen- binding proteins according to any one of the above embodiments.
• vectors comprising the described polynucleotides.
• host cells transformed with the described vectors
• compositions comprising a trispecific antigen-binding protein of any of the above embodiments, a polynucleotide encoding a trispecific antigen-binding protein of any of the above embodiments, a vector comprising the described polynucleotides, or a host cell transformed with a vector of any of the above embodiments and a pharmaceutically acceptable carrier.
• processes for the production of trispecific antigen-binding proteins comprising culturing a host transformed or transfected with a vector comprising a nucleic acid sequence encoding any trispecific antigen-binding protein herein under conditions allowing the expression of the protein and recovering and purifying the produced protein from the culture.
• Also provided herein are methods for the treatment amelioration of a proliferative disease, a tumorous disease, an inflammatory disease, an immunological disorder, an autoimmune disease, an infectious disease, viral disease, allergic reactions, parasitic reactions, graft-versus-host diseases or host-versus-graft diseases comprising the administration of a trispecific antigen-binding protein of any of the above embodiments to a subject in need of such a treatment or amelioration.
• the subject is a human.
• the method further comprises administration of an agent in combination with the trispecific antigen-binding protein described herein.
• Figure 1 is schematic representation of an exemplary trispecific antigen-binding protein where the protein has an constant core element comprising an anti-CD38 single chain variable fragment (scFv) and an anti-HSA variable heavy chain region; and a variable target binding domain that can be a VH, scFv, a non-Ig binder, or ligand.
• scFv single chain variable fragment
• HSA variable heavy chain region variable target binding domain that can be a VH, scFv, a non-Ig binder, or ligand.
• Figure 2 is schematic representation of additional exemplary trispecific antigen-binding proteins constructed for optimal tissue penetration.
• Figure 2 left an exemplary trispecific antigen-binding protein comprising single domain antibody fragments for all its domains.
• Figure 2 middle an exemplary trispecific antigen-binding protein comprising a knottin that binds to a target antigen.
• Figure 2 right an exemplary trispecific antigen-binding protein comprising a natural ligand that binds to a target antigen.
• FIG. 3 is a schematic representation of attaching a small molecule entity binder to a trispecific antigen-binding protein.
• the trispecific antigen-binding protein comprises a sortase recognition sequence as its target antigen binding domain.
• the sortase ligates or conjugates the small molecule binder onto the recognition site.
• Figure discloses "LPETGG” as SEQ ID NO: 60 and "LPETG” as SEQ ID NO: 57.
• Figure 4 is schematic representation of the six different ways in which the three domains of these trispecific antigen binding molecules can be arranged.
• FIG. 5 compares the ability of BiTE molecules (EGFR targeting BiTE from
• Figure 6 shows that all six possible configurations of a trispecific molecule containing an EGFR targeting VH domain can induce T cells to kill the human tumor cell line NCI-1563.
• the experiment was performed in the absence (left side) and presence (right side) of human serum albumin with an EGFR targeting BiTE as positive control.
• FIG 7 assesses the ability of five possible configurations of a trispecific molecule containing a PSMA targeting VH domain to induce T cells to kill the human tumor cell line 22Rvl .
• the experiment was performed in the absence (left side) and presence (right side) of human serum albumin with a PSMA targeting BiTE as positive control. Also shown is the activity of a PSMA targeting trispecific molecule with a PSMA targeting scFv.
• Figure 8 shows that that the trispecific molecules can consist of a constant core element comprising an anti-CD38 single chain variable fragment (scFv) and an anti-HSA variable heavy chain region; and a variable target binding domain that can be a scFv.
• Figure 9 demonstrates that trispecific molecules that use a fynomer as opposed to an antibody derived domain for tumor targeting can induce T cells to kill tumor cells.
• FIG. 10 shows that when EGFR targeting trispecific molecules redirect T cells to kill human CaPan2 tumor cells (panel A), the T cells get activated and produce the cytokines T F- ⁇ (panel B) and ⁇ (panel C) in a manner dependent on the dose of the trispecific.
• FIG. 11 shows that when PSMA targeting trispecific molecules redirect T cells to kill human 22Rvl tumor cells (panel A), the T cells get activated and produce the cytokines TNF-a
• FIG. 12 shows that MSLN targeting trispecific molecules can migrate through matrigel faster than conventional antibodies.
• Figure 13 shows phage titration on biotin-CD38 and biotin-HSA.
• trispecific antigen-binding proteins Described herein are trispecific antigen-binding proteins, pharmaceutical compositions thereof, as well as nucleic acids, recombinant expression vectors and host cells for making such trispecific antigen-binding proteins. Also provided are methods of using the disclosed trispecific antigen-binding proteins in the prevention, and/or treatment of diseases, conditions and disorders.
• the trispecific antigen-binding proteins are capable of specifically binding to a target antigen as well as CD3 and a half-life extension domain, such as a domain binding human serum albumin (HSA).
• HSA domain binding human serum albumin
• Figure 1 depicts one non-limiting example of a trispecific antigen-binding protein.
• the trispecific antigen-binding proteins comprise a domain (A) which specifically binds to CD3, a domain (B) which specifically binds to human serum albumin (HSA), and a domain (C) which specifically binds to a target antigen.
• the three domains in trispecific antigen-binding proteins are arranged in any order.
• the domain order of the trispecific antigen-binding proteins are:
• the trispecific antigen-binding proteins have a domain order of H 2 N-(A)-(B)-(C)-COOH. In some embodiments, the trispecific antigen-binding proteins have a domain order of H 2 N-(A)-(C)-(B)-COOH. In some embodiments, the trispecific antigen- binding proteins have a domain order of H 2 N-(B)-(A)-(C)-COOH. In some embodiments, the trispecific antigen-binding proteins have a domain order of H 2 N-(B)-(C)-(A)-COOH.
• the trispecific antigen-binding proteins have a domain order of H 2 N-(C)-(B)-(A)- COOH. In some embodiments, the trispecific antigen-binding proteins have a domain order of H 2 N-(C)-(A)-(B)-COOH.
• Trispecific antigen-binding proteins described herein optionally comprise a polypeptide having a sequence described in Table 6 or Table 7 (SEQ ID NOS: 1-48) and subsequences thereof.
• the trispecific antigen binding protein comprises a polypeptide having at least 70%-95% or more homology to a sequence described in Table 6 or Table 7 (SEQ ID NOS: 1-48).
• the trispecific antigen binding protein comprises a polypeptide having at least 70%, 75%, 80%, 85%, 90%, 95%, or more homology to a sequence described in Table 6 or Table 7 (SEQ ID NO: 1-48).
• the trispecific antigen binding protein has a sequence comprising at least a portion of a sequence described in Table 6 or Table 7 (SEQ ID NOS: 1-48). In some embodiments, the trispecific antigen-binding protein comprises a polypeptide comprising one or more of the sequences described in Table 6 or Table 7 (SEQ ID NOS: 1-48).
• the trispecific antigen-binding proteins described herein are designed to allow specific targeting of cells expressing a target antigen by recruiting cytotoxic T cells. This improves efficacy compared to ADCC (antibody dependent cell-mediated cytotoxicity) , which is using full length antibodies directed to a sole antigen and is not capable of directly recruiting cytotoxic T cells. In contrast, by engaging CD3 molecules expressed specifically on these cells, the trispecific antigen-binding proteins can crosslink cytotoxic T cells with cells expressing a target antigen in a highly specific fashion, thereby directing the cytotoxic potential of the T cell towards the target cell.
