WO2018098365A2 - Compositions and methods for tcr reprogramming using fusion proteins - Google Patents
Compositions and methods for tcr reprogramming using fusion proteins Download PDFInfo
- Publication number
- WO2018098365A2 WO2018098365A2 PCT/US2017/063137 US2017063137W WO2018098365A2 WO 2018098365 A2 WO2018098365 A2 WO 2018098365A2 US 2017063137 W US2017063137 W US 2017063137W WO 2018098365 A2 WO2018098365 A2 WO 2018098365A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- domain
- tcr
- tfp
- nucleic acid
- molecule
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/283—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/32—T-cell receptors [TCR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4214—Receptors for cytokines
- A61K40/4215—Receptors for tumor necrosis factors [TNF], e.g. lymphotoxin receptor [LTR], CD30
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4224—Molecules with a "CD" designation not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/14—Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/14—Drugs for dermatological disorders for baldness or alopecia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70535—Fc-receptors, e.g. CD16, CD32, CD64 (CD2314/705F)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2836—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD106
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
Definitions
- cancer immunotherapy Most patients with hematological malignancies or with late-stage solid tumors are incurable with standard therapy. In addition, traditional treatment options often have serious side effects. Numerous attempts have been made to engage a patient's immune system for rejecting cancerous cells, an approach collectively referred to as cancer immunotherapy. However, several obstacles make it rather difficult to achieve clinical effectiveness. Although hundreds of so-called tumor antigens have been identified, these are often derived from self and thus can direct the cancer immunotherapy against healthy tissue, or are poorly immunogenic. Furthermore, cancer cells use multiple mechanisms to render themselves invisible or hostile to the initiation and propagation of an immune attack by cancer immunotherapies.
- CAR chimeric antigen receptor
- BCMA B-cell maturation antigen
- TCR T-cell receptor alpha and beta chains selected for a tumor-associated peptide antigen for genetically engineering autologous T cells.
- TCR chains will form complete TCR complexes and provide the T cells with a TCR for a second defined specificity.
- Encouraging results were obtained with engineered autologous T cells expressing NY-ESO-1 -specific TCR alpha and beta chains in patients with synovial carcinoma.
- Most patients with late-stage solid tumors are incurable with standard therapy.
- traditional treatment options often have serious side effects.
- Numerous attempts have been made to engage a patient's immune system for rejecting cancerous cells, an approach collectively referred to as cancer immunotherapy.
- cancer immunotherapy an approach collectively referred to as cancer immunotherapy.
- several obstacles make it rather difficult to achieve clinical effectiveness.
- hundreds of so-called tumor antigens have been identified, these are often derived from self and thus can direct the cancer immunotherapy against healthy tissue, or are poorly immunogenic.
- cancer cells use multiple mechanisms to render themselves invisible or hostile to the initiation and propagation of an immune attack by cancer immunotherapies.
- NKG2D functions as an activating and costimulatory receptor involved in
- NKG2D provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity.
- NK activated killer
- NKG2D acts as a costimulatory receptor for T-cell receptor (TCR) in CD8 + T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells.
- NKG2D signaling involves calcium influx, culminating in the expression of TNF-alpha.
- NKG2D participates in NK cell-mediated bone marrow graft rejection and may play a regulatory role in differentiation and survival of NK cells.
- NKG2D binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.
- ROR1 is expressed on the cell surface of malignant B-cells (B-CLL) and mantle cell lymphoma (MCL). It has also been reported that ROR1 is expressed in certain other cancer cell lines, including Burkett's lymphoma, renal cell carcinoma, colon cancer and breast cancer cell lines.
- CD 16 is a low affinity Fc receptor. It is a cluster of differentiation molecule found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and
- Fc receptors FcyRIIIa CD 16a
- FcyRIIIb CD 16b
- TCR subunits including CD3 epsilon, CD3 gamma and CD3 delta, and of TCR alpha and TCR beta chains with binding domains specific for cell surface antigens that have the potential to overcome limitations of existing approaches.
- novel fusion proteins that more efficiently kill target cells than CARs, but release comparable or lower levels of pro-inflammatory cytokines.
- TCR T-cell receptor
- TFPs T-cell receptor fusion proteins
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain selected from the group consisting of CD3 epsilon, CD3 gamma, CD3 delta, TCR alpha, and TCR beta; and a binding ligand or a fragment thereof that is capable of binding to an antibody or fragment thereof; wherein the TCR subunit and the binding ligand are operatively linked, and wherein the TFP incorporates into a TCR when expressed in a T-cell.
- TCR T- cell receptor
- the binding ligand is capable of binding an Fc domain of the antibody. In some embodiments, the binding ligand is capable of selectively binding an IgGl antibody. In some embodiments, the binding ligand is capable of specifically binding an IgGl antibody. In some embodiments, the antibody or fragment thereof binds to a cell surface antigen. In some embodiments, the antibody or fragment thereof binds to a cell surface antigen on the surface of a tumor cell.
- the binding ligand comprises a monomer, a dimer, a trimer, a tetramer, a pentamer, a hexamer, a heptamer, an octomer, a nonamer, or a decamer. In some embodiments, the binding ligand does not comprise an antibody or fragment thereof. In some embodiments, the binding ligand comprises a CD 16 polypeptide or fragment thereof. In some embodiments, the binding ligand comprises a CD 16- binding polypeptide. In some embodiments, the binding ligand is human or humanized. In some embodiments, the isolated nucleic acid molecule further comprises a nucleic acid sequence encoding an antibody or fragment thereof capable of being bound by the binding ligand. In some embodiments, the antibody or fragment thereof is capable of being secreted from a cell.
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain selected from the group consisting of CD3 epsilon, CD3 gamma, CD3 delta, TCR alpha, and TCR beta; and an antigen domain comprising a ligand or a fragment thereof that binds to a receptor or polypeptide expressed on a surface of a cell; wherein the TCR subunit and the antigen domain are operatively linked, and wherein the TFP incorporates into a TCR when expressed in a T-cell.
- the antigen domain comprises a ligand.
- the ligand binds to the receptor of a cell.
- the ligand binds to the polypeptide expressed on a surface of a cell.
- the receptor or polypeptide expressed on a surface of a cell comprises a stress response receptor or polypeptide.
- the receptor or polypeptide expressed on a surface of a cell is an MHC class I-related glycoprotein.
- the MHC class I-related glycoprotein is selected from the group consisting of MICA, MICB, RAETIE, RAETIG, ULBP1, ULBP2, ULBP3, ULBP4 and combinations thereof.
- the antigen domain comprises a monomer, a dimer, a trimer, a tetramer, a pentamer, a hexamer, a heptamer, an octomer, a nonamer, or a decamer.
- the antigen domain comprises a monomer or a dimer of the ligand or fragment thereof.
- the ligand or fragment thereof is a monomer, a dimer, a trimer, a tetramer, a pentamer, a hexamer, a heptamer, an octomer, a nonamer, or a decamer.
- the ligand or fragment thereof is a monomer or a dimer. In some embodiments, the antigen domain does not comprise an antibody or fragment thereof. In some embodiments, the antigen domain does not comprise a variable region. In some embodiments, the antigen domain does not comprise a CDR. In some embodiments, the ligand or fragment thereof is a Natural Killer Group 2D (NKG2D) ligand or a fragment thereof.
- NVG2D Natural Killer Group 2D
- the TCR subunit comprises a first TCR subunit and a second TCR subunit, wherein the antigen domain comprises a first antigen domain and a second antigen domain, wherein the first TCR subunit is operatively linked to the first antigen domain, and wherein the second TCR subunit is operatively linked to the second antigen domain.
- the antigen domain is human or humanized.
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 epsilon; and a binding ligand comprising a CD 16 polypeptide or a fragment thereof; wherein the TCR subunit and the binding ligand are operatively linked, and wherein the TFP incorporates into a TCR when expressed in a T-cell.
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 gamma; and a binding ligand comprising a CD 16 polypeptide or a fragment thereof; wherein the TCR subunit and the binding ligand are operatively linked, and wherein the TFP incorporates into a TCR when expressed in a T-cell.
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 delta; and a binding ligand comprising a CD 16 polypeptide or a fragment thereof; wherein the TCR subunit and the binding ligand are operatively linked, and wherein the TFP incorporates into a TCR when expressed in a T-cell.
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of TCR alpha; and a binding ligand comprising a CD 16 polypeptide or a fragment thereof; wherein the TCR subunit and the binding ligand are operatively linked, and wherein the TFP incorporates into a TCR when expressed in a T-cell.
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of TCR beta; and a binding ligand comprising a CD 16 polypeptide or a fragment thereof; wherein the TCR subunit and the binding ligand are operatively linked, and wherein the TFP incorporates into a TCR when expressed in a T-cell.
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- TCR T cell receptor
- TFP T cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 epsilon; and a human or humanized antibody domain comprising an antigen binding domain that is an anti-Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1) binding domain; wherein the TCR subunit and the antibody domain are operatively linked, and wherein the TFP incorporates into a TCR when expressed in a T cell.
- TCR T cell receptor
- TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 epsilon
- ROR1 anti-Receptor Tyrosine Kinase Like Orphan Receptor 1
- TCR T cell receptor
- TFP T cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 gamma
- a human or humanized antibody domain comprising an antigen binding domain that is an anti- Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1) binding domain; wherein the TCR subunit and the antibody domain are operatively linked, and wherein the TFP incorporates into a TCR when expressed in a T cell.
- TCR T cell receptor
- TFP T cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 delta
- a human or humanized antibody domain comprising an antigen binding domain that is an anti- Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1) binding domain
- ROR1 anti- Receptor Tyrosine Kinase Like Orphan Receptor 1
- TCR T cell receptor
- TFP T cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of TCR alpha
- a human or humanized antibody domain comprising an antigen binding domain that is an anti- Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1) binding domain
- ROR1 anti- Receptor Tyrosine Kinase Like Orphan Receptor 1
- TCR T cell receptor
- TFP T cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of TCR beta; and a human or humanized antibody domain comprising an antigen binding domain that is an anti- Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1) binding domain; wherein the TCR subunit and the antibody domain are operatively linked, and wherein the TFP incorporates into a TCR when expressed in a T cell.
