US20170290914A1 - Anti-lag3 antibodies and antigen-binding fragments - Google Patents
Anti-lag3 antibodies and antigen-binding fragments Download PDFInfo
- Publication number
- US20170290914A1 US20170290914A1 US15/305,011 US201515305011A US2017290914A1 US 20170290914 A1 US20170290914 A1 US 20170290914A1 US 201515305011 A US201515305011 A US 201515305011A US 2017290914 A1 US2017290914 A1 US 2017290914A1
- Authority
- US
- United States
- Prior art keywords
- amino acid
- acid sequence
- seq
- cdr
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39566—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against immunoglobulins, e.g. anti-idiotypic antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/32—Immunoglobulins specific features characterized by aspects of specificity or valency specific for a neo-epitope on a complex, e.g. antibody-antigen or ligand-receptor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70596—Molecules with a "CD"-designation not provided for elsewhere in G01N2333/705
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention relates to anti-LAG3 antibodies as well as use of the antibodies of the present invention in the treatment of diseases such as cancer and infection.
- LAG3 (CD223) is a cell surface molecule expressed on activated T cells (Huard et al. Immunogenetics 39:213-217, 1994), NK cells (Triebel et al. J Exp Med 171:1393-1405, 1990), B cells (Kisielow et al. Eur J Immunol 35:2081-2088, 2005), and plasmacytoid dendritic cells (Workman et al. J Immunol 182:1885-1891, 2009) that plays an important role in the function of these lymphocyte subsets.
- the interaction between LAG3 and its major ligand, Class II MHC is thought to play a role in modulating dendritic cell function (Andreae et al. J Immunol 168:3874-3880, 2002).
- Recent preclinical studies have documented a role for LAG-3 in CD8 T-cell exhaustion (Blackburn et al. Nat Immunol 10:29-37, 2009).
- tumor antigen-specific CD4 + and CD8 + T cells display impaired effector function and an exhausted phenotype characterized by decreased production of pro-inflammatory cytokines and hyporesponsiveness to antigenic re-stimulation. This is mediated by cell extrinsic mechanisms, such as regulatory T-cells (Treg), and cell intrinsic mechanisms, such as inhibitory molecules that are upregulated on exhausted, tumor-infiltrating lymphocytes (TIL). These inhibitory mechanisms represent a daunting barrier to effective antitumor immunity.
- Treg regulatory T-cells
- TIL tumor-infiltrating lymphocytes
- LAG is expressed on tolerized TILs suggesting that they contribute to tumor-mediated immune suppression Inhibition of LAG3 may lead to enhanced activation of antigen-specific T cells from which a therapeutic benefit may be gained.
- high efficacy therapeutic antibodies which antagonize the activity of LAG3 which can be used to generate a robust immune response to tumors.
- the present invention provides an antibody or antigen-binding fragment thereof (e.g., an antibody, an antigen-binding fragment, monoclonal antibodies, polyclonal antibodies, a multispecific antibody, a humanized antibody, an isolated antibody or antigen-binding fragment thereof, a humanized antagonist antibody, a fully human antibody, a chimeric antibody and a camelized single domain antibody) that specifically binds LAG3 (e.g., human and/or Macaqa fascicularis , e.g., SEQ ID NOs: 443 or 445) comprising: a heavy chain immunoglobulin variable region having at least 78.99% amino acid sequence identity to amino acids 1-119 of SEQ ID NO: 106; and/or a light chain immunoglobulin variable region having at least 78.38% amino acid sequence identity to amino acids 1-111 of SEQ ID NO: 224.
- LAG3 e.g., human and/or Macaqa fascicularis , e.g., SEQ ID NOs: 4
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention comprises the light and heavy chain immunoglobulin (e.g., heavy and light chain variable domains or heavy and light chain CDRs) of Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9 as set forth herein.
- light and heavy chain immunoglobulin e.g., heavy and light chain variable domains or heavy and light chain CDRs
- the present invention provides an antibody or antigen-binding fragment thereof that specifically binds LAG3 (e.g., human or cynomolgous monkey LAG3) comprising (a) the CDR1, CDR2, and CDR3 of a V L domain of an immunoglobulin chain that comprises the amino acid sequence set forth in SEQ ID NO: 7, 17, 27, 37, 57, 59, 61, 63, 65, 101, 126, 130, 132, 136, 138, 208, 210, 224, 226, 228, 230, 232, 241, 257, 259, 261, 263, 351, 369, 371, 373, 375, 401, 403, 405, 426, 427, 450-453 or 459-461; and/or (b) the CDR1, CDR2, and CDR3 of a V H domain of an immunoglobulin chain that comprises the amino acid sequence set forth in SEQ ID NO: 2, 12, 22, 32, 45, 47, 49, 51, 53, 55, 67, 69,
- the present invention also provides an antibody or antigen-binding fragment thereof that specifically binds LAG3 (e.g., human or cynomolgous monkey) comprising (1) a light chain variable domain comprising CDR-L1 that comprises the amino acid sequence: KASQSLDYEGDSDMN (SEQ ID NO: 38); CDR-L2 that comprises the amino acid sequence: GASNLES (SEQ ID NO: 39); and CDR-L3 that comprises the amino acid sequence: QQSTEDPRT (SEQ ID NO: 40); and/or a heavy chain variable domain comprising: CDR-H1 that comprises the amino acid sequence: DYNVD (SEQ ID NO: 33); CDR-H2 that comprises the amino acid sequence: DINPNNGGTIYAQKFQE (SEQ ID NO: 458); and CDR-H3 that comprises the amino acid sequence: NYRWFGAMDH (SEQ ID NO: 35); or (2) a light chain variable domain comprising CDR-L1 that comprises the amino acid sequence: KASQSLDYEGDS
- the antibody or antigen-binding fragment thereof that specifically binds LAG3 comprises the CDRs of various light and/or heavy chain variable regions and having at least 90% overall amino acid sequence identity to the variable region, i.e., variability in the chain occurs outside the CDRs, e.g., (1) a light chain immunoglobulin comprising CDR-L1, CDR-L2 and CDR-L3 of the immunoglobulin comprising the amino acid sequence of SEQ ID NO: 126 or amino acids 21-131 thereof, and having at least 90% amino acid sequence identity to the amino acid sequence set forth in SEQ ID NO: 126 or amino acids 21-131 thereof, and/or a heavy chain immunoglobulin comprising CDR-H1, CDR-H2 and CDR-H3 of the immunoglobulin comprising the amino acid sequence of SEQ ID NO: 106 or amino acids 1-119 thereof, and having at least 90% amino acid sequence identity to the amino acid sequence
- the antibody or antigen-binding fragment comprises the various mature light and/or mature heavy chain immunoglobulin variable regions and having at least 90% overall amino acid sequence identity to the unprocessed immunoglobulin variable region (including the signal sequence), i.e., variability occurs outside the mature immunoglobulin chain sequences.
- the present invention provides an antibody or antigen-binding fragment thereof that specifically binds LAG3 (e.g., human or cynomolgous monkey LAG3) that comprises a mature or unprocessed V L domain or light chain immunoglobulin of SEQ ID NO: 7, 17, 27, 37, 57, 59, 61, 63, 65, 101, 126, 130, 132, 136, 138, 208, 210, 224, 226, 228, 230, 232, 241, 257, 259, 261, 263, 351, 369, 371, 373, 375, 401, 403, 405, 426, 427, 451-453 or 459-461; and/or a mature or unprocessed V H domain or heavy chain immunoglobulin of SEQ ID NO: 2, 12, 22, 32, 45, 47, 49, 51, 53, 55, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95
- the antibody or antigen-binding fragment thereof comprises: (1) a light chain variable domain comprising: CDR-L1 that comprises the amino acid sequence: KASQSLDYEGDSDMN (SEQ ID NO: 38); CDR-L2 that comprises the amino acid sequence: GASNLES (SEQ ID NO: 39); and CDR-L3 that comprises the amino acid sequence: QQSTEDPRT (SEQ ID NO: 40); and/or a heavy chain variable domain comprising: CDR-H1 that comprises the amino acid sequence: DYNVD (SEQ ID NO: 33); CDR-H2 that comprises the amino acid sequence: DINPNNGGTIYAQKFQE (SEQ ID NO: 458); and CDR-H3 that comprises the amino acid sequence: NYRWFGAMDH (SEQ ID NO: 35); or (2) a light chain variable domain comprising: CDR-L1 that comprises the amino acid sequence: KASQSLDYEGDSDMN (SEQ ID NO: 38); CDR-L2 that comprises the amino acid sequence: GASNLES (SEQ ID
- the antibody or fragment is glycosylated with engineered yeast N-linked glycans or CHO N-linked glycans.
- any of the anti-LAG3 antibodies or antigen-binding fragments thereof of the invention are characterized by one or more of the following properties: Inhibits LAG3 binding to MHC class II molecules; Competes with MHC class II molecules for LAG3 binding; Binds the extraloop of LAG3; Binds LAG3 with a K D of about 10 ⁇ 9 M to about 2 ⁇ 10 ⁇ 12 M; Binds to native LAG3 on the surface of activated CD4+ and/or CD8+ T-cells; Binds to human and/or cynomolgous monkey LAG3; Inhibits LAG3 homodimerization; Stimulates antigen-specific T-cell production of IL-2; labels tonsil tissue; does not label brain, heart, kidney, liver, lung, pancreas, and/or pituit
- the present invention also provides any such antibody or fragment in a pharmaceutically acceptable carrier or diluent.
- the anti-LAG3 antibody or fragment is immobilized to a solid substrate.
- the anti-LAG3 antibody or antigen-binding fragment thereof is Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9 (as set forth herein).
- the present invention also provides a complex comprising an anti-LAG3 antibody or fragment discussed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) complexed with LAG3 (e.g., human or cynomolgous monkey) or a fragment thereof or with a secondary antibody (e.g., detectably labeled secondary antibody) that binds specifically to the anti-LAG3 antibody or fragment.
- the antibody or fragment is in vitro (e.g., is immobilized to a solid substrate) or is in the body of a subject.
- the LAG3 is in vitro (e.g., is immobilized to a solid substrate) or is on the surface of a cell or is in the body of a subject.
- the present invention further provides a composition comprising a plurality of anti-LAG3 antibodies or antigen-binding fragments of the present invention which are isolated, monoclonal antibodies or antigen-binding fragments thereof, e.g., which are humanized, e.g., humanized antagonistic antibodies and antigen-binding fragments thereof.
- the present invention also provides a composition comprising anti-LAG3 antibodies or antigen-binding fragments thereof as discussed herein in association with a further therapeutic agent (e.g., a monoclonal antibody or antigen-binding fragment thereof or an organic small molecule) such as an inhibitor of an immunomodulatory receptor, an anti-emetic, an MTOR (mammalian target of rapamycin) inhibitor, a cytotoxic agent, a platinum agent, an EGFR (epidermal growth factor receptor) inhibitor, a VEGF (vascular epidermal growth factor) inhibitor, a microtubule stabilizer, a taxane, a CD20 inhibitor, a CD52 inhibitor, a CD30 inhibitor, a RANK (Receptor activator of nuclear factor kappa-B) inhibitor, a RANKL (Receptor activator of nuclear factor kappa-B ligand) inhibitor, an ERK inhibitor, a MAP Kinase inhibitor, an AKT inhibitor, a MEK inhibitor,
- the further therapeutic agent is an anti-PD1 antibody or an antigen-binding fragment thereof, pembrolizumab, nivolumab, CT-011, anti-CTLA4 antibody or an antigen-binding fragment thereof, anti-TIM3 antibody or an antigen-binding fragment thereof, anti-CS1 antibody or an antigen-binding fragment thereof, elotuzumab, anti-KIR2DL1/2/3 antibody or an antigen-binding fragment thereof, lirilumab, anti-CD137 antibody or an antigen-binding fragment thereof, urelumab, anti-GITR antibody or an antigen-binding fragment thereof, TRX518, anti-PD-L1 antibody or an antigen-binding fragment thereof, BMS-936559, MSB0010718C, MPDL3280A, anti-PD-L2 antibody or an antigen-binding fragment thereof, anti-ILT1 antibody or an antigen-binding fragment thereof, anti-ILT2 antibody or an antigen-binding fragment thereof, anti-ILT2 antibody or an
- the further therapeutic agent is 13-cis-retinoic acid, 3-[5-(methylsulfonylpiperadinemethyl)-indolyl]-quinolone, 4-hydroxytamoxifen, 5-deooxyuridine, 5′-deoxy-5-fluorouridine, 5-fluorouracil, 6-mecaptopurine, 7-hydroxystaurosporine, A-443654, abirateroneacetate, abraxane, ABT-578, acolbifene, ADS-100380, aflibercept, ALT-110, altretamine, amifostine, aminoglutethimide, amrubicin, amsacrine, anagrelide, anastrozole, angiostatin, AP-23573, ARQ-197, arzoxifene, AS-252424, AS-605240, asparaginase, AT-9263, ATI3387, atrasentan, axitinib, AZD115
- the anti-LAG3 antibody or antigen-binding fragment thereof is in association with pembrolizumab. In an embodiment of the invention, the anti-LAG3 antibody or antigen-binding fragment thereof is in association with novolumab. In an embodiment of the invention, the anti-LAG3 antibody or antigen-binding fragment thereof is in association with CT-011. In an embodiment of the invention, the anti-LAG3 antibody or antigen-binding fragment thereof is in association with BMS-936559.
- the present invention also provides a polypeptide comprising an amino acid sequence selected from the group consisting of 2, 3, 4, 5, 7, 8, 9, 10, 12, 13, 14, 15, 17, 18, 19, 20, 22, 23, 24, 25, 27, 28, 29, 30, 32, 33, 34, 35, 37, 38, 39, 40, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186,
- the present invention also provides a polynucleotide encoding any of such polypeptides, e.g., comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 1, 6, 11, 16, 21, 26, 31, 36, 46, 48, 50, 52, 54, 56, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, 167, 169, 171, 173, 175, 177, 179, 181, 183
- a vector e.g., a plasmid
- a host cell e.g., mammalian, bacterial, Chinese hamster ovary (CHO), lower eukaryotic, fungal, yeast, Pichia, Pichia pastoris
- the host cell comprises an antibody, fragment, polypeptide, polynucleotide and/or vector set forth herein.
- the present invention also provides vaccines comprising an antibody or fragment set forth herein, an antigen (e.g., viral peptide antigen, virus-like particle, tumor peptide antigen) and a pharmaceutically acceptable carrier.
- an antigen e.g., viral peptide antigen, virus-like particle, tumor peptide antigen
- the prevent invention also provides a vessel (e.g., plastic or glass vial) or an injection device (e.g., a syringe such as a pre-filled syringe or an autoinjector) comprising any antibody, fragment, polypeptide, polynucleotide, vector, composition or vaccine discussed herein.
- a vessel e.g., plastic or glass vial
- an injection device e.g., a syringe such as a pre-filled syringe or an autoinjector
- the present invention also provides a method of treating a cancer (e.g., osteosarcoma, rhabdomyosarcoma, neuroblastoma, kidney cancer, leukemia, renal transitional cell cancer, bladder cancer, Wilm's cancer, ovarian cancer, pancreatic cancer, breast cancer, prostate cancer, bone cancer, lung cancer, gastric cancer, colorectal cancer, cervical cancer, synovial sarcoma, head and neck cancer, squamous cell carcinoma, multiple myeloma, renal cell cancer, retinoblastoma, hepatoblastoma, hepatocellular carcinoma, melanoma, rhabdoid tumor of the kidney, Ewing's sarcoma, chondrosarcoma, brain cancer, glioblastoma, meningioma, pituitary adenoma, vestibular schwannoma, a primitive neuroectodermal tumor, medulloblastoma, astrocytom
- the present invention also provides a method of administering an anti-LAG3 antibody, fragment, composition, polypeptide, vaccine or polynucleotide discussed herein, or a pharmaceutical composition thereof, to a subject comprising injecting the antibody, fragment, polypeptide, vaccine or polynucleotide into the body of the subject using an injection device; and, optionally, also administering a further therapeutic agent to the subject.
- the present invention also provides a method of producing an anti-LAG3 antibody or antigen-binding fragment thereof or polypeptide discussed herein comprising: a. culturing a host cell comprising a polynucleotide encoding the polypeptide or an immunoglobulin chain of the antibody or fragment in culture medium under conditions favorable to expression of the polynucleotide; and b. optionally, recovering the antibody, fragment or polypeptide from the host cell and/or culture medium.
- the method comprises the step of introducing the polynucleotide into the host cell, e.g., by transformation or transfection.
- the present invention also provides a method for detecting the presence of a LAG3 peptide or a fragment thereof in a sample comprising contacting the sample with an anti-LAG3 antibody or fragment discussed herein and detecting the presence of a complex between the antibody or fragment and the peptide; wherein detection of the complex indicates the presence of the LAG3 peptide.
- FIG. 1 Binding of anti-human LAG3 clones to human and cynomolgus monkey LAG3 expressing CHO-K1 cells.
- FIG. 2 Binding of LAG3 clones to cynomolgous monkey and human primary T-cells.
- FIG. 3 Three-dimensional structure of human LAG3. The location of the antibody 22D2, 11C9 and 4A10 epitopes are indicated.
- FIG. 4 ( a - c ). Heat map indicating regions in human LAG3 which are strongly or weakly protected from deuteration by antibody binding.
- FIG. 5 ( a - b ). Combined heatmaps indicating (a) regions on human LAG3 which are protected from deuteration by 22D2, 11C9 and 4A10 binding and (b) the location in human LAG3 mediating MHC2 binding.
- FIG. 6 Predominant N-linked glycans for monoclonal antibodies produced in Chinese hamster ovary cells (CHO N-linked glycans) and in engineered yeast cells (engineered yeast N-linked glycans): squares: N-acetylglucosamine (GlcNac); circles: mannose (Man); diamonds: galactose (Gal); triangles: fucose (Fuc).
- FIG. 7 Effect of anti-human LAG-3 antibody treatment+/ ⁇ anti-PD-1 treatment on IL-2 production in SEB stimulated human PBMCs.
- PBMC were activated by SEB for 3 days and IL-2 concentration in culture supernatants was determined by MSD.
- Donor 090 SEB 60 ng/mL
- Donor 089 SEB 30 ng/mL.
- Anti-PD1 was used at 10 ⁇ g/mL.
- FIG. 8 Effect of hu22D2 treatment+/ ⁇ anti-PD-1 treatment on IFN- ⁇ and TNF ⁇ production in MLR stimulated human PBMCs.
- PBMC were activated with allogeneic monocyte-derived DC for 7 days and IFN- ⁇ and TNF- ⁇ concentration in culture supernatants was determined by MSD.
- Anti-PD-1 was used at 3 ⁇ g/mL.
- Isotype was used at 200 nM.
- FIG. 9 Antigen-capture assay analysis of concentration of unbound and partially bound anti-LAG3 antibody Ab6 in cynomolgous monkey subjects over time at various doses (0.03 mg/kg; 0.3 mg/kg; 1 mg/kg; 10 mg/kg; 30 mg/kg).
- FIG. 10 Universal assay analysis of concentration of total anti-LAG3 antibody Ab6 in cynomolgous monkey subjects over time at various doses (0.03 mg/kg; 0.3 mg/kg; 1 mg/kg; 10 mg/kg; 30 mg/kg).
- FIG. 11 The dose-normalized concentration data of Ab6 over time in cynomolgous monkey subjects at various doses (0.03 mg/kg; 0.3 mg/kg; 1 mg/kg; 10 mg/kg; 30 mg/kg).
- FIG. 12 Target related clearance (Vmax, Km) evaluation of various does of anti-LAG3 antibody Ab6 at various doses.
- the present invention provides antibodies and antigen-binding fragments thereof that have exceptionally high affinity for human LAG3 and cynomolgous monkey LAG3, e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9 as well as uses thereof and methods of making the same as is discussed herein.
- affinity (K D ) for human LAG3 by KinExA assay was measured to be as high as 2 pM and affinity for cynomolgous LAG3 is in the low double digit pM range.
- a particularly low isoelectric point (e.g., about 6.3) makes some of these antibodies unique.
- antibodies bind LAG3 primarily outside the extraloop region, they exhibit the ability to block LAG3/MCH class II binding.
- the anti-LAG3 antibodies of the present invention have a high degree of specificity for binding to LAG3 over other related proteins. Such antibodies and fragments set forth herein may be useful, for example, for treatment of various cancers and infectious diseases.
- ADCC Antibody-dependent cellular cytotoxicity CDC Complement-dependent cytotoxicity CDR Complementarity determining region in the immunoglobulin variable regions, defined using the Kabat numbering system CHO Chinese hamster ovary EC50 concentration resulting in 50% efficacy or binding ELISA Enzyme-linked immunosorbant assay FR Antibody framework region: the immunoglobulin variable regions excluding the CDR regions.
- V region The segment of IgG chains which is variable in sequence between different antibodies. It extends to Kabat residue 109 in the light chain and 113 in the heavy chain.
- VH Immunoglobulin heavy chain variable region VK Immunoglobulin kappa light chain variable region
- LAG3 refers to human and cynomolgous monkey, e.g., Macaca fascicularis or Macaca mulatta LAG3 as well as fragments thereof such as the mature fragment thereof lacking the signal peptide.
- the amino acid sequence of human LAG3 (Lymphocyte Activation Gene-3) comprises the amino acid sequence:
- amino acid sequence of mouse LAG3 comprises the amino acid sequence:
- the amino acid sequence of cynomolgous monkey LAG3 comprises the amino acid sequence:
- the mature sequence of human, mouse and cynomolgous monkey LAG3, i.e. the sequence after removal of the signal peptide, comprises amino acids 1-28 of SEQ ID NO: 443, 444 or 445.
- LAG3 sequences may differ, for example, by having, for example, conserved mutations or mutations in non-conserved regions, e.g., wherein the LAG3 has substantially the same biological function as the LAG3 of SEQ ID NOs: 443 or 445.
- biological functions of LAG3 are to bind to major histocompatibility complex (MHC) class II molecules and to form homodimers.
- MHC major histocompatibility complex
- a particular LAG3 sequence will generally be at least 90% identical in amino acid sequence to LAG3 of SEQ ID NOs: 443 or 445 or other isoforms.
- a LAG3 may be at least 95%, or even at least 96%, 97%, 98% or 99% identical to a LAG3 of SEQ ID NOs: 443 or 445, or other isoforms or variants.
- a LAG3 sequence will display no more than 10 amino acid differences from the LAG3 of any of SEQ ID NOs: 443 or 445, or other isoforms or variants.
- the LAG3 may display no more than 5, or even no more than 4, 3, 2, or 1 amino acid difference from a LAG3 of SEQ ID NOs: 443 or 445, or other isoforms or variants. Percent identity can be determined as described herein.
- the present invention provides antibodies or antigen-binding fragments thereof that specifically bind LAG3 (e.g., human and/or cynomolgous monkey, e.g., Macaca fascicularis or Macaca mulatta LAG3), for example, 4A10, 19E8, 11C9, 22D2, e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9, and uses of such antibodies or fragments.
- LAG3 e.g., human and/or cynomolgous monkey, e.g., Macaca fascicularis or Macaca mulatta LAG3
- 4A10, 19E8, 11C9, 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9
- the antibody or fragment is an antibody.
- an anti-LAG3 antibody or antigen-binding fragment thereof refers to an antibody or antigen-binding fragment thereof that specifically binds to human or cynomolgous monkey LAG3.
- An antibody binds specifically to a polypeptide comprising a given sequence (in this case an epitope of human or cynomolgous monkey LAG3) if it binds to polypeptides comprising the LAG3 sequence with a K D of about 1 nM or a higher affinity (e.g., 1 nM-2 pM, 1 nM, 100 pM, 10 pM or 2 pM), but does not bind to proteins lacking the sequence.
- an antibody or antigen-binding fragment that specifically binds to a polypeptide comprising human or cynomolgous monkey LAG3 may bind to a FLAG®-tagged form of human or cynomolgous monkey LAG3 but will not bind to other FLAG®-tagged proteins that lack LAG3 epitopes.
- the present invention includes anti-LAG3 antibodies and methods of use thereof.
- antibody refers to any form of antibody that exhibits the desired biological activity. Thus, it is used in the broadest sense and specifically covers, but is not limited to, monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), humanized antibodies, fully human antibodies, chimeric antibodies and camelized single domain antibodies.
- the present invention includes parental anti-LAG3 antibodies and antigen-binding fragments thereof and methods of use thereof.
- Parental antibodies and antigen-binding fragments thereof are antibodies and fragments which may be modified for an intended use, such as humanization of an antibody for use as a human therapeutic antibody or fragment.
- antibody fragment or “antigen-binding fragment” refers to antigen-binding fragments of antibodies, i.e. antibody fragments that retain the ability to bind specifically to the antigen bound by the full-length antibody, e.g. fragments that retain one or more CDR regions.
- antigen-binding fragments include, but are not limited to, Fab, Fab′, F(ab′) 2 , and Fv fragments; diabodies; single-chain antibody molecules, e.g., sc-Fv; nanobodies and multispecific antibodies formed from antibody fragments.
- the present invention includes anti-LAG3 Fab fragments and methods of use thereof.
- a “Fab fragment” is comprised of one light chain and the C H 1 and variable regions of one heavy chain.
- the heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule.
- An “Fab fragment” can be the product of papain cleavage of an antibody.
- the present invention includes anti-LAG3 antibodies and antigen-binding fragments thereof which comprise an Fc region and methods of use thereof.
- An “Fc” region contains two heavy chain fragments comprising the C H 1 and C H 2 domains of an antibody. The two heavy chain fragments are held together by two or more disulfide bonds and by hydrophobic interactions of the C H 3 domains.
- the present invention includes anti-LAG3 Fab′ fragments and methods of use thereof.
- a “Fab′ fragment” contains one light chain and a portion or fragment of one heavy chain that contains the V H domain and the C H 1 domain and also the region between the C H 1 and C H 2 domains, such that an interchain disulfide bond can be formed between the two heavy chains of two Fab′ fragments to form a F(ab′) 2 molecule.
- the present invention includes anti-LAG3 F(ab′) 2 fragments and methods of use thereof.
- a “F(ab′) 2 fragment” contains two light chains and two heavy chains containing a portion of the constant region between the C H1 and C H2 domains, such that an interchain disulfide bond is formed between the two heavy chains.
- a F(ab′) 2 fragment thus is composed of two Fab′ fragments that are held together by a disulfide bond between the two heavy chains.
- An “F(ab′) 2 fragment” can be the product of pepsin cleavage of an antibody.
- the present invention includes anti-LAG3 Fv fragments and methods of use thereof.
- the “Fv region” comprises the variable regions from both the heavy and light chains, but lacks the constant regions.
- the present invention includes anti-LAG3 scFv fragments and methods of use thereof.
- the term “single-chain Fv” or “scFv” antibody refers to antibody fragments comprising the V H and V L domains of an antibody, wherein these domains are present in a single polypeptide chain.
- the Fv polypeptide further comprises a polypeptide linker between the V H and V L domains which enables the scFv to form the desired structure for antigen-binding.
- scFv see Pluckthun (1994) T HE P HARMACOLOGY OF M ONOCLONAL A NTIBODIES , vol. 113, Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269-315. See also, International Patent Application Publication No. WO88/01649 and U.S. Pat. Nos. 4,946,778 and 5,260,203.
- a “domain antibody” is an immunologically functional immunoglobulin fragment containing only the variable region of a heavy chain or the variable region of a light chain.
- two or more V H regions are covalently joined with a peptide linker to create a bivalent domain antibody.
- the two V H regions of a bivalent domain antibody may target the same or different antigens.
- the present invention includes anti-LAG3 bivalent antibodies and methods of use thereof.
- a “bivalent antibody” comprises two antigen-binding sites. In some instances, the two binding sites have the same antigen specificities. However, bivalent antibodies may be bispecific (see below).
- the present invention includes anti-LAG3 camelized single domain antibodies and methods of use thereof.
- antibodies herein also include camelized single domain antibodies. See, e.g., Muyldermans et al. (2001) Trends Biochem. Sci. 26:230; Reichmann et al. (1999) J. Immunol. Methods 231:25; WO 94/04678; WO 94/25591; U.S. Pat. No. 6,005,079).
- the present invention provides single domain antibodies comprising two V H domains with modifications such that single domain antibodies are formed.
- the present invention includes anti-LAG3 diabodies and methods of use thereof.
- diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy chain variable domain (V H ) connected to a light chain variable domain (V L ) in the same polypeptide chain (V H -V L or V L -V H ).
- V H heavy chain variable domain
- V L light chain variable domain
- the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
- Diabodies are described more fully in, e.g., EP 404,097; WO 93/11161; and Holliger et al. (1993) Proc. Natl. Acad. Sci. USA 90: 6444-6448.
- Holliger and Hudson (2005) Nat. Biotechnol. 23:1126-1136 For a review of engineered antibody variants generally see Holliger and Hudson (2005) Nat. Biotechnol. 23:1126-1136
- an antibody or antigen-binding fragment of the invention which is modified in some way retains at least 10% of its LAG3 (e.g., human and/or cynomolgous monkey, e.g., Macaca fascicularis or Macaca mulatta LAG3) binding activity (when compared to the parental antibody) when that activity is expressed on a molar basis.
- LAG3 e.g., human and/or cynomolgous monkey, e.g., Macaca fascicularis or Macaca mulatta LAG3
- an antibody or antigen-binding fragment of the invention can include conservative or non-conservative amino acid substitutions (referred to as “conservative variants” or “function conserved variants” of the antibody) that do not substantially alter its biologic activity.
- the present invention includes isolated anti-LAG3 antibodies and antigen-binding fragments thereof (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) and methods of use thereof as well as isolated polypeptide immunoglobulin chains thereof and isolated polynucleotides encoding such polypeptides and isolated vectors including such polynucleotides. “Isolated” antibodies or antigen-binding fragments thereof, polypeptides, polynucleotides and vectors, are at least partially free of other biological molecules from the cells or cell culture from which they are produced.
- Such biological molecules include nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth medium.
- An isolated antibody or antigen-binding fragment may further be at least partially free of expression system components such as biological molecules from a host cell or of the growth medium thereof.
- the term “isolated” is not intended to refer to a complete absence of such biological molecules or to an absence of water, buffers, or salts or to components of a pharmaceutical formulation that includes the antibodies or fragments.
- the present invention includes monoclonal anti-LAG3 antibodies and antigen-binding fragments thereof as well as monoclonal compositions comprising a plurality of isolated monoclonal antibodies.
- monoclonal antibody refers to a population of substantially homogeneous antibodies, i.e., the antibody molecules comprising the population are identical in amino acid sequence except for possible naturally occurring mutations that may be present in minor amounts.
- a “plurality” of such monoclonal antibodies and fragments in a composition refers to a concentration of identical (i.e., as discussed above, in amino acid sequence except for possible naturally occurring mutations that may be present in minor amounts) antibodies and fragments which is above that which would normally occur in nature, e.g., in the blood of a host organism such as a mouse or a human.
- conventional (polyclonal) antibody preparations typically include a multitude of different antibodies having different amino acid sequences in their variable domains, particularly their CDRs, that are often specific for different epitopes.
- the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al. (1975) Nature 256: 495, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567).
- the “monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al. (1991) Nature 352: 624-628 and Marks et al. (1991) J. Mol. Biol. 222: 581-597, for example. See also Presta (2005) J. Allergy Clin. Immunol. 116:731.
- the present invention includes anti-LAG3 chimeric antibodies (e.g., human constant domain/mouse variable domain) and methods of use thereof.
- a “chimeric antibody” is an antibody having the variable domain from a first antibody and the constant domain from a second antibody, where the first and second antibodies are from different species.
- variable domains are obtained from an antibody from an experimental animal (the “parental antibody”), such as a rodent, and the constant domain sequences are obtained from human antibodies, so that the resulting chimeric antibody will be less likely to elicit an adverse immune response in a human subject than the parental (e.g., mouse) antibody.
- parental antibody an antibody from an experimental animal
- the constant domain sequences are obtained from human antibodies, so that the resulting chimeric antibody will be less likely to elicit an adverse immune response in a human subject than the parental (e.g., mouse) antibody.
- the present invention includes anti-LAG3 humanized antibodies and antigen-binding fragments thereof (e.g., mouse antibodies that have been humanized) and methods of use thereof.
- humanized antibody refers to forms of antibodies that contain sequences from both human and non-human (e.g., mouse or rat) antibodies.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin, and all or substantially all of the framework (FR) regions are those of a human immunoglobulin sequence.
- the humanized antibody may optionally comprise at least a portion of a human immunoglobulin constant region (Fc).
- the present invention includes anti-LAG3 fully human antibodies and antigen-binding fragments thereof and methods of use thereof.
- the term “fully human antibody” refers to an antibody that comprises human immunoglobulin protein sequences only.
- a fully human antibody may contain murine carbohydrate chains if produced in a mouse, in a mouse cell, or in a hybridoma derived from a mouse cell.
- mouse antibody refers to an antibody that comprises mouse immunoglobulin sequences only.