• the trispecific antigen-binding proteins described herein engage cytotoxic T cells via binding to the surface-expressed CD3 proteins, which form part of the TCR.
• trispecific antigen-binding proteins are contemplated to display strong, specific and efficient target cell killing.
• the trispecific antigen-binding proteins described herein stimulate target cell killing by cytotoxic T cells to eliminate pathogenic cells (e.g., tumor cells, virally or bacterially infected cells, autoreactive T cells, etc).
• pathogenic cells e.g., tumor cells, virally or bacterially infected cells, autoreactive T cells, etc.
• cells are eliminated selectively, thereby reducing the potential for toxic side effects.
• the same polypeptides could be used to enhance the elimination of endogenous cells for therapeutic effect, such as B or T lymphocytes in autoimmune disease, or hematopoietic stem cells (HSCs) for stem cell transplantation.
• the effectiveness of recombinant protein pharmaceuticals depends heavily on the intrinsic pharmacokinetics of the protein itself.
• One such benefit here is that the trispecific antigen-binding proteins described herein have extended pharmacokinetic elimination half-time due to having a half-life extension domain such as a domain specific to HSA.
• the trispecific antigen-binding proteins described herein have an extended serum elimination half- time of about two, three, about five, about seven, about 10, about 12, or about 14 days in some embodiments. This contrasts to other binding proteins such as BiTE or DART molecules which have relatively much shorter elimination half-times.
• the BiTE CD19xCD3 bispecific scFv-scFv fusion molecule requires continuous intravenous infusion (i.v.) drug delivery due to its short elimination half-time.
• the longer intrinsic half-times of the trispecific antigen-binding proteins solve this issue thereby allowing for increased therapeutic potential such as low-dose pharmaceutical formulations, decreased periodic administration and/or novel pharmaceutical compositions.
• the trispecific antigen-binding proteins described herein also have an optimal size for enhanced tissue penetration and tissue distribution. Larger sizes limit or prevent penetration or distribution of the protein in the target tissues.
• the trispecific antigen-binding proteins described herein avoid this by having a small size that allows enhanced tissue penetration and distribution. Accordingly, the trispecific antigen-binding proteins described herein, in some embodiments have a size of about 50 kD to about 80 kD, about 50 kD to about 75 kD, about 50 kD to about 70 kD, or about 50 kD to about 65 kD.
• the size of the trispecific antigen- binding proteins is advantageous over IgG antibodies which are about 150 kD and the BiTE and DART diabody molecules which are about 55 kD but are not half-life extended and therefore cleared quickly through the kidney.
• the trispecific antigen-binding proteins described herein have an optimal size for enhanced tissue penetration and distribution.
• the trispecific antigen-binding proteins are constructed to be as small as possible, while retaining specificity toward its targets. Accordingly, in these embodiments, the trispecific antigen- binding proteins described herein have a size of about 20 kD to about 40 kD or about 25 kD to about 35 kD to about 40 kD, to about 45 kD, to about 50 kD, to about 55 kD, to about 60 kD, to about 65 kD.
• the trispecific antigen-binding proteins described herein have a size of about 50kD, 49, kD, 48 kD, 47 kD, 46 kD, 45 kD, 44 kD, 43 kD, 42 kD, 41 kD, 40 kD, about 39 kD, about 38 kD, about 37 kD, about 36 kD, about 35 kD, about 34 kD, about 33 kD, about 32 kD, about 31 kD, about 30 kD, about 29 kD, about 28 kD, about 27 kD, about 26 kD, about 25 kD, about 24 kD, about 23 kD, about 22 kD, about 21 kD, or about 20 kD.
• sdAb single domain antibody
• a particular trispecific antigen-binding protein has an anti-CD3 sdAb, anti-HSA sdAb and an sdAb for a target antigen. This reduces the size of the exemplary trispecific antigen-binding protein to under 40 kD.
• the domains of the trispecific antigen-binding proteins are all single domain antibody (sdAb) fragments.
• the trispecific antigen-binding proteins described herein comprise small molecule entity (SME) binders for HSA and/or the target antigen.
• SME binders are small molecules averaging about 500 to 2000 Da in size and are attached to the trispecific antigen-binding proteins by known methods, such as sortase ligation or conjugation.
• one of the domains of a trispecific antigen-binding protein is a sortase recognition sequence, e.g., LPETG (SEQ ID NO: 57).
• the protein is incubated with a sortase and a SME binder whereby the sortase attaches the SME binder to the recognition sequence.
• Known SME binders include MIP-1072 and MIP-1095 which bind to prostate- specific membrane antigen (PSMA).
• the domain which binds to a target antigen of a trispecific antigen-binding proteins described herein comprise a knottin peptide for binding a target antigen. Knottins are disufide-stabilized peptides with a cysteine knot scaffold and have average sizes about 3.5 kD.
• Knottins have been contemplated for binding to certain tumor molecules such as fibronectin and VEGF-receptor.
• domain which binds to a target antigen of a trispecific antigen-binding proteins described herein comprise a natural receptor ligand such as B-cell activating factor
• trispecific antigen-binding proteins described herein are of a single-polypeptide design with flexible linkage of their domains. This allows for facile production and manufacturing of the trispecific antigen-binding proteins as they can be encoded by single cDNA molecule to be easily incorporated into a vector. Further, because the trispecific antigen-binding proteins described herein are a monomelic single polypeptide chain, there are no chain pairing issues or a requirement for dimerization. It is contemplated that the trispecific antigen-binding proteins described herein have a reduced tendency to aggregate unlike other reported molecules such as bispecific proteins with Fc-gamma immunoglobulin domains.
• the domains are linked by internal linkers LI and L2, where LI links the first and second domain of the trispecific antigen- binding proteins and L2 links the second and third domains of the trispecific antigen-binding proteins.
• Linkers LI and L2 have an optimized length and/or amino acid composition. In some embodiments, linkers LI and L2 are the same length and amino acid composition. In other embodiments, LI and L2 are different.
• internal linkers LI and/or L2 are "short", i.e., consist of 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 amino acid residues. Thus, in certain instances, the internal linkers consist of about 12 or less amino acid residues.
• the internal linker is a peptide bond.
• internal linkers LI and/or L2 are "long", i.e., consist of 15, 20 or 25 amino acid residues. In some embodiments, these internal linkers consist of about 3 to about 15, for example 8, 9 or 10 contiguous amino acid residues.
• peptides are selected with properties that confer flexibility to the trispecific antigen- binding proteins, do not interfere with the binding domains as well as resist cleavage from proteases. For example, glycine and serine residues generally provide protease resistance.
• Examples of internal linkers suitable for linking the domains in the trispecific antigen-binding proteins include but are not limited to (GS) n (SEQ ID NO: 49), (GGS) n (SEQ ID NO: 50), (GGGS) n (SEQ ID NO: 51), (GGSG) n (SEQ ID NO: 52), (GGSGG) n (SEQ ID NO: 53), or (GGGGS)n (SEQ ID NO: 54), wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
• internal linker LI and/or L2 is (GGGGS) 4 (SEQ ID NO: 55) or (GGGGS) 3 (SEQ ID NO: 56).
• CD3 is a protein complex that includes a CD3y (gamma) chain, a CD35 (delta) chain, and two CD3s (epsilon) chains which are present on the cell surface.
• CD3 associates with the a (alpha) and ⁇ (beta) chains of the TCR as well as CD3 ⁇ (zeta) altogether to comprise the complete TCR.
• Clustering of CD3 on T cells, such as by immobilized anti-CD3 antibodies leads to T cell activation similar to the engagement of the T cell receptor but independent of its clone- typical specificity.