- TCR T cell receptor
- TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of TCR beta
- ROR1 anti- Receptor Tyrosine Kinase Like Orphan Receptor 1
- TCR T cell receptor
- TFP T cell receptor fusion protein
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 epsilon; and an antigen domain comprising a ligand that is a Natural Killer Group 2D (NKG2D) ligand or a fragment thereof; wherein the TCR subunit and the antigen domain are operatively linked, and wherein the TFP incorporates into a TCR when expressed in a T-cell.
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 gamma
- an antigen domain comprising a ligand that is a Natural Killer Group 2D (NKG2D) ligand or a fragment thereof; wherein the TCR subunit and the antigen domain are operatively linked, and wherein the TFP incorporates into a TCR when expressed in a T-cell.
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 delta; and an antigen domain comprising a ligand that is a Natural Killer Group 2D (NKG2D) ligand or a fragment thereof; wherein the TCR subunit and the antigen domain are operatively linked, and wherein the TFP incorporates into a TCR when expressed in a T-cell.
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of TCR alpha; and an antigen domain comprising a ligand that is a Natural Killer Group 2D (NKG2D) ligand or a fragment thereof; wherein the TCR subunit and the antigen domain are operatively linked, and wherein the TFP incorporates into a TCR when expressed in a T-cell.
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of TCR beta; and an antigen domain comprising a ligand that is a Natural Killer Group 2D (NKG2D) ligand or a fragment thereof; wherein the TCR subunit and the antigen domain are operative ly linked, and wherein the TFP incorporates into a TCR when expressed in a T-cell.
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- TCR T- cell receptor
- TFP T- cell receptor fusion protein
- NVG2D Natural Killer Group 2D
- the TCR subunit and the antigen domain are operatively linked.
- the TFP incorporates into a TCR when expressed in a T-cell.
- the antigen domain is human or humanized.
- the Natural Killer Group 2D (NKG2D) ligand or a fragment thereof binds to the receptor of a cell.
- the Natural Killer Group 2D (NKG2D) ligand or a fragment thereof binds to the polypeptide expressed on a surface of a cell.
- the Natural Killer Group 2D (NKG2D) ligand or a fragment thereof binds to stress response receptor or polypeptide.
- the Natural Killer Group 2D (NKG2D) ligand or a fragment thereof binds to an MHC class I-related glycoprotein.
- the MHC class I-related glycoprotein is selected from the group consisting of MICA, MICB, RAET1E, RAET1G, ULBP1, ULBP2, ULBP3, ULBP4 and combinations thereof.
- the antigen domain comprises a monomer, a dimer, a trimer, a tetramer, a pentamer, a hexamer, a heptamer, an octomer, a nonamer, or a decamer of the Natural Killer Group 2D (NKG2D) ligand or a fragment thereof.
- the antigen domain comprises a monomer or a dimer of the Natural Killer Group 2D (NKG2D) ligand or a fragment thereof.
- the Natural Killer Group 2D (NKG2D) ligand or a fragment thereof is a monomer, a dimer, a trimer, a tetramer, a pentamer, a hexamer, a heptamer, an octomer, a nonamer, or a decamer.
- the Natural Killer Group 2D (NKG2D) ligand or a fragment thereof is a monomer or a dimer.
- the antigen domain does not comprise an antibody or fragment thereof.
- the antigen domain does not comprise a variable region.
- the antigen domain does not comprise a CDR.
- the TCR subunit comprises a first TCR subunit and a second TCR subunit, wherein the antigen domain comprises a first antigen domain and a second antigen domain, wherein the first TCR subunit is operatively linked to the first antigen domain, and wherein the second TCR subunit is operatively linked to the second antigen domain.
- the encoded ligand is connected to the TCR extracellular domain by a linker sequence.
- a first T-cell receptor (TCR) fusion protein comprising: a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 epsilon; and a first human or humanized antibody domain comprising a first antigen binding domain; and a second T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit of the first TFP and the first antibody domain are operatively linked and the TCR subunit of the second TFP and the second antibody domain are operatively linked, and wherein the first TFP and the second TFP incorporate into a TCR when expressed in a T-
- a first T-cell receptor (TCR) fusion protein comprising: a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 gamma; and a first human or humanized antibody domain comprising a first antigen binding domain; and a second T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit of the first TFP and the first antibody domain are operatively linked and the TCR subunit of the second TFP and the second antibody domain are operatively linked, and wherein the first TFP and the second TFP incorporate into a TCR when expressed in a T-cell.
- TCR T-cell receptor
- a first T-cell receptor (TCR) fusion protein comprising: a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 delta; and a first human or humanized antibody domain comprising a first antigen binding domain; and a second T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit of the first TFP and the first antibody domain are operatively linked and the TCR subunit of the second TFP and the second antibody domain are operatively linked, and wherein the first TFP and the second TFP incorporate into a TCR when expressed in a T-cell.
- TCR T-cell receptor
- a first T-cell receptor (TCR) fusion protein comprising: a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of TCR alpha; and a first human or humanized antibody domain comprising a first antigen binding domain; and a second T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit of the first TFP and the first antibody domain are operatively linked and the TCR subunit of the second TFP and the second antibody domain are operatively linked, and wherein the first TFP and the second TFP incorporate into a TCR when expressed in a T-cell.
- TCR T-cell receptor
- a first T-cell receptor (TCR) fusion protein comprising: a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of TCR beta; and a first human or humanized antibody domain comprising a first antigen binding domain; and a second T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit of the first TFP and the first antibody domain are operatively linked and the TCR subunit of the second TFP and the second antibody domain are operatively linked, and wherein the first TFP and the second TFP incorporate into a TCR when expressed in a T-cell.
- TCR T-cell receptor
- the TCR subunit of the second TFP further comprises a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain or a functional fragment thereof a selected from the group consisting of a TCR alpha, a TCR beta, a CD3 epsilon, a CD3 gamma, and a CD3 delta.
- an isolated recombinant nucleic acid molecule encoding a first T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 epsilon; and a first human or humanized antibody domain comprising a first antigen binding domain and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit, the first antibody domain, and the second antibody domain are operatively linked, and wherein the first TFP incorporates into a TCR when expressed in a T-cell.
- TCR T-cell receptor
- TFP T-cell receptor fusion protein
- an isolated recombinant nucleic acid molecule encoding a first T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 gamma; and a first human or humanized antibody domain comprising a first antigen binding domain and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit, the first antibody domain, and the second antibody domain are operatively linked, and wherein the first TFP incorporates into a TCR when expressed in a T-cell.
- TCR T-cell receptor
- TFP T-cell receptor fusion protein
- an isolated recombinant nucleic acid molecule encoding a first T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 delta; and a first human or humanized antibody domain comprising a first antigen binding domain and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit, the first antibody domain, and the second antibody domain are operatively linked, and wherein the first TFP incorporates into a TCR when expressed in a T-cell.
- TCR T-cell receptor
- TFP T-cell receptor fusion protein
- an isolated recombinant nucleic acid molecule encoding a first T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of TCR alpha; and a first human or humanized antibody domain comprising a first antigen binding domain and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit, the first antibody domain, and the second antibody domain are operatively linked, and wherein the first TFP incorporates into a TCR when expressed in a T-cell.
- TCR T-cell receptor
- TFP T-cell receptor fusion protein
- an isolated recombinant nucleic acid molecule encoding a first T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of TCR beta; and a first human or humanized antibody domain comprising a first antigen binding domain and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit, the first antibody domain, and the second antibody domain are operatively linked, and wherein the first TFP incorporates into a TCR when expressed in a T- cell.
- TCR T-cell receptor
- TFP T-cell receptor fusion protein
- the first antigen binding domain or the second antigen binding domain is an anti-CD 19 binding domain. In some embodiments, the first antigen binding domain or the second antigen binding domain is an anti-B-cell maturation antigen (BCMA) binding domain In some embodiments, the first antigen binding domain or the second antigen binding domain is an anti-CD22 binding domain.
- BCMA anti-B-cell maturation antigen
- an isolated recombinant nucleic acid molecule encoding: a first T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit, a first human or humanized antibody domain comprising a first antigen binding domain that is an anti-CD19 binding domain; and a second T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit, a second human or humanized antibody domain comprising a second antigen binding domain that is an anti-BCMA binding domain.
- TCR T-cell receptor
- TCR TCR fusion protein
- an isolated recombinant nucleic acid molecule encoding: a first T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit, a first human or humanized antibody domain comprising a first antigen binding domain that is an anti-CD19 binding domain; and a second T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit, a second human or humanized antibody domain comprising a second antigen binding domain that is an anti-CD22 binding domain.
- TCR T-cell receptor
- TCR TCR fusion protein
- the TCR subunit of the first TFP and the first antibody domain are operatively linked and the TCR subunit of the second TFP and the second antibody domain are operatively linked.
- the first TFP, the second TFP, or both incorporate into a TCR when expressed in a T-cell.
- the encoded first antigen binding domain is connected to the TCR extracellular domain of the first TFP by a first linker sequence
- the encoded second antigen binding domain is connected to the TCR extracellular domain of the second TFP by a second linker sequence
- both the first antigen binding domain is connected to the TCR extracellular domain of the first TFP by the first linker sequence
- the encoded second antigen binding domain is connected to the TCR extracellular domain of the second TFP by the second linker sequence.
- the TCR subunit of the first TFP, the TCR subunit of the second TFP, or both comprise a TCR extracellular domain. In some embodiments, the TCR subunit of the first TFP, the TCR subunit of the second TFP, or both comprise a TCR transmembrane domain. In some embodiments, the TCR subunit of the first TFP, the TCR subunit of the second TFP, or both comprise a TCR intracellular domain.
- the TCR subunit of the first TFP, the TCR subunit of the second TFP, or both comprise (i) a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain, wherein at least two of (i), (ii), and (iii) are from the same TCR subunit.