- a fully human antibody may contain rat carbohydrate chains if produced in a rat, in a rat cell, or in a hybridoma derived from a rat cell.
- rat antibody refers to an antibody that comprises rat immunoglobulin sequences only.
- an fully human anti-LAG3 antibody or antigen-binding fragment thereof is the product of isolation from a transgenic animal, e.g., a mouse (e.g., a HUMAB mouse, see e.g., U.S. Pat. Nos. 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016; 5,770,429; 5,789,650; 5,814,318; 5,874,299 and 5,877,397; and Harding, et al., (1995) Ann. NY Acad. Sci. 764:536 546; or a XENOMOUSE, see e.g., Green et al., 1999, J.
- Immunol. Methods 231:11-23 which has been genetically modified to have fully human immunoglobulin genes; or the product of isolation from a phage or virus which expresses the immunoglobulin chains of the anti-LAG3 fully human antibody or antigen-binding fragment thereof
- the basic antibody structural unit comprises a tetramer.
- Each tetramer includes two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa).
- the amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal portion of the heavy chain may define a constant region primarily responsible for effector function.
- human light chains are classified as kappa and lambda light chains.
- human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
- the variable and constant regions are joined by a “J” region of about 12 or more amino acids, with the heavy chain also including a “D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989).
- anti-LAG3 antibodies of the present invention comprise a full tetrameric structure having two light chains and two heavy chains, including constant regions.
- variable regions of each light/heavy chain pair form the antibody binding site.
- an intact antibody has two binding sites.
- the two binding sites are, in general, the same.
- variable domains of both the heavy and light chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), located within relatively conserved framework regions (FR).
- CDRs complementarity determining regions
- FR framework regions
- the CDRs are usually aligned by the framework regions, enabling binding to a specific epitope.
- both light and heavy chains variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
- the assignment of amino acids to each domain is, generally, in accordance with the definitions of Sequences of Proteins of Immunological Interest , Kabat, et al.; National Institutes of Health, Bethesda, Md.; 5 th ed.; NIH Publ. No.
- hypervariable region refers to the amino acid residues of an antibody or antigen-binding fragment thereof that are responsible for antigen-binding.
- the hypervariable region comprises amino acid residues from a “complementarity determining region” or “CDR” (i.e. CDR-L1, CDR-L2 and CDR-L3 in the light chain variable domain and CDR-H1, CDR-H2 and CDR-H3 in the heavy chain variable domain).
- CDR complementarity determining region
- the scope of the present invention includes anti-LAG3 antibodies and antigen-binding fragments thereof that specifically bind LAG3, which have any combination of CDRs from the immunoglobulin light chains of SEQ ID NOs: 7, 17, 27 and/or 37 and/or which have any combination of CDRs from the immunoglobulin heavy chains of SEQ ID NOs: 2, 12, 22 and 32 wherein the CDRs are as defined by Kabat and Chothia (see above).
- “Homology” refers to sequence similarity between two polynucleotide sequences or between two polypeptide sequences when they are optimally aligned. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are homologous at that position. The percent of homology is the number of homologous positions shared by the two sequences divided by the total number of positions compared ⁇ 100. For example, if 6 of 10 of the positions in two sequences are matched or homologous when the sequences are optimally aligned then the two sequences are 60% homologous. Generally, the comparison is made when two sequences are aligned to give maximum percent homology.
- isolated nucleic acid molecules or “isolated polynucleotides” (e.g., DNA or RNA) is also not associated with all or a portion of a polynucleotide in which the isolated polynucleotide is found in nature, or is linked to a polynucleotide to which it is not linked in nature.
- a nucleic acid molecule comprising does not encompass intact chromosomes.
- Isolated nucleic acid molecules “comprising” specified nucleic acid sequences may include, in addition to the specified sequences, coding sequences for up to ten or even up to twenty or more other proteins or portions or fragments thereof, or may include operably linked regulatory sequences that control expression of the coding region of the recited nucleic acid sequences, and/or may include vector sequences.
- the present invention includes isolated polynucleotides encoding any of the immunoglobulin chains discussed herein.
- control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism.
- the control sequences that are suitable for prokaryotes include a promoter, optionally an operator sequence, and a ribosome binding site.
- Eukaryotic cells are known to use promoters, polyadenylation signals, and enhancers.
- a nucleic acid or polynucleotide is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence.
- DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide;
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
- operably linked means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
- the expressions “cell,” and “cell line,” are used interchangeably and all such designations include progeny.
- the words “transformants” and “transformed cells” include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that not all progeny will have precisely identical DNA content, due to deliberate or inadvertent mutations. Mutant progeny that have the same function or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, it will be clear from the context.
- PCR polymerase chain reaction
- sequence information from the ends of the region of interest or beyond is used to design oligonucleotide primers. These primers will be identical or similar in sequence to opposite strands of the template to be amplified. The 5′ terminal nucleotides of the two primers can coincide with the ends of the amplified material.
- PCR can be used to amplify specific RNA sequences, specific DNA sequences from total genomic DNA, and cDNA transcribed from total cellular RNA, bacteriophage or plasmid sequences, etc. See generally Mullis et al. (1987) Cold Spring Harbor Symp. Quant. Biol.
- PCR is considered to be one, but not the only, example of a nucleic acid polymerase reaction method for amplifying a nucleic acid test sample comprising the use of a known nucleic acid as a primer and a nucleic acid polymerase to amplify or generate a specific piece of nucleic acid.
- germline sequence refers to a sequence of unrearranged immunoglobulin DNA sequences. Any suitable source of unrearranged immunoglobulin sequences may be used.
- Human germline sequences may be obtained, for example, from JOINSOLVER germline databases on the website for the National Institute of Arthritis and Musculoskeletal and Skin Diseases of the United States National Institutes of Health.
- Mouse germline sequences may be obtained, for example, as described in Giudicelli et al. (2005) Nucleic Acids Res. 33:D256-D261.
- the present invention provides anti-LAG3 antibodies and antigen-binding fragments thereof (e.g., humanized antibodies such as antagonist humanized antibodies) and methods of use of the antibodies or antigen-binding fragments thereof in the treatment or prevention of disease.
- the invention provides for mouse or humanized anti-LAG3 antibodies and antigen-binding fragments thereof and methods of use of the antibodies or antigen-binding fragments thereof in the treatment or prevention of disease.
- the invention provides for antagonistic anti-LAG3 antibodies and methods of use of the antibodies or antigen-binding fragments thereof in the treatment or prevention of disease.
- an anti-LAG3 antibody or antigen-binding fragment thereof comprising a particular light chain and a particular heavy chain may be referred to as “light chain/heavy chain”; for example, an antibody comprising the 45AGX_22 D2_VL3 light chain and the Humanized ⁇ [LAG3_H] mAb.22D2 VH6 N54D heavy chain may be referred to as “45AGX_22D2_VL3/Humanized ⁇ [LAG3_H] mAb.22D2 VH6 N54D”.
- an “anti-LAG3 antibody or antigen-binding fragment thereof” of the present invention includes any antibody or antigen-binding fragment thereof that is discussed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) which specifically binds to LAG3 (e.g., human or cynomolgous monkey LAG3).
- LAG3 e.g., human or cynomolgous monkey LAG3
- Such antibodies and fragments include humanized antibodies and fragments having any combination of the mouse or humanized light and heavy chains that are set forth herein or variants of such chains which specifically bind LAG3.
- Such antibodies and fragments include any antibody or fragment comprising any one or more of the CDRs (e.g., CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 and CDR-H3) of the mouse or humanized chains set forth herein or variants of such CDRs which specifically bind LAG3.
- CDRs e.g., CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 and CDR-H3
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention includes any antibody or antigen-binding fragment thereof that binds to the same epitope in LAG3 to which the antibodies and fragments discussed herein bind and any antibody or antigen-binding fragment that cross-blocks (partially or fully) or is cross-blocked (partially or fully) by an antibody or fragment discussed herein for LAG3 binding; as well as any variant thereof.
- a particular embodiment of the invention includes antibodies and fragments comprising only mouse immunoglobulin chains or only humanized immunoglobulin chains and/or wherein the immunoglobulin chains or CDRs are all derived, directly or indirectly, from the same original mouse clone, i.e., humanized 4A10 light chains paired with humanized 4A10 heavy chains; humanized 19E8 light chains paired with humanized 19E8 heavy chains; humanized 11C9 light chains paired with humanized 11C9 heavy chains; or humanized 22D2 light chains paired with humanized 22D2 heavy chains; or mouse 4A10 light chains paired with mouse 4A10 heavy chains; mouse 19E8 light chains paired with mouse 19E8 heavy chains; mouse 11C9 light chains paired with mouse 11C9 heavy chains; or mouse 22D2 light chains paired with mouse 22D2 heavy chains.
- These antibodies and fragments are part of the present invention along with their uses, e.g., as set forth herein.
- cross-blocking antibodies and antigen-binding fragments thereof discussed herein can be identified based on their ability to block any of the antibodies or fragments specifically set forth herein, e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, 4A10, 19E8, 11C9 and/or 22D2, from binding to LAG3, in binding assays (e.g., bio-layer interferometry (BLI; for example FORTEBIO OCTET binding assay; Pall ForteBio Corp; Menlo Park, Calif.), surface plasmon resonance (SPR), BIACore, ELISA, flow cytometry).
- binding assays e.g., bio-layer interferometry (BLI; for example FORTEBIO OCTET binding assay; Pall ForteBio Corp; Menlo Park, Calif.), surface plasmon resonance (SPR), BIACore, ELISA, flow cytometry.
- the tip of a fiber-optic probe when using BLI, is coated with ligand (e.g., LAG3) and acts as the biosensor wherein binding of anti-LAG3 antibody or antigen-binding fragment to the LAG3 alters the interference pattern of white light reflected from the probe layer bound to LAG3 and an internal reference layer. The shift is indicative of LAG3/anti-LAG3 binding.
- the LAG3 coated tip is immersed in a solution of analyte containing antibody or antigen-binding fragment, e.g., in the well of either a 96- or 384-well plate.
- the plate is shaken during reading to create orbital flow.
- assays can be used in which a LAG3 (e.g., human LAG3) protein is immobilized on a BLI probe or plate, a reference anti-LAG3 antibody or fragment binds to LAG3 (e.g., at saturating concentration) and a test anti-LAG3 antibody or fragment is added. The ability of the test antibody to compete with the reference antibody for LAG3 binding is then determined.
- LAG3 e.g., human LAG3
- a reference anti-LAG3 antibody or fragment binds to LAG3 (e.g., at saturating concentration) and a test anti-LAG3 antibody or fragment is added.
- the test antibody effectively competes with the reference antibody, e.g., nanometers of light wavelength shift over time is monitored wherein a shift indicates additional binding of the test antibody and a lack of cross-blocking.
- cross-blocking is qualitatively deemed to have occurred between the antibodies if no additional binding of test antibody is observed.
- as a control cross-blocking of the reference antibody with itself is confirmed; wherein the assay is determined to be operating correctly if the reference antibody can cross-block itself from LAG3 binding.
- test antibody to inhibit the binding of, for example, Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, 4A10, 19E8, 11C9 and/or 22D2, to LAG3 (e.g., human LAG3) demonstrates that the test antibody can cross-block Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, 4A10, 19E8, 11C9 and/or 22D2 for binding to LAG3 (e.g., human LAG3) and thus, may, in some cases, bind to the same epitope on LAG3 (e.g., human LAG3) as Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8, Ab9, 4A10, 19E8, 11C9 and/or 22D2.
- LAG3 e.g., human LAG3
- BLI is conducted in a sandwich format wherein a reference anti-LAG3 antibody or antigen-binding fragment is immobilized to the probe and then bound with LAG3. Test anti-LAG3 antibody or antigen-binding fragment is then tested for the ability to block binding of the references antibody or fragment.
- “4A10”, “19E8”, “11C9” and “22D2” anti-LAG3 antibodies and antigen-binding fragments thereof referred to herein comprise the CDR-L1, CDR-L2 and CDR-L3 of the mouse immunoglobulin light chains 4A10, 19E8, 11C9 or 22D2 and variants thereof, respectively; as well as CDR-H1, CDR-H2 and CDR-H3 of the mouse immunoglobulin heavy chains 4A10, 19E8, 11C9 or 22D2, and variants thereof, respectively.
- Such “4A10”, “19E8”, “11C9” and “22D2” antibodies and fragments may be humanized antibodies or antigen-binding fragments thereof such as Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9.
- immunoglobulin chains of anti-LAG3 antibodies as well as their CDRs include, but are not limited to:
- the 22D2 mouse parental heavy or light chains may be referred to herein as LB145.22D2.E1.1D1.
- the 19E8 mouse parental heavy or light chains may be referred to herein as LB148.19E8.G1.1A1.
- the 4A10 mouse parental heavy or light chains may be referred to herein as LB148.4A10.1H1.
- the 11C9 mouse parental heavy or light chains may be referred to herein as LB148.11C9.1C1.
- the present invention also includes any anti-LAG3 antibody or antigen-binding fragment thereof (e.g., humanized antibodies such as antagonist humanized antibodies) comprising one or more of the heavy and/or light chains (or variants thereof) or CDRs (or variants thereof) or mature fragments of such chains (or variants thereof) or variable domains thereof of such chains (or variants thereof) which are set for the below.
- Light chains may be designated with a “V L ” or “VK” and heavy chains may be designated with a “V H ”.
- anti-LAG3 antibodies e.g., humanized antibodies such as humanized antagonistic antibodies
- antigen-binding fragments thereof comprising any one or more (e.g., 3) light chain CDRs and/or any one or more (e.g., 3) heavy chain CDRs from the immunoglobulin chains set forth below; or any mature variable domain of a light immunoglobulin chain and/or mature variable domain of a heavy immunoglobulin chain set forth in SEQ ID NOs: 45-104.
- a humanized (e.g., humanized antagonistic) anti-LAG3 antibody or antigen-binding fragment of the invention comprises any combination of heavy and light mature, variable domains of the following immunoglobulin chains.
- the 11C9 humanized light chains are paired with the 11C9 humanized heavy chains; the 19E8 humanized light chains are paired with the 19E8 humanized heavy chains; the 4A10 humanized light chains are paired with the 4A10 humanized heavy chains; and the 22D2 humanized light chains are paired with the 22D2 humanized heavy chains.
- a humanized anti-LAG3 antibody or antigen-binding fragment thereof comprises a “45AGX_22D2_VL3” immunoglobulin variable domain light chain, e.g., comprising the amino acid sequence of SEQ ID NO: 274 or a mature fragment thereof (e.g., amino acids 21-131 of SEQ ID NO: 274); and a “Humanized ⁇ [LAG3_H] mAb.22D2 VH6 N54D” or “Humanized ⁇ [LAG3_H] mAb.22D2 VH6 N54G” immunoglobulin variable domain heavy chain comprising the amino acid sequence of SEQ ID NO: 426 or SEQ ID NO: 427, respectively.
- the scope of the present invention includes anti-LAG3 antibodies (e.g., humanized antibodies such as humanized antagonistic antibodies) and antigen-binding fragments thereof comprising any one or more (e.g., 3) light chain CDRs and/or any one or more (e.g., 3) heavy chain CDRs from the immunoglobulin chains set forth herein; or any mature or unprocessed V L domain or light chain immunoglobulin and/or mature or unprocessed V H domain or heavy chain immunoglobulin set forth herein.
- the scope of the present invention also includes any of the humanized polypeptides or polynucleotides or variable domains thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations or point deletions.
- Specific embodiments of the invention include any humanized anti-LAG3 antibodies and antigen-binding fragments thereof comprising the immunoglobulin light and heavy chains set forth below or any antibody or fragment having the light and heavy chain CDRs thereof (e.g., IgG1 or IgG4).
- Such antibodies and fragments may be referred to as any one of Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9 as follows:
- Ab1 humanized light chain 45AGX Humanized x [LAG3_H] mAb (LB145.22D2.E1.D1 (VL3) ) Kappa (PX) (or the variable domain thereof) and humanized heavy chain 53AHH Humanized x [LAG3_H] mAb (LB145.22D2.E1.D1 VH6) IgG1/Kappa (PX) (or the variable domain thereof); for example comprising: a light chain immunoglobulin comprising the amino acid sequence: DIVMTQTPLSLSVTPGQPASISCKASQSLDYEGDSDMNWYLQKPGQPPQLLIYGASNLESGVPDRFSGSGSGTDFTL KISRVEAEDVGVYYCQQSTEDPRTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG
- the CDR-H2 of any anti-LAG3 antibody or antigen-binding fragment thereof of the present invention comprises the amino acid sequence:
- X 1 D, N, S or Q
- Humanized heavy immunoglobulin chains are set forth in SEQ ID NOs: 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 124, 128, 134, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 212, 214, 216, 218, 220, 222, 234, 235, 237, 239, 243, 245, 247, 249, 251, 253, 255, 265, 267, 269, 271, 273, 275, 277, 279, 281, 283, 285, 287, 289, 291, 293, 295, 297, 299, 301, 303, 305, 307, 309,
- DNA encoding humanized heavy immunoglobulin chains are set forth in SEQ ID NOs: 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 127, 133, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, 167, 169, 171, 173, 175, 177, 179, 181, 183, 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205, 211, 213, 215, 217, 219, 221, 233, 236, 238, 242, 244, 246, 248, 250, 252, 254, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320
- Humanized light immunoglobulin chains are set forth in SEQ ID NOs: 126, 130, 132, 136, 138, 208, 210, 224, 226, 228, 230, 232, 241, 257, 259, 261, 263, 351, 369, 371, 373, 375, 401, 403, 405, 450-453, 426, 427 and 459-461.
- DNA encoding humanized light immunoglobulin chains are set forth in SEQ ID NOs: 125, 129, 131, 135, 137, 207, 209, 223, 225, 227, 229, 231, 240, 256, 258, 260, 262, 350, 368, 370, 372, 374, 400, 402 and 404.
- a “variant” of a polypeptide refers to a polypeptide comprising an amino acid sequence that is at least about 70-99.9% (e.g., 70, 72, 74, 75, 76, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 99.5, 99.9%) identical or similar to a referenced amino acid sequence that is set forth herein; when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g., expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment).
- 70-99.9% e.g., 70, 72, 74, 75, 76, 79
- a “variant” of a polynucleotide refers to a polynucleotide comprising a nucleotide sequence that is at least about 70-99.9% (e.g., 70, 72, 74, 75, 76, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 99.5, 99.9%) identical to a referenced nucleotide sequence that is set forth herein; when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g., expect threshold: 10; word size: 28; max matches in a query range: 0; match/mismatch scores: 1, ⁇ 2; gap costs: linear).
- 70-99.9% e.g., 70, 72, 74,
- Polypeptides and anti-LAG3 antibodies and antigen-binding fragments thereof (e.g., humanized antibodies) of the present invention include a heavy chain immunoglobulin variable region having at least 78.99% (e.g., 79%, 80%, 85%, 90%, 95%, 99%) amino acid sequence identity to amino acids 1-119 of SEQ ID NO: 106; and/or a light chain immunoglobulin variable region having at least 78.38% (e.g., 79%, 80%, 85%, 90%, 95%, 99%) amino acid sequence identity to amino acids 1-111 of SEQ ID NO: 224.
- a variant may be a polypeptide comprising an amino acid sequence that is set forth herein except for one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10) mutations such as, for example, missense mutations (e.g., conservative substitutions), non-sense mutations, deletions, or insertions.
- a polypeptide may be an immunoglobulin light chain, an immunoglobulin heavy chain and/or a CDR (e.g., any one or more of CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 and/or CDR-H3).
- the present invention includes anti-LAG3 antibodies and antigen-binding fragments thereof that include one or more variants of the framework sequences (e.g., any one or more of FR-L1, FR-L2, FR-L3, FR-L4, FR-H1, FR-H2, FR-H3 and/or FR-H4), CDRs (e.g., 1, 2 or 3 variant CDR-Ls and/or 1, 2, or 3 variant CDR-Hs) and/or immunoglobulin chains (e.g., 1 or 2 variant V L s and/or 1 or 2 variant V H s) whose sequences are specifically set forth herein.
- Such antibodies and antigen-binding fragments may, themselves, be referred to as variants.
- Simple polypeptide chains that include one or more variant FRs, CDR-Ls, CDR-Hs and/or immunoglobulin chains, themselves are also part of the present invention. Polynucleotides encoding such variant polypeptide chains are also part of the present invention.
- the present invention provides anti-LAG3 antibodies and antigen-binding fragments thereof that comprising the amino acid sequence of the V H and V L of the antibodies Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9, which are set forth herein, as well as variants thereof comprising the CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 and CDR-H3 of said Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9 but comprising 70% or more (e.g., 80%, 85%, 90%, 95%, 97% or 99%) overall amino acid sequence identity or similarity to said V H and V L of Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9.
- the CDRs of the antibodies and fragments are identical to those of the V H and V L of Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9 but any differences from such V H and V L occur in the frameworks and/or immunoglobulin constant domains.
- the invention provides variant anti-LAG3 antibodies or antigen-binding fragments thereof (e.g., humanized antibodies such as antagonist humanized antibodies) comprising one or more variant CDRs (e.g., any one or more of CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 and/or CDR-H3) and/or framework regions (e.g., any one or more of FR1, FR2, FR3 and/or FR4) that are set forth herein; and/or one or more variant V L domains and/or one or more variant V H domains of such antibodies or fragments that are set forth herein, for example, with at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or 99.9% sequence identity or similarity to, e.g., SEQ ID NO: 2, 3, 4, 5, 7, 8, 9, 10, 12, 13, 14, 15, 17, 18, 19, 20, 22, 23, 24, 25, 27, 28, 29, 30, 32, 33, 34, 35, 37, 38, 39, 40, 45, 47,
- variant anti-LAG3 antibodies or antigen-binding fragments comprising one or more variant CDRs (e.g., 1, 2 or 3 variant CDR-Ls and/or 1, 2, or 3 variant CDR-H); and/or framework regions (e.g., any one or more of FR1, FR2, FR3 and/or FR4) and/or variant V L and/or variant V H domains (with or without a signal sequence) having 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more mutations.
- the mutations can include point mutations which are conservative or non-conservative amino acid substitutions or point deletions, for example in a framework region and/or in a CDR.
- the present invention provides anti-LAG3 antibodies and antigen binding fragments thereof comprising CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 and CDR-H3 of Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9 but having mutations in the framework regions thereof.
- a “conservatively modified variant” or a “conservative substitution” refers to a variant wherein there is one or more substitutions of amino acids in a polypeptide with other amino acids having similar characteristics (e.g. charge, side-chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.). Such changes can frequently be made without significantly disrupting the biological activity of the antibody or fragment.
- Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al. (1987) Molecular Biology of the Gene , The Benjamin/Cummings Pub. Co., p. 224 (4th Ed.)).
- substitutions of structurally or functionally similar amino acids are less likely to significantly disrupt biological activity.
- Variant anti-LAG3 antibodies or antigen-binding fragments of the present invention comprise one or more CDRs (e.g., 1, 2 or 3 variant CDR-Ls and/or 1, 2, or 3 variant CDR-H); framework regions (e.g., any one or more of FR1, FR2, FR3 and/or FR4); and/or immunoglobulin chains having one or more conservative substitutions.
- CDRs e.g., 1, 2 or 3 variant CDR-Ls and/or 1, 2, or 3 variant CDR-H
- framework regions e.g., any one or more of FR1, FR2, FR3 and/or FR4
- immunoglobulin chains having one or more conservative substitutions e.g., such antibodies and fragments may comprise the amino acid sequences disclosed herein, e.g.
- Function-conservative variants of the anti-LAG3 antibodies and antigen-binding fragments thereof are also part of the present invention. Any of the variants of the anti-LAG3 antibodies and antigen-binding fragments thereof (as discussed herein) may be “function-conservative variants”. Such function-conservative variants may, in some cases, also be characterized as conservatively modified variants.
- “Function-conservative variants,” as used herein, refers to variants of the anti-LAG3 antibodies or antigen-binding fragments thereof in which one or more amino acid residues (e.g., of 1, 2, 3, 4, 5 or 6 CDRs and/or of a V L and/or of a V H ) have been changed without significantly altering one or more functional properties of the antibody or fragment.
- one or more amino acid residues e.g., of 1, 2, 3, 4, 5 or 6 CDRs and/or of a V L and/or of a V H
- a function-conservative variant anti-LAG3 antibody and antigen-binding fragments thereof of the present invention comprise a variant of an immunoglobulin chain (e.g., one or two variant V H s and/or one or more variant V L s) and/or of a CDR (e.g., 1, 2 or 3 variant CDR-Ls and/or 1, 2, or 3 variant CDR-H) of any of those set forth herein, e.g., any of SEQ ID NOs: 2, 3, 4, 5, 7, 8, 9, 10, 12, 13, 14, 15, 17, 18, 19, 20, 22, 23, 24, 25, 27, 28, 29, 30, 32, 33, 34, 35, 37, 38, 39, 40, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95,
- an immunoglobulin chain e.g., one or two variant V H s
- the present invention provides a method for making an antibody or antigen-binding fragment thereof that binds specifically to LAG3 comprising administering, to a non-human host animal (e.g., mouse, rabbit, camel, llama or rat), an effective amount of one or more peptides comprising, consisting of or consisting essentially of an amino acid sequence selected from the group consisting of QEGAPAQL (amino acids 35-42 of SEQ ID NO: 443); RPARRADAGEYRAAVH (amino acids 137-152 of SEQ ID NO: 443); DERGRQRGDFSLW (amino acids 123-135 of SEQ ID NO: 443); SPTIPLQDL (amino acids 45-53 of SEQ ID NO: 443); DERGRQRGDFSL (amino acids 123-134 of SEQ ID NO: 443); and HPLAPGPHPAAPSSWGPRPRRYTVL (amino acids 78-102 of SEQ ID NO: 443), e.g
- the antibody or fragment is isolated from the host animal, e.g., from the serum or blood of the host animal.
- the host animal is administered more than one dose of the peptide.
- isolated peptides are part of the present invention, e.g., fused to an immunogen such as Keyhole Limpet Hemocyanin (KLH), human serum albumin or bovine serum albumin.
- KLH Keyhole Limpet Hemocyanin
- human serum albumin or bovine serum albumin.
- Sequence identity refers to the degree to which the amino acids of two polypeptides are the same at equivalent positions when the two sequences are optimally aligned. Sequence similarity includes identical residues and nonidentical, biochemically related amino acids. Biochemically related amino acids that share similar properties and may be interchangeable are discussed above.
- BLAST ALGORITHMS Altschul et al. (2005) FEBS J. 272(20): 5101-5109; Altschul, S. F., et al., (1990) J. Mol. Biol. 215:403-410; Gish, W., et al., (1993) Nature Genet. 3:266-272; Madden, T. L., et al., (1996) Meth. Enzymol. 266:131-141; Altschul, S. F., et al., (1997) Nucleic Acids Res. 25:3389-3402; Zhang, J., et al., (1997) Genome Res.
- the anti-LAG3 antibodies or antigen-binding fragments thereof of the present invention can comprise one, two, three, four, five, or six of the complementarity determining regions (CDRs) of the immunoglobulin chains disclosed herein (wherein 1, 2, 3, 4, 5 or 6 of the CDRs are, optionally, variants of those set forth herein).
- CDRs complementarity determining regions
- the one, two, three, four, five, or six CDRs may be independently selected from the CDR sequences of the various immunoglobulin chains disclosed herein.
- the one, two, three, four, five, or six CDRs may be selected from the CDR sequences of a single described antibody of the invention.
- the present invention includes anti-LAG3 antibodies and antigen-binding fragments thereof as well as immunoglobulin polypeptide chains that comprise:
- the anti-LAG3 antibodies or antigen-binding fragments thereof of the present invention can comprise at least one antibody heavy chain variable (V H ) domain comprising one or more (e.g., 3) of CDR-H1, CDR-H2 or CDR-H3 of 4A10 V H (e.g., SEQ ID NO: 2); e.g., wherein the CDRs comprise the amino acid sequences set forth in SEQ ID NOs: 3 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 4 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), and 5 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), respectively.
- V H antibody heavy chain variable
- the anti-LAG3 antibodies or antigen-binding fragments thereof of the present invention can comprise at least one antibody light chain variable (V L ) domain comprising one or more (e.g., 3) of CDR-L1, CDR-L2 and CDR-L3 of the 4A10 V L (e.g., SEQ ID NO: 7); e.g., wherein the CDRs comprise the amino acid sequences set forth in SEQ ID NOs: 8 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 9 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions) and 10 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), respectively.
- V L antibody light chain variable
- the anti-LAG3 antibodies or antigen-binding fragments thereof of the present invention can comprise at least one antibody heavy chain variable (V H ) domain comprising one or more (e.g., 3) of CDR-H1, CDR-H2 or CDR-H3 of 19E8 V H (e.g., SEQ ID NO: 12); e.g., wherein the CDRs comprise the amino acid sequences set forth in SEQ ID NOs: 13 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 14 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions) and 15 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), respectively.
- V H antibody heavy chain variable
- the anti-LAG3 antibodies or antigen-binding fragments thereof of the present invention can comprise at least one antibody light chain variable (V L ) domain comprising one or more (e.g., 3) of CDR-L1, CDR-L2 and CDR-L3 of 19E8 V L (e.g., SEQ ID NO: 17); e.g., wherein the CDRs comprise the amino acid sequences set forth in SEQ ID NOs: 18 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 19 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions) and 20 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), respectively.
- V L antibody light chain variable
- the anti-LAG3 antibodies or antigen-binding fragments thereof of the present invention can comprise at least one antibody heavy chain variable (V H ) domain comprising one or more (e.g., 3) of CDR-H1, CDR-H2 or CDR-H3 of 11C9 V H (e.g., SEQ ID NO: 22); e.g., wherein the CDRs comprise the amino acid sequences set forth in SEQ ID NOs: 23 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 24 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions) and 25 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), respectively.
- V H antibody heavy chain variable
- the anti-LAG3 antibodies or antigen-binding fragments thereof of the present invention can comprise at least one antibody light chain variable (V L ) domain comprising one or more (e.g., 3) of CDR-L1, CDR-L2 and CDR-L3 of the 11C9 V L (e.g., SEQ ID NO: 27); e.g., wherein the CDRs comprise the amino acid sequences set forth in SEQ ID NOs: 28 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 29 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions) and 30 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), respectively.
- V L antibody light chain variable
- the anti-LAG3 antibodies or antigen-binding fragments thereof of the present invention can comprise at least one antibody heavy chain variable (V H ) domain comprising one or more (e.g., 3) of CDR-H1, CDR-H2 or CDR-H3 of 22D2 V H (e.g., SEQ ID NO: 32, 106, 108, 110, 112, 114, 116, 118, 120 or 122); e.g., wherein the CDRs comprise the amino acid sequences set forth in SEQ ID NOs: 33 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 34, 446, 454, 455, 456, 457, or 458 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions) and 35 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), respectively.
- V H antibody heavy chain variable
- the anti-LAG3 antibodies or antigen-binding fragments thereof of the present invention can comprise at least one antibody light chain variable (V L ) domain comprising one or more (e.g., 3) of CDR-L1, CDR-L2 and CDR-L3 of 22D2 V L (e.g., SEQ ID NO: 37 or 126); e.g., wherein the CDRs comprise the amino acid sequences set forth in SEQ ID NOs: 38 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 39 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions) and 40 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), respectively.
- V L antibody light chain variable
- the present invention provides an anti-LAG3 antibody or antigen-binding fragment thereof that comprises:
- the present invention provides an anti-LAG3 antibody or antigen-binding fragment thereof that comprises an antibody light chain variable (V L ) domain comprising a CDR-L1, CDR-L2 and CDR-L3 of the 4A10 V L (e.g., SEQ ID NOs: 8 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 9 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions) and 10 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions)); and an antibody heavy chain variable (V H ) domain comprising a CDR-H1, CDR-H2 and CDR-H3 of the 4A10 V H (e.g., SEQ ID NOs: 3 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 4 (or a variant thereof having 1, 2, 3, 4, 5, 6,
- an anti-LAG3 antibody or antigen-binding fragment thereof comprises an antibody light chain variable (V L ) domain comprising a CDR-L1, CDR-L2 and CDR-L3 of the 19E8 V L (e.g., SEQ ID NOs: 18 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 19 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions) and 20 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions)); and an antibody heavy chain variable (V H ) domain comprising a CDR-H1, CDR-H2 and CDR-H3 of the 19E8 V H (e.g., SEQ ID NOs: 13 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 14 (or a variant thereof having 1, 2, 3, 4, 5, 6,
- an anti-LAG3 antibody or antigen-binding fragment thereof comprises an antibody light chain variable (V L ) domain comprising a CDR-L1, CDR-L2 and CDR-L3 of the 11C9 V L (e.g., SEQ ID NOs: 28 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 29 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions) and 30 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions)); and an antibody heavy chain variable (V H ) domain comprising a CDR-H1, CDR-H2 and CDR-H3 of the 11C9 V H (e.g., SEQ ID NOs: 23 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 24 (or a variant thereof having 1, 2, 3, 4, 5, 6,
- an anti-LAG3 antibody or antigen-binding fragment thereof comprises an antibody light chain variable (V L ) domain comprising a CDR-L1, CDR-L2 and CDR-L3 of the 22D2 V L (e.g., SEQ ID NOs: 38 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 39 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions) and 40 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions)); and an antibody heavy chain variable (V H ) domain comprising a CDR-H1, CDR-H2 and CDR-H3 of the 22D2 V H (e.g., SEQ ID NOs: 33 (or a variant thereof having 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 point mutations and/or point deletions), 34, 446, 454, 455, 456, 457 or
- the antibody is a humanized antagonist anti-LAG3 antibody.