• the trispecific antigen-binding proteins described herein comprise a domain which specifically binds to CD3. In one aspect, the trispecific antigen-binding proteins described herein comprise a domain which specifically binds to human CD3. In some embodiments, the trispecific antigen-binding proteins described herein comprise a domain which specifically binds to CD3y. In some embodiments, the trispecific antigen-binding proteins described herein comprise a domain which specifically binds to CD35. In some embodiments, the trispecific antigen-binding proteins described herein comprise a domain which specifically binds to CD3s.
• the trispecific antigen-binding proteins described herein comprise a domain which specifically binds to the TCR. In certain instances, the trispecific antigen-binding proteins described herein comprise a domain which specifically binds the a chain of the TCR. In certain instances, the trispecific antigen-binding proteins described herein comprise a domain which specifically binds the ⁇ chain of the TCR.
• the CD3 binding domain of the trispecific antigen-binding proteins described herein exhibit not only potent CD3 binding affinities with human CD3, but show also excellent crossreactivity with the respective cynomolgus monkey CD3 proteins.
• the CD3 binding domain of the trispecific antigen-binding proteins are cross- reactive with CD3 from cynomolgus monkey.
• humanxynomolgous K D ratios for CD3 are between 5 and 0.2.
• the CD3 binding domain of the trispecific antigen-binding protein can be any domain that binds to CD3 including but not limited to domains from a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody.
• the antigen-binding domain comprises a humanized or human antibody or an antibody fragment, or a murine antibody or antibody fragment.
• the humanized or human anti-CD3 binding domain comprises one or more (e.g., all three) light chain complementary determining region 1 (LC CDR1), light chain
• LC CDR2 complementary determining region 2
• LC CDR3 light chain complementary determining region 3
• HC CDR3 heavy chain complementary determining region 1
• HC CDR2 heavy chain complementary determining region 2
• HC CDR3 heavy chain complementary determining region 3
• the humanized or human anti-CD3 binding domain comprises a humanized or human light chain variable region specific to CD3 where the light chain variable region specific to CD3 comprises human or non-human light chain CDRs in a human light chain framework region.
• the light chain framework region is a ⁇ (lamda) light chain framework. In other instances, the light chain framework region is a ⁇ (kappa) light chain framework.
• the humanized or human anti-CD3 binding domain comprises a humanized or human heavy chain variable region specific to CD3 where the heavy chain variable region specific to CD3 comprises human or non-human heavy chain CDRs in a human heavy chain framework region.
• the complementary determining regions of the heavy chain and/or the light chain are derived from known anti-CD3 antibodies, such as, for example, muromonab- CD3 (OKT3), otelixizumab (TRX4), teplizumab (MGA031), visilizumab (Nuvion), SP34, TR- 66 or X35-3, VIT3, BMA030 (BW264/56), CLB-T3/3, CRIS7, YTH12.5, Fl 11-409, CLB- T3.4.2, TR-66, WT32, SPv-T3b, 11D8, XIII-141, XIII-46, XIII-87, 12F6, T3/RW2-8C8, T3/RW2-4B6, OKT3D, M-T301, SMC2, F101.01, UCHT-1 and WT-31.
• known anti-CD3 antibodies such as, for example, muromonab- CD3 (OKT3), otelixizumab (TR
• the anti-CD3 binding domain is a single chain variable fragment (scFv) comprising a light chain and a heavy chain of an amino acid sequence provided herein.
• scFv single chain variable fragment
• single chain variable fragment or “scFv” refers to an antibody fragment comprising a variable region of a light chain and at least one antibody fragment comprising a variable region of a heavy chain, wherein the light and heavy chain variable regions are contiguously linked via a short flexible polypeptide linker, and capable of being expressed as a single polypeptide chain, and wherein the scFv retains the specificity of the intact antibody from which it is derived.
• the anti-CD3 binding domain comprises: a light chain variable region comprising an amino acid sequence having at least one, two or three
• modifications e.g., substitutions
• modifications e.g., substitutions
• modifications e.g., substitutions
• modifications e.g., substitutions
• modifications e.g., substitutions
• modifications e.g., substitutions
• modifications e.g., substitutions
• substitutions modifications
• a heavy chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions) of an amino acid sequence of a heavy chain variable region provided herein, or a sequence with 95-99% identity to an amino acid sequence provided herein.
• the humanized or human anti-CD3 binding domain is a scFv, and a light chain variable region comprising an amino acid sequence described herein, is attached to a heavy chain variable region comprising an amino acid sequence described herein, via a scFv linker.
• the light chain variable region and heavy chain variable region of a scFv can be, e.g., in any of the following orientations: light chain variable region- scFv linker-heavy chain variable region or heavy chain variable region- scFv linker-light chain variable region.
• scFvs which bind to CD3 are prepared according to known methods.
• scFv molecules can be produced by linking VH and VL regions together using flexible polypeptide linkers.
• the scFv molecules comprise a scFv linker (e.g., a Ser-Gly linker) with an optimized length and/or amino acid composition.
• the length of the scFv linker is such that the VH or VL domain can associate intermolecularly with the other variable domain to form the CD3 binding site.
• such scFv linkers are "short", i.e. consist of 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 amino acid residues.
• the scFv linkers consist of about 12 or less amino acid residues. In the case of 0 amino acid residues, the scFv linker is a peptide bond. In some embodiments, these scFv linkers consist of about 3 to about 15, for example 8, 9 or 10 contiguous amino acid residues. Regarding the amino acid composition of the scFv linkers, peptides are selected that confer flexibility, do not interfere with the variable domains as well as allow inter-chain folding to bring the two variable domains together to form a functional CD3 binding site. For example, scFv linkers comprising glycine and serine residues generally provide protease resistance.
• linkers in a scFv comprise glycine and serine residues.
• the amino acid sequence of the scFv linkers can be optimized, for example, by phage-display methods to improve the CD3 binding and production yield of the scFv.
• Examples of peptide scFv linkers suitable for linking a variable light chain domain and a variable heavy chain domain in a scFv include but are not limited to (GS) compassion (SEQ ID NO: 49), (GGS) context (SEQ ID NO: 50), (GGGS) structuri (SEQ ID NO: 51), (GGSG) n (SEQ ID NO: 52), (GGSGG) n (SEQ ID NO: 53), or (GGGGS) n (SEQ ID NO: 54), wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
• the scFv linker can be (GGGGS) 4 (SEQ ID NO: 55) or (GGGGS) 3 (SEQ ID NO: 56). Variation in the linker length may retain or enhance activity, giving rise to superior efficacy in activity studies.
• CD3 binding domain of a trispecific antigen-binding protein has an affinity to CD3 on CD3 expressing cells with a K D of 1000 nM or less, 500 nM or less, 200 nM or less, 100 nM or less, 80 nM or less, 50 nM or less, 20 nM or less, 10 nM or less, 5 nM or less, 1 nM or less, or 0.5 nM or less.
• the CD3 binding domain of a trispecific antigen-binding protein has an affinity to CD3s, ⁇ , or ⁇ with a K D of 1000 nM or less, 500 nM or less, 200 nM or less, 100 nM or less, 80 nM or less, 50 nM or less, 20 nM or less, 10 nM or less, 5 nM or less, 1 nM or less, or 0.5 nM or less.
• CD3 binding domain of a trispecific antigen-binding protein has low affinity to CD3, i.e., about 100 nM or greater.
• the affinity to bind to CD3 can be determined, for example, by the ability of the trispecific antigen-binding protein itself or its CD3 binding domain to bind to CD3 coated on an assay plate; displayed on a microbial cell surface; in solution; etc.