- the TCR subunit of the first TFP, the TCR subunit of the second TFP, or both comprise a TCR intracellular domain comprising a stimulatory domain selected from an intracellular signaling domain of CD3 epsilon, CD3 gamma or CD3 delta, or an amino acid sequence having at least one modification thereto.
- the TCR subunit of the first TFP, the TCR subunit of the second TFP, or both comprise an intracellular domain comprising a stimulatory domain selected from a functional signaling domain of 4- IBB and/or a functional signaling domain of CD3 zeta, or an amino acid sequence having at least one modification thereto.
- the first human or humanized antibody domain, the second human or humanized antibody domain, or both comprise an antibody fragment.
- the first human or humanized antibody domain, the second human or humanized antibody domain, or both comprise a scFv or a VH domain.
- the isolated nucleic acid molecule encodes (i) a light chain (LC) CDR1, LC CDR2 and LC CDR3 of an anti-CD19 light chain binding domain amino acid sequence with 70- 100% sequence identity to SEQ ID NO: 25, SEQ ID NO: 27 and SEQ ID NO: 29, respectively, and/or (ii) a heavy chain (HC) CDR1, HC CDR2 and HC CDR3 of an anti-CD 19 heavy chain binding domain amino acid sequence with 70-100% sequence identity to SEQ ID NO: 31, SEQ ID NO: 33 and SEQ ID NO: 35, respectively.
- LC light chain
- the isolated nucleic acid molecule encodes a light chain variable region, wherein the light chain variable region comprises an amino acid sequence having at least one but not more than 30 modifications of a light chain variable region amino acid sequence of SEQ ID NO: 49, or a sequence with 95-99% identity to a light chain variable region amino acid sequence of SEQ ID NO: 49.
- the isolated nucleic acid molecule encodes a heavy chain variable region, wherein the heavy chain variable region comprises an amino acid sequence having at least one but not more than 30 modifications of a heavy chain variable region amino acid sequence of SEQ ID NO: 51, or a sequence with 95-99% identity to a heavy chain variable region amino acid sequence of SEQ ID NO: 51.
- the isolated nucleic acid molecule encodes (i) a light chain (LC) CDR1, LC CDR2 and LC CDR3 of an anti-BCMA light chain binding domain amino acid sequence with 70- 100% sequence identity to SEQ ID NO: 37, SEQ ID NO: 39and SEQ ID NO: 41, respectively, and/or (ii) a heavy chain (HC) CDR1, HC CDR2 and HC CDR3 of an anti-BCMA heavy chain binding domain amino acid sequence with 70-100% sequence identity to SEQ ID NO: 43, SEQ ID NO: 45 and SEQ ID NO: 47, respectively.
- LC light chain
- the isolated nucleic acid molecule encodes a light chain variable region, wherein the light chain variable region comprises an amino acid sequence having at least one but not more than 30 modifications of a light chain variable region amino acid sequence of SEQ ID NO: 53, or a sequence with 95-99% identity to a light chain variable region amino acid sequence of SEQ ID NO: 53.
- the isolated nucleic acid molecule encodes a heavy chain variable region, wherein the heavy chain variable region comprises an amino acid sequence having at least one but not more than 30 modifications of a heavy chain variable region amino acid sequence of SEQ ID NO: 55, or a sequence with 95-99% identity to a heavy chain variable region amino acid sequence of SEQ ID NO: 55.
- the anti-CD22 antigen binding domain comprises a variable region as described herein or one or more CDRs as described herein.
- the encoded first TFP, the encoded second TFP, or both include an extracellular domain of a TCR subunit that comprises an extracellular domain or portion thereof of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
- the encoded first TFP and the encoded second TFP include a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
- the encoded first TFP and the encoded second TFP include a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a TCR zeta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD28, CD37, CD64, CD80, CD86, CD134, CD137, CD154, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
- the TCR subunit and the binding ligand are operatively linked.
- the TCR subunit and the antibody domain are operatively linked.
- the TFP transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta
- the binding ligand is connected to the TCR extracellular domain by a linker sequence.
- the encoded antigen binding domain is connected to the TCR extracellular domain by a linker sequence.
- the TCR subunit comprises a TCR extracellular domain.
- the TCR subunit comprises a TCR transmembrane domain.
- the TCR subunit comprises a TCR intracellular domain.
- the TCR subunit comprises (i) a TCR extracellular domain, (ii) a TCR
- the TCR subunit comprises a TCR intracellular domain comprising a stimulatory domain selected from an intracellular signaling domain of CD3 epsilon, CD3 gamma, CD3 delta, or an amino acid sequence having at least one modification thereto.
- the TCR subunit comprises an intracellular domain comprising a stimulatory domain selected from a functional signaling domain of 4- IBB and/or a functional signaling domain of CD3 zeta, or an amino acid sequence having at least one modification thereto.
- the binding ligand comprises a CD 16-binding antibody or antibody fragment.
- the human or humanized antibody domain comprises an antibody fragment.
- the human or humanized antibody domain comprises a scFv or a VH domain.
- the isolated nucleic acid molecule encodes an NKG2D amino acid sequence with 70-100% sequence identity to an NKG2D ligand provided herein.
- the isolated nucleic acid molecule encodes a CD 16 amino acid sequence with about 70 to about 100% sequence identity to a CD 16 polypeptide provided herein.
- the isolated nucleic acid molecule encodes (i) a light chain (LC) CDR1, LC CDR2 and LC CDR3 of an anti-RORl light chain binding domain amino acid sequence with 70-100% sequence identity to a light chain (LC) CDR1, LC CDR2 and LC CDR3 of an anti-RORl light chain binding domain provided herein, respectively, and/or (ii) a heavy chain (HC) CDR1, HC CDR2 and HC CDR3 of an anti- RORl heavy chain binding domain amino acid sequence with 70-100% sequence identity to a heavy chain (HC) CDR1, HC CDR2 and HC CDR3 of an anti-RORl heavy chain binding domain provided herein, respectively.
- LC light chain
- LC CDR2 and LC CDR3 of an anti-RORl light chain binding domain amino acid sequence with 70
- the isolated nucleic acid molecule encodes a light chain variable region, wherein the light chain variable region comprises an amino acid sequence having at least one but not more than 30 modifications of a light chain variable region amino acid sequence of a light chain variable region provided herein, or a sequence with 95-99% identity to a light chain variable region amino acid sequence of a light chain variable region provided herein.
- the isolated nucleic acid molecule encodes a heavy chain variable region, wherein the heavy chain variable region comprises an amino acid sequence having at least one but not more than 30 modifications of a heavy chain variable region amino acid sequence of a heavy chain variable region provided herein, or a sequence with 95-99% identity to a heavy chain variable region amino acid sequence of a heavy chain variable region provided herein.
- the TFP includes an extracellular domain of a TCR subunit that comprises an extracellular domain or portion thereof of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
- the encoded TFP includes a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
- the encoded TFP includes a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a TCR zeta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, CD45, CD4, CD5, CD8, CD9, CD 16, CD22, CD33, CD28, CD37, CD64, CD80, CD86, CD 134, CD 137, CD 154, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
- a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a TCR zeta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD
- the isolated nucleic acid molecule further comprises a sequence encoding a costimulatory domain.
- the costimulatory domain is a functional signaling domain obtained from a protein selected from the group consisting of OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD1 la/CD18), ICOS (CD278), and 4- 1BB (CD 137), and amino acid sequences thereof having at least one but not more than 20 modifications thereto.
- the at least one but not more than 20 modifications thereto comprise a modification of an amino acid that mediates cell signaling or a modification of an amino acid that is phosphorylated in response to a ligand binding to the TFP.
- the isolated nucleic acid molecule further comprises a sequence encoding an intracellular signaling domain In some embodiments, the isolated nucleic acid molecule further comprises a leader sequence. In some embodiments, the isolated nucleic acid molecule further comprises a protease cleavage site. In some embodiments, the at least one but not more than 20 modifications thereto comprise a modification of an amino acid that mediates cell signaling or a modification of an amino acid that is phosphorylated in response to a ligand binding to the first TFP, the second TFP, or both.
- the isolated nucleic acid molecule is mRNA.
- the TFP includes an immunoreceptor tyrosine-based activation motif (ITAM) of a TCR subunit that comprises an ITAM or portion thereof of a protein selected from the group consisting of CD3 zeta TCR subunit, CD3 epsilon TCR subunit, CD3 gamma TCR subunit, CD3 delta TCR subunit, TCR zeta chain, Fc epsilon receptor 1 chain, Fc epsilon receptor 2 chain, Fc gamma receptor 1 chain, Fc gamma receptor 2a chain, Fc gamma receptor 2b 1 chain, Fc gamma receptor 2b2 chain, Fc gamma receptor 3a chain, Fc gamma receptor 3b chain, Fc beta receptor 1 chain, TYROBP (DAP 12), CD5, CD16a, CD16b, CD22, CD23, CD32, CD64, CD79a, CD79b, CD89, CD278, CD66d
- ITAM immunoreceptor
- the first TFP, the second TFP, or both include an immunoreceptor tyrosine-based activation motif (ITAM) of a TCR subunit that comprises an ITAM or portion thereof of a protein selected from the group consisting of CD3 zeta TCR subunit, CD3 epsilon TCR subunit, CD3 gamma TCR subunit, CD3 delta TCR subunit, TCR zeta chain, Fc epsilon receptor 1 chain, Fc epsilon receptor 2 chain, Fc gamma receptor 1 chain, Fc gamma receptor 2a chain, Fc gamma receptor 2b 1 chain, Fc gamma receptor 2b2 chain, Fc gamma receptor 3a chain, Fc gamma receptor 3b chain, Fc beta receptor 1 chain, TYROBP (DAP 12), CD5, CD16a, CD16b, CD22, CD23, CD32, CD64, CD79a, CD79b, CD89, CD
- ITAM
- the ITAM replaces an ITAM of CD3 gamma, CD3 delta, or CD3 epsilon.
- the ITAM is selected from the group consisting of CD3 zeta TCR subunit, CD3 epsilon TCR subunit, CD3 gamma TCR subunit, and CD3 delta TCR subunit and replaces a different ITAM selected from the group consisting of CD3 zeta TCR subunit, CD3 epsilon TCR subunit, CD3 gamma TCR subunit, and CD3 delta TCR subunit.