- humanized anti-LAG3 antibodies include, but are not limited to, those comprising CDR-L1, CDR-L2 and CDR-L3 of 4A10; and CDR-H1, CDR-H2 and CDR-H3 of 4A10.
- the antibody is a humanized antagonist anti-LAG3 antibody.
- humanized anti-LAG3 antibodies include, but are not limited to, those comprising CDR-L1, CDR-L2 and CDR-L3 of 19E8; and CDR-H1, CDR-H2 and CDR-H3 of 19E8.
- the antibody is a humanized antagonist anti-LAG3 antibody.
- humanized anti-LAG3 antibodies include, but are not limited to, those comprising CDR-L1, CDR-L2 and CDR-L3 of 11C9; and CDR-H1, CDR-H2 and CDR-H3 of 11C9.
- the antibody is a humanized antagonist anti-LAG3 antibody.
- humanized anti-LAG3 antibodies include, but are not limited to, those comprising CDR-L1, CDR-L2 and CDR-L3 of 22D2; and CDR-H1, CDR-H2 and CDR-H3 of 22D2; for example, Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9.
- the present invention provides an anti-LAG3 antibody or antigen-binding fragment thereof or an immunoglobulin polypeptide that comprises:
- the present invention further provides an anti-LAG3 antibody or antigen-binding fragment thereof that comprises the mature V L domain of 4A10, 19E8, 11C9 or 22D2 wherein the V L domain comprises the amino acid sequence of SEQ ID NO: 7, 17, 27, 37, 57, 59, 61, 63, 65, 101, 126, 130, 132, 136, 138, 208, 210, 224, 226, 228, 230, 232, 241, 257, 259, 261, 263, 351, 369, 371, 373, 375, 401, 403, 405, 426, 427, 450-453 or 459-461 or a variant thereof.
- the present invention further provides an anti-LAG3 antibody or antigen-binding fragment thereof that comprises the mature V H domain of 4A10, 19E8, 11C9 or 22D2 wherein the V H domain comprises the amino acid sequence of SEQ ID NO: 2, 12, 22, 32, 45, 47, 49, 51, 53, 55, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 103, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 128, 134, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 212
- the present invention further provides an anti-LAG3 antibody or antigen-binding fragment thereof that comprises the mature V L domain of 4A10 (e.g., amino acids 21-132 of SEQ ID NO:
- V H domain of 4A10 e.g., amino acids 20-136 of SEQ ID NO: 2 or a variant thereof.
- the present invention further provides an anti-LAG3 antibody or antigen-binding fragment thereof that comprises the mature V L domain of 19E8 (e.g., amino acids 21-128 of SEQ ID NO: 17 or a variant thereof) and the mature V H domain of 19E8 (e.g., amino acids 20-138 of SEQ ID NO: 12 or a variant thereof).
- an anti-LAG3 antibody or antigen-binding fragment thereof that comprises the mature V L domain of 19E8 (e.g., amino acids 21-128 of SEQ ID NO: 17 or a variant thereof) and the mature V H domain of 19E8 (e.g., amino acids 20-138 of SEQ ID NO: 12 or a variant thereof).
- the present invention further provides an anti-LAG3 antibody or antigen-binding fragment thereof that comprises the mature V L domain of 11C9 (e.g., amino acids 21-128 of SEQ ID NO: 27 or a variant thereof) and the mature V H domain of 11C9 (e.g., amino acids 20-142 of SEQ ID NO: 22 or a variant thereof).
- an anti-LAG3 antibody or antigen-binding fragment thereof that comprises the mature V L domain of 11C9 (e.g., amino acids 21-128 of SEQ ID NO: 27 or a variant thereof) and the mature V H domain of 11C9 (e.g., amino acids 20-142 of SEQ ID NO: 22 or a variant thereof).
- the present invention further provides an anti-LAG3 antibody or antigen-binding fragment thereof that comprises the mature V L domain of 22D2 (e.g., amino acids 21-131 of SEQ ID NO: 37 or 126 or a variant thereof) and the mature V H domain of 22D2 (e.g., amino acids 21-138 or 21-131 of SEQ ID NO: 32, 106, 108, 110, 112, 114, 116, 118, 120 or 122 or a variant thereof).
- the mature V L domain of 22D2 e.g., amino acids 21-131 of SEQ ID NO: 37 or 126 or a variant thereof
- the mature V H domain of 22D2 e.g., amino acids 21-138 or 21-131 of SEQ ID NO: 32, 106, 108, 110, 112, 114, 116, 118, 120 or 122 or a variant thereof.
- the invention also provides polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 2 or amino acids 20-136 thereof or a variant thereof; or any polynucleotide encoding such a polypeptide.
- the invention also provides polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 7 or amino acids 21-132 thereof or a variant thereof; or any polynucleotide encoding such a polypeptide.
- the invention also provides polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 12 or amino acids 20-138 thereof or a variant thereof; or any polynucleotide encoding such a polypeptide.
- the invention also provides polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 17 or amino acids 21-128 thereof or a variant thereof; or any polynucleotide encoding such a polypeptide.
- the invention also provides polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 22 or amino acids 20-142 thereof or a variant thereof; or any polynucleotide encoding such a polypeptide.
- the invention also provides polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 27 or amino acids 21-128 thereof or a variant thereof; or any polynucleotide encoding such a polypeptide.
- the invention also provides polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 32, 106, 108, 110, 112, 114, 116, 118, 120 or 122 or a mature fragment thereof, e.g., comprising amino acids 20-138 or 20-131 thereof; or a variant thereof; or any polynucleotide encoding such a polypeptide.
- the invention also provides polypeptides comprising the amino acid sequence set forth in SEQ ID NO: 37 or 126 or a mature fragment thereof, e.g., comprising amino acids 21-131 thereof or a variant thereof; or any polynucleotide encoding such a polypeptide.
- the invention also provides polypeptides (e.g., a humanized immunoglobulin chain) comprising the CDR-H1, CDR-H2, and CDR-H3 of a V H domain comprising SEQ ID NO: 2 (e.g., SEQ ID NOs: 3-5); or any polynucleotide encoding such a polypeptide.
- polypeptides e.g., a humanized immunoglobulin chain
- CDR-H1, CDR-H2, and CDR-H3 of a V H domain comprising SEQ ID NO: 2 e.g., SEQ ID NOs: 3-5
- 1, 2 or 3 of such CDRs are variants of the sequence set forth herein.
- the invention also provides polypeptides (e.g., a humanized immunoglobulin chain) comprising the CDR-L1, CDR-L2, and CDR-L3 of a V L domain comprising SEQ ID NO: 7 (e.g., SEQ ID NOs: 8-10); or any polynucleotide encoding such a polypeptide.
- polypeptides e.g., a humanized immunoglobulin chain
- CDR-L1, CDR-L2, and CDR-L3 of a V L domain comprising SEQ ID NO: 7 e.g., SEQ ID NOs: 8-10
- 1, 2 or 3 of such CDRs are variants of the sequence set forth herein.
- the invention also provides polypeptides (e.g., a humanized immunoglobulin chain) comprising the CDR-H1, CDR-H2, and CDR-H3 of a V H domain comprising SEQ ID NO: 12 (e.g., SEQ ID NOs: 13-15); or any polynucleotide encoding such a polypeptide.
- polypeptides e.g., a humanized immunoglobulin chain
- CDR-H1, CDR-H2, and CDR-H3 of a V H domain comprising SEQ ID NO: 12 e.g., SEQ ID NOs: 13-15
- 1, 2 or 3 of such CDRs are variants of the sequence set forth herein.
- the invention also provides polypeptides (e.g., a humanized immunoglobulin chain) comprising the CDR-L1, CDR-L2, and CDR-L3 of a V L domain comprising SEQ ID NO: 17 (e.g., SEQ ID NOs: 18-20); or any polynucleotide encoding such a polypeptide.
- polypeptides e.g., a humanized immunoglobulin chain
- CDR-L1, CDR-L2, and CDR-L3 of a V L domain comprising SEQ ID NO: 17 e.g., SEQ ID NOs: 18-20
- 1, 2 or 3 of such CDRs are variants of the sequence set forth herein.
- the invention also provides polypeptides (e.g., a humanized immunoglobulin chain) comprising the CDR-H1, CDR-H2, and CDR-H3 of a V H domain comprising SEQ ID NO: 22 (e.g., SEQ ID NOs: 23-25); or any polynucleotide encoding such a polypeptide.
- polypeptides e.g., a humanized immunoglobulin chain
- CDR-H1, CDR-H2, and CDR-H3 of a V H domain comprising SEQ ID NO: 22 e.g., SEQ ID NOs: 23-25
- 1, 2 or 3 of such CDRs are variants of the sequence set forth herein.
- the invention also provides polypeptides (e.g., a humanized immunoglobulin chain) comprising the CDR-L1, CDR-L2, and CDR-L3 of a V L domain comprising SEQ ID NO: 27 (e.g., SEQ ID NOs: 28-30); or any polynucleotide encoding such a polypeptide.
- polypeptides e.g., a humanized immunoglobulin chain
- CDR-L1, CDR-L2, and CDR-L3 of a V L domain comprising SEQ ID NO: 27 e.g., SEQ ID NOs: 28-30
- 1, 2 or 3 of such CDRs are variants of the sequence set forth herein.
- the invention also provides polypeptides (e.g., a humanized immunoglobulin chain) comprising the CDR-H1, CDR-H2, and CDR-H3 of a V H domain comprising SEQ ID NO: 32, 106, 108, 110, 112, 114, 116, 118, 120 or 122 (e.g., SEQ ID NOs: 33, 34 (or 446, 454, 455, 456, 457 or 458) or 35); or any polynucleotide encoding such a polypeptide.
- polypeptides e.g., a humanized immunoglobulin chain
- polypeptides e.g., a humanized immunoglobulin chain
- CDR-H1 CDR-H2
- CDR-H3 of a V H domain comprising SEQ ID NO: 32, 106, 108, 110, 112, 114, 116, 118, 120 or 122
- SEQ ID NOs: 33, 34 or 446, 454, 455, 456,
- the invention also provides polypeptides (e.g., a humanized immunoglobulin chain) comprising the CDR-L1, CDR-L2, and CDR-L3 of a V L domain comprising SEQ ID NO: 37 or 126 (e.g., SEQ ID NOs: 38-40); or any polynucleotide encoding such a polypeptide.
- polypeptides e.g., a humanized immunoglobulin chain
- CDR-L1, CDR-L2, and CDR-L3 of a V L domain comprising SEQ ID NO: 37 or 126 (e.g., SEQ ID NOs: 38-40); or any polynucleotide encoding such a polypeptide.
- 1, 2 or 3 of such CDRs are variants of the sequence set forth herein.
- the present invention includes crystalline compositions of the anti-LAG3 antibodies and antigen-binding fragments thereof of the present invention.
- the present invention further comprises the polynucleotides encoding any of the polypeptides or immunoglobulin chains of anti-LAG3 antibodies and antigen-binding fragments thereof disclosed herein (including variants of the amino acid chains specifically set forth herein).
- the present invention includes the polynucleotides described in SEQ ID NOs: 1, 6, 11, 16, 21, 26, 31, 36, 46, 48, 50, 52, 54, 56, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157,
- the present invention includes anti-LAG3 antibodies and antigen-binding fragments thereof comprising immunoglobulin heavy and light chains (e.g., variable regions thereof) and/or heavy and light chain CDRs encoded by the polynucleotides set forth herein.
- the present invention includes anti-LAG3 antibodies and antigen-binding fragments thereof comprising a heavy chain immunoglobulin encoded by a polynucleotide comprising the nucleotide sequence set forth in SEQ ID NO: 107 (or encoding a variable domain thereof) and a light chain immunoglobulin encoded by the nucleotide sequence set forth in SEQ ID NO: 125 (or encoding a variable domain thereof).
- the present invention also includes anti-LAG3 antibodies and antigen-binding fragments thereof comprising a heavy chain immunoglobulin encoded by a polynucleotide comprising the nucleotide sequence set forth in SEQ ID NO: 115 (or encoding a variable domain thereof) and a light chain immunoglobulin encoded by the nucleotide sequence set forth in SEQ ID NO: 125 (or encoding a variable domain thereof).
- the present invention provides polynucleotide encoding the
- the invention also provides polynucleotide comprising the nucleotide sequence set forth in SEQ ID NO: 1 or nucleotide 58-408 thereof; or a variant thereof.
- the invention also provides polynucleotide comprising the nucleotide sequence set forth in SEQ ID NO: 6 or nucleotide 61-396 thereof; or a variant thereof.
- the invention also provides polynucleotide comprising the nucleotide sequence set forth in SEQ ID NO:11 or nucleotide 58-414 thereof; or a variant thereof.
- the invention also provides polynucleotides comprising the nucleotide sequence set forth in SEQ ID NO: 16 or nucleotide 61-384 thereof; or a variant thereof.
- the invention also provides polynucleotides comprising the nucleotide sequence set forth in SEQ ID NO: 21 or nucleotide 58-426 thereof; or a variant thereof.
- the invention also provides polynucleotides comprising the nucleotide sequence set forth in SEQ ID NO: 26 or nucleotide 61-384 thereof; or a variant thereof.
- the invention also provides polynucleotides comprising the nucleotide sequence set forth in SEQ ID NO: 31 or nucleotide 61-447 thereof; or a variant thereof.
- the invention also provides polynucleotides comprising the nucleotide sequence set forth in SEQ ID NO: 36 or nucleotide 61-547 thereof; or a variant thereof
- Variant polynucleotides set forth herein include those that hybridize under low, moderate or high stringency conditions to the polynucleotides set forth herein or to polynucleotides that encode the polypeptides set forth herein, and encode immunoglobulin chains of anti-LAG3 antibodies or antigen-binding fragments thereof which maintain the ability to specifically bind to LAG3 (human and/or cynomolgous monkey, e.g., Macaca fascicularis or Macaca mulatta ).
- LAG3 human and/or cynomolgous monkey, e.g., Macaca fascicularis or Macaca mulatta
- a first polynucleotide molecule is “hybridizable” to a second polynucleotide molecule when a single stranded form of the first polynucleotide molecule can anneal to the second polynucleotide molecule under the appropriate conditions of temperature and solution ionic strength (see Sambrook, et al., supra).
- the conditions of temperature and ionic strength determine the “stringency” of the hybridization.
- Typical low stringency hybridization conditions include 55° C., 5 ⁇ SSC, 0.1% SDS and no formamide; or 30% formamide, 5 ⁇ SSC, 0.5% SDS at 42° C.
- Typical moderate stringency hybridization conditions are 40% formamide, with 5 ⁇ or 6 ⁇ SSC and 0.1% SDS at 42° C.
- High stringency hybridization conditions are 50% formamide, 5 ⁇ or 6 ⁇ SSC at 42° C. or, optionally, at a higher temperature (e.g., 57° C., 59° C., 60° C., 62° C., 63° C., 65° C. or 68° C.).
- SSC is 0.15M NaCl and 0.015M Na-citrate.
- Hybridization requires that the two polynucleotide contain complementary sequences, although, depending on the stringency of the hybridization, mismatches between bases are possible.
- the appropriate stringency for hybridizing polynucleotides depends on the length of the polynucleotides and the degree of complementation, variables well known in the art. The greater the degree of similarity or homology between two nucleotide sequences, the higher the stringency under which the nucleic acids may hybridize. For hybrids of greater than 100 nucleotides in length, equations for calculating the melting temperature have been derived (see Sambrook, et al., supra, 9.50-9.51).
- oligonucleotide For hybridization with shorter polynucleotides, e.g., oligonucleotides, the position of mismatches becomes more important, and the length of the oligonucleotide determines its specificity (see Sambrook, et al., supra, 11.7-11.8).
- an polynucleotide for example DNA, encoding the immunoglobulin polypeptide chains of the anti-LAG3 antibodies or antigen-binding fragments set forth herein forms part of the present invention.
- the polynucleotide encodes at least one mature immunoglobulin polypeptide light chain variable (V L ) domain and at least one mature immunoglobulin polypeptide heavy chain variable (V H ) domain, wherein the V L domain comprises a CDR-L1, CDR-L2 and CDR-L3 having a sequence selected from SEQ ID NOs: 8-10, 18-20 28-30 and 38-40, and the V H domain comprises CDR-H1, CDR-H2 and CDR-H3 having a sequence selected from SEQ ID NOs: 3-5, 13-15, 23-25 and 33-35.
- the nucleic acid encodes the 4A10, 11C9, 19E8 or 22D2 mature light chain variable region and/or the 4A10, 11C9, 19E8 or 22D2 mature heavy chain variable region sequences.
- the polynucleotide encodes both a light chain and a heavy chain on a single polynucleotide molecule, and, in other embodiments of the invention, the light and heavy chains are encoded on separate polynucleotide molecules, e.g., in separate or common host cells.
- the polynucleotides further encodes a signal sequence.
- the polynucleotide encodes a mature immunoglobulin light chain variable (V L ) domain comprising the CDR-L1, CDR-L2 and CDR-L3 of SEQ ID NO: 7. Variants of such polynucleotides are also part of the present invention.
- the polynucleotide encodes a mature immunoglobulin light chain variable (V L ) domain comprising the CDR-L1, CDR-L2 and CDR-L3 of SEQ ID NO: 17. Variants of such polynucleotides are also part of the present invention.
- the polynucleotide encodes a mature immunoglobulin light chain variable (V L ) domain comprising the CDR-L1, CDR-L2 and CDR-L3 of SEQ ID NO: 27. Variants of such polynucleotides are also part of the present invention.
- the polynucleotide encodes a mature immunoglobulin light chain variable (V L ) domain comprising the CDR-L1, CDR-L2 and CDR-L3 of SEQ ID NO: 37 or 126. Variants of such polynucleotides are also part of the present invention.
- the polynucleotide encodes a mature immunoglobulin heavy chain variable (V H ) domain comprising the CDR-H1, CDR-H2 and CDR-H3 of SEQ ID NO: 2. Variants of such polynucleotides are also part of the present invention.
- the polynucleotide encodes a mature immunoglobulin heavy chain variable (V H ) domain comprising the CDR-H1, CDR-H2 and CDR-H3 of SEQ ID NO: 12. Variants of such polynucleotides are also part of the present invention.
- the polynucleotide encodes a mature immunoglobulin heavy chain variable (V H ) domain comprising the CDR-H1, CDR-H2 and
- the polynucleotide encodes a mature immunoglobulin heavy chain variable (V H ) domain comprising the CDR-H1, CDR-H2 and CDR-H3 of SEQ ID NO: 32, 106, 108, 110, 112, 114, 116, 118, 120 or 122. Variants of such polynucleotides are also part of the present invention.
- the polynucleotide encodes the immunoglobulin light chain variable (V L ) domain of SEQ ID NO: 7, 17, 27 and/or 37. Variants of such polynucleotides are also part of the present invention.
- the polynucleotide encodes the immunoglobulin heavy chain variable (V H ) domain of SEQ ID NO: 2, 12, 22, 32, 106, 108, 110, 112, 114, 116, 118, 120 and/or 122. Variants of such polynucleotides are also part of the present invention.
- This present invention also provides vectors, e.g., expression vectors, such as plasmids, comprising the polynucleotides of the invention (sequences set forth herein and variants thereof, e.g., SEQ ID NO: 125, 105, 107, 109, 111, 113, 115, 117, 119 and/or 121), wherein the polynucleotide is operably linked to control sequences that are recognized by a host cell when the host cell is transfected with the vector.
- expression vectors such as plasmids
- host cells comprising a polynucleotide (e.g., integrated into the genome, e.g., a chromosome, of the host cell) or vector of the present invention and methods for producing the antibody or antigen-binding fragment thereof or polypeptide disclosed herein comprising culturing a host cell harboring an expression vector or polynucleotide encoding the immunoglobulin chains of the antibody or antigen-binding fragment thereof in culture medium, and isolating the antigen or antigen-binding fragment thereof from the host cell or culture medium.
- the anti-LAG3 antibodies and antigen-binding fragments thereof disclosed herein bind human and/or cynomolgous monkey, e.g., Macaca fascicularis or Macaca mulatta LAG3, e.g., with a K D value of at least about 100 nM (1 ⁇ 10 ⁇ 7 M); at least about 10 nM; or at least about 1 nM.
- the antibodies have K D values of at least about 200 pM (2 ⁇ 10 ⁇ 1 ° M), 100 pM, 50 pM, 20 pM, 10 pM, 5 pM or even 2 pM.
- the K D is about 2.77 ⁇ 10 ⁇ 12 M, 1.47 ⁇ 10 ⁇ 11 M, 1.47 ⁇ 10 ⁇ 09 M, or 9.03 ⁇ 10 ⁇ 11 M; or a higher affinity.
- the K D is as measured in a KinExA assay or similar kinetic exclusion assay. See e.g., Darling et al. Assay and Drug Dev. Tech. 2(6): 647-657 (2004).
- Hybridoma cells that produce parental (e.g., mouse) monoclonal anti-LAG3 antibodies or antigen-binding fragments thereof discussed herein may be produced by methods which are commonly known in the art. Such isolated hybridomas are part of the present invention. These methods include, but are not limited to, the hybridoma technique originally developed by Kohler, et al., (1975) (Nature 256:495-497), as well as the trioma technique (Hering, et al., (1988) Biomed. Biochim. Acta. 47:211-216 and Hagiwara, et al., (1993) Hum. Antibod.
- Hybridomas 4:15) the human B-cell hybridoma technique (Kozbor, et al., (1983) Immunology Today 4:72 and Cote, et al., (1983) Proc. Natl. Acad. Sci. U.S.A 80:2026-2030), the EBV-hybridoma technique (Cole, et al., in Monoclonal Antibodies and Cancer Therapy , Alan R. Liss, Inc., pp. 77-96, 1985), and electric field based electrofusion using a Cyto Pulse large chamber cull fusion electroporator (Cyto Pulse Sciences, Inc., Glen Burnie, Md.).
- mouse splenocytes are isolated and fused with PEG or by electrofusion to a mouse myeloma cell line based upon standard protocols.
- the resulting hybridomas may then be screened for the production of antigen-specific antibodies.
- single cell suspensions of splenic lymphocytes from immunized mice may by fused to one-sixth the number of P3X63-Ag8.653 nonsecreting mouse myeloma cells (ATCC, CRL 1580) with 50% PEG.
- Cells may be plated at approximately 2 ⁇ 10 5 cells/mL in a flat bottom microtiter plate, followed by a two week incubation in selective medium containing 20% fetal Clone Serum, 18% “653” conditioned media, 5% origen (IGEN), 4 mM L-glutamine, 1 mM L-glutamine, 1 mM sodium pyruvate, 5 mM HEPES, 0.055 mM 2-mercaptoethanol, 50 units/ml penicillin, 50 mg/ml streptomycin, 50 mg/ml gentamycin and 1 ⁇ HAT (Sigma; the HAT is added 24 hours after the fusion). After two weeks, cells may be cultured in medium in which the HAT is replaced with HT.
- selective medium containing 20% fetal Clone Serum, 18% “653” conditioned media, 5% origen (IGEN), 4 mM L-glutamine, 1 mM L-glutamine, 1 mM sodium pyruvate, 5
- Individual wells may then be screened by ELISA for anti-LAG3 monoclonal IgG antibodies. Once extensive hybridoma growth occurs, medium can be observed usually after 10-14 days.
- the antibody secreting hybridomas may be replated, screened again, and if still positive for human IgG, anti-LAG3 monoclonal antibodies, can be subcloned at least twice by limiting dilution.
- the stable subclones may then be cultured in vitro to generate small amounts of antibody in tissue culture medium for characterization.
- the present invention includes methods for making an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention comprising culturing a hybridoma cell that expresses the antibody or fragment under condition favorable to such expression and, optionally, isolating the antibody or fragment from the hybridoma.
- the anti-LAG3 antibodies disclosed herein may also be produced recombinantly (e.g., in an E. coli /T7 expression system).
- nucleic acids encoding the anti-LAG3 antibody immunoglobulin molecules of the invention e.g., V H or V L ; e.g., any one or more of SEQ ID NO: 125, 105, 107, 109, 111, 113, 115, 117, 119 and/or 121
- V H or V L any one or more of SEQ ID NO: 125, 105, 107, 109, 111, 113, 115, 117, 119 and/or 121
- the present invention includes methods for expressing an antibody or antigen-binding fragment thereof or immunoglobulin chain thereof in a host cell (e.g., bacterial host cell such as E. coli such as BL21 or BL21DE3) comprising expressing T7 RNA polymerase in the cell which also includes a polynucleotide encoding an immunoglobulin chain that is operably linked to a T7 promoter.
- a host cell e.g., bacterial host cell such as E. coli such as BL21 or BL21DE3
- T7 RNA polymerase in the cell which also includes a polynucleotide encoding an immunoglobulin chain that is operably linked to a T7 promoter.
- a bacterial host cell such as a E.
- coli includes a polynucleotide encoding the T7 RNA polymerase gene operably linked to a lac promoter and expression of the polymerase and the chain is induced by incubation of the host cell with IPTG (isopropyl-beta-D-thiogalactopyranoside).
- IPTG isopropyl-beta-D-thiogalactopyranoside
- Transformation can be by any known method for introducing polynucleotides into a host cell.
- Methods for introduction of heterologous polynucleotides into mammalian cells are well known in the art and include dextran-mediated transfection, calcium phosphate precipitation, polybrene-mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, biolistic injection and direct microinjection of the DNA into nuclei.
- nucleic acid molecules may be introduced into mammalian cells by viral vectors. Methods of transforming cells are well known in the art. See, for example, U.S. Pat. Nos. 4,399,216; 4,912,040; 4,740,461 and 4,959,455.
- the present invention includes recombinant methods for making an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention, or an immunoglobulin chain thereof, comprising (i) introducing a polynucleotide (e.g., any one or more of SEQ ID NO: 125, 105, 107, 109, 111, 113, 115, 117, 119 and/or 121) encoding one or more immunoglobulin chains of the antibody or fragment (e.g., heavy chain immunoglobulin of 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 and/or light chain immunoglobulin of 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9), for example, wherein the polynucleotide is in a vector and
- an antibody or antigen-binding fragment comprising more than one immunoglobulin chain, e.g., an antibody that comprises two heavy immunoglobulin chains and two light immunoglobulin chains
- co-expression of the chains in a single host cell leads to association of the chains, e.g., in the cell or on the cell surface or outside the cell if such chains are secreted, so as to form the antibody or antigen-binding fragment molecule.
- the methods include those wherein only a heavy immunoglobulin chain or only a light immunoglobulin chain (e.g., any of those discussed herein including mature fragments and/or variable domains thereof) is expressed.
- the present invention also includes anti-LAG3 antibodies and antigen-binding fragments thereof comprising a heavy chain immunoglobulin (or variable domain thereof or comprising the CDRs thereof) encoded by a polynucleotide comprising the nucleotide sequence set forth in SEQ ID NO: 115 (or encoding a variable domain thereof) and a light chain immunoglobulin (or variable domain thereof or comprising the CDRs thereof) encoded by the nucleotide sequence set forth in SEQ ID NO: 125 (or encoding a variable domain thereof) which are the product of such production methods, and, optionally, the purification methods set forth herein.
- Anti-LAG3 antibodies can also be synthesized by any of the methods set forth in U.S. Pat. No. 6,331,415.
- Eukaryotic and prokaryotic host cells including mammalian cells as hosts for expression of the anti-LAG3 antibodies or fragments or immunoglobulin chains disclosed herein are well known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC). These include, inter alia, Chinese hamster ovary (CHO) cells, NSO, SP2 cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), A549 cells, 3T3 cells, HEK-293 cells and a number of other cell lines.
- Mammalian host cells include human, mouse, rat, dog, monkey, pig, goat, bovine, horse and hamster cells.
- Cell lines of particular preference are selected through determining which cell lines have high expression levels.
- Other cell lines that may be used are insect cell lines (e.g., Spodoptera frugiperda or Trichoplusia ni ), amphibian cells, bacterial cells, plant cells and fungal cells.
- Fungal cells include yeast and filamentous fungus cells including, for example, Pichia pastoris, Pichia finlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia minuta ( Ogataea minuta, Pichia lindneri ), Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorpha, Kluyveromyces sp., Kluyveromyces lactis, Candida albicans, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, Trichoderma reesei, Chrysospor
- Pichia sp. any Saccharomyces sp., Hansenula polymorpha , any Kluyveromyces sp., Candida albicans , any Aspergillus sp., Trichoderma reesei, Chrysosporium lucknowense , any Fusarium sp., Yarrowia lipolytica , and Neurospora crassa.
- the glutamine synthetase gene expression system (the GS system) is a common approach for enhancing expression under certain conditions.
- the GS system is discussed in whole or part in connection with European Patent Nos. 0 216 846, 0 256 055, and 0 323 997 and European Patent Application No. 89303964.4.
- the mammalian host cells e.g., CHO
- the polynucleotide encoding the immunoglobulin chain comprises a glutamine synthetase gene which complements the lack of the gene in the host cell.
- the present invention includes methods for purifying an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention comprising introducing a sample (e.g., culture medium, cell lysate or cell lysate fraction, e.g., a soluble fraction of the lysate) comprising the antibody or fragment to a purification medium (e.g., cation-exchange medium, anion-exchange medium, hydrophobic exchange medium, affinity purification medium (e.g., protein-A, protein-G, protein-A/G, protein-L)) and either collecting purified antibody or fragment from the flow-through fraction of said sample that does not bind to the medium; or, discarding the flow-through fraction and eluting bound antibody or fragment from the medium and collecting the eluate.
- a sample e.g., culture medium, cell lysate or cell lysate fraction, e.g., a soluble fraction of the lysate
- a purification medium e.g.,
- the medium is in a column to which the sample is applied.
- the purification method is conducted following recombinant expression of the antibody or fragment in a host cell, e.g., wherein the host cell is first lysed and, optionally, the lysate is purified of insoluble materials prior to purification on a medium; or wherein the antibody or fragment is secreted into the culture medium by the host cell and the medium or a fraction thereof is applied to the purification medium.
- glycoproteins produced in a particular cell line or transgenic animal will have a glycosylation pattern that is characteristic for glycoproteins produced in the cell line or transgenic animal. Therefore, the particular glycosylation pattern of an antibody will depend on the particular cell line or transgenic animal used to produce the antibody.
- all antibodies encoded by the nucleic acid molecules provided herein, or comprising the amino acid sequences provided herein comprise the instant invention, independent of the glycosylation pattern the antibodies may have.
- antibodies with a glycosylation pattern comprising only non-fucosylated N-glycans may be advantageous, because these antibodies have been shown to typically exhibit more potent efficacy than their fucosylated counterparts both in vitro and in vivo (See for example, Shinkawa et al., J. Biol. Chem. 278: 3466-3473 (2003); U.S. Pat. Nos. 6,946,292 and 7,214,775). These antibodies with non-fucosylated N-glycans are not likely to be immunogenic because their carbohydrate structures are a normal component of the population that exists in human serum IgG.
- the present invention includes anti-LAG3 antibodies and antigen-binding fragments thereof (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) comprising N-linked glycans that are typically added to immunoglobulins produced in Chinese hamster ovary cells (CHO N-linked glycans) or to engineered yeast cells (engineered yeast N-linked glycans), such as, for example, Pichia pastoris .
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- N-linked glycans that are typically added to immunoglobulins produced in Chinese hamster ovary cells (CHO N-linked glycans) or to engineered yeast cells (engineered yeast N-linked glycans), such as, for example
- the antibody or antigen-binding fragment comprises one or more of the “engineered yeast N-linked glycans” or “CHO N-linked glycans” that are set forth in FIG. 6 (e.g., G0 and/or G0-F and/or G1 and/or G1-F and/or and/or G2-F and/or Man5).
- the antibody or antigen-binding fragment comprises the engineered yeast N-linked glycans, i.e., G0 and/or G1 and/or G2, optionally, further including Man5.
- the antibody or antigen-binding fragment comprise the CHO N-linked glycans, i.e., G0-F, G1-F and G2-F, optionally, further including G0 and/or G1 and/or G2 and/or Man5.
- about 80% to about 95% e.g., about 80-90%, about 85%, about 90% or about 95%) of all N-linked glycans on the antibody or antigen-binding fragment immunoglobulin chains are engineered yeast N-linked glycans or CHO N-linked glycans. See Nett et al. Yeast. 28(3): 237-252 (2011); Hamilton et al. Science.