• the binding activity of the trispecific antigen-binding protein itself or its CD3 binding domain of the present disclosure to CD3 can be assayed by immobilizing the ligand (e.g., CD3) or the trispecific antigen-binding protein itself or its CD3 binding domain, to a bead, substrate, cell, etc.
• Agents can be added in an appropriate buffer and the binding partners incubated for a period of time at a given temperature. After washes to remove unbound material, the bound protein can be released with, for example, SDS, buffers with a high pH, and the like and analyzed, for example, by Surface Plasmon Resonance (SPR).
• SPR Surface Plasmon Resonance
• domains which extend the half-life of an antigen-binding domain. Such domains are contemplated to include but are not limited to HSA binding domains, Fc domains, small molecules, and other half-life extension domains known in the art.
• HSA Human serum albumin
• Noncovalent association with albumin extends the elimination half-time of short lived proteins.
• a recombinant fusion of an albumin binding domain to a Fab fragment resulted in an in vivo clearance of 25- and 58-fold and a half-life extension of 26- and 37-fold when administered intravenously to mice and rabbits respectively as compared to the
• the trispecific antigen-binding proteins described herein comprise a half- life extension domain, for example a domain which specifically binds to HSA.
• the HSA binding domain of a trispecific antigen-binding protein can be any domain that binds to HSA including but not limited to domains from a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody.
• the HSA binding domain is a single chain variable fragments (scFv), single- domain antibody such as a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain (VHH) of camelid derived single domain antibody, peptide, ligand or small molecule entity specific for HSA.
• the HSA binding domain is a single-domain antibody.
• the HSA binding domain is a peptide.
• the HSA binding domain is a small molecule.
• the HSA binding domain of a trispecific antigen-binding protein is fairly small and no more than 25 kD, no more than 20 kD, no more than 15 kD, or no more than 10 kD in some embodiments. In certain instances, the HSA binding is 5 kD or less if it is a peptide or small molecule entity.
• the half-life extension domain of a trispecific antigen-binding protein provides for altered pharmacodynamics and pharmacokinetics of the trispecific antigen-binding protein itself. As above, the half-life extension domain extends the elimination half-time. The half-life extension domain also alters pharmacodynamic properties including alteration of tissue distribution, penetration, and diffusion of the trispecific antigen-binding protein. In some embodiments, the half-life extension domain provides for improved tissue (including tumor) targeting, tissue distribution, tissue penetration, diffusion within the tissue, and enhanced efficacy as compared with a protein without an half-life extension domain. In one embodiment, therapeutic methods effectively and efficiently utilize a reduced amount of the trispecific antigen-binding protein, resulting in reduced side effects, such as reduced non-tumor cell cytotoxicity.
• the binding affinity of the half-life extension domain can be selected so as to target a specific elimination half-time in a particular trispecific antigen-binding protein.
• the half-life extension domain has a high binding affinity.
• the half-life extension domain has a medium binding affinity.
• the half-life extension domain has a low or marginal binding affinity.
• Exemplary binding affinities include K D concentrations at 10 nM or less (high), between 10 nM and 100 nM (medium), and greater than 100 nM (low).
• binding affinities to HSA are determined by known methods such as Surface Plasmon Resonance (SPR).
• the trispecific antigen- binding proteins described herein also comprise a domain that binds to a target antigen.
• a target antigen is involved in and/or associated with a disease, disorder or condition.
• a target antigen is a tumor antigen expressed on a tumor cell.
• a target antigen is associated with a pathogen such as a virus or bacterium.
• a target antigen is a cell surface molecule such as a protein, lipid or polysaccharide. In some embodiments, a target antigen is a on a tumor cell, virally infected cell, bacterially infected cell, damaged red blood cell, arterial plaque cell, or fibrotic tissue cell.
• the design of the trispecific antigen-binding proteins described herein allows the binding domain to a target antigen to be flexible in that the binding domain to a target antigen can be any type of binding domain, including but not limited to, domains from a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody.
• the binding domain to a target antigen is a single chain variable fragments (scFv), single-domain antibody such as a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain (VHH) of camelid derived single domain antibody.
• the binding domain to a target antigen is a non-Ig binding domain, i.e., antibody mimetic, such as anticalins, affilins, affibody molecules, affimers, affitins, alphabodies, avimers, DARPins, fynomers, kunitz domain peptides, and monobodies.
• antibody mimetic such as anticalins, affilins, affibody molecules, affimers, affitins, alphabodies, avimers, DARPins, fynomers, kunitz domain peptides, and monobodies.
• the binding domain to a target antigen is a ligand or peptide that binds to or associates with a target antigen.
• the binding domain to a target antigen is a knottin.
• the binding domain to a target antigen is a small molecular entity.
• the trispecific antigen-binding proteins described herein encompass derivatives or analogs in which (i) an amino acid is substituted with an amino acid residue that is not one encoded by the genetic code, (ii) the mature polypeptide is fused with another compound such as polyethylene glycol, or (iii) additional amino acids are fused to the protein, such as a leader or secretory sequence or a sequence for purification of the protein.
• Typical modifications include, but are not limited to, acetylation, acylation, ADP- ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphatidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent crosslinks, formation of cystine, formation of pyroglutamate, formylation, gamma carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination.
• Modifications are made anywhere in trispecific antigen-binding proteins described herein, including the peptide backbone, the amino acid side-chains, and the amino or carboxyl termini.
• Certain common peptide modifications that are useful for modification of trispecific antigen-binding proteins include glycosylation, lipid attachment, sulfation, gamma- carboxylation of glutamic acid residues, hydroxylation, blockage of the amino or carboxyl group in a polypeptide, or both, by a covalent modification, and ADP-ribosylation.
• polynucleotide molecules encoding a trispecific antigen-binding protein described herein.
• the polynucleotide molecules are provided as a DNA construct.
• the polynucleotide molecules are provided as a messenger RNA transcript.
• the polynucleotide molecules are constructed by known methods such as by combining the genes encoding the three binding domains either separated by peptide linkers or, in other embodiments, directly linked by a peptide bond, into a single genetic construct operably linked to a suitable promoter, and optionally a suitable transcription terminator, and expressing it in bacteria or other appropriate expression system such as, for example CHO cells.
• the polynucleotides contain genes encoding the CD3 binding domain and the half-life extension domain.
• the polynucleotides contain genes encoding the domains that bind to CD3 and the target antigen.
• any number of suitable transcription and translation elements including constitutive and inducible promoters, may be used.
• the promoter is selected such that it drives the expression of the polynucleotide in the respective host cell.
• the polynucleotide is inserted into a vector, preferably an expression vector, which represents a further embodiment.
• This recombinant vector can be constructed according to known methods.
• Vectors of particular interest include plasmids, phagemids, phage derivatives, virii (e.g., retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, lentiviruses, and the like), and cosmids.
• a variety of expression vector/host systems may be utilized to contain and express the polynucleotide encoding the polypeptide of the described trispecific antigen-binding protein.
• Examples of expression vectors for expression in E.coli are pSKK (Le Gall et al., J Immunol Methods. (2004) 285(1): 111-27) or pcDNA5 (Invitrogen) for expression in mammalian cells.
• the trispecific antigen-binding proteins as described herein are produced by introducing a vector encoding the protein as described above into a host cell and cultunng said host cell under conditions whereby the protein domains are expressed, may be isolated and, optionally, further purified.