- the isolated nucleic acid molecule further comprises a leader sequence.
- an isolated polypeptide molecule encoded by a nucleic acid molecule described herein comprises a first polypeptide encoded by a first nucleic acid molecule and a second polypeptide encoded by a second nucleic acid molecule.
- an isolated recombinant TFP molecule comprising a human or humanized CD 16 polypeptide or a fragment thereof, a TCR extracellular domain, a transmembrane domain, and an intracellular domain.
- an isolated recombinant TFP molecule comprising a human or humanized CD 16 polypeptide or a fragment thereof, a TCR extracellular domain, a transmembrane domain, and an intracellular signaling domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide.
- an isolated recombinant TFP molecule comprising a human or humanized CD 16 polypeptide or a fragment thereof, a TCR extracellular domain, a transmembrane domain, and an intracellular signaling domain, wherein the TFP molecule is capable of functionally integrating into an endogenous TCR complex.
- an isolated recombinant TFP molecule comprising a human or humanized anti- Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1) binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain.
- ROR1 Tyrosine Kinase Like Orphan Receptor 1
- an isolated recombinant TFP molecule comprising a human or humanized anti- Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1) binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular signaling domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide.
- ROR1 Tyrosine Kinase Like Orphan Receptor 1
- an isolated recombinant TFP molecule comprising a human or humanized anti- Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1) binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular signaling domain, wherein the TFP molecule is capable of functionally integrating into an endogenous TCR complex.
- ROR1 Tyrosine Kinase Like Orphan Receptor 1
- an isolated recombinant TFP molecule comprising a human NKG2D polypeptide or a fragment thereof, a TCR extracellular domain, a transmembrane domain, and an intracellular domain.
- an isolated recombinant TFP molecule comprising a human NKG2D polypeptide or a fragment thereof, a TCR extracellular domain, a transmembrane domain, and an intracellular signaling domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide.
- an isolated recombinant TFP molecule comprising a human NKG2D polypeptide or a fragment thereof, a TCR extracellular domain, a transmembrane domain, and an intracellular signaling domain, wherein the TFP molecule is capable of functionally integrating into an endogenous TCR complex.
- an isolated recombinant TFP molecule comprising a first TFP molecule comprising a human or humanized anti-CD19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, and a second TFP molecule comprising a human or humanized anti-BCMA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain.
- an isolated recombinant TFP molecule comprising a first TFP molecule comprising a human or humanized anti-CD19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, and a second TFP molecule comprising a human or humanized anti-BCMA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the first TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide.
- an isolated recombinant TFP molecule comprising a first TFP molecule comprising a human or humanized anti-CD19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, and a second TFP molecule comprising a human or humanized anti-BCMA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the first TFP molecule is capable of functionally integrating into an endogenous TCR complex.
- the isolated recombinant TFP molecule comprises an antibody or antibody fragment comprising a human or humanized anti-CD 19 binding domain, a humanized anti-BCMA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain.
- an isolated recombinant TFP molecule comprising a first TFP molecule comprising a human or humanized anti-CD19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, and a second TFP molecule comprising a human or humanized anti-CD22 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain.
- an isolated recombinant first TFP molecule comprising a human or humanized anti-CD 19 binding domain, a humanized anti-CD22 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular signaling domain, wherein the first TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide.
- an isolated recombinant first TFP molecule comprising a human or humanized anti-CD 19 binding domain, a humanized anti-CD22 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular signaling domain, wherein the first TFP molecule is capable of functionally integrating into an endogenous TCR complex.
- the isolated TFP molecule comprises an antibody or antibody fragment comprising a human or humanized anti-RORl binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain.
- the anti-RORl binding domain is a scFv or a VH domain.
- the anti-RORl binding domain comprises a heavy chain with 95-100% identity to an amino acid sequence of an anti-RORl light chain provided herein, a functional fragment thereof, or an amino acid sequence thereof having at least one but not more than 30 modifications.
- the anti-RORl binding domain comprises a light chain with 95-100% identity to an amino acid sequence of an anti-RORl heavy chain provided herein, a functional fragment thereof, or an amino acid sequence thereof having at least one but not more than 30 modifications.
- the isolated TFP molecule comprises a TCR extracellular domain that comprises an extracellular domain or portion thereof of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
- the TCR extracellular domain is operably connected by a linker sequence.
- the isolated TFP molecule further comprises a sequence encoding a costimulatory domain.
- the isolated TFP molecule further comprises a sequence encoding an intracellular signaling domain.
- the isolated TFP molecule further comprises comprising a leader sequence.
- the isolated recombinant TFP molecule comprises an antibody or antibody fragment comprising a human or humanized anti-CD 19 binding domain, a humanized anti- CD22 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain.
- the isolated TFP molecule further comprises the anti-CD19 binding domain, the anti-BCMA binding domain, the anti-CD22 binding domain, or a combination thereof are a scFv or a VH domain.
- the anti-CD19 binding domain comprises a heavy chain with 95-100% identity to an amino acid sequence of SEQ ID NO: 51, a functional fragment thereof, or an amino acid sequence thereof having at least one but not more than 30 modifications.
- the anti- CD ⁇ binding domain comprises a light chain with 95-100% identity to an amino acid sequence of SEQ ID NO: 49, a functional fragment thereof, or an amino acid sequence thereof having at least one but not more than 30 modifications.
- the anti-BCMA binding domain comprises a heavy chain with 95-100% identity to an amino acid sequence of SEQ ID NO: 55, a functional fragment thereof, or an amino acid sequence thereof having at least one but not more than 30 modifications.
- the anti-BCMA binding domain comprises a light chain with 95-100% identity to an amino acid sequence of SEQ ID NO: 53, a functional fragment thereof, or an amino acid sequence thereof having at least one but not more than 30 modifications.
- the anti-CD22 binding domain comprises a variable region as described herein or one or more CDRs as described herein.
- the isolated recombinant TFP molecule comprises a TCR extracellular domain that comprises an extracellular domain or portion thereof of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
- the anti-CD19 binding domain is connected to the TCR extracellular domain of the first TFP molecule by a first linker sequence and the anti-BCMA binding domain is connected to the TCR extracellular domain of the first TFP molecule by a second linker sequence.
- the anti-CD19 binding domain is connected to the TCR extracellular domain of the first TFP molecule by a first linker sequence and the anti-CD22 binding domain is connected to the TCR extracellular domain of the first TFP molecule by a second linker sequence.
- the isolated recombinant TFP molecule further comprises a costimulatory domain.
- the isolated recombinant TFP molecule further comprises an intracellular signaling domain.
- the isolated recombinant TFP molecule further comprises a leader sequence.
- nucleic acid comprising a sequence encoding an isolated recombinant TFP described herein.
- the nucleic acid comprises a first nucleic acid encoding the first TFP molecule and a second nucleic acid encoding the second TFP molecule.
- the nucleic acid is selected from the group consisting of a DNA and a RNA.
- the nucleic acid is a mRNA.
- the nucleic acid further comprises a promoter.
- the nucleic acid is an in vitro transcribed nucleic acid.
- the nucleic acid further comprises a sequence encoding a poly(A) tail.
- the nucleic acid further comprises a 3 ' UTR sequence.
- the nucleic acid further comprises a sequencing encoding a protease cleavage site.
- a vector comprising a nucleic acid molecule encoding a TFP described herein.
- a vector comprising a nucleic acid molecule encoding the isolated recombinant TFP molecule described herein.
- the vector comprises a) a first vector comprising a first nucleic acid molecule encoding the first TFP; and b) a second vector comprising a second nucleic acid molecule encoding the second TFP.
- the vector is selected from the group consisting of a DNA, a RNA, a plasmid, a lentivirus vector, adenoviral vector, a Rous sarcoma viral (RSV) vector, or a retrovirus vector.
- the vector further comprises a promoter.
- the vector is an in vitro transcribed vector.
- the nucleic acid molecule in the vector further encodes a poly(A) tail.
- the nucleic acid molecule in the vector further encodes a 3 ' UTR.
- the nucleic acid molecule in the vector further encodes a protease cleavage site.
- a cell comprising an isolated nucleic acid molecule described herein, a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, or a vector described herein.
- a cell comprising an isolated nucleic acid molecule described herein, a polypeptide molecule described herein, an isolated recombinant TFP molecule described herein, a nucleic acid described herein, or a vector described herein.
- the cell is a human T cell.
- the T cell is a CD8 + or CD4 + T cell.
- the cell further comprises a nucleic acid encoding an inhibitory molecule that comprises a first polypeptide that comprises at least a portion of an inhibitory molecule, associated with a second polypeptide that comprises a positive signal from an intracellular signaling domain.
- the inhibitory molecule comprises a first polypeptide that comprises at least a portion of PD 1 and a second polypeptide comprising a costimulatory domain and primary signaling domain.
- a human CD8 + or CD4 + T-cell comprising at least two TFP molecules, the TFP molecules comprising a human or humanized CD 16 polypeptide or a fragment thereof, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T-cell.
- a protein complex comprising: a TFP molecule comprising a human or humanized CD 16 polypeptide or a fragment thereof, a TCR extracellular domain, a transmembrane domain, and an intracellular domain; and at least one endogenous TCR subunit or endogenous TCR complex.
- a human CD8 + or CD4 + T cell comprising at least two TFP molecules, the TFP molecules comprising a human or humanized anti- Receptor Tyrosine Kinase Like Orphan Receptor 1 (RORl) binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T cell.
- RORl Tyrosine Kinase Like Orphan Receptor 1
- a protein complex comprising: a TFP molecule comprising a human or humanized anti- Receptor Tyrosine Kinase Like Orphan Receptor 1 (RORl) binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain; and at least one endogenous TCR subunit or endogenous TCR complex.
- a TFP molecule comprising a human or humanized anti- Receptor Tyrosine Kinase Like Orphan Receptor 1 (RORl) binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain; and at least one endogenous TCR subunit or endogenous TCR complex.