- an engineered yeast cell is GFI5.0 or YGLY8316 or strains set forth in U.S. Pat. No. 7,795,002 or Zha et al. Methods Mol Biol. 988:31-43 (2013). See also international patent application publication no. WO2013/066765.
- the present invention includes polyclonal anti-LAG3 antibodies and antigen-binding fragments thereof, e.g., a composition comprising a plurality of anti-LAG3 antibodies and fragments, which include one or more of the anti-LAG3 antibodies or antigen-binding fragments thereof of the present invention (e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 or Ab9), and methods of use thereof.
- a polyclonal antibody is an antibody which was produced among or in the presence of one or more other, non-identical antibodies.
- polyclonal antibodies are produced from collections of different B-lymphocytes, e.g., the B-lymphocyte of an animal treated with an immunogen of interest, which produces a population of different antibodies but which are all directed to the immunogen.
- polyclonal antibodies are obtained directly from an immunized animal, e.g., spleen, serum or ascites fluid.
- the present invention includes “antagonist” anti-LAG3 antibodies and antigen-binding fragments thereof and methods of use thereof, e.g., humanized, antagonist anti-LAG3 antibodies and fragments.
- An antagonist anti-LAG3 antibody or antigen-binding fragment thereof antagonizes an activity of LAG3 (e.g., human LAG3) such as by inhibiting LAG3 binding to MHC class II molecules; competing with MHC class II molecules for LAG3 binding; or when a cell or subject is contacted with the antibody or fragment, a biological phenotype associated with LAG3 antagonism, such as stimulation of antigen-specific T-cell production of IL-2, is produced.
- LAG3 e.g., human LAG3
- the present invention includes bispecific and bifunctional antibodies and antigen-binding fragments having a binding specificity for LAG3 and another antigen such as, for example, PD-1 or PD-L1, and methods of use thereof.
- the anti-PD1 chains comprise the amino acid sequence of SEQ ID NOs: 41 and 42 or of SEQ ID NOs: 43 and 44.
- a bispecific or bifunctional antibody is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites.
- Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab′ fragments. See, e.g., Songsivilai, et al., (1990) Clin. Exp. Immunol.
- bispecific antibodies may be formed as “diabodies” (Holliger, et al., (1993) PNAS USA 90:6444-6448) or as “Janusins” (Traunecker, et al., (1991) EMBO J. 10:3655-3659 and Traunecker, et al., (1992) Int. J. Cancer Suppl. 7:51-52).
- the present invention further includes anti-LAG3 antigen-binding fragments of the anti-LAG3 antibodies disclosed herein.
- the antibody fragments include F(ab) 2 fragments, which may be produced by enzymatic cleavage of an IgG by, for example, pepsin.
- Fab fragments may be produced by, for example, reduction of F(ab) 2 with dithiothreitol or mercaptoethylamine.
- a Fab fragment is a V L -C L chain appended to a V H -C H1 chain by a disulfide bridge.
- a F(ab) 2 fragment is two Fab fragments which, in turn, are appended by two disulfide bridges.
- the Fab portion of an F(ab) 2 molecule includes a portion of the F c region between which disulfide bridges are located.
- An F v fragment is a V L or V H region.
- Immunoglobulins may be assigned to different classes depending on the amino acid sequences of the constant domain of their heavy chains. There are at least five major classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgG-1, IgG-2, IgG-3 and IgG-4; IgA-1 and IgA-2.
- the invention comprises anti-LAG3 antibodies and antigen-binding fragments of any of these classes or subclasses of antibodies.
- the anti-LAG3 antibody or antigen-binding fragment comprises a heavy chain constant region, e.g. a human constant region, such as ⁇ 1, ⁇ 2, ⁇ 3, or ⁇ 4 human heavy chain constant region or a variant thereof.
- the anti-LAG3 antibody or antigen-binding fragment comprises a light chain constant region, e.g. a human light chain constant region, such as lambda or kappa human light chain region or variant thereof.
- the human heavy chain constant region can be ⁇ 4 and the human light chain constant region can be kappa.
- the Fc region of the antibody is ⁇ 4 with a Ser228Pro mutation (Schuurman, J et. al., Mol. Immunol. 38: 1-8, 2001).
- different constant domains may be appended to humanized V L and V H regions derived from the CDRs provided herein.
- a heavy chain constant domain other than human IgG1 may be used, or hybrid IgG1/IgG4 may be utilized.
- human IgG1 antibodies provide for long half-life and for effector functions, such as complement activation and antibody-dependent cellular cytotoxicity, such activities may not be desirable for all uses of the antibody.
- a human IgG4 constant domain for example, may be used.
- the present invention includes anti-LAG3 antibodies and antigen-binding fragments thereof which comprise an IgG4 constant domain, e.g., antagonist, humanized anti-LAG3 antibodies and fragments, and methods of use thereof.
- the IgG4 constant domain can differ from the native human IgG4 constant domain (Swiss-Prot Accession No.
- the anti-LAG3 antibodies and antigen-binding fragments thereof are engineered antibodies to include modifications to framework residues within the variable domains of a parental (e.g., mouse) monoclonal antibody, e.g. to improve the properties of the antibody or fragment.
- framework modifications are made to decrease the immunogenicity of the antibody or fragment. This is usually accomplished by replacing non-CDR residues in the variable domains (i.e. framework residues) in a parental (e.g. rodent) antibody or fragment with analogous residues from the immune repertoire of the species in which the antibody is to be used, e.g. human residues in the case of human therapeutics.
- Such an antibody or fragment is referred to as a “humanized” antibody or fragment.
- an engineered (e.g. humanized) antibody In some cases it is desirable to increase the affinity, or alter the specificity of an engineered (e.g. humanized) antibody.
- One approach is to “backmutate” one or more framework residues to the corresponding germline sequence. More specifically, an antibody or fragment that has undergone somatic mutation can contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody or fragment framework sequences to the germline sequences from which the antibody or fragment is derived.
- Another approach is to revert to the original parental (e.g., rodent) residue at one or more positions of the engineered (e.g. humanized) antibody, e.g. to restore binding affinity that may have been lost in the process of replacing the framework residues. (See, e.g., U.S. Pat. No. 5,693,762, U.S. Pat. No. 5,585,089 and U.S. Pat. No. 5,530,101.)
- Table 2 shows regions where a framework region amino acid position (using Kabat numbering system) differs from the germline and how this position can be backmutated to the germline by the indicated substitutions:
- Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as “deimmunization” and is described in further detail in U.S. Pat. No. 7,125,689.
- the antibodies of the present disclosure do not contain asparagine isomerism sites.
- an asparagine (Asn) residue may be changed to Gln or Ala to reduce the potential for formation of isoaspartate at any Asn-Gly sequences, particularly within a CDR.
- a similar problem may occur at a Asp-Gly sequence. Reissner and Aswad (2003) Cell. Mol. Life Sci. 60:1281. Isoaspartate formation may debilitate or completely abrogate binding of an antibody to its target antigen. See, Presta (2005) J. Allergy Clin. Immunol. 116:731 at 734.
- the asparagine is changed to glutamine (Gin).
- any methionine residues may be changed to Lys, Leu, Ala, or Phe or other amino acids in order to reduce the possibility that the methionine sulfur would oxidize, which could reduce antigen-binding affinity and also contribute to molecular heterogeneity in the final antibody preparation. Id.
- the methionine is changed to alanine (Ala).
- Al alanine
- Antibodies with such substitutions are subsequently screened to ensure that the substitutions do not decrease the affinity or specificity of the antibody for LAG3, or other desired biological activity to unacceptable levels.
- immunoglobulin chains set forth above 4A10, 19E8, 11C9 and 22D2 contain residues that are double-underscored.
- the scope of the present invention includes antibodies, antigen-binding fragments, polypeptides and polynucleotides as discussed herein wherein any one or more of such residues are mutated to any other residue including, for example, those of the stabilizing variant sequences set forth above in Table 3.
- Mouse anti-LAG3 antibodies and antigen-binding fragments can be humanized by various methods known in the art (see e.g., humanization methods set forth in WO2005/047326 or U.S. Pat. No. 7,846,443.).
- mouse anti-LAG3 antibodies and fragments are humanized by a method wherein computer aided molecular modeling is used for identifying CDR loops in non-human immunoglobulin chains. This identification is made based upon the three-dimensional structure of the immunoglobulin chain and the position of the loops in the chain.
- Human frameworks obtained from the IMGD Database, into which the non-human loops will be introduced, are selected based on best matches (by amino acid sequence comparison) with the non-human sequence both in the frameworks and in the CDRs.
- FR4 in the V H domain VJ regions, for the human germlines, are compared with the corresponding non-human VJ regions; and, regarding FR4 in V L domain, J-kappa and J-Lambda regions, of human germline sequences, are compared with the corresponding non-human J-Kappa and J-Lambda regions.
- the molecular models are constructed and used for identifying residues in the V L -V H interface as well as for identifying residues that can potentially alter the CDR conformations and hence binding to antigen. If necessary, mutations in the immunoglobulin chain may be introduced so as to achieve desirable properties e.g., antigen binding.
- Developability Filters are established through the use of molecular modeling techniques.
- Developability Filters are criteria used for filtering features out of the final immunoglobulin chain so as to avoid unwanted effects.
- Molecular models are further used to identify solvent exposed amino acids that can result in unwanted effects such as glycosylation, deamidation and oxidation. Such effects on the antibody can lead to changes in the antibody conformation and hence function. Such problems can occur, for example, during scale-up or over a prolonged period of time when exposed to extreme chemical/physical environments. Again, if necessary, mutations in the chains can be introduced so as achieve the desired properties.
- the Developability Filters are typically introduced early on in the design stage of the humanized chains to eliminate/minimize these potential problems. Humanized antibodies are further subjected to design criteria, such as good expressibility and desirable isoelectric points.
- the anti-LAG3 antibodies may also be engineered to include modifications within the Fc region, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or effector function (e.g., antigen-dependent cellular cytotoxicity).
- modifications within the Fc region typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or effector function (e.g., antigen-dependent cellular cytotoxicity).
- the antibodies and antigen-binding fragments thereof can be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more functional properties of the antibody or fragment.
- chemically modified e.g., one or more chemical moieties can be attached to the antibody
- modified to alter its glycosylation again to alter one or more functional properties of the antibody or fragment.
- the numbering of residues in the Fc region is that of the EU index of Kabat. Any such anti-LAG3 antibody or antigen-binding fragment thereof having the modifications (e.g., Fc modifications) and/or alterations discussed herein are part of the present invention.
- the anti-LAG3 antibodies e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragments thereof disclosed herein e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- modified (or blocked) Fc regions to provide altered effector functions. See, e.g., U.S. Pat. No. 5,624,821; WO2003/086310; WO2005/120571; WO2006/0057702.
- modifications can be used to enhance or suppress various reactions of the immune system, with possible beneficial effects in diagnosis and therapy.
- Alterations of the Fc region include amino acid changes (substitutions, deletions and insertions), glycosylation or deglycosylation, and adding multiple Fc. Changes to the Fc can also alter the half-life of antibodies in therapeutic antibodies, enabling less frequent dosing and thus increased convenience and decreased use of material. See Presta (2005) J. Allergy Clin. Immunol. 116:731 at 734-35.
- the anti-LAG3 antibody e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragment e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- IgG4 isotype antibody or fragment comprising a serine to proline mutation at a position corresponding to position 228 (S228P; EU index) in the hinge region of the heavy chain constant region.
- S228P S228P
- EU index position 228
- This mutation has been reported to abolish the heterogeneity of inter-heavy chain disulfide bridges in the hinge region (Angal et al. supra; position 241 is based on the Kabat numbering system).
- the hinge region of CH1 is modified such that the number of cysteine residues in the hinge region is increased or decreased. This approach is described further in U.S. Pat. No. 5,677,425.
- the number of cysteine residues in the hinge region of CH1 is altered, for example, to facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
- the Fc hinge region of an anti-LAG3 antibody or antigen-binding fragment (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) is mutated to decrease the biological half-life of the antibody or fragment. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody or fragment has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding. This approach is described in further detail in U.S. Pat. No. 6,165,745.
- SpA Staphylococcyl protein A
- the anti-LAG3 antibody e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragment e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- T252L, T254S, T256F as described in U.S. Pat. No. 6,277,375.
- the antibody can be altered within the CH1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Pat. Nos. 5,869,046 and 6,121,022.
- the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector function(s) of the anti-LAG3 antibody or antigen-binding fragment.
- one or more amino acids selected from amino acid residues 234, 235, 236, 237, 297, 318, 320 and 322 can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand but retains the antigen-binding ability of the parent antibody.
- the effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260.
- one or more amino acids selected from amino acid residues 329, 331 and 322 can be replaced with a different amino acid residue such that the anti-LAG3 antibody has altered C1q binding and/or reduced or abolished complement dependent cytotoxicity (CDC).
- CDC complement dependent cytotoxicity
- one or more amino acid residues within amino acid positions 231 and 239 are altered to thereby alter the ability of the anti-LAG3 antibody or antigen-binding fragment thereof to fix complement. This approach is described further in PCT Publication WO 94/29351.
- the Fc region is modified to decrease the ability of the anti-LAG3 antibody (e.g., humanized antibodies such as antagonist humanized antibodies) or antigen-binding fragment (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to decrease the affinity of the antibody or fragment for an Fc ⁇ receptor by modifying one or more amino acids at the following positions: 238, 239, 243, 248, 249, 252, 254, 255, 256, 258, 264, 265, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 301, 303, 305, 307, 309, 312, 315, 320, 322, 324, 326, 327, 329,
- ADCC
- the Fc region is modified to decrease the ability of the anti-LAG3 antibody (e.g., humanized antibodies such as antagonist humanized antibodies) or antigen-binding fragment (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to mediate effector function and/or to increase anti-inflammatory properties by modifying residues 243 and 264.
- the Fc region of the antibody or fragment is modified by changing the residues at positions 243 and 264 to alanine.
- the Fc region is modified to decrease the ability of the antibody or fragment to mediate effector function and/or to increase anti-inflammatory properties by modifying residues 243, 264, 267 and 328.
- the anti-LAG3 antibody e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragment e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a particular glycosylation pattern For example, an aglycosylated antibody or fragment can be made (i.e., the antibody lacks glycosylation).
- the glycosylation pattern of an antibody or fragment may be altered to, for example, increase the affinity or avidity of the antibody or fragment for a LAG3 antigen.
- Such modifications can be accomplished by, for example, altering one or more of the glycosylation sites within the antibody or fragment sequence. For example, one or more amino acid substitutions can be made that result removal of one or more of the variable region framework glycosylation sites to thereby eliminate glycosylation at that site. Such aglycosylation may increase the affinity or avidity of the antibody or fragment for antigen. See, e.g., U.S. Pat. Nos. 5,714,350 and 6,350,861.
- Anti-LAG3 antibodies include those produced in lower eukaryote host cells, in particular fungal host cells such as yeast (e.g., Pichia pastoris ) and filamentous fungi, that have been genetically engineered to produce glycoproteins that have mammalian- or human-like glycosylation patterns (See for example, Choi et al, (2003) Proc. Natl. Acad. Sci.
- a particular advantage of these genetically modified host cells over currently used mammalian cell lines is the ability to control the glycosylation profile of glycoproteins that are produced in the cells such that compositions of glycoproteins can be produced wherein a particular N-glycan structure predominates (see, e.g., U.S. Pat. No. 7,029,872 and U.S. Pat. No. 7,449,308).
- These genetically modified host cells have been used to produce antibodies that have predominantly particular N-glycan structures (See for example, Li et al., (2006) Nat. Biotechnol. 24: 210-215).
- the anti-LAG3 antibodies e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragments thereof disclosed herein e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the anti-LAG3 antibodies further include those produced in lower eukaryotic host cells and which comprise fucosylated and non-fucosylated hybrid and complex N-glycans, including bisected and multiantennary species, including but not limited to N-glycans such as GlcNAc (1-4) Man 3 GlcNAc 2 ; Gal (1-4) GlcNAc (1-4) Man 3 GlcNAc 2 ; NANA (1-4) Gal (1-4) GlcNAc (1-4) Man 3 GlcNAc 2 .
- the anti-LAG3 antibodies may comprise antibodies or fragments having at least one hybrid N-glycan selected from the group consisting of GlcNAcMan 5 GlcNAc 2 ; GalGlcNAcMan 5 GlcNAc 2 ; and NANAGalGlcNAcMan 5 GlcNAc 2 .
- the hybrid N-glycan is the predominant N-glycan species in the composition.
- the hybrid N-glycan is a particular N-glycan species that comprises about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the hybrid N-glycans in the composition.
- the anti-LAG3 antibodies e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragments thereof provided herein e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the anti-LAG3 antibodies comprise antibodies and fragments having at least one complex N-glycan selected from the group consisting of GlcNAcMan 3 GlcNAc 2 ; GalGlcNAcMan 3 GlcNAc 2 ; NANAGalGlcNAcMan 3 GlcNAc 2 ; GlcNAc 2 Man 3 GlcNAc 2 ; GalGlcNAc 2 Man 3 GlcNAc 2 ; Gal 2 GlcNAc 2 Man 3 GlcNAc 2 ; Gal 2 GlcNAc 2 Man 3 GlcNAc 2 ; NANAGal 2 GlcNAc 2 Man 3 GlcNAc
- the complex N-glycan is the predominant N-glycan species in the composition.
- the complex N-glycan is a particular N-glycan species that comprises about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the complex N-glycans in the composition.
- the anti-LAG3 antibody and antigen-binding fragment N-glycan is fucosylated.
- the fucose is in an ⁇ 1,3-linkage with the GlcNAc at the reducing end of the N-glycan, an ⁇ 1,6-linkage with the GlcNAc at the reducing end of the N-glycan, an ⁇ 1,2-linkage with the Gal at the non-reducing end of the N-glycan, an ⁇ 1,3-linkage with the GlcNac at the non-reducing end of the N-glycan, or an ⁇ 1,4-linkage with a GlcNAc at the non-reducing end of the N-glycan.
- the glycoform is in an ⁇ 1,3-linkage or ⁇ 1,6-linkage fucose to produce a glycoform selected from the group consisting of Man 5 GlcNAc 2 (Fuc), GlcNAcMan 5 GlcNAc 2 (Fuc), Man 3 GlcNAc 2 (Fuc), GlcNAcMan 3 GlcNAc 2 (Fuc), GlcNAc 2 Man 3 GlcNAc 2 (Fuc), GalGlcNAc 2 Man 3 GlcNAc 2 (Fuc), Gal 2 GlcNAc 2 Man 3 GlcNAc 2 (Fuc), NANAGal 2 GlcNAc 2 Man 3 GlcNAc 2 (Fuc), and NANA 2 Gal 2 GlcNAc 2 Man 3 GlcNAc 2 (Fuc); in an ⁇ 1,3-linkage or ⁇ 1,4-linkage fucose to produce a glycoform selected from the group consisting of Man 5 GlcNAc 2 (Fu
- the anti-LAG3 antibodies e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragments thereof comprise high mannose N-glycans, including but not limited to, Man 8 GlcNAc 2 , Man 7 GlcNAc 2 , Man 6 GlcNAc 2 , Man 5 GlcNAc 2 , Man 4 GlcNAc 2 , or N-glycans that consist of the Man 3 GlcNAc 2 N-glycan structure.
- the complex N-glycans further include fucosylated and non-fucosylated bisected and multiantennary species.
- an anti-LAG3 antibody or antigen-binding fragment thereof comprises an immunoglobulin Fc domain that comprises glycans that comprise sialic acid (e.g., N-Acetylneuraminic acid), e.g., terminal ⁇ 2,3-sialic acid or terminal ⁇ 2,6-sialic acid.
- sialic acid e.g., N-Acetylneuraminic acid
- the glycans on the Fc are 5, 10, 20, 50, 90% or more sialylated species.
- the Fc comprises the mutations at positions 297, 264 and/or 243.
- N-glycan and “glycoform” are used interchangeably and refer to an N-linked oligosaccharide, for example, one that is attached by an asparagine-N-acetylglucosamine linkage to an asparagine residue of a polypeptide.
- N-linked glycoproteins contain an N-acetylglucosamine residue linked to the amide nitrogen of an asparagine residue in the protein.
- glycoproteins The predominant sugars found on glycoproteins are glucose, galactose, mannose, fucose, N-acetylgalactosamine (GalNAc), N-acetylglucosamine (GlcNAc) and sialic acid (e.g., N-acetyl-neuraminic acid (NANA)).
- GalNAc N-acetylgalactosamine
- GlcNAc N-acetylglucosamine
- sialic acid e.g., N-acetyl-neuraminic acid (NANA)
- N-glycans have a common pentasaccharide core of Man 3 GlcNAc 2 (“Man” refers to mannose; “Glc” refers to glucose; and “NAc” refers to N-acetyl; GlcNAc refers to N-acetylglucosamine).
- Man refers to mannose
- Glc refers to glucose
- NAc refers to N-acetyl
- GlcNAc refers to N-acetylglucosamine
- N-glycan structures are presented with the non-reducing end to the left and the reducing end to the right.
- the reducing end of the N-glycan is the end that is attached to the Asn residue comprising the glycosylation site on the protein.
- N-glycans differ with respect to the number of branches (antennae) comprising peripheral sugars (e.g., GlcNAc, galactose, fucose and sialic acid) that are added to the Man 3 GlcNAc 2 (“Man3”) core structure which is also referred to as the “trimannose core”, the “pentasaccharide core” or the “paucimannose core”.
- branches comprising peripheral sugars (e.g., GlcNAc, galactose, fucose and sialic acid) that are added to the Man 3 GlcNAc 2 (“Man3”) core structure which is also referred to as the “trimannose core”, the “pentasaccharide core” or the “paucimannose core”.
- Man3 Man 3 GlcNAc 2
- N-glycans are classified according to their branched constituents (e.g., high mannose, complex or hybrid).
- a “complex” type N-glycan typically has at least one GlcNAc attached to the 1,3 mannose arm and at least one GlcNAc attached to the 1,6 mannose arm of a “trimannose” core.
- Complex N-glycans may also have galactose (“Gal”) or N-acetylgalactosamine (“GalNAc”) residues that are optionally modified with sialic acid or derivatives (e.g., “NANA” or “NeuAc”, where “Neu” refers to neuraminic acid and “Ac” refers to acetyl).
- Complex N-glycans may also have intrachain substitutions comprising “bisecting” GlcNAc and core fucose (“Fuc”).
- Complex N-glycans may also have multiple antennae on the “trimannose core,” often referred to as “multiple antennary glycans.”
- a “hybrid” N-glycan has at least one GlcNAc on the terminal of the 1,3 mannose arm of the trimannose core and zero or more mannoses on the 1,6 mannose arm of the trimannose core.
- the various N-glycans are also referred to as “glycoforms.”
- G-2 refers to an N-glycan structure that can be characterized as Man 3 GlcNAc 2
- G-1 refers to an N-glycan structure that can be characterized as GlcNAcMan 3 GlcNAc 2
- G0 refers to an N-glycan structure that can be characterized as GlcNAc 2 Man 3 GlcNAc 2
- G1 refers to an N-glycan structure that can be characterized as GalGlcNAc 2 Man 3 GlcNAc 2
- G2 refers to an N-glycan structure that can be characterized as Gal 2 GlcNAc 2 Man 3 GlcNAc 2
- A1 refers to an N-glycan structure that can be characterized as NANAG
- the terms G-2′′, “G-1”, “G0”, “G1”, “G2”, “A1”, and “A2” refer to N-glycan species that lack fucose attached to the GlcNAc residue at the reducing end of the N-glycan.
- the term includes an “F”
- the “F” indicates that the N-glycan species contains a fucose residue on the GlcNAc residue at the reducing end of the N-glycan.
- G0F, G1F, G2F, A1F, and A2F all indicate that the N-glycan further includes a fucose residue attached to the GlcNAc residue at the reducing end of the N-glycan.
- Lower eukaryotes such as yeast and filamentous fungi do not normally produce N-glycans that produce fucose.
- multiantennary N-glycan refers to N-glycans that further comprise a GlcNAc residue on the mannose residue comprising the non-reducing end of the 1,6 arm or the 1,3 arm of the N-glycan or a GlcNAc residue on each of the mannose residues comprising the non-reducing end of the 1,6 arm and the 1,3 arm of the N-glycan.
- multiantennary N-glycans can be characterized by the formulas GlcNAc (2-4) Man 3 GlcNAc 2 , Gal (1-4) GlcNAc (2-4) Man 3 GlcNAc 2 , or NANA (1-4) Gal (1-4) GlcNAc (2-4) Man 3 GlcNAc 2 .
- the term “1-4” refers to 1, 2, 3, or 4 residues.
- bisected N-glycan refers to N-glycans in which a GlcNAc residue is linked to the mannose residue at the reducing end of the N-glycan.
- a bisected N-glycan can be characterized by the formula GlcNAc 3 Man 3 GlcNAc 2 wherein each mannose residue is linked at its non-reducing end to a GlcNAc residue.
- a multiantennary N-glycan is characterized as GlcNAc 3 Man 3 GlcNAc 2
- the formula indicates that two GlcNAc residues are linked to the mannose residue at the non-reducing end of one of the two arms of the N-glycans and one GlcNAc residue is linked to the mannose residue at the non-reducing end of the other arm of the N-glycan.
- the anti-LAG3 antibodies may further contain one or more glycosylation sites in either the light or heavy chain immunoglobulin variable region. Such glycosylation sites may result in increased immunogenicity of the antibody or fragment or an alteration of the pK of the antibody due to altered antigen-binding (Marshall et al.
- Each anti-LAG3 antibody e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragment e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- pI isoelectric point
- some antibodies, such as Ab6, have a pI of about 6.3.
- Each anti-LAG3 antibody e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragment e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- T M1 the temperature of initial unfolding
- the melting point of an antibody or fragment can be measured using differential scanning calorimetry (Chen et al (2003) Pharm Res 20:1952-60; Ghirlando et al (1999) Immunol Lett 68:47-52) or circular dichroism (Murray et al. (2002) J. Chromatogr Sci 40:343-9).
- anti-LAG3 antibodies e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragments thereof e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- CE capillary electrophoresis
- MALDI-MS Alexander A J and Hughes D E (1995) Anal Chem 67:3626-32).
- anti-LAG3 antibodies e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragments thereof are selected that have minimal aggregation effects, which can lead to the triggering of an unwanted immune response and/or altered or unfavorable pharmacokinetic properties.
- antibodies and fragments are acceptable with aggregation of 25% or less, 20% or less, 15% or less, 10% or less, or 5% or less. Aggregation can be measured by several techniques, including size-exclusion column (SEC), high performance liquid chromatography (HPLC), and light scattering.
- the anti-LAG3 antibodies may also be conjugated to a chemical moiety.
- a chemical moiety may be, inter alia, a polymer, a radionuclide or a cytotoxic factor.
- the chemical moiety is a polymer which increases the half-life of the antibody or fragment in the body of a subject.
- Suitable polymers include, but are not limited to, hydrophilic polymers which include but are not limited to polyethylene glycol (PEG) (e.g., PEG with a molecular weight of 2 kDa, 5 kDa, 10 kDa, 12 kDa, 20 kDa, 30 kDa or 40 kDa), dextran and monomethoxypolyethylene glycol (mPEG).
- PEG polyethylene glycol
- mPEG monomethoxypolyethylene glycol
- the anti-LAG3 antibodies may also be conjugated with labels such as 99 Tc 90 Y 111 In, 32 P, 14 C, 125 I, 3 H, 131 I, 11 C, 15 O, 13 N, 18 F, 35 S, 51 Cr, 57 To, 226 Ra, 60 Co, 59 Fe, 57 Se, 152 Eu, 67 CU, 217 Ci, 211 At, 212 Pb, 47 Sc, 109 Pd, 234 Th, and 40 K, 157 Gd, 55 Mn, 52 Tr, and 56 Fe.
- labels such as 99 Tc 90 Y 111 In, 32 P, 14 C, 125 I, 3 H, 131 I, 11 C, 15 O, 13 N, 18 F, 35 S, 51 Cr, 57 To, 226 Ra, 60 Co, 59 Fe, 57 Se, 152 Eu, 67 CU, 217 Ci, 211 At, 212 Pb, 47 Sc, 109 Pd, 234 Th, and 40 K, 157 Gd, 55 Mn, 52 Tr, and
- the anti-LAG3 antibodies may also be PEGylated, for example to increase its biological (e.g., serum) half-life.
- PEG polyethylene glycol
- the antibody or fragment typically is reacted with a reactive form of polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment.
- PEG polyethylene glycol
- the PEGylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer).
- a reactive PEG molecule or an analogous reactive water-soluble polymer.
- polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide.
- the antibody or fragment to be PEGylated is an aglycosylated antibody or fragment. Methods for PEGylating proteins are known in the art and can be applied to the antibodies of the invention. See, e.g., EP 0 154 316 and EP 0 401 384.
- the anti-LAG3 antibodies may also be conjugated with fluorescent or chemiluminescent labels, including fluorophores such as rare earth chelates, fluorescein and its derivatives, rhodamine and its derivatives, isothiocyanate, phycoerythrin, phycocyanin, allophycocyanin, o-phthaladehyde, fluorescamine, 152 Eu, dansyl, umbelliferone, luciferin, luminal label, isoluminal label, an aromatic acridinium ester label, an imidazole label, an acridimium salt label, an oxalate ester label, an aequorin label, 2,3
- the anti-LAG3 antibodies may also be conjugated to a cytotoxic factor such as diptheria toxin, Pseudomonas aeruginosa exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins and compounds (e.g., fatty acids), dianthin proteins, Phytoiacca americana proteins PAPI, PAPII, and PAP-S, momordica charantia inhibitor, curcin, crotin, saponaria officinalis inhibitor, mitogellin, restrictocin, phenomycin, and enomycin.
- a cytotoxic factor such as diptheria toxin, Pseudomonas aeruginosa exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins and compounds (e.g., fatty
- any method known in the art for conjugating the anti-LAG3 antibodies e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragments thereof e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- 4A10, 19E8, 11C9 and/or 22D2 e.g.,
- an effective amount of the anti-LAG3 antibodies or antigen-binding fragments thereof of the present invention which are disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) which may be effective for such treatment or prevention.
- an effective amount of the anti-LAG3 antibodies or antigen-binding fragments thereof of the present invention which are disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) which may be effective for such treatment or prevention.
- such a subject suffers from and is treated for cancer, e.g., a solid tumor which includes, in addition to the tumor cells, tumor infiltrating lymphocytes (TILs), such as T-cells, expressing LAG3, e.g., osteosarcoma, rhabdomyosarcoma, neuroblastoma, kidney cancer, leukemia, renal transitional cell cancer, bladder cancer, Wilm's cancer, ovarian cancer, pancreatic cancer, breast cancer (e.g., characterized by a mutation in BRCA1 and/or BRCA2), prostate cancer, bone cancer, lung cancer (e.g., non-small cell lung cancer), gastric cancer, colorectal cancer, cervical cancer, synovial sarcoma, head and neck cancer, squamous cell carcinoma, multiple myeloma, renal cell cancer, retinoblastoma, hepatoblastoma, hepatocellular carcinoma, melanoma, rhabdoid
- TILs tumor
- the present invention also provides methods for treating or preventing an infectious disease in a subject by administering an effective amount of anti-LAG3 antibodies or antigen-binding fragments thereof disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to the subject which may be effective for such treatment or prevention.
- the infectious disease is viral infection.
- the infectious disease is bacterial infection.
- the infectious disease is parasitic infection.
- the infectious disease is fungal infection.
- the present invention includes methods of treating any of the cancers or infectious diseases discussed herein by administering a therapeutically effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) optionally in association with any of the further chemotherapeutic agents or therapeutic procedures discussed herein as well as compositions including such an antibody or fragment in association with such a further chemotherapeutic agent.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the viral infection is infection with a virus selected from the group consisting of human immunodeficiency virus (HIV), ebola virus, hepatitis virus (A, B, or C), herpes virus (e.g., VZV, HSV-I, HAV-6, HSV-II, and CMV, Epstein Barr virus), adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, coronavirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus or arboviral encephalitis virus.
- HCV human immunodeficiency virus
- ebola virus ebola virus
- hepatitis virus A, B, or C
- herpes virus e.g., VZ
- the bacterial infection is infection with a bacteria selected from the group consisting of Chlamydia , rickettsial bacteria, mycobacteria, staphylococci, streptococci, pneumonococci, meningococci and gonococci, klebsiella, proteus, serratia, pseudomonas, Legionella, Corynebacterium diphtheriae, Salmonella , bacilli, Vibrio cholerae, Clostridium tetan, Clostridium botulinum, Bacillus anthricis, Yersinia pestis, Mycobacterium leprae, Mycobacterium lepromatosis , and Borriella.