• compositions comprising a trispecific antigen-binding protein described herein, a vector comprising the polynucleotide encoding the polypeptide of the trispecific antigen-binding proteins or a host cell transformed by this vector and at least one pharmaceutically acceptable carrier.
• pharmaceutically acceptable carrier includes, but is not limited to, any carrier that does not interfere with the effectiveness of the biological activity of the ingredients and that is not toxic to the patient to whom it is administered. Examples of suitable pharmaceutical carriers are well known in the art and include phosphate buffered saline solutions, water, emulsions, such as oil/water emulsions, various types of wetting agents, sterile solutions etc.
• compositions are sterile.
• compositions may also contain adjuvants such as preservative, emulsifying agents and dispersing agents. Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents.
• the trispecific antigen- binding protein described herein is encapsulated in nanoparticles.
• the nanoparticles are fullerenes, liquid crystals, liposome, quantum dots, superparamagnetic nanoparticles, dendrimers, or nanorods.
• the pharmaceutical compositions are encapsulated in nanoparticles.
• the nanoparticles are fullerenes, liquid crystals, liposome, quantum dots, superparamagnetic nanoparticles, dendrimers, or nanorods.
• the trispecific antigen-binding protein is attached to liposomes.
• the trispecific antigen-binding protein are conjugated to the surface of liposomes.
• the trispecific antigen-binding protein are encapsulated within the shell of a liposome.
• the liposome is a cationic liposome.
• the trispecific antigen-binding proteins described herein are contemplated for use as a medicament.
• Administration is effected by different ways, e.g. by intravenous, intraperitoneal, subcutaneous, intramuscular, topical or intradermal administration.
• the route of administration depends on the kind of therapy and the kind of compound contained in the pharmaceutical composition.
• the dosage regimen will be determined by the attending physician and other clinical factors. Dosages for any one patient depends on many factors, including the patient ' s size, body surface area, age, sex, the particular compound to be administered, time and route of administration, the kind of therapy, general health and other drugs being administered concurrently.
• An "effective dose” refers to amounts of the active ingredient that are sufficient to affect the course and the severity of the disease, leading to the reduction or remission of such pathology and may be determined using known methods.
• kits and uses for stimulating the immune system of an individual in need thereof comprising administration of a trispecific antigen-binding protein described herein.
• the administration of a trispecific antigen-binding protein described herein induces and/or sustains cytotoxicity towards a cell expressing a target antigen.
• the cell expressing a target antigen is a cancer or tumor cell, a virally infected cell, a bacterially infected cell, an autoreactive T or B cell, damaged red blood cells, arterial plaques, or fibrotic tissue.
• Diseases, disorders or conditions associated with a target antigen include, but are not limited to, viral infection, bacterial infection, auto-immune disease, transplant rejection, atherosclerosis, or fibrosis.
• the disease, disorder or condition associated with a target antigen is a proliferative disease, a tumorous disease, an inflammatory disease, an immunological disorder, an autoimmune disease, an infectious disease, a viral disease, an allergic reaction, a parasitic reaction, a graft-versus-host disease or a host-versus-graft disease.
• the disease, disorder or condition associated with a target antigen is cancer.
• the cancer is a hematological cancer.
• the cancer is a solid tumor cancer.
• treatment or “treating” or “treated” refers to therapeutic treatment wherein the object is to slow (lessen) an undesired physiological condition, disorder or disease, or to obtain beneficial or desired clinical results.
• beneficial or desired clinical results include, but are not limited to, alleviation of symptoms; diminishment of the extent of the condition, disorder or disease; stabilization (i.e., not worsening) of the state of the condition, disorder or disease; delay in onset or slowing of the progression of the condition, disorder or disease; amelioration of the condition, disorder or disease state; and remission (whether partial or total), whether detectable or undetectable, or enhancement or improvement of the condition, disorder or disease.
• Treatment includes eliciting a clinically significant response without excessive levels of side effects. Treatment also includes prolonging survival as compared to expected survival if not receiving treatment.
• treatment or “treating” or “treated” refers to prophylactic measures, wherein the object is to delay onset of or reduce severity of an undesired physiological condition, disorder or disease, such as, for example is a person who is predisposed to a disease (e.g., an individual who carries a genetic marker for a disease such as breast cancer).
• the trispecific antigen-binding proteins are administered in combination with an agent for treatment of the particular disease, disorder or condition.
• Agents include but are not limited to, therapies involving antibodies, small molecules (e.g., chemotherapeutics), hormones (steroidal, peptide, and the like), radiotherapies ( ⁇ -rays, X-rays, and/or the directed delivery of radioisotopes, microwaves, UV radiation and the like), gene therapies (e.g., antisense, retroviral therapy and the like) and other immunotherapies.
• the trispecific antigen-binding proteins are examples of antibodies, small molecules (e.g., chemotherapeutics), hormones (steroidal, peptide, and the like), radiotherapies ( ⁇ -rays, X-rays, and/or the directed delivery of radioisotopes, microwaves, UV radiation and the like), gene therapies (e.g., antisense, retroviral therapy and the like) and other immunotherapies.
• the trispecific antigen- binding proteins are administered before, during, or after surgery.
• “elimination half-time” is used in its ordinary sense, as is described in Goodman and Gillman's The Pharmaceutical Basis of Therapeutics 21-25 (Alfred Goodman Gilman, Louis S. Goodman, and Alfred Gilman, eds., 6th ed. 1980). Briefly, the term is meant to encompass a quantitative measure of the time course of drug elimination.
• the elimination of most drugs is exponential (i.e., follows first-order kinetics), since drug concentrations usually do not approach those required for saturation of the elimination process.
• the rate of an exponential process may be expressed by its rate constant, k, which expresses the fractional change per unit of time, or by its half-time, ti /2 the time required for 50% completion of the process.
• the units of these two constants are time -1 and time, respectively.
• a first-order rate constant and the half- time of the reaction are simply related and may be interchanged accordingly. Since first-order elimination kinetics dictates that a constant fraction of drug is lost per unit time, a plot of the log of drug concentration versus time is linear at all times following the initial distribution phase (i.e. after drug absorption and distribution are complete). The half-time for drug elimination can be accurately determined from such a graph.
• Example 1 Construction of an Exemplary Trispecific Anti en -binding Protein to CD20
• the human CD3s chain canonical sequence is Uniprot Accession No. P07766.
• the human CD3y chain canonical sequence is Uniprot Accession No. P09693.
• the human CD35 chain canonical sequence is Uniprot Accession No. P043234.
• Antibodies against CD3s, CD3y or CD35 are generated via known technologies such as affinity maturation. Where murine anti- CD3 antibodies are used as a starting material, humanization of murine anti-CD3 antibodies is desired for the clinical setting, where the mouse-specific residues may induce a human-anti- mouse antigen (HAMA) response in subjects who receive treatment of a trispecific antigen- binding protein described herein.
• HAMA human-anti- mouse antigen
• Humanization is accomplished by grafting CDR regions from murine anti-CD3 antibody onto appropriate human germline acceptor frameworks, optionally including other modifications to CDR and/or framework regions.
• antibody and antibody fragment residue numbering follows Kabat (Kabat E. A. et al, 1991; Chothia et al, 1987).
• Human or humanized anti-CD3 antibodies are therefore used to generate scFv sequences for CD3 binding domains of a trispecific antigen-binding protein.
• DNA sequences coding for human or humanized VL and VH domains are obtained, and the codons for the constructs are, optionally, optimized for expression in cells from Homo sapiens.