- a human CD8 + or CD4 + T-cell comprising at least two TFP molecules, the TFP molecules comprising a human NKG2D polypeptide or a fragment thereof, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T-cell.
- a protein complex comprising: a TFP molecule comprising a human NKG2D polypeptide or a fragment thereof, a TCR extracellular domain, a transmembrane domain, and an intracellular domain; and at least one endogenous TCR subunit or endogenous TCR complex.
- a human CD8 + or CD4 + T-cell comprising an isolated recombinant TFP molecule, the isolated recombinant TFP molecule comprising a) a first TFP molecule comprising a human or humanized anti-CD 19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, and b) second TFP molecule comprising a human or humanized anti-BCMA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T-cell.
- a human CD8 + or CD4 + T-cell comprising an isolated recombinant TFP molecule, the isolated recombinant TFP molecule comprising a) a first TFP molecule comprising a human or humanized anti-CD 19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, and b) second TFP molecule comprising a human or humanized anti-CD22 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T-cell.
- a protein complex comprising: a first TFP molecule comprising a human or humanized CD 19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain; a second TFP molecule comprising a human or humanized anti- BCMA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain; and at least one endogenous TCR subunit or endogenous TCR complex.
- a protein complex comprising: a first TFP molecule comprising a human or humanized CD 19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain; a second TFP molecule comprising a human or humanized anti- CD22 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain; and at least one endogenous TCR subunit or endogenous TCR complex.
- the TCR comprises an extracellular domain or portion thereof of a protein selected from the group consisting of TCR alpha chain, a TCR beta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, and a CD3 delta TCR subunit.
- the NKG2D ligand or a fragment thereof is connected to the TCR extracellular domain by a linker sequence.
- the CD 16 polypeptide or a fragment thereof is connected to the TCR extracellular domain by a linker sequence.
- the anti-RORl binding domain is connected to the TCR extracellular domain by a linker sequence.
- a protein complex comprising a TFP encoded by an isolated nucleic acid molecule desscribed eherin, and at least one endogenous TCR subunit or endogenous TCR complex.
- a human CD8 + or CD4 + T-cell comprising at least two different TFP proteins per a protein complex described herein.
- a human CD8 + or CD4 + T-cell comprising at least two different TFP molecules encoded by an isolated nucleic acid molecule described herein.
- the TFP comprises an extracellular domain or portion thereof of a protein selected from the group consisting of TCR alpha chain, a TCR beta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, and a CD3 delta TCR subunit.
- the human or humanized anti-CD 19 binding domain is connected to the TCR extracellular domain of the first TFP molecule by a first linker sequence and the human or humanized anti-BCMA binding domain is connected to the TCR extracellular domain of the second TFP molecule by a second linker sequence.
- the human or humanized anti-CD 19 binding domain is connected to the TCR extracellular domain of the first TFP molecule by a first linker sequence and the human or humanized anti-CD20 binding domain is connected to the TCR extracellular domain of the second TFP molecule by a second linker sequence.
- a protein complex comprising a first TFP and a second TFP encoded by an isolated nucleic acid molecule described herein, and at least one endogenous TCR subunit or endogenous TCR complex.
- a human CD8 + or CD4 + T-cell comprising the first TFP molecule and the second TFP molecule per a protein complex described herein.
- a human CD8 + or CD4 + T-cell comprising the first TFP molecule and the second TFP molecule encoded by an isolated nucleic acid molecule described herein.
- a population of human CD8 + or CD4 + T-cells wherein the T- cells of the population individually or collectively comprise at least two TFP molecules, the TFP molecules comprising a human or humanized CD 16 polypeptide or a fragment thereof, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T-cell.
- a population of human CD8 + or CD4 + T cells wherein the T cells of the population individually or collectively comprise at least two TFP molecules, the TFP molecules comprising a human or humanized anti- Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1) binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T cell.
- ROR1 Tyrosine Kinase Like Orphan Receptor 1
- a population of human CD8 + or CD4 + T-cells wherein the T- cells of the population individually or collectively comprise at least two TFP molecules, the TFP molecules comprising a human NKG2D polypeptide or a fragment thereof, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T-cell.
- a population of human CD8 + or CD4 + T-cells wherein the T- cells of the population individually or collectively comprise a first TFP molecule and a second TFP molecule, the first TFP molecule comprising a human or humanized anti-CD 19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain and the second TFP molecule comprising a human or humanized anti-BCMA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the first TFP molecule and the second TFP molecule are capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T-cell.
- a population of human CD8 + or CD4 + T-cells wherein the T- cells of the population individually or collectively comprise a first TFP molecule and a second TFP molecule, the first TFP molecule comprising a human or humanized anti-CD 19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain and the second TFP molecule comprising a human or humanized anti-CD22 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the first TFP molecule and the second TFP molecule are capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T-cell.
- a population of human CD8 + or CD4 + T-cells wherein the T- cells of the population individually or collectively comprise the first TFP molecule and the second TFP molecule encoded by an isolated nucleic acid molecule described herein.
- a population of human CD8 + or CD4 + T-cells wherein the T- cells of the population individually or collectively comprise at least two TFP molecules encoded by an isolated nucleic acid molecule described herein.
- provided herein is a method of making a cell comprising transducing a T-cell with an isolated nucleic acid molecule described herein, a nucleic acid described herein, or a vector described herein.
- RNA-engineered cells comprising introducing an in vitro transcribed RNA or synthetic RNA into a cell, where the RNA comprises a nucleic acid encoding a TFP molecule described herein.
- RNA-engineered cells comprising introducing an in vitro transcribed RNA or synthetic RNA into a cell, where the RNA comprises a nucleic acid encoding an isolated recombinant TFP molecule described herein.
- provided herein is a method of providing an anti -tumor immunity in a mammal comprising administering to the mammal an effective amount of an isolated nucleic acid molecule described herein, a polypeptide molecule described herein, a cell expressing a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, a vector described herein, or a cell described herein.
- provided herein is a method of providing an anti -tumor immunity in a mammal comprising administering to the mammal an effective amount of an isolated nucleic acid molecule described herein, a polypeptide molecule described herein, a cell expressing a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, a vector described herein, or a cell described herein.
- the cell is an autologous T-cell. In some embodiments, the cell is an allogeneic T-cell. In some embodiments, the mammal is a human.
- a method of treating a mammal having a disease associated with expression of a tumor-associated antigen comprising administering to the mammal an effective amount of an isolated nucleic acid molecule described herein, a polypeptide molecule described herein, a cell expressing a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, a vector described herein, or a cell described herein.
- a method of treating a mammal having a disease associated with expression of a ROR1 comprising administering to the mammal an effective amount of an isolated nucleic acid molecule described herein, a polypeptide molecule described herein, a cell expressing a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, a vector described herein, or a cell described herein.
- a method of treating a mammal having a disease associated with expression of a NKG2D receptor comprising administering to the mammal an effective amount of an isolated nucleic acid molecule described herein, a polypeptide molecule described herein, a cell expressing a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, a vector described herein, or a cell described herein.
- the disease associated with expression of an anti-NKG2D receptor is selected from the group consisting of a dysplasia, a proliferative disease, a cancer, a malignancy, a non- cancer related indication associated with expression of an anti-NKG2D receptor, inflammatory disease, rheumatoid arthritis, colitis, celiac disease, intestinal inflammation, multiple sclerosis, alopecia areata, type 1 diabetes, chronic obstructive pulmonary disease, atherosclerosis, and metabolic syndrome associated with type 2 diabetes.
- the disease associated with expression of an anti- NKG2D receptor is an infectious disease.
- a method of treating a mammal having a disease associated with expression of CD 19, BCMA, or CD22 comprising administering to the mammal an effective amount of an isolated nucleic acid molecule described herein, a polypeptide molecule described herein, a cell expressing a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, a vector described herein, or a cell described herein.
- the disease associated with CD 19, BCMA, or CD22 expression is selected from the group consisting of a proliferative disease, a cancer, a malignancy, myelodysplasia, a myelodysplastic syndrome, a preleukemia, a non-cancer related indication associated with expression of CD 19, a non -cancer related indication associated with expression of BCMA, and a non -cancer related indication associated with expression of CD22.
- the disease associated with ROR1 expression is selected from the group consisting of a dysplasia, a proliferative disease, a cancer, a malignancy, and a non -cancer related indication associated with expression of ROR1.
- the disease is a cancer selected from the group consisting of mesothelioma, papillary serous ovarian adenocarcinoma, clear cell acute lymphoid leukemia (T-ALL), acute lymphoblastic leukemia (ALL); chronic myelogenous leukemia (CML), chronic lymphocytic leukemia (CLL), B cell chronic lymphocytic leukemia, B cell prolymphocyte leukemia, blastic plasmacytoid dendritic cell neoplasm, Burkitt' s lymphoma, diffuse large B cell lymphoma, follicular lymphoma, hairy cell leukemia, small cell-follicular lymphoma, large cell-follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma, Marginal zone lymphoma, multiple myeloma, myelodysplasia, myelodysplastic syndrome
- the disease is a cancer selected from the group consisting of mesothelioma, papillary serous ovarian adenocarcinoma, clear cell acute lymphoid leukemia (T-ALL), acute lymphoblastic leukemia (ALL); chronic myelogenous leukemia (CML), chronic lymphocytic leukemia (CLL), B cell chronic lymphocytic leukemia, B cell
- prolymphocyte leukemia blastic plasmacytoid dendritic cell neoplasm, Burkitt' s lymphoma, diffuse large B cell lymphoma, follicular lymphoma, hairy cell leukemia, small cell-follicular lymphoma, large cell-follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma, Marginal zone lymphoma, multiple myeloma, myelodysplasia, myelodysplastic syndrome, non-Hodgkin ' s lymphoma, plasmablastic lymphoma, plasmacytoid dendritic cell neoplasm,
- adenocarcinoma uterine serous carcinoma, lung adenocarcinoma, extrahepatic bile duct carcinoma, gastric adenocarcinoma, esophageal adenocarcinoma, colorectal adenocarcinoma, breast
- the disease is a cancer selected from the group consisting of Ewing' s sarcoma, glioma, neuroblastoma, multiple myeloma, melanoma, leukemia (e.g., AML, CML, ad CLL), ovarian carcinoma, bladder carcinoma, breast carcinoma, lung carcinoma, hepatocellular carcinoma, colon carcinoma, renal carcinoma, and prostate carcinoma.