- a bacteria selected from the group consisting of Chlamydia , rickettsial bacteria, mycobacteria, staphylococci, streptococci, pneumonococci, meningococci and gonococci, klebsiella, proteus, ser
- the fungal infection is infection with a fungus selected from the group consisting of Candida ( albicans, krusei, glabrata, tropicalis , etc.), Cryptococcus neoformans, Aspergillus ( fumigatus, niger , etc.), Genus Mucorales ( mucor, absidia, rhizopus ), Sporothrix schenkii, Blastomyces dermatitidis, Paracoccidioides brasiliensis, Coccidioides immitis and Histoplasma capsulatum.
- Candida albicans, krusei, glabrata, tropicalis , etc.
- Cryptococcus neoformans Aspergillus ( fumigatus, niger , etc.)
- Genus Mucorales mucor, absidia, rhizopus
- Sporothrix schenkii Blastomyces dermatitidis
- Paracoccidioides brasiliensis Coccidio
- the parasitic infection is infection with a parasite selected from the group consisting of Entamoeba histolytica, Balantidium coli, Naegleria fowleri, Acanthamoeba, Giardia lambia, Cryptosporidium, Pneumocystis carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei, Trypanosoma cruzi, Leishmania donovani, Toxoplasma gondii, Nippostrongylus brasiliensis.
- a parasite selected from the group consisting of Entamoeba histolytica, Balantidium coli, Naegleria fowleri, Acanthamoeba, Giardia lambia, Cryptosporidium, Pneumocystis carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei, Trypanosoma cruzi, Le
- the present invention provides a method for preventing or inhibiting LAG3 binding to MHC class II, enhancing antigen-specific T-cell activation or stimulating T-cell production of interleukin-2 in a subject (e.g., human), for example, wherein the subject suffers from cancer or infectious disease (e.g., as discussed herein) comprising administering an effective amount of anti-LAG3 antibody or antigen-binding fragment thereof (e.g., 4A10, 19E8, 11C9, 22D2, Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9, to the subject, optionally, in association with a further chemotherapeutic agent, e.g., pembrolizumab or nivolumab.
- a further chemotherapeutic agent e.g., pembrolizumab or nivolumab.
- the scope of the present invention provides uses of the anti-LAG3 antibodies or antigen-binding fragments thereof disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) in the manufacture of a medicament for treating cancer or infectious disease in a subject.
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing osteosarcoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing rhabdomyosarcoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing neuroblastoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing kidney cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing leukemia comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing renal transitional cell cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing bladder cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing Wilm's cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing ovarian cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing pancreatic cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing breast cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the method for treating or preventing breast cancer comprises administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention in association with an anthracycline (e.g., doxorubicin and/or epirubicin) and/or a taxane (e.g., paclitaxel and/or docetaxel).
- an anthracycline and taxane is in association with 5-fluorouracil (5-FU), cyclophosphamide, and carboplatin.
- the anti-LAG3 antibody or fragment is administered in association with trastuzumab, optionally with a taxane and/or pertuzumab.
- the present invention includes methods for treating or preventing prostate cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing bone cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing lung cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- the method for treating or preventing lung cancer comprises administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention in association with bevacizumab and/or cetuximab.
- the present invention includes methods for treating or preventing non-small cell lung cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the method for treating or preventing non-small cell lung cancer comprises administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention in association with cisplatin, carboplatin, paclitaxel, albumin-bound paclitaxel, docetaxel, gemcitabine, vinorelbine, irinotecan, etoposide, vinblastine, and/or pemetrexed.
- the present invention includes methods for treating or preventing gastric cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing colorectal cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the method for treating or preventing colorectal cancer comprises administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention in association with 5-Fluorouracil (5-FU), capecitabine, irinotecan and/or oxaliplatin (e.g., FOLFOX, FOLFIRI, FOLFOXIRI or CapeOx).
- 5-Fluorouracil 5-Fluorouracil
- capecitabine ecitabine
- irinotecan e.g., FOLFOX, FOLFIRI, FOLFOXIRI or CapeOx
- oxaliplatin e.g., FOLFOX, FOLFIRI, FOLFOXIRI or CapeOx.
- the present invention includes methods for treating or preventing cervical cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing synovial sarcoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing head and neck cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing squamous cell carcinoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing multiple myeloma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing renal cell cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing retinoblastoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing hepatoblastoma comprising administering (optionally in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present and/or Ab9) to a subject, such as a human, in need thereof.
- the present invention includes methods for treating or preventing hepatocellular carcinoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing melanoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing rhabdoid tumor of the kidney comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing Ewing's sarcoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing chondrosarcoma comprising administering (optionally in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing brain cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing glioblastoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- the method for treating or preventing glioblastoma multiforme comprises administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention in association with temozolomide.
- the present invention includes methods for treating or preventing meningioma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing pituitary adenoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing vestibular schwannoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing a primitive neuroectodermal tumor comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing medulloblastoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing astrocytoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing anaplastic astrocytoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- the method for treating or preventing refractory anaplastic astrocytoma comprises administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention in association with temozolomide.
- the present invention includes methods for treating or preventing oligodendroglioma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing ependymoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing choroid plexus papilloma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing polycythemia vera comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing thrombocythemia comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing idiopathic myelfibrosis comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing soft tissue sarcoma comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing thyroid cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing endometrial cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing carcinoid cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing liver cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing breast cancer (e.g., characterized by a mutation in BRCA1 and/or BRCA2) comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing gastric cancer comprising administering (optionally, in association with pembrolizumab or nivolumab) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing an infection with human immunodeficiency virus (HIV) in a subject comprising administering) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- HIV human immunodeficiency virus
- the subject is administered an anti-viral therapeutic agent such as a protease inhibitor, a nucleoside/nucleotide reverse transcriptase inhibitor, a non-nucleoside reverse transcriptase inhibitors, an entry inhibitor, a fusion inhibitor or an integrase inhibitors.
- an anti-viral therapeutic agent such as a protease inhibitor, a nucleoside/nucleotide reverse transcriptase inhibitor, a non-nucleoside reverse transcriptase inhibitors, an entry inhibitor, a fusion inhibitor or an integrase inhibitors.
- the present invention includes methods for treating or preventing an infection with Bundibugyo virus (BDBV), Sudan virus (SUDV), Tai Forest virus (TAFV) and/or ebola virus in a subject comprising administering) an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-viral therapeutic agent such as one or more antibodies that specifically bind to the BDBV, SUDV, TAFV or ebola virus or a nucleoside RNA polymerase inhibitor; or a vaccine.
- the present invention includes methods for treating or preventing an infection with hepatitis A virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with hepatitis B virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with hepatitis C virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-viral therapeutic agent such as interferon and/or ribavirin.
- the present invention includes methods for treating or preventing an infection with herpes virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with vesicular stomatitis virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with herpes simplex virus-I in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with HAV-6 virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with herpes simplex virus-II in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with cytomegalovirus (CMV) in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with epstein Barr virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with adenovirus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with influenza virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with flavivirus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with echovirus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with rhinovirus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with coxsackie virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with coronavirus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with respiratory syncytial virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with mumps virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with rotavirus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with measles virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with rubella virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with parvovirus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with vaccinia virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with human T-lymphotrophic virus (HTLV) in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with dengue virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with papillomavirus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with molluscum virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with poliovirus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with rabies virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with John Cunningham virus (JC virus) in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with arboviral encephalitis virus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-viral therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Chlamydia trachomatis in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with rickettsia bacteria in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with mycobacteria in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with staphylococci in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with streptococci in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with pneumonococci in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with meningococci in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with gonococci in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with klebsiella in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with proteus (e.g., P. vulgaris, P. mirabilis , or P. penneri ) in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with serratia in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with pseudomonas in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with legionella in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with Corynebacterium diphtheriae in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with Salmonella (e.g., Salmonella bongori or Salmonella enterica ) in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with bacilli in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2;
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2;
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with Vibrio cholerae in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with Clostridium tetani in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with Clostridium botulinum in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with Bacillus anthracis in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with Yersinia pestis in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with Leptospira in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with Borrelia in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-bacterial antibiotic.
- the present invention includes methods for treating or preventing an infection with Candida albicans in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Candida krusei in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Candida glabrata in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Candida tropicalis in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Cryptococcus neoformans in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Aspergillus fumigatus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Aspergillus niger in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Mucorales mucor in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Mucorales absidia in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Mucorales rhizopus in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Sporothrix schenkii in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Blastomyces dermatitidis in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Paracoccidioides brasiliensis in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Coccidioides immitis in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Histoplasma capsulatum in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the subject is administered an anti-fungal therapeutic agent.
- the present invention includes methods for treating or preventing an infection with Entamoeba histolytica in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing an infection with Balantidium coli in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing an infection with Naegleria fowleri in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing an infection with Acanthamoeba sp. in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing an infection with Giardia lambia in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing an infection with Cryptosporidium sp. in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing an infection with Pneumocystis carinii in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing an infection with Plasmodium vivax in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing an infection with Babesia microti in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing an infection with Trypanosoma brucei in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing an infection with Trypanosoma cruzi in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing an infection with Leishmania donovani in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing an infection with Toxoplasma gondii in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes methods for treating or preventing an infection with Nippostrongylus brasiliensis in a subject comprising administering an effective amount of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) to a subject, such as a human, in need thereof.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a “subject” is a mammal such as, for example, a human, dog, cat, horse, cow, mouse, rat, monkey (e.g., cynomolgous monkey, e.g., Macaca fascicularis or Macaca mulatta ) or rabbit.
- a mammal such as, for example, a human, dog, cat, horse, cow, mouse, rat, monkey (e.g., cynomolgous monkey, e.g., Macaca fascicularis or Macaca mulatta ) or rabbit.
- the anti-LAG3 antibodies e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragments thereof of the present invention which are disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) may be used alone, or in association with other, further therapeutic agents and/or therapeutic procedures, for treating or preventing any disease such as cancer, e.g., as discussed herein, in a subject in need of such treatment or prevention.
- Compositions or kits e.g., pharmaceutical compositions comprising a pharmaceutically acceptable carrier, comprising such antibodies and fragments in association with further therapeutic agents are also part of the present invention.
- the anti-LAG3 antibodies e.g., humanized antibody such as antagonist humanized antibodies
- antigen-binding fragments thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-cancer therapeutic agent or immunomodulatory drug such as an immunomodulatory receptor inhibitor, e.g., an antibody or antigen-binding fragment thereof that specifically binds to the receptor.
- an anti-LAG3 antibody e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an inhibitors e.g., a small organic molecule or an antibody or antigen-binding fragment thereof
- an MTOR mimmalian target of rapamycin
- a cytotoxic agent e.g., a platinum agent a BRAF inhibitor, a CDK4/6 inhibitor an EGFR inhibitor, a VEGF inhibitor, a microtubule stabilizer, a taxane
- RANK Receptor activator of nuclear factor kappa-B
- RANKL Receptor activator of
- an anti-LAG3 antibody e.g., humanized antibody such as antagonist humanized antibodies
- antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-PD1 e.g., pembrolizumab, nivolumab, CT-011
- anti-PDL1, anti-CTLA4, anti-TIM3, anti-CS1, e.g., elotuzumab
- anti-KIR2DL1/2/3 e.g., lirilumab
- anti-CD27 anti-CD137 (e.g., urelumab)
- anti-GITR e.g., TRX518)
- anti-PD-L1 e.g., BMS-936559, MSB0010718C or MPDL3280A
- anti-PD1 e.g.
- the molecular weight of the polyethylene glycol (PEG) moiety, on a PEGylated IL-10 molecule is about 12,000 daltons or about 20,000 daltons.
- PEGylated IL-10 e.g., PEGylated human IL-10
- PEGylated IL-10 is: (PEG) b-L-NH-IL-10; wherein b is 1-9 and L is a C 2-12 alkyl linker moiety covalently attached to a nitrogen (N) of the single amino acid residue of the IL-10.
- the IL-10 of PEGylated IL-10 has the formula: [X—O(CH 2 CH 2 O) n ] b -L-NH-IL-10, wherein X is H or C 1-4 alkyl; n is 20 to 2300; b is 1 to 9; and L is a C 1-ii alkyl linker moiety which is covalently attached to the nitrogen (N) of the alpha amino group at the amino terminus of one IL-10 subunit; provided that when b is greater than 1, the total of n does not exceed 2300. See U.S. Pat. No. 7,052,686.
- the anti-IL-10 antibody or antigen-binding fragment thereof comprises the CDRs set forth below:
- CDR-L1 KTSQNIFENLA (SEQ ID NO: 466)
- CDR-L2 NASPLQA (SEQ ID NO: 467)
- CDR-L3 HQYYSGYT (SEQ ID NO: 468)
- CDR-H1 GFTFSDYHMA (SEQ ID NO: 469)
- CDR-H2 SITLDATYTYYRDSVRG (SEQ ID NO: 470)
- the anti-TSLP antibody or antigen-binding fragment thereof comprises the CDRs set forth below:
- the anti-CD27 antibody or antigen-binding fragment thereof comprises the CDRs set forth below:
- the present invention includes compositions comprising an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) in association with pembrolizumab; as well as methods for treating or preventing cancer in a subject comprising administering an effective amount of the anti-LAG3 antibody or antigen-binding fragment thereof in association with pembrolizumab (e.g., pembrolizumab dosed at 200 mg once every three weeks) to the subject.
- the subject is also administered in association with a another further therapeutic agent.
- an anti-LAG3 antibody e.g., humanized antibody such as antagonist humanized antibodies
- antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a pembrolizumab antibody which comprises an immunoglobulin heavy chain (or CDR-H1, CDR-H2 and CDR-H3 thereof) comprising the amino acid sequence:
- an anti-LAG3 antibody e.g., humanized antibody such as antagonist humanized antibodies
- antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an antibody comprising an immunoglobulin heavy chain or CDR-H1, CDR-H2 and CDR-H3 thereof) comprising the amino acid sequence:
- an anti-LAG3 antibody e.g., humanized antibody such as antagonist humanized antibodies
- antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- 13-cis-retinoic acid 3-[5-(methylsulfonylpiperadinemethyl)-indolyl]-quinolone, 4-hydroxytamoxifen, 5-deooxyuridine, 5′-deoxy-5-fluorouridine, 5-fluorouracil, 6-mecaptopurine, 7-hydroxystaurosporine, A-443654, abirateroneacetate, abraxane, ABT-578, acolbifene, ADS-100380, aflibercept, ALT-110, altretamine, amifostine, aminogluteth
- an anti-LAG3 antibody e.g., humanized antibody such as antagonist humanized antibodies
- antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- one or more antiemetics including, but not limited to: casopitant (GlaxoSmithKline), Netupitant (MGI-Helsinn) and other NK-1 receptor antagonists, palonosetron (sold as Aloxi by MGI Pharma), aprepitant (sold as Emend by Merck and Co.; Rahway, N.J.), diphenhydramine (sold as Benadryl® by Pfizer; New York, N.Y.), hydroxyzine (sold as Atarax® by Pfizer; New York, N.Y.), metoclopramide (sold as Reglan® by AH Robins
- an anti-LAG3 antibody e.g., humanized antibody such as antagonist humanized antibodies
- antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an agent which treats or prevents such a deficiency, such as, e.g., filgrastim, PEG-filgrastim, erythropoietin, epoetin alfa or darbepoetin alfa.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- the vaccine is an anti-cancer vaccine, a peptide vaccine or a DNA vaccine.
- the vaccine is a tumor cell (e.g., an irradiated tumor cell) or a dendritic cell (e.g., a dendritic cell pulsed with a tumor peptide).
- an anti-LAG3 antibody e.g., humanized antibody such as antagonist humanized antibodies
- antigen-binding fragment thereof of the present and/or Ab9 is administered in association with a therapeutic procedure.
- a therapeutic procedure is one or more steps carried out by a physician or clinician in treating a subject which is intended to alleviate one or more symptoms (e.g., of cancer and/or infectious disease) in the treated subject, whether by inducing the regression or elimination of such symptoms or by inhibiting the progression of such symptom(s), e.g., cancer symptoms such as tumor growth or metastasis, by any clinically measurable degree.
- a therapeutic procedure is anti-cancer radiation therapy.
- the radiation therapy is external beam therapy (EBT): a method for delivering a beam of high-energy X-rays to the location of the tumor. The beam is generated outside the patient (e.g., by a linear accelerator) and is targeted at the tumor site. These X-rays can destroy the cancer cells and careful treatment planning allows the surrounding normal tissues to be spared. No radioactive sources are placed inside the patient's body.
- the radiation therapy is proton beam therapy: a type of conformal therapy that bombards the diseased tissue with protons instead of X-rays.
- the radiation therapy is conformal external beam radiation therapy: a procedure that uses advanced technology to tailor the radiation therapy to an individual's body structures.
- the radiation therapy is brachytherapy: the temporary placement of radioactive materials within the body, usually employed to give an extra dose—or boost—of radiation to an area.
- a surgical procedure administered in association with an anti-LAG3 antibody e.g., humanized antibody such as antagonist humanized antibodies
- an antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody e.g., humanized antibody such as antagonist humanized antibodies
- antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- MTOR mimmalian target of rapamycin
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a cytotoxic agent e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a platinum agent e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an EGFR inhibitor e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a VEGF inhibitor e.g., 4A10, 19E8, 11C9 and/or 22D2
- a VEGF inhibitor e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a microtubule stabilizer e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a taxane e.g., CD20 inhibitor.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a CD52 inhibitor e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with a CD52 inhibitor.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a CD30 inhibitor e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- a RANK Receptor activator of nuclear factor kappa-B
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- RANKL Receptor activator of nuclear factor kappa-B ligand
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- a BRAF inhibitor e.g., for treatment of melanoma.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an a CDK4/6 inhibitor e.g., for treatment of melanoma.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an ERK inhibitor e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a MAP Kinase inhibitor e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- AKT inhibitor e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with an AKT inhibitor.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- a MEK inhibitor e.g., for treatment of melanoma.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- PI3K inhibitor e.g., 4A10, 19E8, 11C9 and/or 22D2
- a PI3K inhibitor e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- HER1 inhibitor e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- HER2 inhibitor e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- HER3 inhibitor e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- HER4 inhibitor e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Bcl2 inhibitor e.g., 4A10, 19E8, 11C9 and/or 22D2
- Bcl2 inhibitor e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a CD22 inhibitor e.g., CD22 inhibitor
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a CD79b inhibitor e.g., CD79b inhibitor
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- ErbB2 inhibitor e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with an ErbB2 inhibitor.
- an anti-LAG3 antibody or antigen-binding fragment thereof (e.g., humanized antibody such as antagonist humanized antibodies) of the present and/or Ab9) is in association with a farnesyl protein transferase inhibitor.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-PD1 e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with nivolumab.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- CT-011 e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with CT-011.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-PDL1 e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-CTLA4 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-CTLA4 e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-TIM3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-CS1 e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- elotuzumab e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with elotuzumab.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-KIR2DL1/2/3 e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with lirilumab.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-CD137 antibody or antigen-binding fragment thereof e.g., an agonist anti-CD137 antibody or fragment.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with urelumab.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-GITR e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-GITR antigen-binding fragment thereof
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- TRX518 e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-PD-L1 e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- BMS-936559 e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- MSB0010718C e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- MPDL3280A e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with MPDL3280A.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-PD-L2 e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-ILT1 e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-ILT2 e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with anti-ILT2.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-ILT3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-ILT4 e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-ILT5 e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with anti-ILT5.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies of the present and/or Ab9 is in association with anti-ILT6.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-ILT7 e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-ILT8 e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-CD40 e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-OX40 e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-CD137 e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-KIR2DL1 e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as antagonist humanized antibodies
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-KIR2DL4 e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-KIR2DL5A e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-KIR2DL5B e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-KIR3DL1 e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-KIR3DL2 e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-KIR3DL3 e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-NKG2A e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-NKG2C e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-NKG2E e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof (e.g., humanized antibody such as an antagonist humanized antibody) of the present and/or Ab9) is in association with IL-10.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anti-IL10 e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-TSLP thymic stromal lymphopoietin
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- PEGylated IL-10 is administered to the subject at a dose of up to 20 micrograms/kg (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 micrograms/kg).
- up to 20 micrograms/kg daily, e.g., for up to four (e.g., 1, 2, 3 or 4) 28 day cycles—e.g., 20 micrograms/kg/day for four 28 day cycles.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- 13-cis-retinoic acid is in association with 13-cis-retinoic acid.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- 4-hydroxytamoxifen e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- 5-deooxyuridine e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- 5′-deoxy-5-fluorouridine e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- 5-fluorouracil e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- 6-mecaptopurine e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- 7-hydroxystaurosporine e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- abraxane e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with abraxane.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof (e.g., humanized antibody such as an antagonist humanized antibody) of the present and/or Ab9) is in association with acolbifene.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- ALT-110 is in association with ALT-110.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- altretamine e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with altretamine.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- amifostine e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- aminoglutethimide e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- amrubicin e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Amsacrine e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with Amsacrine.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- anastrozole e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- angiostatin e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- ARQ-197 e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- arzoxifene e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- AS-252424 e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with AS-252424.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- AS-605240 e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with AS-605240.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- asparaginase e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with asparaginase.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody of the present and/or Ab9 is in association with AT-9263.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- axitinib e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- AZD1152 e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with AZD1152.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- BCG Bacillus Calmette - Guerin
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- batabulin e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- BC-210 e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with BC-210.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- besodutox e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with besodutox.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Bio111 e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- BIO140 is in association with BIO140.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- BMS-214662 e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- BMS-247550 e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- BMS-275291 e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- BMS-310705 e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof (e.g., humanized antibody such as an antagonist humanized antibody) of the present and/or Ab9) is in association with bortezimib.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- camptothecin e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with camptothecin.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- canertinib e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- capecitabine e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- carmustine e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- CEA vaccinia-carcinoembryonic antigen vaccine
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- cediranib e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with cediranib.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- CG-1521 e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- CG-781 is in association with CG-781.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- chlamydocin e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- chlorambucil e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with chlorambucil.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- chlorotoxin e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with chlorotoxin.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- cimitidine e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with cimitidine.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- cladribine is in association with cladribine.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- clodronate e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- COL-3 an anti-LAG3 antibody or antigen-binding fragment thereof (e.g., humanized antibody such as an antagonist humanized antibody) of the present invention
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- CP-724714 e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- cyclophosphamide e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof (e.g., humanized antibody such as an antagonist humanized antibody) of the present and/or Ab9) is in association with cyproterone.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- cyproteroneacetate e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- cytarabine e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- cytosinearabinoside e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- dacarbazine e.g., dacarbazine.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- dactinomycin e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- danusertib e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- dasatanib e.g., 4A10, 19E8, 11C9 and/or 22D2
- dasatanib e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- daunorubicin e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- deguelin e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with deguelin.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- denileukin e.g., 4A10, 19E8, 11C9 and/or 22D2
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- deoxycoformycin e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with deoxycoformycin.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- depsipeptide e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with depsipeptide.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- diarylpropionitrile e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody of the present and/or Ab9 is in association with diethylstilbestrol.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- docetaxel e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- doxorubicin is in association with doxorubicin.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- droloxifene e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with droloxifene.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- edotecarin e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- yttrium-90 labeled-edotreotide e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- edotreotide e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- endostatin e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- epirubicin e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- epithilone B e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody of the present and/or Ab9 is in association with Cetuximab.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- erlotinib e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- estradiol e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- estramustine e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- everolimus e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- exemestane e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with exemestane.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- ficlatuzumab e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- finasteride e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- flavopiridol e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- floxuridine e.g., 4A10, 19E8, 11C9 and/or 22D2
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- fludarabine e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- fludrocortisone e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- fluoxymesterone e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- flutamide e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with flutamide.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody of the present and/or Ab9 is in association with galeterone.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- gefitinib e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with gefitinib.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- gemcitabine e.g., 4A10, 19E8, 11C9 and/or 22D2
- gemcitabine e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- glycopyranosyl lipid A e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- goserelin acetate e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- hydroxyprogesteronecaproate e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- hydroxyurea e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- IC87114 is in association with IC87114.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- idarubicin is in association with idarubicin.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- idoxyfene e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with idoxyfene.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- ifosfamide is in association with ifosfamide.
- an anti-LAG3 antibody or antigen-binding fragment thereof (e.g., humanized antibody such as an antagonist humanized antibody) of the present and/or Ab9) is in association with IM862.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- imatinib e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- imiquimod e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with imiquimod.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- IMC-1C11 is in association with IMC-1C11.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- INCB24360 is in association with INCB24360.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- INO1001 is in association with INO1001.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- interferon e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- IL-2 interleukin-2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- IL-12 interleukin-12
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- ipilimumab e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- irinotecan is in association with irinotecan.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- ketoconazole e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- lapatinib e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- lasofoxifene e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- letrozole e.g., 4A10, 19E8, 11C9 and/or 22D2
- e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with letrozole.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody of the present and/or Ab9 is in association with leucovorin.
- an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with leuprolide.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- leuprolide acetate e.g., 4A10, 19E8, 11C9 and/or 22D2
- leuprolide acetate e.g., 4A10, 19E8, 11C9 and/or 22D2
- leuprolide acetate e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with leuprolide acetate.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- levamisole e.g., 4A10, 19E8, 11C9 and/or 22D2
- levamisole e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- liposome entrapped paclitaxel e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- lomustine e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with lomustine.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- lucanthone e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- LY292223 e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- LY292696 is in association with LY292696.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- LY293646 is in association with LY293646.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- LY293684 is in association with LY293684.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- LY294002 e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- LY317615 is in association with LY317615.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- marimastat is in association with marimastat.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- mechlorethamine e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with mechlorethamine.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- medroxyprogesteroneacetate e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody of the present and/or Ab9 is in association with megestrolacetate.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- melphalan e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- mesna e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- methotrexate e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- mithramycin e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- mitomycin e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- mitotane e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- mitoxantrone e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a suspension of heat killed Mycobacterium obuense e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- MLN8054 is in association with MLN8054.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Neratinib e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- neuradiab e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody of the present and/or Ab9 is in association with nolatrexe.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- NVP-BEZ235 e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- octreotide e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with octreotide.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- oxaliplatin e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with oxaliplatin.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- paclitaxel e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with paclitaxel.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- palbociclib e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with palbociclib.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- pazopanib e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- PEG-interferon e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- pemetrexed e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody of the present and/or Ab9 is in association with pentostatin.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- perifosine e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- phenylalanine mustard e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- PI-103 is in association with PI-103.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- pictilisib e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- pipendoxifene e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- plicamycin e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- poly-ICLC e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with poly-ICLC.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- porfimer e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- prednisone e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- procarbazine e.g., 4A10, 19E8, 11C9 and/or 22D2
- procarbazine e.g., 4A10, 19E8, 11C9 and/or 22D2
- procarbazine e.g., 4A10, 19E8, 11C9 and/or 22D2
- procarbazine e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- progestins e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- PSK protein bound polysaccharide derived from Basidiomycete coriolus versicolor
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- R-763 is in association with R-763.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- raloxifene e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with raloxifene.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- razoxin e.g., 4A10, 19E8, 11C9 and/or 22D2
- razoxin e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- ridaforolimus e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with ridaforolimus.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- rituximab e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with rituximab.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- romidepsin e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with romidepsin.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- RTA744 is in association with RTA744.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- rubitecan e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody of the present and/or Ab9 is in association with scriptaid.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Sdx102 e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with Sdx102.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- selumetinib e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with selumetinib.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- semaxanib e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with semaxanib.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- SF1126 e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- sirolimus e.g., 4A10, 19E8, 11C9 and/or 22D2
- sirolimus e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with sirolimus.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- sorafenib is in association with sorafenib.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- spironolactone e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with spironolactone.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- SR13668 is in association with SR13668.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- streptozocin e.g., 4A10, 19E8, 11C9 and/or 22D2
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- SU6668 is in association with SU6668.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- suberoylanalide hydroxamic acid e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- sunitinib e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- synthetic estrogen e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof (e.g., humanized antibody such as an antagonist humanized antibody) of the present and/or Ab9) is in association with talampanel.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- talimogene laherparepvec e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- tamoxifen e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with tamoxifen.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- temozolomide e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with temozolomide.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- temsirolimus e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- teniposide e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- tesmilifene e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with tesmilifene.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- testosterone e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- tetrandrine e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with tetrandrine.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- TGX-221 e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- thalidomide e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with thalidomide.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- 6-thioguanine e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- thiotepa is in association with thiotepa.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- ticilimumab is in association with ticilimumab.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- tipifarnib e.g., 4A10, 19E8, 11C9 and/or 22D2
- tipifarnib e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- tivozanib e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- TKI-258 e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody of the present and/or Ab9 is in association with TLK286.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- toremifene citrate e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- trabectedin e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- trastuzumab e.g., trastuzumab.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- tretinoin is in association with tretinoin.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- trichostatin A e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- triciribinephosphate monohydrate e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- triptorelin pamoate e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- TNF ⁇ tumor necrosis factor alpha
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- uracil mustard e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with uracil mustard.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- valproic acid e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with valproic acid.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- valrubicin e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- vandetanib e.g., 4A10, 19E8, 11C9 and/or 22D2
- vandetanib e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- vatalanib e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with vatalanib.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- VEGF trap e.g., VEGF trap.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody of the present and/or Ab9 is in association with vinblastine.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- vincristine e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with vincristine.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with vindesine.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- vinorelbine e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with vinorelbine.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- vitaxin e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- vitespan e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- vorinostat e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- VX-745 is in association with VX-745.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Z-100 hot water extract of Bacillus tuberculosis e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- ZK186619 e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- ZM336372 is in association with ZM336372.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- casopitant e.g., 4A10, 19E8, 11C9 and/or 22D2
- casopitant e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody of the present and/or Ab9 is in association with netupitant.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- palonosetron e.g., 4A10, 19E8, 11C9 and/or 22D2
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- diphenhydramine e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- hydroxyzine e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- metoclopramide e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- lorazepam e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with lorazepam.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- alprazolam e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with alprazolam.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- haloperidol e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with haloperidol.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- droperidol e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- dronabinol e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with dronabinol.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- dexamethasone e.g., 4A10, 19E8, 11C9 and/or 22D2
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- prochlorperazine e.g., 4A10, 19E8, 11C9 and/or 22D2
- prochlorperazine e.g., 4A10, 19E8, 11C9 and/or 22D2
- prochlorperazine e.g., 4A10, 19E8, 11C9 and/or 22D2
- prochlorperazine e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- ondansetron e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with ondansetron.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody of the present and/or Ab9 is in association with dolasetron.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- tropisetron e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- filgrastim e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- PEG-filgrastim e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- darbepoetin alfa e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- dabrafenib e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- trametinib e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with trametinib.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- cobimetnib e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- DNE03 an anti-LAG3 antibody or antigen-binding fragment thereof (e.g., humanized antibody such as an antagonist humanized antibody) of the present invention
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- ATI13387 is in association with ATI13387.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- encorafenib e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- MEK162 is in association with MEK162.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody of the present and/or Ab9 is in association with BKM120.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- LEE011 an anti-LAG3 antibody or antigen-binding fragment thereof (e.g., humanized antibody such as an antagonist humanized antibody) of the present invention
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- BGJ398 e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- INC280 is in association with INC280.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- natitoclax e.g., 4A10, 19E8, 11C9 and/or 22D2
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is in association with natitoclax.
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- an anti-LAG3 antibody or antigen-binding fragment thereof e.g., humanized antibody such as an antagonist humanized antibody
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1 Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- an anti-LAG3 antibody e.g., humanized antibody such as antagonist humanized antibodies
- antigen-binding fragment thereof of the present invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- another agent such as pembrolizumab or nivolumab
- can be formulated into a single composition e.g., for simultaneous delivery, or formulated separately into two or more compositions (e.g., a kit).
- Each component can be administered to a subject at a different time than when the other component is administered; for example, each administration may be given non-simultaneously (e.g., separately or sequentially) at intervals over a given period of time.
- the separate components may be administered to a subject by the same or by a different route (e.g., wherein an anti-LAG3 antibody (e.g., humanized antibody such as antagonist humanized antibodies) or antigen-binding fragment thereof (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 is administered parenterally and paclitaxel is administered orally).
- an anti-LAG3 antibody e.g., humanized antibody such as antagonist humanized antibodies
- antigen-binding fragment thereof e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2,
- the present invention includes any method for forming a complex between an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention and LAG3 (e.g., human or cynomolgous monkey LAG3) comprising contacting the LAG3 polypeptide with the anti-LAG3 antibody or fragment under conditions suitable for binding and complex formation.
- LAG3 e.g., human or cynomolgous monkey LAG3
- the anti-LAG3 antibodies e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragments thereof disclosed herein e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a solid phase such as sephadex, glass or agarose resin or filter paper
- the immobilized antibody or fragment is contacted with a sample containing the LAG3 protein (or a fragment thereof) to be purified, and, thereafter, the support is washed with a suitable solvent that will remove substantially all of the material in the sample except the LAG3 protein which is bound to the immobilized antibody or fragment. Finally, the support is washed with a solvent which elutes the bound LAG3 (e.g., protein A).