• VL and VH domains appear in the scFv is varied (i.e., VL-VH, or VH-VL orientation), and three copies of the "G4S" (SEQ ID NO: 58) or "G 4 S” (SEQ ID NO: 58) subunit (G 4 S) 3 (SEQ ID NO: 56) connect the variable domains to create the scFv domain.
• Anti-CD3 scFv plasmid constructs can have optional Flag, His or other affinity tags, and are electroporated into HEK293 or other suitable human or mammalian cell lines and purified.
• Validation assays include binding analysis by FACS, kinetic analysis using Proteon, and staining of CD3 -expressing cells.
• CD20 is one of the cell surface proteins present on B-lymphocytes.
• CD20 antigen is found in normal and malignant pre-B and mature B lymphocytes, including those in over 90% of B-cell non-Hodgkin's lymphomas (NHL).
• the antigen is absent in hematopoetic stem cells, activated B lymphocytes (plasma cells) and normal tissue.
• hematopoetic stem cells activated B lymphocytes (plasma cells) and normal tissue.
• a scFv binding domain to CD20 is generated similarly to the above method for generation of a scFv binding domain to CD3.
• the anti-CD3 scFv domains are used to construct a trispecific antigen-binding protein in combination with an anti-CD20 scFv domain and a HSA binding domain (e.g, a peptide or VH domain), with the domains organized as shown Figure 1.
• a trispecific antigen-binding protein in CHO cells, coding sequences of all protein domains are cloned into a mammalian expression vector system.
• gene sequences encoding the CD3 binding domain, HSA binding domain, and CD20 binding domain along with peptide linkers LI and L2 are separately synthesized and subcloned.
• All expression constructs are designed to contain coding sequences for an N-terminal signal peptide and a C-terminal hexahistidine (6xHis)-tag (SEQ ID NO: 59) to facilitate protein secretion and purification, respectively.
• a CHO cell expression system (Flp-In®, Life Technologies), a derivative of CHO-K1 Chinese Hamster ovary cells (ATCC, CCL-61) (Kao and Puck, Proc. Natl. Acad Sci USA 1968;60(4): 1275-81), is used. Adherent cells are subcultured according to standard cell culture protocols provided by Life Technologies.
• Recombinant CHO cell lines stably expressing secreted trispecific antigen-binding proteins are generated by transfection of suspension-adapted cells. During selection with the antibiotic Hygromycin B viable cell densities are measured twice a week, and cells are centrifuged and resuspended in fresh selection medium at a maximal density of 0. lxlO 6 viable cells/mL. Cell pools stably expressing trispecific antigen-binding proteins are recovered after 2- 3 weeks of selection at which point cells are transferred to standard culture medium in shake flasks. Expression of recombinant secreted proteins is confirmed by performing protein gel electrophoresis or flow cytometry. Stable cell pools are cryopreserved in DMSO containing medium.
• Trispecific antigen-binding proteins are produced in 10-day fed-batch cultures of stably transfected CHO cell lines by secretion into the cell culture supernatant.
• Cell culture supematants are harvested after 10 days at culture viabilities of typically >75%. Samples are collected from the production cultures every other day and cell density and viability are assessed. On day of harvest, cell culture supematants are cleared by centrifugation and vacuum filtration before further use.
• Protein expression titers and product integrity in cell culture supematants are analyzed by SDS-PAGE.
• Trispecific antigen-binding proteins are purified from CHO cell culture supematants in a two-step procedure. The constructs are subjected to affinity chromatography in a first step followed by preparative size exclusion chromatography (SEC) on Superdex 200 in a second step. Samples are buffer-exchanged and concentrated by ultrafiltration to a typical concentration of >1 mg/mL. Purity and homogeneity (typically >90%) of final samples are assessed by SDS PAGE under reducing and non-reducing conditions, followed by immunoblotting using an anti- HSA or anti idiotype antibody as well as by analytical SEC, respectively. Purified proteins are stored at aliquots at -80°C until use.
• Example 2 Determination of antigen affinity by flow cytometry
• Example 1 The trispecific antigen-binding proteins of Example 1 are tested for their binding affinities to human CD3 + and CD20 + cells and cynomolgus CD3 + and CD20 + cells.
• CD3 + and CD20 + cells are incubated with 100 ⁇ . of serial dilutions of the trispecific antigen-binding proteins of Example 1. After washing three times with FACS buffer the cells are incubated with 0.1 mL of 10 ⁇ g/mL mouse monoclonal anti -idiotype antibody in the same buffer for 45 min on ice. After a second washing cycle, the cells are incubated with 0.1 mL of 15 ⁇ g/mL FITC-conjugated goat anti -mouse IgG antibodies under the same conditions as before.
• cells are incubated with the anti-His IgG followed by the FITC-conjugated goat anti-mouse IgG antibodies without the trispecific antigen-binding proteins.
• the cells were then washed again and resuspended in 0.2 mL of FACS buffer containing 2 ⁇ g/mL propidium iodide (PI) in order to exclude dead cells.
• PI propidium iodide
• the fluorescence of lxlO 4 living cells is measured using a Beckman-Coulter FC500 MPL flow cytometer using the MXP software (Beckman- Coulter, Krefeld, Germany) or a Millipore Guava EasyCyte flow cytometer using the Incyte software (Merck Millipore, Schwalbach, Germany).
• Mean fluorescence intensities of the cell samples are calculated using CXP software (Beckman-Coulter, Krefeld, Germany) or Incyte software (Merck Millipore, Schwalbach, Germany). After subtracting the fluorescence intensity values of the cells stained with the secondary and tertiary reagents alone the values are them used for calculation of the K D values with the equation for one-site binding (hyperbola) of the GraphPad Prism (version 6.00 for Windows, GraphPad Software, La Jolla California USA).
• CD3 binding affinity and crossreactivity are evaluated in titration and flow cytometric experiments on CD3 + Jurkat cells and the cynomolgus CD3 + HSC-F cell line (JCRB, cat.: JCRBl 164).
• CD20 binding and crossreactivity are assessed on the human CD20 + tumor cell lines.
• the K D ratio of crossreactivity is calculated using the K D values determined on the CHO cell lines expressing either recombinant human or recombinant cynomolgus antigens.
• the trispecific antigen-binding protein of Example 1 is evaluated in vitro on its mediation of T cell dependent cytotoxicity to CD20 + target cells.
• Fluorescence labeled CD20 + REC-1 cells (a Mantle cell lymphoma cell line, ATCC CRL-3004) are incubated with isolated PBMC of random donors or CB15 T-cells (standardized T-cell line) as effector cells in the presence of the trispecific antigen-binding protein of Example 1. After incubation for 4 h at 37°C. in a humidified incubator, the release of the fluorescent dye from the target cells into the supernatant is determined in a spectrofluorimeter. Target cells incubated without the trispecific antigen-binding protein of Example land target cells totally lysed by the addition of saponin at the end of the incubation serve as negative and positive controls, respectively.
• the percentage of specific cell lysis is calculated according to the following formula: [1 -(number of living targetS( Sam pie ) /number of living targetS( S pontaneous))] x 100%.
• Sigmoidal dose response curves and EC50 values are calculated by non-linear regression/4-parameter logistic fit using the GraphPad Software. The lysis values obtained for a given antibody concentration are used to calculate sigmoidal dose- response curves by 4 parameter logistic fit analysis using the Prism software.
• Example 1 The trispecific antigen-binding protein of Example 1 is evaluated for half-time elimination in animal studies.
• the trispecific antigen-binding protein is administered to cynomolgus monkeys as a 0.5 mg/kg bolus injection intramuscularly.