- the disease is a hematologic cancer selected from the group consisting of B -cell acute lymphoid leukemia (B-ALL), T-cell acute lymphoid leukemia (T-ALL), acute lymphoblastic leukemia (ALL); chronic myelogenous leukemia (CML), chronic lymphocytic leukemia (CLL), B cell prolymphocyte leukemia, blastic plasmacytoid dendritic cell neoplasm, Burkitt' s lymphoma, diffuse large B cell lymphoma, follicular lymphoma, hairy cell leukemia, small cell-follicular lymphoma, large cell-follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma, Marginal zone lymphoma, multiple myeloma, myelodysplasia, myelodysplastic syndrome, non-Hodgkin ' s lymphoma, plasmablastic lymph
- the cells expressing a TFP molecule are administered in combination with an agent that increases the efficacy of a cell expressing a TFP molecule.
- the cells expressing a TFP molecule are administered in combination with an antibody or fragment thereof that specifically binds to a cell surface-associated antigen on a tumor cell.
- the cells expressing a first TFP molecule and a second TFP molecule are administered in combination with an agent that increases the efficacy of a cell expressing the first TFP molecule and the second TFP molecule.
- less cytokines are released in the mammal compared a mammal administered an effective amount of a T-cell expressing a chimeric antigen receptor (CAR) having the antigen domain. In some embodiments, less cytokines are released in the mammal compared a mammal administered an effective amount of a T-cell expressing a chimeric antigen receptor (CAR) having the antigen domain comprising the ligand NKG2D. In some embodiments, less cytokines are released in the mammal compared to a mammal administered an effective amount of a T-cell expressing a chimeric antigen receptor (CAR) capable of binding to the cell surface -associated antigen.
- CAR chimeric antigen receptor
- less cytokines are released in the mammal compared to a mammal administered an effective amount of a T- cell expressing an anti-RORl chimeric antigen receptor (CAR). In some embodiments, less cytokines are released in the mammal compared a mammal administered an effective amount of a T-cell expressing: an anti-CD 19 chimeric antigen receptor (CAR); an anti-BCMA CAR; an anti-CD22 CAR; an anti-CD 19 CAR and an anti-BCMA CAR; an anti-CD 19CAR and an anti-CD22CAR; or a combination thereof.
- CAR anti-CD 19 chimeric antigen receptor
- the cells expressing a TFP molecule are administered in combination with an agent that ameliorates one or more side effects associated with administration of a cell expressing a TFP molecule. In some embodiments, the cells expressing a TFP molecule are administered in combination with a second therapeutic agent. In some embodiments, the cells expressing a TFP molecule are administered in combination with an agent that treats the disease associated with ROR1. In some embodiments, the cells expressing a TFP molecule are administered in combination with an agent that treats the disease associated with an anti-NKG2D receptor.
- the cells expressing the first TFP molecule and a second TFP molecule are administered in combination with an agent that ameliorates one or more side effects associated with administration of a cell expressing the first TFP molecule and the second TFP molecule. In some embodiments, the cells expressing the first TFP molecule and a second TFP molecule are administered in combination with an agent that treats the disease associated with CD 19, BCMA, or CD22.
- nucleic acid molecule described herein a polypeptide molecule described herein, a cell expressing a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, a vector described herein, or a cell described herein, for use as a medicament.
- nucleic acid molecule described herein for use as a medicament.
- a method of treating a mammal having a disease associated with expression of ROR1 comprising administering to the mammal an effective amount of an isolated nucleic acid molecule described herein, a polypeptide molecule described herein, a cell expressing a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, a vector described herein, or a cell described herein, wherein less cytokines are released in the mammal compared a mammal administered an effective amount of a T cell expressing an anti-RORl chimeric antigen receptor (CAR).
- CAR anti-RORl chimeric antigen receptor
- a method of treating a mammal having a disease associated with expression of an anti-NKG2D receptor comprising administering to the mammal an effective amount of an isolated nucleic acid molecule described herein, a polypeptide molecule described herein, a cell expressing a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, a vector described herein, or a cell described herein, wherein less cytokines are released in the mammal compared a mammal administered an effective amount of a T-cell expressing a chimeric antigen receptor (CAR) having the antigen domain comprising the ligand NKG2D.
- CAR chimeric antigen receptor
- a method of treating a mammal having a disease associated with expression of CD 19, BCMA, or CD22 comprising administering to the mammal an effective amount of an isolated nucleic acid molecule described herein, a polypeptide molecule described herein, a cell expressing a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, a vector described herein, or a cell described herein, wherein less cytokines are released in the mammal compared to a mammal administered an effective amount of a T-cell expressing: an anti- CD 19 chimeric antigen receptor (CAR); an anti-BCMA CAR; an anti-CD22 CAR; an anti-CD 19 CAR and an anti-BCMA CAR; an anti-CD 19CAR and an anti-CD22CAR; or a combination thereof.
- CAR anti- CD 19 chimeric antigen receptor
- a first T-cell receptor (TCR) fusion protein comprising: a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 epsilon; and a first human or humanized antibody domain comprising a first antigen binding domain; and a second T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit of the first TFP and the first antibody domain are operatively linked and the TCR subunit of the second TFP and the second antibody domain are operatively linked, and wherein the first TFP and the second TFP incorporate into a TCR when expressed in a T-
- a first T-cell receptor (TCR) fusion protein comprising: a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 gamma; and a first human or humanized antibody domain comprising a first antigen binding domain; and a second T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit of the first TFP and the first antibody domain are operatively linked and the TCR subunit of the second TFP and the second antibody domain are operatively linked, and wherein the first TFP and the second TFP incorporate into a TCR when expressed in a T-cell.
- TCR T-cell receptor
- a first T-cell receptor (TCR) fusion protein comprising: a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of CD3 delta; and a first human or humanized antibody domain comprising a first antigen binding domain; and a second T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit of the first TFP and the first antibody domain are operatively linked and the TCR subunit of the second TFP and the second antibody domain are operatively linked, and wherein the first TFP and the second TFP incorporate into a TCR when expressed in a T-cell.
- TCR T-cell receptor
- a first T-cell receptor (TCR) fusion protein comprising: a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of TCR alpha; and a first human or humanized antibody domain comprising a first antigen binding domain; and a second T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit of the first TFP and the first antibody domain are operatively linked and the TCR subunit of the second TFP and the second antibody domain are operatively linked, and wherein the first TFP and the second TFP incorporate into a TCR when expressed in a T-cell.
- TCR T-cell receptor
- TFP TCR subunit comprising at least a portion of a TCR extracellular domain, and
- a first T-cell receptor (TCR) fusion protein comprising: a TCR subunit comprising at least a portion of a TCR extracellular domain, and a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain of TCR beta; and a first human or humanized antibody domain comprising a first antigen binding domain; and a second T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit comprising at least a portion of a TCR extracellular domain, and a second human or humanized antibody domain comprising a second antigen binding domain; wherein the TCR subunit of the first TFP and the first antibody domain are operatively linked and the TCR subunit of the second TFP and the second antibody domain are operatively linked, and wherein the first TFP and the second TFP incorporate into a TCR when expressed in a T-cell.
- TCR T-cell receptor
- the TCR subunit of the second TFP further comprises a TCR intracellular domain comprising a stimulatory domain from an intracellular signaling domain or a functional fragment thereof a selected from the group consisting of a TCR alpha, a TCR beta, a CD3 epsilon, a CD3 gamma, and a CD3 delta.
- the first antigen binding domain or the second antigen binding domain is an anti-CD 19 binding domain.
- the first antigen binding domain or the second antigen binding domain is an anti-B-cell maturation antigen (BCMA) binding domain.
- the first antigen binding domain or the second antigen binding domain is an anti-CD22 binding domain.
- an isolated recombinant nucleic acid molecule encoding: a first T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit, a first human or humanized antibody domain comprising a first antigen binding domain that is an anti-CD19 binding domain; and a second T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit, a second human or humanized antibody domain comprising a second antigen binding domain that is an anti-BCMA binding domain.
- TCR T-cell receptor
- TCR TCR fusion protein
- an isolated recombinant nucleic acid molecule encoding: a first T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit, a first human or humanized antibody domain comprising a first antigen binding domain that is an anti-CD19 binding domain; and a second T-cell receptor (TCR) fusion protein (TFP) comprising a TCR subunit, a second human or humanized antibody domain comprising a second antigen binding domain that is an anti-CD22 binding domain.
- TCR T-cell receptor
- TCR TCR fusion protein
- the TCR subunit of the first TFP and the first antibody domain are operatively linked and the TCR subunit of the second TFP and the second antibody domain are operatively linked.
- the first TFP, the second TFP, or both incorporate into a TCR when expressed in a T-cell.
- the encoded first antigen binding domain is connected to the TCR extracellular domain of the first TFP by a first linker sequence
- the encoded second antigen binding domain is connected to the TCR extracellular domain of the second TFP by a second linker sequence
- both the first antigen binding domain is connected to the TCR extracellular domain of the first TFP by the first linker sequence
- the encoded second antigen binding domain is connected to the TCR extracellular domain of the second TFP by the second linker sequence.
- the TCR subunit of the first TFP, the TCR subunit of the second TFP, or both comprise a TCR extracellular domain. In some embodiments, the TCR subunit of the first TFP, the TCR subunit of the second TFP, or both comprise a TCR transmembrane domain. In some embodiments, the TCR subunit of the first TFP, the TCR subunit of the second TFP, or both comprise a TCR intracellular domain.
- the TCR subunit of the first TFP, the TCR subunit of the second TFP, or both comprise (i) a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain, wherein at least two of (i), (ii), and (iii) are from the same TCR subunit.