- a suitable solvent which elutes the bound LAG3 (e.g., protein A).
- the present invention provides methods for using the anti-LAG3 antibodies and antigen-binding fragments thereof of the present invention to determine the extent of T-cell activation that a particular subject is having or could have in the present of the antibody or fragment.
- embodiments of the invention include methods including (i) contacting T-cells (e.g., CD4+ T-cells) from a subject with superantigen (e.g., any one or more of a staphylococcal superantigen such as SEA, SEB ( Staphylococcus enterotoxin B), SEC2, SEC3, SED, SEH and/or TSST; and/or any one or more of a streptococcal superantigen such as SPE-A, SPE-C, SPE-H and/or SMEZ-2), e.g., at a concentration of 500 pg/ml or more, such as about 10 ng/ml or 100 ng/ml, in the presence of the anti-LAG3 antibody or fragment (optionally
- Subjects possessing T-cells which exhibit cytokine production are considered superior candidates for receipt of the antibody or fragment as a therapy, e.g., for treating cancer or infection.
- such superior candidates are selected for receipt of the antibody or fragment.
- such superior candidates are administered an effective amount of the antibody or fragment.
- the method includes the step of isolating the T-cells from the blood of the subject.
- the T-cells are contacted with anti-LAG3 antibody or antigen-binding fragment thereof of the present invention and pembrolizumab.
- antigens for generating secondary antibodies which are useful, for example, for performing Western blots and other immunoassays discussed herein.
- polypeptides which comprise the variable regions and/or CDR sequences of an anti-LAG3 antibody or fragment disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) and which may be used to generate anti-idiotypic antibodies for use in specifically detecting the presence of the antibody, e.g., in a therapeutic context.
- an anti-LAG3 antibody or fragment disclosed herein e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the present invention includes cell-based ELISA methods using the anti-LAG3 antibodies and antigen-binding fragments thereof of the present invention.
- the method includes the steps: (i) contacting cells (e.g., cells or tissue taken from a tumor, e.g., which include lymphocytes suspected of expressing LAG3) immobilized to a solid surface (e.g., a microplate) to be tested for the presence of LAG3 with an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention, (ii) optionally washing the mixture to remove unbound anti-LAG3 antibody or fragment, (iii) contacting the anti-LAG3 antibody or fragment with a labeled secondary antibody or antigen-binding fragment thereof that binds to the anti-LAG3 antibody or fragment, (iv) optionally washing the complex to remove unbound antibodies or fragments and (v) detecting the presence of the label on the secondary antibody or fragment; wherein detection of the label indicates that the cells contain LAG3.
- cells e.
- the present invention includes ELISA assays (enzyme-linked immunosorbent assay) incorporating the use of an anti-LAG3 antibody (e.g., humanized antibodies such as antagonist humanized antibodies) or antigen-binding fragment thereof disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9).
- an anti-LAG3 antibody e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragment thereof disclosed herein e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9.
- such a method comprises the following steps:
- a substrate e.g., surface of a microtiter plate well, e.g., a plastic plate
- anti-LAG3 antibody e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragment thereof e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a sample to be tested for the presence of LAG3 to the substrate e.g., cells taken from a tumor, e.g., which include lymphocytes suspected of expressing LAG3
- detectably labeled antibodies e.g., enzyme-linked antibodies
- the substrate so that the unbound, labeled antibodies are removed
- if the labeled antibodies are enzyme linked
- Detection of the label associated with the substrate indicates the presence of the LAG3 protein.
- the ELISA methods can also be used identifying LAG3+ cells in a tumor sample.
- the labeled antibody or antigen-binding fragment thereof is labeled with peroxidase which react with ABTS (e.g., 2,2′-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)) or 3,3′,5,5′-Tetramethylbenzidine to produce a color change which is detectable.
- ABTS e.g., 2,2′-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)
- 3,3′,5,5′-Tetramethylbenzidine e.g., 2,2′-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)
- 3,3′,5,5′-Tetramethylbenzidine e.g., 2,2′-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)
- 3,3′,5,5′-Tetramethylbenzidine e.g., 2,2′-azino
- An anti-LAG3 antibody e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragment thereof of the invention e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a Western blot or immune-protein blot procedure Such a procedure forms part of the present invention and includes e.g.:
- a membrane or other solid substrate comprising a sample to be tested for the presence of LAG3, e.g., optionally including the step of transferring proteins from a sample to be tested for the presence of LAG3 (e.g., from a PAGE or SDS-PAGE electrophoretic separation of the proteins in the sample) onto a membrane or other solid substrate using a method known in the art (e.g., semi-dry blotting or tank blotting); and contacting the membrane or other solid substrate to be tested for the presence of bound LAG3 or a fragment thereof with an anti-LAG3 antibody or antigen-binding fragment thereof of the invention.
- a method known in the art e.g., semi-dry blotting or tank blotting
- Such a membrane may take the form, for example, of a nitrocellulose or vinyl-based (e.g., polyvinylidene fluoride (PVDF)) membrane to which the proteins to be tested for the presence of LAG3 in a non-denaturing PAGE (polyacrylamide gel electrophoresis) gel or SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) gel have been transferred (e.g., following electrophoretic separation in the gel).
- PVDF polyvinylidene fluoride
- SDS-PAGE sodium dodecyl sulfate polyacrylamide gel electrophoresis
- Detection of the bound antibody or fragment indicates that the LAG3 protein is present on the membrane or substrate and in the sample. Detection of the bound antibody or fragment may be by binding the antibody or fragment with a secondary antibody (an anti-immunoglobulin antibody) which is detectably labeled and, then, detecting the presence of the secondary antibody label.
- a secondary antibody an anti-immunoglobulin antibody
- anti-LAG3 antibodies e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragments thereof disclosed herein e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Such a method forms part of the present invention and comprises, e.g.,
- TILs tissue comprising TILs and tumor cells (e.g., melanoma tumor) to be tested for the presence of LAG3 protein with an anti-LAG3 antibody or antigen-binding fragment thereof of the invention; and (2) detecting the antibody or fragment on or in the TILs.
- tumor cells e.g., melanoma tumor
- the antibody or fragment itself is detectably labeled, it can be detected directly. Alternatively, the antibody or fragment may be bound by a detectably labeled secondary antibody wherein the label is then detected.
- Certain anti-LAG3 antibodies and antigen-binding fragments thereof disclosed herein may also be used for in vivo tumor imaging.
- 4A10, 19E8, 11C9 and/or 22D2 e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9 may also be used for in vivo tumor imaging.
- Such a method may include injection of a detectably labeled, e.g., radiolabeled, anti-LAG3 antibody or antigen-binding fragment thereof (as discussed herein) into the body of a patient to be tested for the presence of a tumor associated with LAG3 expression (e.g., which expresses LAG3, for example, on tumor infiltrating lymphocytes (TILs)) followed by imagine, e.g., nuclear imaging, of the body of the patient to detect the presence of the labeled antibody or fragment e.g., at loci comprising a high concentration of the antibody or fragment which are bound to or associated with the tumor. The detection of the loci indicates the presence of the LAG3′ TILs in a tumor.
- a detectably labeled e.g., radiolabeled, anti-LAG3 antibody or antigen-binding fragment thereof (as discussed herein) into the body of a patient to be tested for the presence of a tumor associated with LAG3 expression (e.g
- Imaging techniques include SPECT imaging (single photon emission computed tomography) or PET imaging (positron emission tomography).
- Labels include e.g., iodine-123 ( 123 I) and technetium-99m ( 99m Tc), e.g., in conjunction with SPECT imaging or 11 C, 13 N, 15 O or 18 F, e.g., in conjunction with PET imaging or Indium-111 (See e.g., Gordon et al., (2005) International Rev. Neurobiol. 67:385-440).
- the present invention provide a method for determining whether a tumor in a subject is sensitive to treatment with an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention comprising determining whether the LAG3 is expressed in or on the tumor infiltrating lymphocytes (TILs) and, if said expression is identified, determining that the tumor is sensitive to said treatment.
- TILs can be determined to express LAG3 using any of the methods set forth herein, e.g., ELISA or in vivo imaging.
- the method comprises the step of obtaining a sample of said tumor tissue before making the determination of LAG3 expression is done.
- the sample is obtained surgically, e.g., by biopsy, for example, needle biopsy or partial tumorectomy.
- LAG3 expression is determined by contacting the TILs with the antibody or fragment and detecting the presence of the antibody or fragment bound to the tumor tissue or fragment.
- compositions of the anti-LAG3 antibodies e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragments thereof e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the antibody or antigen-binding fragment thereof is admixed with a pharmaceutically acceptable carrier or excipient.
- a pharmaceutically acceptable carrier or excipient See, e.g., Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary, Mack Publishing Company, Easton, Pa. (1984).
- Such compositions are part of the present invention.
- compositions comprising an anti-LAG3 antibody or antigen-binding fragment thereof or a pharmaceutical composition thereof that includes a pharmaceutically acceptable carrier but substantially lacks water.
- Formulations of therapeutic and diagnostic agents may be prepared by mixing with acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions or suspensions (see, e.g., Hardman, et al. (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, N.Y.; Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.Y.; Avis, et al. (eds.) (1993) Pharmaceutical Dosage Forms: Parenteral Medications, Marcel Dekker, NY; Lieberman, et al.
- the present invention includes any pharmaceutical formulation comprising an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention, and PO 4 2 ⁇ , for example, sodium phosphate or potassium phosphate (e.g., about 10 mM), NaCl (e.g., about 7.5 mM) and sucrose (e.g., about 3%), e.g., having a pH of about 7.4 or about 7.3; or NaOAc (e.g., about 20 mM), and sucrose (about 7 or about 9%), e.g., having a pH of about 5.0.
- sodium phosphate or potassium phosphate e.g., about 10 mM
- NaCl e.g., about 7.5 mM
- sucrose e.g., about 3%
- NaOAc e.g., about 20 mM
- sucrose about 7 or about 9%
- Toxicity and therapeutic efficacy of the antibody or fragment compositions, administered alone or in combination with another therapeutic agent can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD 50 (the dose lethal to 50% of the population) and the ED 50 (the dose effective in 50% of the population).
- the dose ratio between toxic and therapeutic effects is the therapeutic index (LD 50 /ED 50 ).
- antibodies exhibiting high therapeutic indices are desirable.
- the data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in human.
- the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED 50 with little or no toxicity.
- the dosage may vary within this range depending upon the dosage form employed and the route of administration.
- a further therapeutic agent that is administered to a subject in association with an anti-LAG3 antibody (e.g., humanized antibody such as antagonist humanized antibodies) or antigen-binding fragment thereof disclosed herein (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9) is administered to the subject in accordance with the Physicians' Desk Reference 2003 (Thomson Healthcare; 57th edition (Nov. 1, 2002)).
- an anti-LAG3 antibody e.g., humanized antibody such as antagonist humanized antibodies
- antigen-binding fragment thereof disclosed herein e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- the mode of administration can vary. Routes of administration include oral, rectal, transmucosal, intestinal, parenteral; intramuscular, subcutaneous, intradermal, intramedullary, intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, intraocular, inhalation, insufflation, topical, cutaneous, transdermal, or intra-arterial.
- the present invention provided methods for administering an anti-LAG3 antibody or antigen-binding fragment thereof comprising introducing the antibody or fragment into the body of a subject.
- the method comprises piercing the body of the subject with a needle of a syringe and injecting the antibody or fragment into the body of the subject, e.g., into the vein, artery, tumor, muscular tissue or subcutis of the subject.
- the present invention provides a vessel (e.g., a plastic or glass vial, e.g., with a cap or a chromatography column, hollow bore needle or a syringe cylinder) comprising any of the antibodies or antigen-binding fragments (e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9), polypeptides or polynucleotides set forth herein or a pharmaceutical composition thereof comprising a pharmaceutically acceptable carrier.
- a vessel e.g., a plastic or glass vial, e.g., with a cap or a chromatography column, hollow bore needle or a syringe cylinder
- any of the antibodies or antigen-binding fragments e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab
- the present invention also provides an injection device comprising any of the antibodies or antigen-binding fragments, polypeptides or polynucleotides set forth herein or a pharmaceutical composition thereof.
- An injection device is a device that introduces a substance into the body of a patient via a parenteral route, e.g., intramuscular, subcutaneous or intravenous.
- an injection device may be a syringe (e.g., pre-filled with the pharmaceutical composition, such as an auto-injector) which, for example, includes a cylinder or barrel for holding fluid to be injected (e.g., comprising the antibody or fragment or a pharmaceutical composition thereof), a needle for piecing skin and/or blood vessels for injection of the fluid; and a plunger for pushing the fluid out of the cylinder and through the needle bore.
- an injection device that comprises an antibody or antigen-binding fragment thereof of the present invention or a pharmaceutical composition thereof is an intravenous (IV) injection device.
- Such a device includes the antibody or fragment or a pharmaceutical composition thereof in a cannula or trocar/needle which may be attached to a tube which may be attached to a bag or reservoir for holding fluid (e.g., saline; or lactated ringer solution comprising NaCl, sodium lactate, KCl, CaCl 2 and optionally including glucose) introduced into the body of the patient through the cannula or trocar/needle.
- fluid e.g., saline; or lactated ringer solution comprising NaCl, sodium lactate, KCl, CaCl 2 and optionally including glucose
- the antibody or fragment or a pharmaceutical composition thereof may, in an embodiment of the invention, be introduced into the device once the trocar and cannula are inserted into the vein of a subject and the trocar is removed from the inserted cannula.
- the IV device may, for example, be inserted into a peripheral vein (e.g., in the hand or arm); the superior vena cava or inferior vena cava, or within the right atrium of the heart (e.g., a central IV); or into a subclavian, internal jugular, or a femoral vein and, for example, advanced toward the heart until it reaches the superior vena cava or right atrium (e.g., a central venous line).
- an injection device is an autoinjector; a jet injector or an external infusion pump.
- a jet injector uses a high-pressure narrow jet of liquid which penetrate the epidermis to introduce the antibody or fragment or a pharmaceutical composition thereof to a patient's body.
- External infusion pumps are medical devices that deliver the antibody or fragment or a pharmaceutical composition thereof into a patient's body in controlled amounts. External infusion pumps may be powered electrically or mechanically.
- Different pumps operate in different ways, for example, a syringe pump holds fluid in the reservoir of a syringe, and a moveable piston controls fluid delivery, an elastomeric pump holds fluid in a stretchable balloon reservoir, and pressure from the elastic walls of the balloon drives fluid delivery.
- a set of rollers pinches down on a length of flexible tubing, pushing fluid forward.
- fluids can be delivered from multiple reservoirs at multiple rates.
- the pharmaceutical compositions disclosed herein may also be administered with a needleless hypodermic injection device; such as the devices disclosed in U.S. Pat. Nos. 6,620,135; 6,096,002; 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824 or 4,596,556.
- a needleless hypodermic injection device such as the devices disclosed in U.S. Pat. Nos. 6,620,135; 6,096,002; 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824 or 4,596,556.
- Such needleless devices comprising the pharmaceutical composition are also part of the present invention.
- the pharmaceutical compositions disclosed herein may also be administered by infusion. Examples of well-known implants and modules for administering the pharmaceutical compositions include those disclosed in: U.S. Pat. No. 4,487,603, which discloses an implantable micro
- one may administer the anti-LAG3 antibody e.g., humanized antibody such as antagonist humanized antibodies
- antigen-binding fragment e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- a local rather than systemic manner for example, via injection of the antibody or fragment directly into a tumor, e.g., a LAG3 + tumor.
- a tumor e.g., a LAG3 + tumor, e.g., characterized by immunopathology.
- the liposomes will be targeted to and taken up selectively by the afflicted tissue.
- Such methods and liposomes are part of the present invention.
- Treat” or “treating” means to administer anti-LAG3 antibodies or antigen-binding fragments thereof of the present invention, to a subject having one or more symptoms of a disease for which the anti-LAG3 antibodies and antigen-binding fragments are effective, e.g., in the treatment of a subject having cancer or an infectious disease, or being suspected of having cancer or infectious disease, for which the agent has therapeutic activity.
- the antibody or fragment is administered in an “effective amount” or “effective dose” which will alleviate one or more symptoms (e.g., of cancer or infectious disease) in the treated subject or population, whether by inducing the regression or elimination of such symptoms or by inhibiting the progression of such symptom(s), e.g., cancer symptoms such as tumor growth or metastasis, by any clinically measurable degree.
- the effective amount of the antibody or fragment may vary according to factors such as the disease stage, age, and weight of the patient, and the ability of the drug to elicit a desired response in the subject.
- Antibodies e.g., humanized antibodies such as antagonist humanized antibodies
- antigen-binding fragments thereof disclosed herein e.g., 4A10, 19E8, 11C9 and/or 22D2; e.g., Ab1, Ab2, Ab3, Ab4, Ab5, Ab6, Ab7, Ab8 and/or Ab9
- doses administered e.g., daily, 1-7 times per week, weekly, bi-weekly, monthly, bimonthly, quarterly, semiannually, annually etc.
- Doses may be provided, e.g., intravenously, subcutaneously, topically, orally, nasally, rectally, intramuscular, intracerebrally, intraspinally, or by inhalation.
- an effective dose of an anti-LAG3 antibody or antigen-binding fragment thereof of the present invention is from about 0.1 mg/kg (body weight) to about 100 mg/kg (body weight), e.g., for treatment or prevention of cancer or infectious diseases.
- an effective dose for treatment of a medical condition, wherein overexpression of LAG3 occurs is the dose at which complete saturation of the LAG3 antigen occurs in the body of the subject, e.g., on T-cells within tumors of the subject or wherein there is about 10% saturation or more than about 10%.
- Determination of the appropriate dose is made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment. Generally, in determining the dose, the dose begins with an amount somewhat less than the optimum dose and it is increased by small increments thereafter until the desired or optimum effect is achieved relative to any negative side effects.
- Important diagnostic measures include those of symptoms of, e.g., the inflammation or level of inflammatory cytokines produced.
- a biologic that will be used is derived from the same species as the animal targeted for treatment, thereby minimizing any immune response to the reagent.
- chimeric, humanized and fully human antibodies are may be desirable.
- Whether a disease symptom has been alleviated can be assessed by any clinical measurement typically used by physicians or other skilled healthcare providers to assess the severity or progression status of that symptom. While an embodiment of the present invention (e.g., a treatment method or article of manufacture) may not be effective in alleviating the target disease symptom(s) in every subject, it should alleviate the target disease symptom(s) in a statistically significant number of subjects as determined by any statistical test known in the art such as the Student's t-test, the chi 2 -test, the U-test according to Mann and Whitney, the Kruskal-Wallis test (H-test), Jonckheere-Terpstra-test and the Wilcoxon-test.
- any statistical test known in the art such as the Student's t-test, the chi 2 -test, the U-test according to Mann and Whitney, the Kruskal-Wallis test (H-test), Jonckheere-Terpstra-test and the Wilcoxon-test.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Microbiology (AREA)
- Hematology (AREA)
- Mycology (AREA)
- Urology & Nephrology (AREA)
- Biomedical Technology (AREA)
- Oncology (AREA)
- Food Science & Technology (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Communicable Diseases (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/305,011 US20170290914A1 (en) | 2014-08-19 | 2015-08-17 | Anti-lag3 antibodies and antigen-binding fragments |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462039081P | 2014-08-19 | 2014-08-19 | |
| US201562171319P | 2015-06-05 | 2015-06-05 | |
| US15/305,011 US20170290914A1 (en) | 2014-08-19 | 2015-08-17 | Anti-lag3 antibodies and antigen-binding fragments |
| PCT/US2015/045481 WO2016028672A1 (en) | 2014-08-19 | 2015-08-17 | Anti-lag3 antibodies and antigen-binding fragments |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/045481 A-371-Of-International WO2016028672A1 (en) | 2014-08-19 | 2015-08-17 | Anti-lag3 antibodies and antigen-binding fragments |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/482,355 Continuation US10188730B2 (en) | 2014-08-19 | 2017-04-07 | Anti-LAG3 antibodies and antigen-binding fragments |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20170290914A1 true US20170290914A1 (en) | 2017-10-12 |
Family
ID=53938468
Family Applications (6)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/305,011 Abandoned US20170290914A1 (en) | 2014-08-19 | 2015-08-17 | Anti-lag3 antibodies and antigen-binding fragments |
| US15/482,355 Active US10188730B2 (en) | 2014-08-19 | 2017-04-07 | Anti-LAG3 antibodies and antigen-binding fragments |
| US16/209,381 Active 2036-04-03 US10898571B2 (en) | 2014-08-19 | 2018-12-04 | Anti-LAG3 antibodies and antigen-binding fragments |
| US16/210,140 Active 2036-07-18 US11278620B2 (en) | 2014-08-19 | 2018-12-05 | Anti-LAG3 antibodies and antigen-binding fragments |
| US16/213,443 Active 2036-06-05 US11207406B2 (en) | 2014-08-19 | 2018-12-07 | Anti-LAG3 antibodies and antigen-binding fragments |
| US17/669,891 Active 2036-06-28 US12102681B2 (en) | 2014-08-19 | 2022-02-11 | Anti-LAG3 antibodies and antigen-binding fragments |
Family Applications After (5)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/482,355 Active US10188730B2 (en) | 2014-08-19 | 2017-04-07 | Anti-LAG3 antibodies and antigen-binding fragments |
| US16/209,381 Active 2036-04-03 US10898571B2 (en) | 2014-08-19 | 2018-12-04 | Anti-LAG3 antibodies and antigen-binding fragments |
| US16/210,140 Active 2036-07-18 US11278620B2 (en) | 2014-08-19 | 2018-12-05 | Anti-LAG3 antibodies and antigen-binding fragments |
| US16/213,443 Active 2036-06-05 US11207406B2 (en) | 2014-08-19 | 2018-12-07 | Anti-LAG3 antibodies and antigen-binding fragments |
| US17/669,891 Active 2036-06-28 US12102681B2 (en) | 2014-08-19 | 2022-02-11 | Anti-LAG3 antibodies and antigen-binding fragments |
Country Status (40)
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018148476A1 (en) | 2017-02-10 | 2018-08-16 | Regeneron Pharmaceuticals, Inc. | Radiolabeled anti-lag3 antibodies for immuno-pet imaging |
| US10259882B2 (en) | 2015-05-07 | 2019-04-16 | Agenus Inc. | Anti-OX40 antibodies |
| WO2019191133A1 (en) | 2018-03-27 | 2019-10-03 | Bristol-Myers Squibb Company | Real-time monitoring of protein concentration using ultraviolet signal |
| WO2020096917A1 (en) * | 2018-11-05 | 2020-05-14 | Merck Sharp & Dohme Corp. | Dosing regimen of anti-lag3 antibody and combination therapy with anti-pd-1 antibody for treating cancer |
| WO2020172658A1 (en) | 2019-02-24 | 2020-08-27 | Bristol-Myers Squibb Company | Methods of isolating a protein |
| US10836830B2 (en) | 2015-12-02 | 2020-11-17 | Agenus Inc. | Antibodies and methods of use thereof |
| WO2020237221A1 (en) | 2019-05-23 | 2020-11-26 | Bristol-Myers Squibb Company | Methods of monitoring cell culture media |
| WO2021126967A1 (en) * | 2019-12-20 | 2021-06-24 | Merck Sharp & Dohme Corp. | Lag3 antagonist cell based potency assay |
| WO2021217117A1 (en) * | 2020-04-24 | 2021-10-28 | Memorial Sloan Kettering Cancer Center | Targeted therapy for the treatment & prevention of life-threatening complications of infection |
| WO2022076318A1 (en) | 2020-10-05 | 2022-04-14 | Bristol-Myers Squibb Company | Methods for concentrating proteins |
| US11359028B2 (en) | 2016-11-09 | 2022-06-14 | Agenus Inc. | Anti-OX40 antibodies and anti-GITR antibodies |
| US11564986B2 (en) * | 2015-07-16 | 2023-01-31 | Onkosxcel Therapeutics, Llc | Approach for treatment of cancer via immunomodulation by using talabostat |
| WO2023173011A1 (en) | 2022-03-09 | 2023-09-14 | Bristol-Myers Squibb Company | Transient expression of therapeutic proteins |
| US11840568B2 (en) | 2018-04-02 | 2023-12-12 | Mab-Venture Biopharm Co., Ltd. | Lymphocyte activation gene-3 (LAG-3) binding antibody and use thereof |