• Another cynomolgus monkey group receives a comparable protein in size with binding domains to CD3 and CD20, but lacking HSA binding.
• a third and fourth group receive a protein with CD3 and HSA binding domains and a protein with CD20 and HSA binding domains respectively, and both comparable in size to the trispecific antigen-binding protein.
• Each test group consists of 5 monkeys. Serum samples are taken at indicated time points, serially diluted, and the concentration of the proteins is determined using a binding ELISA to CD3 and/or CD20.
• Pharmacokinetic analysis is performed using the test article plasma concentrations.
• Group mean plasma data for each test article conforms to a multi -exponential profile when plotted against the time post-dosing.
• the data are fit by a standard two-compartment model with bolus input and first-order rate constants for distribution and elimination phases.
• the a-phase is the initial phase of the clearance and reflects distribution of the protein into all extracellular fluid of the animal, whereas the second or ⁇ -phase portion of the decay curve represents true plasma clearance.
• the trispecific antigen-binding protein of Example 1 has improved pharmacokinetic parameters such as an increase in elimination half-time as compared to proteins lacking an HSA binding domain.
• Example 1 The trispecific antigen-binding protein of Example 1 is evaluated in a xenograft model.
• mice Female immune-deficient NOD/scid mice are sub-lethally irradiated (2 Gy) and subcutaneously inoculated with 4xl0 6 Ramos RA1 cells into their the right dorsal flank. When tumors reach 100 to 200 mm 3 , animals are allocated into 3 treatment groups. Groups 2 and 3 (8 animals each) are intraperitoneally injected with 1.5xl0 7 activated human T-cells. Three days later, animals from Group 3 are subsequently treated with a total of 9 intravenous doses of 50 ⁇ g trispecific antigen-binding protein of Example 1 (qdx9d). Groups 1 and 2 are only treated with vehicle. Body weight and tumor volume are determined for 30 days.
• Example 6 Proof-of-Concept Clinical Trial Protocol for Administration of the Trispecific Antigen-binding Protein of Example 1 to B-cell Lymphoma Patients
• MTD maximum tolerated dose
• the goal is to identify the highest dose of trispecific antigen-binding protein of Example 1 that can be administered safely without severe or unmanageable side effects in participants.
• the dose given will depend on the number of participants who have been enrolled in the study prior and how well the dose was tolerated. Not all participants will receive the same dose.
• a subsequent phase II section will be treated at the MTD with a goal of determining if therapy with therapy of trispecific antigen-binding protein of Example 1 results in at least a 20% response rate.
• Example 7 Methods to assess binding and cytotoxic activities of trispecific antigen binding molecules
• Trispecific proteins were subsequently polished by ion exchange or, alternatively, concentrated with Amicon Ultra centrifugal filtration units (EMD Millipore), applied to Superdex 200 size exclusion media (GE Healthcare) and resolved in a neutral buffer containing excipients. Fraction pooling and final purity were assessed by SDS-PAGE and analytical SEC.
• PSMA affinities were measured by loading human PSMA-Fc protein (100 nM) onto anti-human IgG Fc biosensors for 120 seconds, followed by a 60 second baseline, after which associations were measured by incubating the sensor tip in a dilution series of the trispecific molecules for 180 seconds, followed by dissociation for 50 seconds.
• EGFR and CD3 affinities were measured by loading human EGFR-Fc protein or human CD3-Flag-Fc protein,
• a human T-cell dependent cellular cytotoxicity (TDCC) assay is used to measure the ability of T cell engagers, including trispecific molecules, to direct T cells to kill tumor cells (Nazarian et al. 2015. J Biomol Screen. 20:519-27).
• T cells and target cancer cell line cells are mixed together at a 10: 1 ratio in a 384 wells plate, and varying amounts of T cell engager are added. After 48 hours, the T cells are washed away leaving attached to the plate target cells that were not killed by the T cells. To quantitate the remaining viable cells,
• AlphaLISA assays Perkin Elmer for T F alpha and Interferon gamma are used to obtain evidence that T cells are activated by tnspecific molecules in the presence of target cells.
• T F alpha and Interferon gamma are activated by tnspecific molecules in the presence of target cells.
• primary human T cells and human tumor cells are incubated in the presence of test molecules as described under cytotoxicity assays. After 48 h of incubation, 2 microliter aliquots of the assay supernatants are analyzed according to the manufacturer's instructions.
• a layer of Matrigel was added to 24 well Transwell inserts (0.4 ⁇ ), after which PBS was added to the upper and lower chambers (100 and 1025 ⁇ ⁇ , respectively) and equilibrated overnight at 4°C. 100 pmol of IgG or Fab (goat anti -human Fc, Jackson
• IgG and Fab were captured by donkey anti -goat IgG (Jackson ImmunoResearch) that had been immobilized on ELISA plates, and were detected with a horseradish peroxidase conjugated donkey anti -goat IgG (Jackson ImmunoResearch) and TMB development.
• Trispecific molecules were captured by human serum albumin (Athens Research & Technology) that had been immobilized on ELISA plates, and were detected with a horseradish peroxidase conjugated anti-His antibody (Genscript) and TMB development.
• Example 8 Affinity measurements for EGFR targeting trispecific molecules
• Trispecific molecules in which the EGFR binding domain is located at the N-terminus of the molecule showed significantly higher affinities to EGFR, compared to trispecific molecules that contained the EGFR binding domain in the center or in the C-terminal position.
• the trispecific molecules containing the albumin binding domain at the N-terminus also exhibited higher affinities to HSA than those containing albumin in the middle or C- terminal positions.
• all trispecific molecules exhibited very similar affinities to human CD3, independent of the position of the binding domain within the trispecific molecule.
• Example 9 Affinity measurements for PSMA targeting trispecific molecules
• Trispecific molecules containing the albumin binding domain at the N-terminus had higher affinities to HSA than those containing the albumin binding domain in the middle or C- terminal positions.
• the position of the CD3 binding domain did not affect the affinity for its target.
• the position of the PSMA binding domain had little impact on affinity, with all trispecific molecules having affinities for human PSMA within 3-fold of each other.
• Trispecific molecules were tested in T cell dependent cytotoxicity (TDCC) assays for their ability to induce primary human T cells to kill human tumor cells in a tumor target dependent manner.
• TDCC T cell dependent cytotoxicity
• Trispecific molecules containing single domain antibody derived tumor targeting domains against EGFR or PSMA can induce potent cell killing in a manner comparable to bispecific T cell engagers (BiTE), see Figure 5.
• the TDCC assay was also performed with the addition of 15 mg/ml human serum albumin to assess the impact of albumin binding on the TDCC activity of the trispecific molecules.
• the potency of the EGFR BiTE which lacks an albumin binding domain, was similar in the absence or presence of albumin.
• the potencies of the trispecific molecules decreased in the presence of albumin, but the amount of the decrease was dependent on the configuration of the molecule.
• the configurations whose potencies decreased the least in the presence of albumin were the EGFR-scFv:C:A and E:A:C (anti-EGFR-scFv:anti-CD3E- scFv:anti-ALB-sdAb and anti-EGFR-sdAb:anti-ALB-sdAb:anti-CD3E-scFv).
• PSMA targeting trispecific molecules had similar activity to the PSMA BiTE in the TDCC assay except for a trispecific molecule with a A:C:P configuration (anti-PSMA-sdAb:anti-CD3E-scFv:anti-ALB-sdAb).
• These trispecific molecules were also tested in a TDCC assay containing 15 mg/ml human serum albumin to assess the impact of albumin binding on the TDCC activity of the trispecific molecules.