- the TCR subunit of the first TFP, the TCR subunit of the second TFP, or both comprise a TCR intracellular domain comprising a stimulatory domain selected from an intracellular signaling domain of CD3 epsilon, CD3 gamma or CD3 delta, or an amino acid sequence having at least one modification thereto.
- the TCR subunit of the first TFP, the TCR subunit of the second TFP, or both comprise an intracellular domain comprising a stimulatory domain selected from a functional signaling domain of 4- IBB and/or a functional signaling domain of CD3 zeta, or an amino acid sequence having at least one modification thereto.
- the first human or humanized antibody domain, the second human or humanized antibody domain, or both comprise an antibody fragment.
- the first human or humanized antibody domain, the second human or humanized antibody domain, or both comprise a scFv or a VH domain.
- the isolated nucleic acid molecule encodes (i) a light chain (LC) CDR1, LC CDR2 and LC CDR3 of an anti-CD 19 light chain binding domain amino acid sequence with 70- 100% sequence identity to SEQ ID NO: 25, SEQ ID NO: 27 and SEQ ID NO: 29, respectively, and/or (ii) a heavy chain (HC) CDR1, HC CDR2 and HC CDR3 of an anti-CD 19 heavy chain binding domain amino acid sequence with 70-100% sequence identity to SEQ ID NO: 31, SEQ ID NO: 33 and SEQ ID NO: 35, respectively.
- LC light chain
- the isolated nucleic acid molecule encodes a light chain variable region, wherein the light chain variable region comprises an amino acid sequence having at least one but not more than 30 modifications of a light chain variable region amino acid sequence of SEQ ID NO: 49, or a sequence with 95-99% identity to a light chain variable region amino acid sequence of SEQ ID NO: 49.
- the isolated nucleic acid molecule encodes a heavy chain variable region, wherein the heavy chain variable region comprises an amino acid sequence having at least one but not more than 30 modifications of a heavy chain variable region amino acid sequence of SEQ ID NO: 51, or a sequence with 95-99% identity to a heavy chain variable region amino acid sequence of SEQ ID NO: 51.
- the isolated nucleic acid molecule encodes (i) a light chain (LC) CDR1, LC CDR2 and LC CDR3 of an anti-BCMA light chain binding domain amino acid sequence with 70- 100% sequence identity to SEQ ID NO: 37, SEQ ID NO: 39 and SEQ ID NO: 41, respectively, and/or (ii) a heavy chain (HC) CDR1, HC CDR2 and HC CDR3 of an anti-BCMA heavy chain binding domain amino acid sequence with 70-100% sequence identity to SEQ ID NO: 43, SEQ ID NO: 45 and SEQ ID NO: 47, respectively.
- LC light chain
- the isolated nucleic acid molecule encodes a light chain variable region, wherein the light chain variable region comprises an amino acid sequence having at least one but not more than 30 modifications of a light chain variable region amino acid sequence of SEQ ID NO: 53, or a sequence with 95-99% identity to a light chain variable region amino acid sequence of SEQ ID NO: 53.
- the isolated nucleic acid molecule encodes a heavy chain variable region, wherein the heavy chain variable region comprises an amino acid sequence having at least one but not more than 30 modifications of a heavy chain variable region amino acid sequence of SEQ ID NO: 55, or a sequence with 95-99% identity to a heavy chain variable region amino acid sequence of SEQ ID NO: 55.
- the anti-CD22 antigen binding domain comprises a variable region as described herein or one or more CDRs as described herein.
- the encoded first TFP, the encoded second TFP, or both include an extracellular domain of a TCR subunit that comprises an extracellular domain or portion thereof of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
- the encoded first TFP and the encoded second TFP include a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
- the encoded first TFP and the encoded second TFP include a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a TCR zeta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD28, CD37, CD64, CD80, CD86, CD134, CD137, CD154, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
- the isolated nucleic acid molecule further comprises a sequence encoding a costimulatory domain.
- the costimulatory domain is a functional signaling domain obtained from a protein selected from the group consisting of OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD1 la/CD18), ICOS (CD278), and 4-1BB (CD137), and amino acid sequences thereof having at least one but not more than 20 modifications thereto.
- the isolated nucleic acid molecule further comprises a sequence encoding an intracellular signaling domain.
- the isolated nucleic acid molecule further comprises a leader sequence.
- the isolated nucleic acid molecule further comprises a protease cleavage site.
- the at least one but not more than 20 modifications thereto comprise a modification of an amino acid that mediates cell signaling or a modification of an amino acid that is phosphorylated in response to a ligand binding to the first TFP, the second TFP, or both.
- the isolated nucleic acid molecule is an mRNA.
- the first TFP, the second TFP, or both include an immunoreceptor tyrosine-based activation motif (ITAM) of a TCR subunit that comprises an ITAM or portion thereof of a protein selected from the group consisting of CD3 zeta TCR subunit, CD3 epsilon TCR subunit, CD3 gamma TCR subunit, CD3 delta TCR subunit, TCR zeta chain, Fc epsilon receptor 1 chain, Fc epsilon receptor 2 chain, Fc gamma receptor 1 chain, Fc gamma receptor 2a chain, Fc gamma receptor 2b 1 chain, Fc gamma receptor 2b2 chain, Fc gamma receptor 3a chain, Fc gamma receptor 3b chain, Fc beta receptor 1 chain, TYROBP (DAP 12), CD5, CD16a, CD16b, CD22, CD23, CD32, CD64, CD79a, CD79b, CD89, CD
- ITAM
- the ITAM replaces an ITAM of CD3 gamma, CD3 delta, or CD3 epsilon.
- the ITAM is selected from the group consisting of CD3 zeta TCR subunit, CD3 epsilon TCR subunit, CD3 gamma TCR subunit, and CD3 delta TCR subunit and replaces a different ITAM selected from the group consisting of CD3 zeta TCR subunit, CD3 epsilon TCR subunit, CD3 gamma TCR subunit, and CD3 delta TCR subunit.
- the isolated nucleic acid molecule further comprises a leader sequence.
- an isolated polypeptide molecule encoded by a nucleic acid molecule described herein comprises a first polypeptide encoded by a first nucleic acid molecule and a second polypeptide encoded by a second nucleic acid molecule.
- an isolated recombinant TFP molecule comprising a first TFP molecule comprising a human or humanized anti-CD19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, and a second TFP molecule comprising a human or humanized anti-BCMA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain.
- an isolated recombinant TFP molecule comprising a first TFP molecule comprising a human or humanized anti-CD19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, and a second TFP molecule comprising a human or humanized anti-BCMA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the first TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide.
- an isolated recombinant TFP molecule comprising a first TFP molecule comprising a human or humanized anti-CD19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, and a second TFP molecule comprising a human or humanized anti-BCMA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the first TFP molecule is capable of functionally integrating into an endogenous TCR complex.
- the isolated recombinant TFP molecule comprises an antibody or antibody fragment comprising a human or humanized anti-CD 19 binding domain, a humanized anti-BCMA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain.
- an isolated recombinant TFP molecule comprising a first TFP molecule comprising a human or humanized anti-CD19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, and a second TFP molecule comprising a human or humanized anti-CD22 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain.
- an isolated recombinant first TFP molecule comprising a human or humanized anti-CD 19 binding domain, a humanized anti-CD22 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular signaling domain, wherein the first TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide.
- an isolated recombinant first TFP molecule comprising a human or humanized anti-CD 19 binding domain, a humanized anti-CD22 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular signaling domain, wherein the first TFP molecule is capable of functionally integrating into an endogenous TCR complex.
- the isolated recombinant TFP molecule comprises an antibody or antibody fragment comprising a human or humanized anti-CD 19 binding domain, a humanized anti- CD22 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain.
- the anti-CD 19 binding domain, the anti-BCMA binding domain, the anti- CD22 binding domain, or a combination thereof are a scFv or a VH domain.
- the anti-CD19 binding domain comprises a heavy chain with 95-100% identity to an amino acid sequence of SEQ ID NO: 51, a functional fragment thereof, or an amino acid sequence thereof having at least one but not more than 30 modifications.
- the anti-CD19 binding domain comprises a light chain with 95-100% identity to an amino acid sequence of SEQ ID NO: 49, a functional fragment thereof, or an amino acid sequence thereof having at least one but not more than 30 modifications.
- the anti-BCMA binding domain comprises a heavy chain with 95-100% identity to an amino acid sequence of SEQ ID NO: 55, a functional fragment thereof, or an amino acid sequence thereof having at least one but not more than 30 modifications. In some embodiments, the anti-BCMA binding domain comprises a light chain with 95-100% identity to an amino acid sequence of SEQ ID NO: 53, a functional fragment thereof, or an amino acid sequence thereof having at least one but not more than 30 modifications. In some embodiments, the anti-CD22 binding domain comprises a variable region as described herein or one or more CDRs as described herein.
- the isolated recombinant TFP molecule comprises a TCR extracellular domain that comprises an extracellular domain or portion thereof of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, functional fragments thereof, and amino acid sequences thereof having at least one but not more than 20 modifications.
- the anti-CD 19 binding domain is connected to the TCR extracellular domain of the first TFP molecule by a first linker sequence and the anti-BCMA binding domain is connected to the TCR extracellular domain of the first TFP molecule by a second linker sequence.
- the anti-CD 19 binding domain is connected to the TCR extracellular domain of the first TFP molecule by a first linker sequence and the anti-CD22 binding domain is connected to the TCR extracellular domain of the first TFP molecule by a second linker sequence.
- the isolated recombinant TFP molecule further comprises a
- an isolated recombinant TFP molecule described herein further comprises an intracellular signaling domain. In some embodiments, an isolated recombinant TFP molecule described herein, further comprises a leader sequence.
- a nucleic acid comprising a sequence encoding an isolated recombinant TFP described herein. In some embodiments, the nucleic acid comprises a first nucleic acid encoding the first TFP molecule and a second nucleic acid encoding the second TFP molecule. In some embodiments, the nucleic acid is selected from the group consisting of a DNA and an RNA. In some embodiments, the nucleic acid is an mRNA.