| WO2024173876A1 (en) | 2023-02-17 | 2024-08-22 | Regeneron Pharmaceuticals, Inc. | Radiolabeled anti-lag3 antibodies for immuno-pet imaging |
| US12202856B2 (en) | 2016-05-19 | 2025-01-21 | The General Hospital Corporation | Tethered interleukin-2 to its receptor IL-2RBETA, a platform to enhance natural killer and regulatory T cell activity |
| WO2025096478A1 (en) | 2023-10-30 | 2025-05-08 | Regeneron Pharmaceuticals, Inc. | Stable antibody formulation comprising fianlimab |
| US12319970B2 (en) | 2019-04-02 | 2025-06-03 | The Brigham And Women's Hospital, Inc. | Methods for identifying progression of a primary melanoma |
| WO2025226695A1 (en) | 2024-04-23 | 2025-10-30 | Regeneron Pharmaceuticals, Inc. | Stable antibody formulation |
Families Citing this family (266)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NZ600758A (en) | 2007-06-18 | 2013-09-27 | Merck Sharp & Dohme | Antibodies to human programmed death receptor pd-1 |
| US9416132B2 (en) | 2011-07-21 | 2016-08-16 | Tolero Pharmaceuticals, Inc. | Substituted imidazo[1,2-b]pyridazines as protein kinase inhibitors |
| US12466897B2 (en) | 2011-10-10 | 2025-11-11 | Xencor, Inc. | Heterodimeric human IgG1 polypeptides with isoelectric point modifications |
| US9605084B2 (en) | 2013-03-15 | 2017-03-28 | Xencor, Inc. | Heterodimeric proteins |
| US11053316B2 (en) | 2013-01-14 | 2021-07-06 | Xencor, Inc. | Optimized antibody variable regions |
| HRP20191865T1 (hr) | 2013-01-14 | 2020-01-10 | Xencor, Inc. | Novi heterodimerni proteini |
| US10487155B2 (en) | 2013-01-14 | 2019-11-26 | Xencor, Inc. | Heterodimeric proteins |
| US10968276B2 (en) | 2013-03-12 | 2021-04-06 | Xencor, Inc. | Optimized anti-CD3 variable regions |
| US10858417B2 (en) | 2013-03-15 | 2020-12-08 | Xencor, Inc. | Heterodimeric proteins |
| EP3757130A1 (en) | 2013-09-26 | 2020-12-30 | Costim Pharmaceuticals Inc. | Methods for treating hematologic cancers |
| PE20160953A1 (es) | 2013-12-12 | 2016-09-26 | Shanghai hengrui pharmaceutical co ltd | Anticuerpo pd-1, fragmento de union al antigeno de este y uso medico de este |
| JOP20200094A1 (ar) | 2014-01-24 | 2017-06-16 | Dana Farber Cancer Inst Inc | جزيئات جسم مضاد لـ pd-1 واستخداماتها |
| JOP20200096A1 (ar) | 2014-01-31 | 2017-06-16 | Children’S Medical Center Corp | جزيئات جسم مضاد لـ tim-3 واستخداماتها |
| ME03558B (me) | 2014-03-14 | 2020-07-20 | Novartis Ag | Molekuli anti-lag-3 antiтela i njihove upotrebe |
| EP3954713A3 (en) | 2014-03-28 | 2022-03-30 | Xencor, Inc. | Bispecific antibodies that bind to cd38 and cd3 |
| SMT202100116T1 (it) | 2014-05-28 | 2021-05-07 | Agenus Inc | Anticorpi anti-gitr e metodi di utilizzo degli stessi |
| TWI693232B (zh) | 2014-06-26 | 2020-05-11 | 美商宏觀基因股份有限公司 | 與pd-1和lag-3具有免疫反應性的共價結合的雙抗體和其使用方法 |
| JO3663B1 (ar) * | 2014-08-19 | 2020-08-27 | Merck Sharp & Dohme | الأجسام المضادة لمضاد lag3 وأجزاء ربط الأنتيجين |
| KR20170060042A (ko) | 2014-09-13 | 2017-05-31 | 노파르티스 아게 | Alk 억제제의 조합 요법 |
| EA201790737A1 (ru) * | 2014-10-03 | 2017-08-31 | Новартис Аг | Комбинированная терапия |
| MX389663B (es) | 2014-10-14 | 2025-03-20 | Novartis Ag | Moleculas de anticuerpo que se unen a pd-l1 y usos de las mismas. |
| EP3223907A2 (en) | 2014-11-26 | 2017-10-04 | Xencor, Inc. | Heterodimeric antibodies that bind cd3 and cd38 |
| US10259887B2 (en) | 2014-11-26 | 2019-04-16 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
| CN116333153A (zh) | 2014-11-26 | 2023-06-27 | 森科股份有限公司 | 结合cd3和肿瘤抗原的异二聚体抗体 |
| WO2016105450A2 (en) | 2014-12-22 | 2016-06-30 | Xencor, Inc. | Trispecific antibodies |
| CA2976926A1 (en) | 2015-02-19 | 2016-08-25 | Compugen Ltd. | Anti-pvrig antibodies and methods of use |
| JP6510075B2 (ja) | 2015-05-18 | 2019-05-08 | トレロ ファーマシューティカルズ, インコーポレイテッド | バイオアベイラビリティが高いアルボシジブプロドラッグ |
| CN107849144B (zh) | 2015-05-29 | 2021-09-17 | 艾吉纳斯公司 | 抗-ctla-4抗体及其使用方法 |
| TWI773646B (zh) | 2015-06-08 | 2022-08-11 | 美商宏觀基因股份有限公司 | 結合lag-3的分子和其使用方法 |
| CN116333138A (zh) | 2015-07-30 | 2023-06-27 | 宏观基因有限公司 | Pd-1结合分子和其使用方法 |
| PE20180773A1 (es) | 2015-10-02 | 2018-05-07 | Hoffmann La Roche | Anticuerpos biespecificos para pd1 y tim3 |
| TWI756187B (zh) | 2015-10-09 | 2022-03-01 | 美商再生元醫藥公司 | 抗lag3抗體及其用途 |
| KR20180085800A (ko) | 2015-12-07 | 2018-07-27 | 젠코어 인코포레이티드 | Cd3 및 psma에 결합하는 이종이합체성 항체 |
| TW202208440A (zh) | 2015-12-14 | 2022-03-01 | 美商宏觀基因股份有限公司 | 對於pd-1和ctla-4具有免疫反應性的雙特異性分子及其使用方法 |
| MX2018007406A (es) * | 2015-12-16 | 2018-08-15 | Merck Sharp & Dohme | Anticuerpos anti-lag3 y fragmentos de enlace al antigeno. |
| AU2017222928A1 (en) * | 2016-02-26 | 2018-09-20 | Eli Lilly And Company | Anti-CD11d antibodies and uses thereof |
| CA3058503A1 (en) | 2016-04-06 | 2017-10-12 | Noxopharm Limited | Isoflavonoid composition with improved pharmacokinetics |
| TWI808055B (zh) | 2016-05-11 | 2023-07-11 | 美商滬亞生物國際有限公司 | Hdac 抑制劑與 pd-1 抑制劑之組合治療 |
| TWI794171B (zh) | 2016-05-11 | 2023-03-01 | 美商滬亞生物國際有限公司 | Hdac抑制劑與pd-l1抑制劑之組合治療 |
| MA55697A (fr) * | 2016-05-18 | 2022-02-23 | Boehringer Ingelheim Int | Molécules d'anticorps pour le traitement du cancer |
| MA45123A (fr) | 2016-05-27 | 2019-04-10 | Agenus Inc | Anticorps anti-tim-3 et leurs méthodes d'utilisation |
| CA3029813A1 (en) | 2016-06-13 | 2017-12-21 | Torque Therapeutics, Inc. | Methods and compositions for promoting immune cell function |
| IL263542B2 (en) | 2016-06-14 | 2024-10-01 | Xencor Inc | Bispecific antibodies inhibit immunological checkpoint |
| US11214618B2 (en) | 2016-06-20 | 2022-01-04 | F-Star Therapeutics Limited | LAG-3 binding members |
| BR112018076260A2 (pt) | 2016-06-20 | 2019-03-26 | Kymab Limited | anticorpo ou fragmento do mesmo que se liga especificamente a hpd-l1, anticorpo biespecífico ou proteína de fusão, uso de um anticorpo ou fragmento, método, composição farmacêutica, método de modulação, método de inibição, método de tratamento, ácido nucleico, vetor, hospedeiro e imunocitocina |
| US11214620B2 (en) | 2016-06-20 | 2022-01-04 | F-Star Therapeutics Limited | Binding molecules binding PD-L1 and LAG-3 |
| HUE058657T2 (hu) * | 2016-06-23 | 2022-09-28 | Jiangsu Hengrui Medicine Co | Lag-3 antitest, antigénkötõ fragmentuma és gyógyszerészeti alkalmazása |
| KR20190020341A (ko) | 2016-06-28 | 2019-02-28 | 젠코어 인코포레이티드 | 소마토스타틴 수용체 2에 결합하는 이종이량체 항체 |
| GB201612520D0 (en) | 2016-07-19 | 2016-08-31 | F-Star Beta Ltd | Binding molecules |
| NL2017270B1 (en) * | 2016-08-02 | 2018-02-09 | Aduro Biotech Holdings Europe B V | New anti-hCTLA-4 antibodies |
| CN109790532B (zh) * | 2016-08-15 | 2022-06-17 | 国立大学法人北海道大学 | 抗lag-3抗体 |
| IL301682B2 (en) | 2016-08-17 | 2025-06-01 | Compugen Ltd | Anti-tigit antibodies, anti-pvrig antibodies and combinations thereof |
| US10793632B2 (en) | 2016-08-30 | 2020-10-06 | Xencor, Inc. | Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors |
| SG10201912764TA (en) * | 2016-09-08 | 2020-02-27 | Daiichi Sankyo Co Ltd | Antibody for treating autoimmune diseases |
| CA3037380A1 (en) * | 2016-10-11 | 2018-04-19 | Agenus Inc. | Anti-lag-3 antibodies and methods of use thereof |
| UA127050C2 (uk) | 2016-10-13 | 2023-03-29 | Чіа Тай Тяньцин Фармасьютікал Груп Ко., Лтд. | Ahtи-lag-3 антитіло i композиція, що містить його |
| CN110214148A (zh) | 2016-10-14 | 2019-09-06 | Xencor股份有限公司 | 含有IL-15/IL-15Rα Fc融合蛋白和PD-1抗体片段的双特异性异源二聚体融合蛋白 |
| KR102617873B1 (ko) * | 2016-10-28 | 2023-12-22 | 머크 샤프 앤드 돔 엘엘씨 | 티로신 황산화 항체 변이체의 제거를 위한 정제 프로세스, 정제된 조성물 |
| US11279694B2 (en) | 2016-11-18 | 2022-03-22 | Sumitomo Dainippon Pharma Oncology, Inc. | Alvocidib prodrugs and their use as protein kinase inhibitors |
| FI3551660T3 (fi) | 2016-12-07 | 2023-12-11 | Agenus Inc | Anti-ctla-4-vasta-aineita ja niiden käyttömenetelmiä |
| CN108204958A (zh) * | 2016-12-19 | 2018-06-26 | 伊缪泰普有限公司 | 结合测定 |
| CN110462027A (zh) * | 2017-01-06 | 2019-11-15 | 艾欧凡斯生物治疗公司 | 用肿瘤坏死因子受体超家族(tnfrsf)激动剂扩增肿瘤浸润淋巴细胞(til)及til和tnfrsf激动剂的治疗组合 |
| WO2018134254A1 (en) | 2017-01-17 | 2018-07-26 | Heparegenix Gmbh | Protein kinase inhibitors for promoting liver regeneration or reducing or preventing hepatocyte death |
| CN110944651A (zh) | 2017-02-08 | 2020-03-31 | 蜻蜓疗法股份有限公司 | 用于自然杀伤细胞激活的多特异性结合蛋白及其治疗癌症的治疗性用途 |
| ES2955074T3 (es) | 2017-02-20 | 2023-11-28 | Dragonfly Therapeutics Inc | Proteínas que se unen a HER2, NKG2D Y CD16 |
| KR102236259B1 (ko) | 2017-02-22 | 2021-04-06 | 아이-맵 바이오파마 유에스 리미티드 | 항-lag-3 항체 및 그것의 사용 |
| PT3606946T (pt) | 2017-04-03 | 2022-10-17 | Hoffmann La Roche | Imunoconjugados de um anticorpo anti-pd-1 com uma il-2 mutante ou com il-15 |
| CN116375876A (zh) | 2017-04-05 | 2023-07-04 | 豪夫迈·罗氏有限公司 | 特异性结合pd1和lag3的双特异性抗体 |
| CN110621698B (zh) | 2017-04-05 | 2024-04-12 | 法国施维雅药厂 | 靶向pd-1、tim-3及lag-3的组合疗法 |
| LT3606954T (lt) | 2017-04-05 | 2022-09-26 | F. Hoffmann-La Roche Ag | Anti-lag3 antikūnai |
| TWI796329B (zh) | 2017-04-07 | 2023-03-21 | 美商默沙東有限責任公司 | 抗-ilt4抗體及抗原結合片段 |
| NZ759517A (en) * | 2017-04-27 | 2025-02-28 | Tesaro Inc | Antibody agents directed against lymphocyte activation gene-3 (lag-3) and uses thereof |
| AR111651A1 (es) | 2017-04-28 | 2019-08-07 | Novartis Ag | Conjugados de anticuerpos que comprenden agonistas del receptor de tipo toll y terapias de combinación |
| JOP20190260A1 (ar) | 2017-05-02 | 2019-10-31 | Merck Sharp & Dohme | صيغ ثابتة لأجسام مضادة لمستقبل الموت المبرمج 1 (pd-1) وطرق استخدامها |
| SG11201909955XA (en) * | 2017-05-02 | 2019-11-28 | Merck Sharp & Dohme | Formulations of anti-lag3 antibodies and co-formulations of anti-lag3 antibodies and anti-pd-1 antibodies |
| CN110621337B (zh) * | 2017-05-10 | 2021-11-09 | 浙江时迈药业有限公司 | 抗lag3人单克隆抗体及其用途 |
| BR112019021847A2 (pt) | 2017-05-30 | 2020-06-02 | Bristol-Myers Squibb Company | Composições compreendendo um anticorpo anti-lag-3 ou um anticorpo anti-lag-3 e um anticorpo anti-pd-1 ou anti-pd-l1 |
| HUE065242T2 (hu) | 2017-05-30 | 2024-05-28 | Bristol Myers Squibb Co | LAG-3-pozitív tumorok kezelése |
| BR112019018759A2 (pt) | 2017-05-30 | 2020-05-05 | Bristol-Myers Squibb Company | composições compreendendo uma combinação de um anticorpo anti-lag-3, um inibidor da via pd-1, e um agente imunoterápico |
| CN111032085A (zh) * | 2017-06-05 | 2020-04-17 | 昆士兰医学研究所理事会 | 用于癌症治疗或预防的免疫检查点分子拮抗剂和rank-l(nf-kb配体)拮抗剂的组合或其双特异性结合分子及其用途 |
| WO2018229715A1 (en) | 2017-06-16 | 2018-12-20 | Novartis Ag | Compositions comprising anti-cd32b antibodies and methods of use thereof |
| EP3641812A1 (en) | 2017-06-22 | 2020-04-29 | Novartis AG | Antibody molecules to cd73 and uses thereof |
| WO2018235056A1 (en) | 2017-06-22 | 2018-12-27 | Novartis Ag | Il-1beta binding antibodies for use in treating cancer |
| AU2018287519B2 (en) | 2017-06-22 | 2021-07-22 | Novartis Ag | IL-1beta binding antibodies for use in treating cancer |
| AU2018292618A1 (en) | 2017-06-27 | 2019-12-19 | Novartis Ag | Dosage regimens for anti-TIM-3 antibodies and uses thereof |
| WO2019009728A1 (en) * | 2017-07-06 | 2019-01-10 | Merus N.V. | ANTIBODIES THAT MODULATE A BIOLOGICAL ACTIVITY EXPRESSED BY A CELL |
| US10844121B2 (en) * | 2017-07-13 | 2020-11-24 | Nanjing Leads Biolabs Co., Ltd | Antibodies binding LAG-3 and uses thereof |
| KR20250025039A (ko) | 2017-07-20 | 2025-02-20 | 노파르티스 아게 | 항-lag-3 항체의 투여 요법 및 그의 용도 |
| AU2018308088B2 (en) | 2017-07-25 | 2025-05-29 | Truebinding, Inc. | Treating cancer by blocking the interaction of TIM-3 and its ligand |
| EP3675898A4 (en) * | 2017-08-30 | 2021-09-01 | Phanes Therapeutics, Inc. | ANTI-LAG-3 ANTIBODIES AND THEIR USES |
| WO2019055579A1 (en) | 2017-09-12 | 2019-03-21 | Tolero Pharmaceuticals, Inc. | TREATMENT REGIME FOR CANCERS THAT ARE INSENSITIVE TO BCL-2 INHIBITORS USING THE MCL-1 ALVOCIDIB INHIBITOR |
| US20210040205A1 (en) | 2017-10-25 | 2021-02-11 | Novartis Ag | Antibodies targeting cd32b and methods of use thereof |
| US10981992B2 (en) | 2017-11-08 | 2021-04-20 | Xencor, Inc. | Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors |
| AU2018366199A1 (en) * | 2017-11-08 | 2020-05-28 | Xencor, Inc. | Bispecific and monospecific antibodies using novel anti-PD-1 sequences |
| AU2018368731A1 (en) | 2017-11-16 | 2020-05-14 | Novartis Ag | Combination therapies |
| JOP20200131A1 (ar) | 2017-11-17 | 2020-05-28 | Merck Sharp & Dohme | أجسام مضادة خاصة بنسخة تشبه جلوبيولين مناعي 3 (ilt3) واستخدامتها |
| TW201925782A (zh) | 2017-11-30 | 2019-07-01 | 瑞士商諾華公司 | 靶向bcma之嵌合抗原受體及其用途 |
| CN111741976B (zh) | 2017-12-19 | 2024-09-17 | 英沃克斯制药有限公司 | 包括pd-l1抗原结合位点的fc结合片段 |
| MX2020006322A (es) | 2017-12-19 | 2020-09-18 | Xencor Inc | Proteinas de fusion il-2 fc modificadas. |
| BR112020011664A2 (pt) * | 2017-12-22 | 2020-11-17 | Jiangsu Hengrui Medicine Co., Ltd. | composição farmacêutica do anticorpo lag-3 e seu uso |
| CN109970857B (zh) | 2017-12-27 | 2022-09-30 | 信达生物制药(苏州)有限公司 | 抗pd-l1抗体及其用途 |
| CN109970856B (zh) | 2017-12-27 | 2022-08-23 | 信达生物制药(苏州)有限公司 | 抗lag-3抗体及其用途 |
| WO2019129136A1 (zh) | 2017-12-27 | 2019-07-04 | 信达生物制药(苏州)有限公司 | 抗pd-l1抗体及其用途 |
| WO2019129137A1 (zh) | 2017-12-27 | 2019-07-04 | 信达生物制药(苏州)有限公司 | 抗lag-3抗体及其用途 |
| TW201930591A (zh) | 2018-01-08 | 2019-08-01 | 瑞士商諾華公司 | 用於與嵌合抗原受體療法併用之免疫增強rna |
| WO2019141092A1 (zh) * | 2018-01-18 | 2019-07-25 | 四川科伦博泰生物医药股份有限公司 | 抗lag-3抗体及其用途 |
| CN108085393B (zh) * | 2018-01-31 | 2020-06-02 | 青岛泱深生物医药有限公司 | 肾透明细胞癌相关生物标志物及其应用 |
| CA3090249A1 (en) | 2018-01-31 | 2019-08-08 | Novartis Ag | Combination therapy using a chimeric antigen receptor |
| WO2019148412A1 (en) | 2018-02-01 | 2019-08-08 | Merck Sharp & Dohme Corp. | Anti-pd-1/lag3 bispecific antibodies |
| WO2019148410A1 (en) | 2018-02-01 | 2019-08-08 | Merck Sharp & Dohme Corp. | Anti-pd-1 antibodies |
| EP3746119A4 (en) * | 2018-02-01 | 2021-11-10 | Merck Sharp & Dohme Corp. | METHOD OF TREATMENT FOR CANCER OR INFECTION USING A COMBINATION OF ANTI-PD-1 ANTIBODY, ANTI-LAG3 ANTIBODY, AND ANTI-TIGITE ANTIBODY |
| CA3090236A1 (en) | 2018-02-08 | 2019-08-15 | Dragonfly Therapeutics, Inc. | Combination therapy of cancer involving multi-specific binding proteins that activate natural killer cells |
| SG11202007482WA (en) | 2018-02-08 | 2020-09-29 | Dragonfly Therapeutics Inc | Antibody variable domains targeting the nkg2d receptor |
| WO2019160956A1 (en) | 2018-02-13 | 2019-08-22 | Novartis Ag | Chimeric antigen receptor therapy in combination with il-15r and il15 |
| GB201802573D0 (en) * | 2018-02-16 | 2018-04-04 | Crescendo Biologics Ltd | Therapeutic molecules that bind to LAG3 |
| KR102832460B1 (ko) | 2018-02-20 | 2025-07-11 | 드래곤플라이 쎄라퓨틱스, 인크. | Cd33, nkg2d, 및 cd16에 결합하는 다중-특이적 결합 단백질, 및 이의 사용 방법 |
| TWI833738B (zh) * | 2018-03-20 | 2024-03-01 | 中國大陸商上海藥明生物技術有限公司 | 新型抗lag-3抗體多肽 |
| US11661452B2 (en) | 2018-03-20 | 2023-05-30 | WuXi Biologics Ireland Limited | Anti-lag-3 antibody polypeptide |
| AU2019241350B2 (en) | 2018-03-30 | 2025-10-02 | Nanjing Legend Biotech Co., Ltd. | Single-domain antibodies against LAG-3 and uses thereof |
| EP3774921A4 (en) * | 2018-04-03 | 2022-01-05 | Dragonfly Therapeutics, Inc. | ANTIBODY VARIABLE DOMAINS AGAINST DLL3 AND USE OF IT |
| CN112469477A (zh) | 2018-04-04 | 2021-03-09 | Xencor股份有限公司 | 与成纤维细胞活化蛋白结合的异源二聚体抗体 |
| US20210147547A1 (en) | 2018-04-13 | 2021-05-20 | Novartis Ag | Dosage Regimens For Anti-Pd-L1 Antibodies And Uses Thereof |
| AU2019256539A1 (en) | 2018-04-18 | 2020-11-26 | Xencor, Inc. | PD-1 targeted heterodimeric fusion proteins containing IL-15/IL-15Ra Fc-fusion proteins and PD-1 antigen binding domains and uses thereof |
| EP3781598A1 (en) | 2018-04-18 | 2021-02-24 | Xencor, Inc. | Tim-3 targeted heterodimeric fusion proteins containing il-15/il-15ra fc-fusion proteins and tim-3 antigen binding domains |
| JP7368453B2 (ja) * | 2018-05-03 | 2023-10-24 | シャンハイ エピムアブ バイオセラピューティクス カンパニー リミテッド | Pd-1およびlag-3に対する高親和性抗体ならびにそれらから作製された二重特異性結合タンパク質 |
| TWI869346B (zh) | 2018-05-30 | 2025-01-11 | 瑞士商諾華公司 | Entpd2抗體、組合療法、及使用該等抗體和組合療法之方法 |
| US20210214459A1 (en) | 2018-05-31 | 2021-07-15 | Novartis Ag | Antibody molecules to cd73 and uses thereof |
| TWI848951B (zh) | 2018-06-01 | 2024-07-21 | 瑞士商諾華公司 | 針對bcma之結合分子及其用途 |
| CA3103385A1 (en) | 2018-07-10 | 2020-01-16 | Novartis Ag | 3-(5-hydroxy-1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and their use in the treatment of ikaros family zinc finger 2 (ikzf2)-dependent diseases |
| AR116109A1 (es) | 2018-07-10 | 2021-03-31 | Novartis Ag | Derivados de 3-(5-amino-1-oxoisoindolin-2-il)piperidina-2,6-diona y usos de los mismos |
| GB201811450D0 (en) | 2018-07-12 | 2018-08-29 | F Star Delta Ltd | Mesothelin and CD137 binding molecules |
| GB201811415D0 (en) | 2018-07-12 | 2018-08-29 | F Star Beta Ltd | Anti-Mesothelin Anti bodies |
| GB201811408D0 (en) | 2018-07-12 | 2018-08-29 | F Star Beta Ltd | CD137 Binding Molecules |
| GB201811410D0 (en) | 2018-07-12 | 2018-08-29 | F Star Beta Ltd | OX40 Binding molecules |
| GB201811403D0 (en) | 2018-07-12 | 2018-08-29 | F Star Beta Ltd | Antibody molecules |
| CN112423845B (zh) | 2018-07-12 | 2024-07-30 | F-星治疗有限公司 | 结合pd-l1和cd137的抗体分子 |
| CA3106048A1 (en) | 2018-07-12 | 2020-01-16 | F-Star Beta Limited | Antibody molecules that bind cd137 and ox40 |
| WO2020021465A1 (en) | 2018-07-25 | 2020-01-30 | Advanced Accelerator Applications (Italy) S.R.L. | Method of treatment of neuroendocrine tumors |
| KR20210040080A (ko) | 2018-07-26 | 2021-04-12 | 브리스톨-마이어스 스큅 컴퍼니 | 암의 치료를 위한 lag-3 조합 요법 |
| MX2021001527A (es) | 2018-08-08 | 2021-06-15 | Dragonfly Therapeutics Inc | Proteínas de unión a nkg2d, cd16 y a un antígeno asociado a tumor. |
| MA53293A (fr) | 2018-08-08 | 2021-11-17 | Dragonfly Therapeutics Inc | Protéines de liaison multi-spécifiques se liant à bcma, nkg2d et cd16, et méthodes d'utilisation |
| EA202091888A1 (ru) | 2018-08-08 | 2020-10-23 | Драгонфлай Терапьютикс, Инк. | Вариабельные домены антител, нацеленные на рецептор nkg2d |
| WO2020038397A1 (en) * | 2018-08-21 | 2020-02-27 | I-Mab | Anti-pd-l1/anti-lag3 bispecific antibodies and uses thereof |
| WO2020055702A1 (en) | 2018-09-13 | 2020-03-19 | Merck Sharp & Dohme Corp. | Combination of pd-1 antagonist and lag3 antagonist for treating non-microsatellite instablity-high/proficient mismatch repair colorectal cancer |
| SG11202103192RA (en) | 2018-10-03 | 2021-04-29 | Xencor Inc | Il-12 heterodimeric fc-fusion proteins |
| PL3866850T3 (pl) | 2018-10-19 | 2024-10-14 | Bristol-Myers Squibb Company | Terapia skojarzona czerniaka |
| WO2020089811A1 (en) | 2018-10-31 | 2020-05-07 | Novartis Ag | Dc-sign antibody drug conjugates |
| EP3876990A4 (en) * | 2018-11-07 | 2023-09-06 | Merck Sharp & Dohme LLC | CO-FORMULATIONS OF ANTI-LAG3 ANTIBODIES AND ANTI-PD-1 ANTIBODIES |
| US11034710B2 (en) | 2018-12-04 | 2021-06-15 | Sumitomo Dainippon Pharma Oncology, Inc. | CDK9 inhibitors and polymorphs thereof for use as agents for treatment of cancer |
| WO2020128972A1 (en) | 2018-12-20 | 2020-06-25 | Novartis Ag | Dosing regimen and pharmaceutical combination comprising 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives |
| CN113166762B (zh) | 2018-12-21 | 2025-01-14 | 瓦莱里奥治疗公司 | 新的偶联核酸分子及其用途 |
| EP3897613A1 (en) | 2018-12-21 | 2021-10-27 | Novartis AG | Use of il-1beta binding antibodies |
| AU2019406840A1 (en) | 2018-12-21 | 2021-06-03 | Novartis Ag | Use of IL-1 beta antibodies in the treatment or prevention of myelodysplastic syndrome |
| EP3898674A1 (en) | 2018-12-21 | 2021-10-27 | Novartis AG | Use of il-1beta binding antibodies |
| WO2020128637A1 (en) | 2018-12-21 | 2020-06-25 | Novartis Ag | Use of il-1 binding antibodies in the treatment of a msi-h cancer |
| CA3127502A1 (en) | 2019-02-12 | 2020-08-20 | Sumitomo Dainippon Pharma Oncology, Inc. | Formulations comprising heterocyclic protein kinase inhibitors |
| ES2982474T3 (es) | 2019-02-15 | 2024-10-16 | Novartis Ag | Derivados de 3-(1-oxoisoindolin-2-il)piperidin-1,6-diona sustituidos y usos de estos |
| ES3032659T3 (en) | 2019-02-15 | 2025-07-23 | Novartis Ag | 3-(1-oxo-5-(piperidin-4-yl)isoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof |
| AU2020232605A1 (en) | 2019-03-01 | 2021-10-21 | Xencor, Inc. | Heterodimeric antibodies that bind ENPP3 and CD3 |
| US11793802B2 (en) | 2019-03-20 | 2023-10-24 | Sumitomo Pharma Oncology, Inc. | Treatment of acute myeloid leukemia (AML) with venetoclax failure |
| WO2020198077A1 (en) | 2019-03-22 | 2020-10-01 | Sumitomo Dainippon Pharma Oncology, Inc. | Compositions comprising pkm2 modulators and methods of treatment using the same |
| WO2020216383A1 (en) * | 2019-04-26 | 2020-10-29 | Single Cell Technology, Inc. | Anti-lag-3 antibodies |
| WO2020236668A1 (en) * | 2019-05-17 | 2020-11-26 | Gb006, Inc. | Leukadherin-1 alone or in combination for use in the treatment of cancer |
| CA3141162A1 (en) | 2019-05-22 | 2020-11-26 | Leidos, Inc. | Lag3 binding peptides |
| US20220363760A1 (en) | 2019-05-30 | 2022-11-17 | Bristol-Myers Squibb Company | Multi-tumor gene signature for suitability to immuno-oncology therapy |
| WO2020243570A1 (en) | 2019-05-30 | 2020-12-03 | Bristol-Myers Squibb Company | Cell localization signature and combination therapy |
| JP2022534982A (ja) | 2019-05-30 | 2022-08-04 | ブリストル-マイヤーズ スクイブ カンパニー | 細胞局在化シグネチャーおよびその使用 |
| US11529350B2 (en) | 2019-07-03 | 2022-12-20 | Sumitomo Pharma Oncology, Inc. | Tyrosine kinase non-receptor 1 (TNK1) inhibitors and uses thereof |
| CA3139314A1 (en) * | 2019-07-17 | 2021-01-21 | Noxopharm Limited | Immuno-oncology therapy using isoflavone compounds |
| US20220251194A1 (en) * | 2019-07-30 | 2022-08-11 | Merck Sharp & Dohme Corp. | Anti-pd-1/lag3/tigit trispecific antibodies and anti-pd-1/lag3 bicpecific antibodies |
| WO2021024020A1 (en) | 2019-08-06 | 2021-02-11 | Astellas Pharma Inc. | Combination therapy involving antibodies against claudin 18.2 and immune checkpoint inhibitors for treatment of cancer |
| US20220348651A1 (en) | 2019-09-18 | 2022-11-03 | Novartis Ag | Entpd2 antibodies, combination therapies, and methods of using the antibodies and combination therapies |
| WO2021055994A1 (en) | 2019-09-22 | 2021-03-25 | Bristol-Myers Squibb Company | Quantitative spatial profiling for lag-3 antagonist therapy |
| CN114786679A (zh) | 2019-10-21 | 2022-07-22 | 诺华股份有限公司 | 具有维奈托克和tim-3抑制剂的组合疗法 |
| CN114786680A (zh) | 2019-10-21 | 2022-07-22 | 诺华股份有限公司 | Tim-3抑制剂及其用途 |
| WO2021092220A1 (en) | 2019-11-06 | 2021-05-14 | Bristol-Myers Squibb Company | Methods of identifying a subject with a tumor suitable for a checkpoint inhibitor therapy |
| WO2021092221A1 (en) | 2019-11-06 | 2021-05-14 | Bristol-Myers Squibb Company | Methods of identifying a subject with a tumor suitable for a checkpoint inhibitor therapy |
| US20220411499A1 (en) | 2019-11-08 | 2022-12-29 | Bristol-Myers Squibb Company | LAG-3 Antagonist Therapy for Melanoma |
| JP2023500385A (ja) * | 2019-11-11 | 2023-01-05 | シーストーン・ファーマシューティカルズ・(スージョウ)・カンパニー・リミテッド | 医薬組合せ物およびその使用 |
| MX2022007759A (es) | 2019-12-20 | 2022-07-19 | Novartis Ag | Combinacion del anticuerpo anti tim-3 mbg453 y anticuerpo anti tgf-beta nis793, con o sin decitabina o el anticuerpo anti pd-1 spartalizumab, para el tratamiento de mielofibrosis y sindrome mielodisplasico. |
| EP4090335A1 (en) | 2020-01-17 | 2022-11-23 | Novartis AG | Combination comprising a tim-3 inhibitor and a hypomethylating agent for use in treating myelodysplastic syndrome or chronic myelomonocytic leukemia |
| KR20220131279A (ko) * | 2020-01-21 | 2022-09-27 | 상하이 헨리우스 바이오테크, 인크. | 항lag3단일 클론 항체 및 그 제조 방법과 응용 |
| EP4096802A4 (en) * | 2020-01-29 | 2024-07-03 | Merck Sharp & Dohme LLC | METHOD FOR SEPARATION OF HOST CELL LIPASES FROM ANTI-LAG3 ANTIBODY PRODUCTION |
| US20230087600A1 (en) | 2020-02-06 | 2023-03-23 | Bristol-Myers Squibb Company | Il-10 and uses thereof |
| KR102245082B1 (ko) * | 2020-02-14 | 2021-04-26 | 단국대학교 천안캠퍼스 산학협력단 | 치주인대전구세포 표면에 특이적으로 결합하는 두 가지 IgG 타입 단일클론항체 LG43, LG73 및 그의 용도 |
| JP2023519990A (ja) | 2020-03-30 | 2023-05-15 | ノクソファーム リミティド | 感染に関連する炎症の治療のための方法 |
| US20230184771A1 (en) * | 2020-04-21 | 2023-06-15 | Board Of Regents, The University Of Texas System | Methods for treating bladder cancer |
| MX2022013944A (es) | 2020-05-06 | 2022-11-30 | Dragonfly Therapeutics Inc | Proteinas que se unen al receptor activador de celulas asesinas naturales grupo 2 miembro d (nkg2d), cumulo de diferenciacion (cd16) y miembro a de la familia de dominios de lectina tipo c 12 (clec12a). |
| WO2021231976A1 (en) | 2020-05-14 | 2021-11-18 | Xencor, Inc. | Heterodimeric antibodies that bind prostate specific membrane antigen (psma) and cd3 |
| US12281166B2 (en) | 2020-05-26 | 2025-04-22 | Truebinding, Inc. | Methods of treating inflammatory diseases by blocking Galectin-3 |
| CA3185657A1 (en) | 2020-06-04 | 2021-12-09 | Leidos, Inc. | Immunomodulatory compounds |
| CN111808192B (zh) * | 2020-06-05 | 2022-02-15 | 北京天广实生物技术股份有限公司 | 结合lag3的抗体及其用途 |
| AR122644A1 (es) | 2020-06-19 | 2022-09-28 | Onxeo | Nuevas moléculas de ácido nucleico conjugado y sus usos |
| MX2022015852A (es) | 2020-06-23 | 2023-01-24 | Novartis Ag | Regimen de dosificacion que comprende derivados de 3-(1-oxoisoindolin-2-il)piperidina-2,6-diona. |
| MX2023000197A (es) | 2020-07-07 | 2023-02-22 | BioNTech SE | Arn terapeutico para el cancer positivo para vph. |
| EP4188947A2 (en) * | 2020-07-31 | 2023-06-07 | Leidos, Inc. | Lag3 binding peptides |
| EP4188549A1 (en) | 2020-08-03 | 2023-06-07 | Novartis AG | Heteroaryl substituted 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof |
| KR102607909B1 (ko) | 2020-08-19 | 2023-12-01 | 젠코어 인코포레이티드 | 항-cd28 조성물 |
| CA3193421A1 (en) | 2020-08-28 | 2022-03-03 | Bristol-Myers Squibb Company | Lag-3 antagonist therapy for hepatocellular carcinoma |
| EP4204020A1 (en) | 2020-08-31 | 2023-07-05 | Advanced Accelerator Applications International S.A. | Method of treating psma-expressing cancers |
| US20230321285A1 (en) | 2020-08-31 | 2023-10-12 | Advanced Accelerator Applications International Sa | Method of treating psma-expressing cancers |
| EP4204453A1 (en) | 2020-08-31 | 2023-07-05 | Bristol-Myers Squibb Company | Cell localization signature and immunotherapy |
| EP4232019A1 (en) | 2020-10-23 | 2023-08-30 | Bristol-Myers Squibb Company | Lag-3 antagonist therapy for lung cancer |
| AU2021373366A1 (en) | 2020-11-06 | 2023-06-01 | Novartis Ag | Cd19 binding molecules and uses thereof |
| WO2022109987A1 (en) * | 2020-11-27 | 2022-06-02 | Shanghai Benemae Pharmaceutical Corporation | Novel anti-lag3 antibodies and methods of making and using the same |
| JP2024508207A (ja) | 2020-12-02 | 2024-02-26 | ブイアイビー ブイゼットダブリュ | がんに対する組み合わせ治療におけるltbrアゴニスト |
| WO2022120179A1 (en) | 2020-12-03 | 2022-06-09 | Bristol-Myers Squibb Company | Multi-tumor gene signatures and uses thereof |
| CN115819585B (zh) * | 2020-12-10 | 2023-06-02 | 北京东方百泰生物科技股份有限公司 | 一种抗lag-3的单克隆抗体、其抗原结合片段及其应用 |
| TW202237119A (zh) | 2020-12-10 | 2022-10-01 | 美商住友製藥腫瘤公司 | Alk﹘5抑制劑和彼之用途 |
| TW202245808A (zh) | 2020-12-21 | 2022-12-01 | 德商拜恩迪克公司 | 用於治療癌症之治療性rna |
| WO2022135667A1 (en) | 2020-12-21 | 2022-06-30 | BioNTech SE | Therapeutic rna for treating cancer |
| WO2022135666A1 (en) | 2020-12-21 | 2022-06-30 | BioNTech SE | Treatment schedule for cytokine proteins |
| US20220233689A1 (en) | 2020-12-28 | 2022-07-28 | Bristol-Myers Squibb Company | Methods of treating tumors |
| RS66849B1 (sr) | 2020-12-28 | 2025-06-30 | Bristol Myers Squibb Co | Kompozicije antitela i postupci njihove upotrebe |
| US20240384350A1 (en) | 2021-01-29 | 2024-11-21 | Board Of Regents, The University Of Texas System | Methods of treating cancer with kinase inhibitors |
| WO2022187539A1 (en) | 2021-03-03 | 2022-09-09 | Dragonfly Therapeutics, Inc. | Methods of treating cancer using multi-specific binding proteins that bind nkg2d, cd16 and a tumor-associated antigen |