• the potency of the PSMA BiTE which lacks an albumin binding domain, was similar in the absence or presence of albumin.
• the potencies of the trispecific molecules decreased in the presence of albumin, but the amount of the decrease was dependent on the configuration of the molecule.
• the configurations whose potency decreased the least in the presence of albumin was the P:A:C (anti-PSMA-sdAb:anti-ALB-sdAb:anti-CD3E-scFv).
• the trispecific molecules described here can utilize various modalities to target tumor cells.
• Figures 5, 6 and 7 show trispecific molecules with sdAb derived tumor targeting domains
• Figures 7 and 8 show that trispecific molecules with a scFv derived tumor binding domain can work equally well.
• Figure 9 demonstrates that the tumor targeting domain is not limited to constructs derived from antibodies like sdAbs and scFvs, but that non-immunoglobulin domains can also work.
• a 7 kDa fynomer specific to Her2 is used to redirect resting human T cells to kill the human ovarian cancer cells.
• the trispecific molecules analyzed here are smaller than conventional IgG molecules, and hence are expected to diffuse faster and penetrate tissues better than monoclonal antibodies.
• a diffusion/migration assay through matrigel was developed to assess this property.
• transwell assay plates were coated with matrigel, a gelatinous protein mixture resembling the complex extracellular environment found in many tissues.
• Trispecific molecules, full length IgG or Fab fragments were added to the upper chamber. After eight and 12 hours, the lower chamber was assessed for the amount of macromolecule able to migrate through the matrix. As shown in Figure 12, the trispecific molecules migrated at both time points at a rater much faster than full length IgG molecules.
• Example 13 Identification of anti-CD3 scFv variants with varying affinities for human CD3e Characterization of Parental anti-CD 3 ⁇ Phage
• the parental anti-CD38 showed good binding to biotin-CD38 and low binding to biotin-HSA ( Figure 13).
• a single substitution library was provided for the heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3 domains. Residues were varied one at a time via mutagensis.
• Biotinylated hu-CD3 was used as the round 2 selection target, and washed for 3 hours after binding of both libraries ( ⁇ 2x selection). PCRed inserts from the second round of selection were subcloned into the pcDNA3.4 His6 expression vector. 180 clones were picked and DNA was purified, sequenced, and transfected into Expi293. A panel of sixteen clones with a range of affinities for human CD3s were selected for more precise K d determination (Table 6).
• Table 6 summarizes binding affinities of CD3e scFv phage libraries.
• aEGFR VYYCVRHGNFGNSYISYWAYWGQGTLVTVSSGGGGSGGGGSGG aAlbumin: GGSQTVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQK aCD3 PGQAPRGLIGGTKFLAPGTPARFSGSLLGGKAALTLSGVQPEDEAE Trispecific E:A:C YYCVLWYSNRWVFGGGTKLTVLHH HH HH HH HH HH HH HH HH HH HH HH HH
• aCD3 YYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGGLVQA aAlbumin: GGSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVVAI NWSSGST aEGFR YYADSVKGRFTISRDNAKNTMYLQM NSLKPEDTAVYYCAAGYQI Trispecific C:A:E NSGNYN FKDYEYDYWGQGTQVTVSSHH HH HH HH HH HH HH HH HH HH
• aAlbumin GGGSQTVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGNYPNWVQQ aEGFR:aCD3 KPGQAPRGLIGGTKFLAPGTPARFSGSLLGGKAALTLSGVQPEDEA
• aAlbumin GSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVVAI NWSSGSTYY aCD3:aEGFR ADSVKGRFTISRDNAKNTMYLQM NSLKPEDTAVYYCAAGYQI NS
• aPSMA:aCD3 SLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYA aAlbumin DSVKGRFTISRDNAKTTLYLQM NSLRPEDTAVYYCTIGGSLSRSSQ
• aPSMA PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLA aAlbumirmCD PGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFG 3 Trispecific P:A:C GGTKLTVLHHHHHH
• aCD3 YYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSEVQLVESGGGLVQP aAlbumin: GGSLTLSCAASRFMISEYSMHWVRQAPGKGLEWVSTINPAGTTD aPSMA YAESVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCDGYGYRGQ Trispecific C:A:P GTQVTVSSHHHHHH
• aAlbumin TLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLAPGTPA aPSMA:aCD3 RFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFGGGTKLT
• aAlbumin GSLTLSCAASRFMISEYSMHWVRQAPGKGLEWVSTINPAGTTDY aCD3:aPSMA AESVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCDGYGYRGQ
• Fynomer aCD3: AASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKG aAlbumin RFTISRDNAKTTLYLQM NSLRPEDTAVYYCTIGGSLSRSSQGTLVTV
• aCD3 YYCTIGGSLSRSSQGTLVTVSSGGGGSGGGSQVQLVQSGGGLVQ aAlbumin: PGGSLRLSCAASDFDFAAYDMSWVRQAPGQGLEWVAI ISH DGI D aMSLN KYYDDSVKGRFTISRDNSKNTLYLQM NTLRAEDTATYQCLRLGAV Trispecific C:A:M GQGTLVTVSSHH HH HH EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKG
• aAlbumin PGGTVTLTCGSSTGAVTSGNYPNWVQQKPGQAPRGLIGGTKFLA aMSLN:aCD3 PGTPARFSGSLLGGKAALTLSGVQPEDEAEYYCVLWYSNRWVFG
• aAlbumin GSLRLSCAASDFDFAAYDMSWVRQAPGQGLEWVAIISH DGIDKY aCD3:aMSLN YDDSVKGRFTISRDNSKNTLYLQM NTLRAEDTATYQCLRLGAVGQ
• VL only LLIYRSSSLQSAVPSRFSGSGSGTVFTLTISSLQPEDFATYYCQQTYA

Landscapes

• Health & Medical Sciences (AREA)
• Chemical & Material Sciences (AREA)
• Immunology (AREA)
• Organic Chemistry (AREA)
• Life Sciences & Earth Sciences (AREA)
• Medicinal Chemistry (AREA)
• General Health & Medical Sciences (AREA)
• Genetics & Genomics (AREA)
• Proteomics, Peptides & Aminoacids (AREA)
• Molecular Biology (AREA)
• Biochemistry (AREA)
• Biophysics (AREA)
• Veterinary Medicine (AREA)
• Chemical Kinetics & Catalysis (AREA)
• Public Health (AREA)
• Animal Behavior & Ethology (AREA)
• Pharmacology & Pharmacy (AREA)
• Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
• General Chemical & Material Sciences (AREA)
• Bioinformatics & Cheminformatics (AREA)
• Engineering & Computer Science (AREA)
• Cell Biology (AREA)
• Pregnancy & Childbirth (AREA)
• Gynecology & Obstetrics (AREA)
• Reproductive Health (AREA)
• Oncology (AREA)
• Communicable Diseases (AREA)
• Pain & Pain Management (AREA)
• Tropical Medicine & Parasitology (AREA)
• Virology (AREA)
• Transplantation (AREA)
• Rheumatology (AREA)
• Pulmonology (AREA)
• Peptides Or Proteins (AREA)
• Micro-Organisms Or Cultivation Processes Thereof (AREA)
• Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
• Medicines Containing Material From Animals Or Micro-Organisms (AREA)
• Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
• Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
• Medicinal Preparation (AREA)

Priority Applications (17)

Applications Claiming Priority (6)

Publications (1)

Family

ID=57320980

Family Applications (1)

Country Status (14)

Cited By (50)

Families Citing this family (43)

Citations (2)

Family Cites Families (431)