| WO2022189936A1 (en) * | 2021-03-08 | 2022-09-15 | Medimmune, Llc | Antibodies directed against gdf-15 |
| JP2024511319A (ja) | 2021-03-09 | 2024-03-13 | ゼンコア インコーポレイテッド | Cd3及びcldn6に結合するヘテロ二量体抗体 |
| JP2024509274A (ja) | 2021-03-10 | 2024-02-29 | ゼンコア インコーポレイテッド | Cd3及びgpc3に結合するヘテロ二量体抗体 |
| KR20240005700A (ko) | 2021-03-29 | 2024-01-12 | 주노 쎄러퓨티크스 인코퍼레이티드 | 체크포인트 억제제 요법 및 car t 세포 요법의 조합을 사용한 투여 및 치료 방법 |
| TW202304979A (zh) | 2021-04-07 | 2023-02-01 | 瑞士商諾華公司 | 抗TGFβ抗體及其他治療劑用於治療增殖性疾病之用途 |
| WO2022216979A1 (en) | 2021-04-08 | 2022-10-13 | Board Of Regents, The University Of Texas System | Compounds and methods for theranostic targeting of parp activity |
| EP4323356A1 (en) | 2021-04-13 | 2024-02-21 | Nuvalent, Inc. | Amino-substituted heterocycles for treating cancers with egfr mutations |
| US20240285740A1 (en) | 2021-05-12 | 2024-08-29 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for treating cancer |
| AR125874A1 (es) | 2021-05-18 | 2023-08-23 | Novartis Ag | Terapias de combinación |
| CN115403670A (zh) | 2021-05-26 | 2022-11-29 | 安徽瀚海博兴生物技术有限公司 | 抗cd40抗体及其用途 |
| CA3225254A1 (en) | 2021-07-13 | 2023-01-19 | BioNTech SE | Multispecific binding agents against cd40 and cd137 in combination therapy for cancer |
| CN115611983A (zh) | 2021-07-14 | 2023-01-17 | 三优生物医药(上海)有限公司 | Cldn18.2结合分子及其用途 |
| KR20240051178A (ko) * | 2021-08-17 | 2024-04-19 | 웨어울프 세라퓨틱스, 인크. | 유도성 il-2 및 pd-1/pd-l1 병용 요법 |
| WO2023051621A1 (zh) * | 2021-09-29 | 2023-04-06 | 中山康方生物医药有限公司 | 抗lag3抗体、药物组合物及用途 |
| TW202333802A (zh) | 2021-10-11 | 2023-09-01 | 德商拜恩迪克公司 | 用於肺癌之治療性rna(二) |
| WO2023077090A1 (en) | 2021-10-29 | 2023-05-04 | Bristol-Myers Squibb Company | Lag-3 antagonist therapy for hematological cancer |
| EP4426739A1 (en) * | 2021-11-01 | 2024-09-11 | Elpiscience (Suzhou) Biopharma, Ltd. | Novel anti-lag3 antibodies |
| IL313439A (en) | 2021-12-16 | 2024-08-01 | Valerio Therapeutics | New conjugated nucleic acid molecules and their uses |
| JP2025503962A (ja) | 2022-01-26 | 2025-02-06 | ブリストル-マイヤーズ スクイブ カンパニー | 肝細胞がんのための併用療法 |
| US20250327041A1 (en) | 2022-02-24 | 2025-10-23 | Io Biotech Aps | Nucleotide delivery of cancer therapy |
| JP2025507694A (ja) | 2022-02-25 | 2025-03-21 | ブリストル-マイヤーズ スクイブ カンパニー | 結腸直腸癌に対する組み合わせ療法 |
| WO2023168404A1 (en) | 2022-03-04 | 2023-09-07 | Bristol-Myers Squibb Company | Methods of treating a tumor |
| AU2023230110A1 (en) | 2022-03-08 | 2024-10-24 | Alentis Therapeutics Ag | Use of anti-claudin-1 antibodies to increase t cell availability |
| JP2025509832A (ja) | 2022-03-15 | 2025-04-11 | コンピュジェン リミテッド | Il-18bpアンタゴニスト抗体、並びに癌の治療での単剤療法及び併用療法におけるそれらの使用 |
| KR20240159621A (ko) | 2022-03-18 | 2024-11-05 | 브리스톨-마이어스 스큅 컴퍼니 | 폴리펩티드를 단리하는 방법 |
| CN114634574B (zh) * | 2022-04-18 | 2022-12-20 | 先进生物(苏州)有限公司 | 抗B7H6的scFv抗体、其编码基因及其应用 |
| WO2023214325A1 (en) | 2022-05-05 | 2023-11-09 | Novartis Ag | Pyrazolopyrimidine derivatives and uses thereof as tet2 inhibitors |
| AU2023281061A1 (en) | 2022-06-02 | 2024-12-05 | Bristol-Myers Squibb Company | Antibody compositions and methods of use thereof |
| WO2024102603A1 (en) * | 2022-11-07 | 2024-05-16 | Merck Sharp & Dohme Llc | Bisecting-glycan bridged conjugation for producing glycoprotein conjugates |
| CN120390652A (zh) | 2022-12-01 | 2025-07-29 | 免疫医疗有限公司 | 用于治疗癌症的包含抗pd-l1抗体和抗cd73抗体的组合疗法 |
| AU2023393653A1 (en) | 2022-12-14 | 2025-05-22 | Astellas Pharma Europe Bv | Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and immune checkpoint inhibitors |
| AU2023409221A1 (en) | 2022-12-21 | 2025-06-12 | Bristol-Myers Squibb Company | Combination therapy for lung cancer |
| WO2024163477A1 (en) | 2023-01-31 | 2024-08-08 | University Of Rochester | Immune checkpoint blockade therapy for treating staphylococcus aureus infections |
| AU2024225483A1 (en) | 2023-02-23 | 2025-08-28 | Imcheck Therapeutics | Combination of btn3a activating antibody and immune checkpoint inhibitors |
| CN120835901A (zh) | 2023-03-13 | 2025-10-24 | 豪夫迈·罗氏有限公司 | 采用pd1-lag3双特异性抗体和hla-g t细胞双特异性抗体的组合疗法 |
| WO2024196952A1 (en) | 2023-03-20 | 2024-09-26 | Bristol-Myers Squibb Company | Tumor subtype assessment for cancer therapy |
| TW202515608A (zh) | 2023-06-26 | 2025-04-16 | 以色列商坎布根有限公司 | Il—18bp拮抗抗體及其於癌症治療之單一療法及組合療法的用途 |
| WO2025038763A1 (en) | 2023-08-15 | 2025-02-20 | Bristol-Myers Squibb Company | Ceramic hydroxyapatite chromatography flow through method |
| WO2025054110A1 (en) * | 2023-09-07 | 2025-03-13 | Merck Sharp & Dohme Llc | Combination therapy of a pd-1 antagonist and lag3 antagonist for treating patients with cancer before and/or after surgery |
| WO2025068461A1 (en) | 2023-09-29 | 2025-04-03 | Negio Therapeutics | Guanfacine derivatives and their use in treating cancer |
| WO2025068452A1 (en) | 2023-09-29 | 2025-04-03 | Negio Therapeutics | Guanfacine derivatives and their use in treating cancer |
| WO2025120867A1 (en) | 2023-12-08 | 2025-06-12 | Astellas Pharma Inc. | Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and anti-vegfr2 antibodies |
| WO2025120866A1 (en) | 2023-12-08 | 2025-06-12 | Astellas Pharma Inc. | Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2 |
| WO2025121445A1 (en) | 2023-12-08 | 2025-06-12 | Astellas Pharma Inc. | Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2 |
| WO2025132831A1 (en) | 2023-12-19 | 2025-06-26 | Universite D'aix-Marseille | N-heteroaryl derivatives and uses thereof for treating cancer |
| WO2025145207A1 (en) | 2023-12-29 | 2025-07-03 | Bristol-Myers Squibb Company | Combination therapy of kras inhibitor and treg-depleting agent |
| EP4658320A1 (en) | 2024-02-27 | 2025-12-10 | Bristol-Myers Squibb Company | Anti-ceacam5 antibody drug conjugates |
| US20250361320A1 (en) | 2024-02-27 | 2025-11-27 | Bristol-Myers Squibb Company | Anti-ceacam5 antibodies and uses thereof |
| WO2025202213A1 (en) | 2024-03-26 | 2025-10-02 | Institut National de la Santé et de la Recherche Médicale | Lipid nanoparticle loaded with antitumoral agent and functionnalized to target immosuppressive cells |
| WO2025245489A1 (en) | 2024-05-24 | 2025-11-27 | Bristol-Myers Squibb Company | Treatment of tumors in subjects having fgl-1 positive samples |
Family Cites Families (127)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4946A (en) | 1847-01-26 | Improvement in carriage-wheels | ||
| US778A (en) | 1838-06-12 | Thomas wright | ||
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4740461A (en) | 1983-12-27 | 1988-04-26 | Genetics Institute, Inc. | Vectors and methods for transformation of eucaryotic cells |
| EP0154316B1 (en) | 1984-03-06 | 1989-09-13 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| EP0216846B2 (en) | 1985-04-01 | 1995-04-26 | Celltech Limited | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same |
| GB8601597D0 (en) | 1986-01-23 | 1986-02-26 | Wilson R H | Nucleotide sequences |
| US4959455A (en) | 1986-07-14 | 1990-09-25 | Genetics Institute, Inc. | Primate hematopoietic growth factors IL-3 and pharmaceutical compositions |
| DE3785186T2 (de) | 1986-09-02 | 1993-07-15 | Enzon Lab Inc | Bindungsmolekuele mit einzelpolypeptidkette. |
| US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US4912040A (en) | 1986-11-14 | 1990-03-27 | Genetics Institute, Inc. | Eucaryotic expression system |
| AU600575B2 (en) | 1987-03-18 | 1990-08-16 | Sb2, Inc. | Altered antibodies |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| GB8717430D0 (en) | 1987-07-23 | 1987-08-26 | Celltech Ltd | Recombinant dna product |
| US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
| EP0401384B1 (en) | 1988-12-22 | 1996-03-13 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| DE3920358A1 (de) | 1989-06-22 | 1991-01-17 | Behringwerke Ag | Bispezifische und oligospezifische, mono- und oligovalente antikoerperkonstrukte, ihre herstellung und verwendung |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| US5976877A (en) | 1990-01-08 | 1999-11-02 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Proteins produced by human lymphocytes DNA sequence encoding these proteins and their pharmaceutical and biological uses |
| FR2656800B1 (fr) | 1990-01-08 | 1992-05-15 | Roussy Inst Gustave | Nouvelles proteines produits par les lymphocytes humains, sequence d'adn codant pour ces proteines et applications pharmaceutiques et biologiques. |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| KR100272077B1 (ko) | 1990-08-29 | 2000-11-15 | 젠팜인터내셔날,인코포레이티드 | 이종 항체를 생산할 수 있는 전이유전자를 가진 인간이외의 동물 |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| AU3178993A (en) | 1991-11-25 | 1993-06-28 | Enzon, Inc. | Multivalent antigen-binding proteins |
| US5932448A (en) | 1991-11-29 | 1999-08-03 | Protein Design Labs., Inc. | Bispecific antibody heterodimers |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| US6129914A (en) | 1992-03-27 | 2000-10-10 | Protein Design Labs, Inc. | Bispecific antibody effective to treat B-cell lymphoma and cell line |
| CA2118508A1 (en) | 1992-04-24 | 1993-11-11 | Elizabeth S. Ward | Recombinant production of immunoglobulin-like domains in prokaryotic cells |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| EP0656946B2 (en) | 1992-08-21 | 2010-03-31 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
| DE69427974T2 (de) | 1993-04-29 | 2001-12-06 | Unilever N.V., Rotterdam | Herstellung von antikörpern oder funktionstüchtig gemachten teilen davon, abgeleitet von schweren ketten von immunglobulinen von camelidae |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| ES2281899T3 (es) * | 1994-05-06 | 2007-10-01 | Institut Gustave Roussy | Fracciones polipeptidicas solubles de la proteina lag-3; procedimiento de produccion; composicion terapeutica; anticuerpo anti-idiotipo. |
| US5532210A (en) | 1994-06-08 | 1996-07-02 | E. I. Du Pont De Nemours And Company | High temperature superconductor dielectric slow wave structures for accelerators and traveling wave tubes |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| CA2227334A1 (en) | 1995-07-21 | 1997-02-06 | Applied Research Systems Ars Holding N.V. | Methods for detecting, identifying, isolating, and selectively labelling and targeting th1 lymphocytes by means of the lag-3 protein |
| IL130123A (en) | 1996-11-28 | 2007-07-24 | Roussy Inst Gustave | LAG-3 protein mutants, their expression, use and method of production |
| UA73270C2 (en) | 1996-11-29 | 2005-07-15 | Application of genetically structured cells expressing lymphocytes activation gene (lag-3) on the surface for protection of transplant against rejection and a method for induction of specific protection against rejection of material being tranplanted | |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| ES2258817T3 (es) | 1997-05-21 | 2006-09-01 | Biovation Limited | Metodo para la produccion de proteinas no inmunogenas. |
| EP0900841A1 (en) | 1997-06-18 | 1999-03-10 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | LAG-3 splice variants |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| GB9818110D0 (en) | 1998-08-19 | 1998-10-14 | Weston Medical Ltd | Needleless injectors and other devices |
| US6096002A (en) | 1998-11-18 | 2000-08-01 | Bioject, Inc. | NGAS powered self-resetting needle-less hypodermic jet injection apparatus and method |
| ATE477273T1 (de) | 1998-12-01 | 2010-08-15 | Facet Biotech Corp | Humanisierte antikoerper gegen gamma-interferon |
| BR0008758A (pt) | 1999-01-15 | 2001-12-04 | Genentech Inc | Variantes de polipeptìdeos parentais com funçãoefetora alterada, polipeptìdeos, composição ácidonucleico isolado, vetor, célula hospedeira,método para produzir uma variante depolipeptìdeo, método para o tratamento de umadesordem em mamìferos e método para produziruma região fc variante |
| CA2369292C (en) | 1999-04-09 | 2010-09-21 | Kyowa Hakko Kogyo Co. Ltd. | Method of modulating the activity of functional immune molecules |
| US7449308B2 (en) | 2000-06-28 | 2008-11-11 | Glycofi, Inc. | Combinatorial DNA library for producing modified N-glycans in lower eukaryotes |
| KR100787073B1 (ko) | 2000-06-28 | 2007-12-21 | 글리코파이, 인크. | 변형된 당단백질의 제조방법 |
| US7795002B2 (en) | 2000-06-28 | 2010-09-14 | Glycofi, Inc. | Production of galactosylated glycoproteins in lower eukaryotes |
| ATE516820T1 (de) | 2000-09-29 | 2011-08-15 | Schering Corp | Pegyliertes interleukin 10 |
| US6946292B2 (en) | 2000-10-06 | 2005-09-20 | Kyowa Hakko Kogyo Co., Ltd. | Cells producing antibody compositions with increased antibody dependent cytotoxic activity |
| SE0103423D0 (sv) | 2001-10-12 | 2001-10-12 | Astrazeneca Ab | Polymorphism |
| AU2003226356A1 (en) | 2002-04-12 | 2003-10-27 | Ramot At Tel Aviv University Ltd. | Prevention of brain inflammation as a result of induced autoimmune response |
| JP2006523226A (ja) | 2003-02-28 | 2006-10-12 | ザ ジョンズ ホプキンス ユニバーシティ | T細胞調節方法 |
| US7410483B2 (en) | 2003-05-23 | 2008-08-12 | Novare Surgical Systems, Inc. | Hand-actuated device for remote manipulation of a grasping tool |
| WO2005047324A2 (en) | 2003-11-10 | 2005-05-26 | Schering Corp | Interleukin-10 antibodies |
| DE602005022871D1 (de) | 2004-06-07 | 2010-09-23 | Univ Ramot | Verfahren zur passiven immunisierung gegen eine durch amyloidaggregation gekennzeichnete krankheit oder erkrankung mit vermindertem nervenentzündungsrisiko |
| US7846443B2 (en) | 2006-08-11 | 2010-12-07 | Schering Corporation | Antibodies to IL-17A |
| KR20090088950A (ko) | 2006-12-14 | 2009-08-20 | 쉐링 코포레이션 | 가공된 항-tslp 항체 |
| US9244059B2 (en) * | 2007-04-30 | 2016-01-26 | Immutep Parc Club Orsay | Cytotoxic anti-LAG-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| EP1987839A1 (en) | 2007-04-30 | 2008-11-05 | I.N.S.E.R.M. Institut National de la Sante et de la Recherche Medicale | Cytotoxic anti-LAG-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| NZ600758A (en) | 2007-06-18 | 2013-09-27 | Merck Sharp & Dohme | Antibodies to human programmed death receptor pd-1 |
| EP2044949A1 (en) | 2007-10-05 | 2009-04-08 | Immutep | Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response |
| AR072999A1 (es) | 2008-08-11 | 2010-10-06 | Medarex Inc | Anticuerpos humanos que se unen al gen 3 de activacion linfocitaria (lag-3) y los usos de estos |
| JP5620918B2 (ja) * | 2008-11-25 | 2014-11-05 | ブリストル・マイヤーズ スクイブ カンパニー | アルブミンを上昇および/またはcrpを低下させるためのil−6アンタゴニスト |
| CN103396487A (zh) * | 2008-12-12 | 2013-11-20 | 贝林格尔.英格海姆国际有限公司 | 抗igf抗体 |
| IL300733B1 (en) | 2010-03-05 | 2025-10-01 | Univ Johns Hopkins | Compositions and methods for antibodies and fusion proteins targeted for immune modulation |
| CA2804550C (en) | 2010-07-09 | 2021-01-05 | Bionovion Holding B.V. | Agonistic antibody to cd27 |
| JP5503520B2 (ja) | 2010-12-22 | 2014-05-28 | 新電元工業株式会社 | 制御回路 |
| EP2723381A4 (en) | 2011-06-21 | 2015-03-18 | Univ Johns Hopkins | FOCUSED RADIATION FOR THE REINFORCEMENT OF IMMUNE TREATMENTS AGAINST NEOPLASMS |
| EP2726101B1 (en) | 2011-06-30 | 2018-08-08 | Genzyme Corporation | Inhibitors of t-cell activation |
| IN2014CN03072A (enExample) | 2011-10-31 | 2015-07-31 | Merck Sharp & Dohme | |
| WO2013066765A1 (en) | 2011-11-01 | 2013-05-10 | Merck Sharp & Dohme Corp. | Mutation of tup1 in glycoengineered yeast |
| GB201120527D0 (en) | 2011-11-29 | 2012-01-11 | Ucl Business Plc | Method |
| EP3882337A1 (en) | 2012-06-18 | 2021-09-22 | Ospedale San Raffaele S.r.l. | Compositions and methods for diminishing an immune response |
| AR091649A1 (es) | 2012-07-02 | 2015-02-18 | Bristol Myers Squibb Co | Optimizacion de anticuerpos que se fijan al gen de activacion de linfocitos 3 (lag-3) y sus usos |
| AU2013302696B9 (en) | 2012-08-14 | 2018-08-09 | Ibc Pharmaceuticals, Inc. | T-cell redirecting bispecific antibodies for treatment of disease |
| JP2015527357A (ja) | 2012-08-21 | 2015-09-17 | グラクソ グループ リミテッドGlaxo Group Limited | 単一可変ドメインとカモスタットメシル酸塩(cm)とを含んでなる組成物 |
| EP2888276A2 (en) | 2012-08-21 | 2015-07-01 | Glaxo Group Limited | Compositions comprising an antibody and camostat mesylate (cm) |
| MX382301B (es) * | 2012-12-24 | 2025-03-13 | Abbvie Inc | Proteinas de union al receptor de prolactina y usos de las mismas. |
| SI2970464T1 (sl) | 2013-03-15 | 2020-08-31 | Glaxosmithkline Intellectual Propety Development Limited | Anti-LAG-3 vezavni proteini |
| WO2014144791A2 (en) | 2013-03-15 | 2014-09-18 | Dana-Farber Cancer Institute, Inc. | Therapeutic peptides |
| WO2014163684A1 (en) | 2013-04-03 | 2014-10-09 | Ibc Pharmaceuticals, Inc. | Combination therapy for inducing immune response to disease |
| HRP20210122T1 (hr) | 2013-05-02 | 2021-04-16 | Anaptysbio, Inc. | Protutijela usmjerena protiv programirane smrti-1 (pd-1) |
| WO2014209804A1 (en) | 2013-06-24 | 2014-12-31 | Biomed Valley Discoveries, Inc. | Bispecific antibodies |
| CN105682683A (zh) | 2013-08-02 | 2016-06-15 | 阿杜罗生物科技控股有限公司 | 结合cd27激动剂以及免疫检查点抑制以用于免疫刺激 |
| US10081681B2 (en) | 2013-09-20 | 2018-09-25 | Bristol-Myers Squibb Company | Combination of anti-LAG-3 antibodies and anti-PD-1 antibodies to treat tumors |
| EP3757130A1 (en) | 2013-09-26 | 2020-12-30 | Costim Pharmaceuticals Inc. | Methods for treating hematologic cancers |
| CN105744950A (zh) | 2013-11-05 | 2016-07-06 | 巴法里安诺迪克有限公司 | 用于使用表达肿瘤抗原的痘病毒和免疫检查点抑制剂的拮抗剂和/或激动剂治疗癌症的组合疗法 |
| KR20160093012A (ko) | 2013-11-05 | 2016-08-05 | 코그네이트 바이오서비시즈, 인코포레이티드 | 암 치료를 위한 체크포인트 억제제 및 치료제의 배합물 |
| WO2015085210A1 (en) | 2013-12-06 | 2015-06-11 | Dana-Farber Cancer Institute, Inc. | Therapeutic peptides |
| GB201322626D0 (en) | 2013-12-19 | 2014-02-05 | Immutep S A | Combined preparations for the treatment of cancer |
| GB201322725D0 (en) | 2013-12-20 | 2014-02-05 | Immodulon Therapeutics Ltd | Cancer therapy |
| CA2936244A1 (en) | 2014-01-21 | 2015-07-30 | Medimmune, Llc | Compositions and methods for modulating and redirecting immune responses |
| SI3556775T1 (sl) | 2014-01-28 | 2022-02-28 | Bristol-Myers Squibb Company | Protitelesa proti-LAG-3 za zdravljenje hematoloških malignosti |
| ME03558B (me) | 2014-03-14 | 2020-07-20 | Novartis Ag | Molekuli anti-lag-3 antiтela i njihove upotrebe |
| TWI693232B (zh) | 2014-06-26 | 2020-05-11 | 美商宏觀基因股份有限公司 | 與pd-1和lag-3具有免疫反應性的共價結合的雙抗體和其使用方法 |
| WO2015200828A1 (en) | 2014-06-27 | 2015-12-30 | H. Lee Moffit Cancer Center And Research Institute, Inc. | Conjugates for immunotherapy |
| JO3663B1 (ar) * | 2014-08-19 | 2020-08-27 | Merck Sharp & Dohme | الأجسام المضادة لمضاد lag3 وأجزاء ربط الأنتيجين |
| KR20240132103A (ko) | 2015-01-29 | 2024-09-02 | 더 트러스티스 오브 더 유니버시티 오브 펜실바니아 | 관문 억제제 및 백신 조합 및 면역요법을 위한 이들의 사용 |
| MA41463A (fr) | 2015-02-03 | 2017-12-12 | Anaptysbio Inc | Anticorps dirigés contre le gène d'activation 3 des lymphocytes (lag-3) |
| NZ735820A (en) | 2015-04-17 | 2025-02-28 | Bristol Myers Squibb Co | Compositions comprising a combination of an anti-pd-1 antibody and another antibody |
| TWI773646B (zh) | 2015-06-08 | 2022-08-11 | 美商宏觀基因股份有限公司 | 結合lag-3的分子和其使用方法 |
| AR105444A1 (es) | 2015-07-22 | 2017-10-04 | Sorrento Therapeutics Inc | Anticuerpos terapéuticos que se unen a la proteína codificada por el gen de activación de linfocitos 3 (lag3) |
| DK3317301T3 (da) | 2015-07-29 | 2021-06-28 | Immutep Sas | Kombinationsterapier omfattende antistofmolekyler mod lag-3 |
| WO2019148412A1 (en) | 2018-02-01 | 2019-08-08 | Merck Sharp & Dohme Corp. | Anti-pd-1/lag3 bispecific antibodies |
-
2015
- 2015-08-11 JO JOP/2015/0192A patent/JO3663B1/ar active
- 2015-08-17 BR BR112017003194A patent/BR112017003194B8/pt active IP Right Grant
- 2015-08-17 UA UAA201702455A patent/UA119571C2/uk unknown
- 2015-08-17 MY MYPI2017000223A patent/MY187262A/en unknown
- 2015-08-17 SI SI201531525T patent/SI3182999T1/sl unknown
- 2015-08-17 PH PH1/2017/500297A patent/PH12017500297B1/en unknown
- 2015-08-17 IL IL297053A patent/IL297053A/en unknown
- 2015-08-17 CN CN201580056806.5A patent/CN107001470B/zh active Active
- 2015-08-17 LT LTEP15753877.8T patent/LT3182999T/lt unknown
- 2015-08-17 AU AU2015305770A patent/AU2015305770C1/en active Active
- 2015-08-17 MA MA40476A patent/MA40476B1/fr unknown
- 2015-08-17 MX MX2017002230A patent/MX377753B/es active IP Right Grant
- 2015-08-17 PT PT157538778T patent/PT3182999T/pt unknown
- 2015-08-17 CA CA3082655A patent/CA3082655A1/en not_active Abandoned
- 2015-08-17 DK DK15753877.8T patent/DK3182999T3/da active
- 2015-08-17 TN TN2017000025A patent/TN2017000025A1/en unknown
- 2015-08-17 MA MA055347A patent/MA55347A/fr unknown
- 2015-08-17 EP EP20214920.9A patent/EP3834842A1/en active Pending
- 2015-08-17 RS RS20210287A patent/RS61559B1/sr unknown
- 2015-08-17 UA UAA201901575A patent/UA127888C2/uk unknown
- 2015-08-17 AP AP2017009763A patent/AP2017009763A0/en unknown
- 2015-08-17 CR CR20170059A patent/CR20170059A/es unknown
- 2015-08-17 KR KR1020197031113A patent/KR102321166B1/ko active Active
- 2015-08-17 JP JP2017528771A patent/JP2017532059A/ja active Pending
- 2015-08-17 EP EP15753877.8A patent/EP3182999B1/en active Active
- 2015-08-17 CA CA2957275A patent/CA2957275C/en active Active
- 2015-08-17 US US15/305,011 patent/US20170290914A1/en not_active Abandoned
- 2015-08-17 SG SG11201701090VA patent/SG11201701090VA/en unknown
- 2015-08-17 PE PE2017000228A patent/PE20170288A1/es unknown
- 2015-08-17 WO PCT/US2015/045481 patent/WO2016028672A1/en not_active Ceased
- 2015-08-17 MD MDA20170031A patent/MD4716C1/ro active IP Right Grant
- 2015-08-17 PL PL15753877T patent/PL3182999T3/pl unknown
- 2015-08-17 KR KR1020177007118A patent/KR102037197B1/ko active Active
- 2015-08-17 HU HUE15753877A patent/HUE053641T2/hu unknown
- 2015-08-17 GE GEAP201514453A patent/GEP20227343B/en unknown
- 2015-08-17 HR HRP20210372TT patent/HRP20210372T1/hr unknown
- 2015-08-17 ES ES15753877T patent/ES2857505T3/es active Active
- 2015-08-18 TW TW108102061A patent/TWI698448B/zh active
- 2015-08-18 TW TW104126866A patent/TWI673286B/zh active
- 2015-08-18 TW TW108123466A patent/TWI742395B/zh active
-
2017
- 2017-02-07 CL CL2017000311A patent/CL2017000311A1/es unknown
- 2017-02-07 ZA ZA2017/00956A patent/ZA201700956B/en unknown
- 2017-02-12 IL IL250566A patent/IL250566B2/en unknown
- 2017-02-17 GT GT201700034A patent/GT201700034A/es unknown
- 2017-02-17 CO CONC2017/0001558A patent/CO2017001558A2/es unknown
- 2017-02-17 MX MX2019005426A patent/MX2019005426A/es unknown
- 2017-02-17 NI NI201700018A patent/NI201700018A/es unknown
- 2017-02-17 DO DO2017000047A patent/DOP2017000047A/es unknown
- 2017-04-07 US US15/482,355 patent/US10188730B2/en active Active
-
2018
- 2018-07-26 JP JP2018140501A patent/JP6538247B2/ja active Active
- 2018-12-04 US US16/209,381 patent/US10898571B2/en active Active
- 2018-12-05 US US16/210,140 patent/US11278620B2/en active Active
- 2018-12-07 US US16/213,443 patent/US11207406B2/en active Active
- 2018-12-12 AU AU2018278910A patent/AU2018278910A1/en not_active Abandoned
-
2019
- 2019-04-01 JP JP2019069725A patent/JP6843174B2/ja active Active
-
2020
- 2020-06-22 ZA ZA2020/03742A patent/ZA202003742B/en unknown
- 2020-09-08 AU AU2020230256A patent/AU2020230256B2/en active Active
-
2021
- 2021-03-24 CY CY20211100263T patent/CY1124252T1/el unknown
-
2022
- 2022-02-11 US US17/669,891 patent/US12102681B2/en active Active
Cited By (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11136404B2 (en) | 2015-05-07 | 2021-10-05 | Agenus Inc. | Anti-OX40 antibodies |
| US10259882B2 (en) | 2015-05-07 | 2019-04-16 | Agenus Inc. | Anti-OX40 antibodies |
| US10626181B2 (en) | 2015-05-07 | 2020-04-21 | Agenus Inc. | Nucleic acids encoding anti-OX40 antibodies |
| US11472883B2 (en) | 2015-05-07 | 2022-10-18 | Agenus Inc. | Methods of administering anti-OX40 antibodies |
| US11332536B2 (en) | 2015-05-07 | 2022-05-17 | Agenus Inc. | Vectors comprising nucleic acids encoding anti-OX40 antibodies |
| US11564986B2 (en) * | 2015-07-16 | 2023-01-31 | Onkosxcel Therapeutics, Llc | Approach for treatment of cancer via immunomodulation by using talabostat |
| US10836830B2 (en) | 2015-12-02 | 2020-11-17 | Agenus Inc. | Antibodies and methods of use thereof |
| US11447557B2 (en) | 2015-12-02 | 2022-09-20 | Agenus Inc. | Antibodies and methods of use thereof |
| US12202856B2 (en) | 2016-05-19 | 2025-01-21 | The General Hospital Corporation | Tethered interleukin-2 to its receptor IL-2RBETA, a platform to enhance natural killer and regulatory T cell activity |
| US11359028B2 (en) | 2016-11-09 | 2022-06-14 | Agenus Inc. | Anti-OX40 antibodies and anti-GITR antibodies |
| US11511001B2 (en) | 2017-02-10 | 2022-11-29 | Regeneron Pharmaceuticals, Inc. | Radiolabeled anti-LAG3 antibodies for immuno-PET imaging |
| US10905784B2 (en) | 2017-02-10 | 2021-02-02 | Regeneron Pharmaceuticals, Inc. | Radiolabeled anti-LAG3 antibodies for immuno-PET imaging |
| WO2018148476A1 (en) | 2017-02-10 | 2018-08-16 | Regeneron Pharmaceuticals, Inc. | Radiolabeled anti-lag3 antibodies for immuno-pet imaging |
| WO2019191133A1 (en) | 2018-03-27 | 2019-10-03 | Bristol-Myers Squibb Company | Real-time monitoring of protein concentration using ultraviolet signal |
| US11840568B2 (en) | 2018-04-02 | 2023-12-12 | Mab-Venture Biopharm Co., Ltd. | Lymphocyte activation gene-3 (LAG-3) binding antibody and use thereof |
| US20210347889A1 (en) * | 2018-11-05 | 2021-11-11 | Merck Sharp & Dohme Corp. | Dosing regimen of anti-lag3 antibody and combination therapy with anti-pd-1 antibody for treating cancer |
| WO2020096917A1 (en) * | 2018-11-05 | 2020-05-14 | Merck Sharp & Dohme Corp. | Dosing regimen of anti-lag3 antibody and combination therapy with anti-pd-1 antibody for treating cancer |
| WO2020172658A1 (en) | 2019-02-24 | 2020-08-27 | Bristol-Myers Squibb Company | Methods of isolating a protein |
| US12319970B2 (en) | 2019-04-02 | 2025-06-03 | The Brigham And Women's Hospital, Inc. | Methods for identifying progression of a primary melanoma |
| WO2020237221A1 (en) | 2019-05-23 | 2020-11-26 | Bristol-Myers Squibb Company | Methods of monitoring cell culture media |
| WO2021126967A1 (en) * | 2019-12-20 | 2021-06-24 | Merck Sharp & Dohme Corp. | Lag3 antagonist cell based potency assay |
| WO2021217117A1 (en) * | 2020-04-24 | 2021-10-28 | Memorial Sloan Kettering Cancer Center | Targeted therapy for the treatment & prevention of life-threatening complications of infection |
| WO2022076318A1 (en) | 2020-10-05 | 2022-04-14 | Bristol-Myers Squibb Company | Methods for concentrating proteins |
| WO2023173011A1 (en) | 2022-03-09 | 2023-09-14 | Bristol-Myers Squibb Company | Transient expression of therapeutic proteins |
| WO2024173876A1 (en) | 2023-02-17 | 2024-08-22 | Regeneron Pharmaceuticals, Inc. | Radiolabeled anti-lag3 antibodies for immuno-pet imaging |
| WO2025096478A1 (en) | 2023-10-30 | 2025-05-08 | Regeneron Pharmaceuticals, Inc. | Stable antibody formulation comprising fianlimab |
| WO2025226695A1 (en) | 2024-04-23 | 2025-10-30 | Regeneron Pharmaceuticals, Inc. | Stable antibody formulation |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12102681B2 (en) | Anti-LAG3 antibodies and antigen-binding fragments | |
| US20250064924A1 (en) | Anti-tigit antibodies | |
| US11958902B2 (en) | Anti-TIGIT antibodies | |
| US11045547B2 (en) | Anti-LAG3 antibodies and antigen-binding fragments | |
| HK40045378A (en) | Anti-lag3 antibodies and antigen-binding fragments | |
| HK1233194A1 (en) | Anti-lag3 antibodies and antigen-binding fragments | |
| HK1233194B (en) | Anti-lag3 antibodies and antigen-binding fragments | |
| EA039293B1 (ru) | Антитела против lag3 и антигенсвязывающие фрагменты |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: MERCK SHARP & DOHME CORP., NEW JERSEY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:LIANG, LINDA;FAYADAT-DILMAN, LAURENCE;DE WAAL MALEFYT, RENE;AND OTHERS;SIGNING DATES FROM 20150803 TO 20150825;REEL/FRAME:042007/0767 |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- INCOMPLETE APPLICATION (PRE-EXAMINATION) |