- the nucleic acid described herein further comprises a promoter.
- the nucleic acid is an in vitro transcribed nucleic acid.
- the nucleic acid further comprises a sequence encoding a poly(A) tail.
- the nucleic acid further comprises a 3 ' UTR sequence.
- the nucleic acid further comprises a sequencing encoding a protease cleavage site.
- a vector comprising a nucleic acid molecule encoding an isolated recombinant TFP molecule described herein.
- the vector comprises a) a first vector comprising a first nucleic acid molecule encoding the first TFP; and b) a second vector comprising a second nucleic acid molecule encoding the second TFP.
- the vector is selected from the group consisting of a DNA, an RNA, a plasmid, a lentivirus vector, adenoviral vector, a Rous sarcoma viral (RSV) vector, or a retrovirus vector.
- the vector described herein further comprises a promoter.
- the vector is an in vitro transcribed vector.
- the nucleic acid molecule in the vector further encodes a poly(A) tail. In some embodiments, the nucleic acid molecule in the vector further encodes a 3 ' UTR. In some embodiments, the nucleic acid molecule in the vector further encodes a protease cleavage site.
- a cell comprising ab isolated nucleic acid molecule described herein, a polypeptide molecule described herein, an isolated recombinant TFP molecule described herein, a nucleic acid described herein, or a vector described herein.
- the cell is a human T-cell.
- the T-cell is a CD8 + or CD4 + T-cell.
- a cell described herein further comprises a nucleic acid encoding an inhibitory molecule that comprises a first polypeptide that comprises at least a portion of an inhibitory molecule, associated with a second polypeptide that comprises a positive signal from an intracellular signaling domain.
- the inhibitory molecule comprises a first polypeptide that comprises at least a portion of PD 1 and a second polypeptide comprising a costimulatory domain and primary signaling domain.
- a human CD8 + or CD4 + T-cell comprising an isolated recombinant TFP molecule, the isolated recombinant TFP molecule comprising a first TFP molecule comprising a human or humanized anti-CD 19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, and second TFP molecule comprising a human or humanized anti-BCMA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T-cell.
- a human CD8 + or CD4 + T-cell comprising an isolated recombinant TFP molecule, the isolated recombinant TFP molecule comprising a first TFP molecule comprising a human or humanized anti-CD 19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, and second TFP molecule comprising a human or humanized anti-CD22 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T-cell.
- a protein complex comprising: a first TFP molecule comprising a human or humanized CD 19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain; a second TFP molecule comprising a human or humanized anti- BCMA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain; and at least one endogenous TCR subunit or endogenous TCR complex.
- a protein complex comprising: a first TFP molecule comprising a human or humanized CD 19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain; a second TFP molecule comprising a human or humanized anti- CD22 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain; and at least one endogenous TCR subunit or endogenous TCR complex.
- the TFP comprises an extracellular domain or portion thereof of a protein selected from the group consisting of TCR alpha chain, a TCR beta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, and a CD3 delta TCR subunit.
- the human or humanized anti-CD 19 binding domain is connected to the TCR extracellular domain of the first TFP molecule by a first linker sequence and the human or humanized anti-BCMA binding domain is connected to the TCR extracellular domain of the second TFP molecule by a second linker sequence.
- the human or humanized anti-CD 19 binding domain is connected to the TCR extracellular domain of the first TFP molecule by a first linker sequence and the human or humanized anti-CD20 binding domain is connected to the TCR extracellular domain of the second TFP molecule by a second linker sequence.
- a protein complex comprising a first TFP and a second TFP encoded by the isolated nucleic acid molecule described herein, and at least one endogenous TCR subunit or endogenous TCR complex.
- a human CD8 + or CD4 + T-cell comprising the first TFP molecule and the second TFP molecule per the protein complex described herein.
- a human CD8 + or CD4 + T-cell comprising the first TFP molecule and the second TFP molecule encoded by an isolated nucleic acid molecule described herein.
- a population of human CD8 + or CD4 + T-cells wherein the T- cells of the population individually or collectively comprise a first TFP molecule and a second TFP molecule, the first TFP molecule comprising a human or humanized anti-CD 19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain and the second TFP molecule comprising a human or humanized anti-BCMA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the first TFP molecule and the second TFP molecule are capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T-cell.
- a population of human CD8 + or CD4 + T-cells wherein the T- cells of the population individually or collectively comprise a first TFP molecule and a second TFP molecule, the first TFP molecule comprising a human or humanized anti-CD 19 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain and the second TFP molecule comprising a human or humanized anti-CD22 binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the first TFP molecule and the second TFP molecule are capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T-cell.
- a population of human CD8 + or CD4 + T-cells wherein the T- cells of the population individually or collectively comprise the first TFP molecule and the second TFP molecule encoded by the isolated nucleic acid molecule described herein.
- provided herein is a method of making a cell comprising transducing a T-cell with an isolated nucleic acid molecule described herein, a nucleic acid described herein, or a vector described herein.
- RNA-engineered cells comprising introducing an in vitro transcribed RNA or synthetic RNA into a cell, where the RNA comprises a nucleic acid encoding the isolated recombinant TFP molecule described herein.
- provided herein is a method of providing an anti-tumor immunity in a mammal comprising administering to the mammal an effective amount of an isolated nucleic acid molecule described herein, a polypeptide molecule described herein, a cell expressing a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, a vector described herein, or a cell or cell population described herein.
- the cell is an autologous T-cell. In some embodiments, the cell is an allogeneic T-cell. In some embodiments, the mammal is a human.
- a method of treating a mammal having a disease associated with expression of CD 19, BCMA, or CD22 comprising administering to the mammal an effective amount of an isolated nucleic acid molecule described herein, a polypeptide molecule described herein, a cell expressing a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, a vector described herein, or a cell or cell population described herein.
- the disease associated with CD 19, BCMA, or CD22 expression is selected from the group consisting of a proliferative disease, a cancer, a malignancy, myelodysplasia, a myelodysplastic syndrome, a preleukemia, a non-cancer related indication associated with expression of CD 19, a non -cancer related indication associated with expression of BCMA, and a non -cancer related indication associated with expression of CD22.
- the disease is a hematologic cancer selected from the group consisting of B-cell acute lymphoid leukemia (B-ALL), T-cell acute lymphoid leukemia (T-ALL), acute lymphoblastic leukemia (ALL); chronic myelogenous leukemia (CML), chronic lymphocytic leukemia (CLL), B cell prolymphocyte leukemia, blastic plasmacytoid dendritic cell neoplasm, Burkitt' s lymphoma, diffuse large B cell lymphoma, follicular lymphoma, hairy cell leukemia, small cell-follicular lymphoma, large cell -follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma, Marginal zone lymphoma, multiple myeloma, myelodysplasia, myelodysplastic syndrome, non-Hodgkin' s lymphoma, plasmablastic lympho
- the cells expressing a first TFP molecule and a second TFP molecule are administered in combination with an agent that increases the efficacy of a cell expressing the first TFP molecule and the second TFP molecule.
- less cytokines are released in the mammal compared a mammal administered an effective amount of a T-cell expressing: an anti-CD19 chimeric antigen receptor (CAR); an anti-BCMA CAR; an anti-CD22 CAR; an anti-CD19 CAR and an anti-BCMA CAR; an anti-CD 19 CAR and an anti-CD22 CAR; or a combination thereof.
- CAR anti-CD19 chimeric antigen receptor
- the cells expressing the first TFP molecule and a second TFP molecule are administered in combination with an agent that ameliorates one or more side effects associated with administration of a cell expressing the first TFP molecule and the second TFP molecule. In some embodiments, the cells expressing the first TFP molecule and a second TFP molecule are administered in combination with an agent that treats the disease associated with CD 19, BCMA, or CD22.
- nucleic acid molecule described herein a polypeptide molecule described herein, a cell expressing a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, a vector described herein, or a cell or cell population described herein, for use as a medicament.
- a method of treating a mammal having a disease associated with expression of CD 19, BCMA, or CD22 comprising administering to the mammal an effective amount of an isolated nucleic acid molecule described herein, a polypeptide molecule described herein, a cell expressing a polypeptide molecule described herein, a TFP molecule described herein, a nucleic acid described herein, a vector described herein, or a cell or cell population described herein, wherein less cytokines are released in the mammal compared to a mammal administered an effective amount of a T- cell expressing: an anti-CD 19 chimeric antigen receptor (CAR); an anti-BCMA CAR; an anti-CD22 CAR; an anti-CD19 CAR and an anti-BCMA CAR; an anti-CD 19CAR and an anti-CD22CAR; or a combination thereof.
- CAR anti-CD 19 chimeric antigen receptor
- FIG. 1A is a drawing showing some of the methods of dual targeting of cancer cells disclosed herein.
- Tumor cell antigen targets BCMA and CD19 are exemplary antigens.
- the figure shows T cells as circles.
- White circles show examples of T cells transduced with a TFP having an anti-CD19 TFP attached to the CD3 epsilon subunit.
- Black circles show examples of T cells transduced with a TFP having an anti-BCMA TFP attached to the CD3 epsilon ( ⁇ ) or gamma ( ⁇ ) subunit.
- the 'black' and 'white' cells are mixed to create a T cell population that comprises both anti-BCMA TFPs and anti-CD 19 TFPs.
- the grey cells show examples of co-transduced T cell populations that have been made by either transducing a single T cell population with two types of lentivirus (i.e., each having specificity for (i.e., an scFv) a different anti -tumor-antigen) or by transducing a single T cell population with (a) a lentivirus having the first anti -tumor-antigen scFv on one TCR subunit and a second anti-tumor antigen scFv on a second TCR subunit, or (b) a lentivirus having the first anti-tumor antigen scFv and the second anti-tumor antigen scFv operatively linked (e.g., by a G4S linker) and attached to a single TCR subunit.
- two types of lentivirus i.e., each having specificity for (i.e., an scFv) a different anti -tum
- FIG. IB is a drawing showing two exemplary ways a single TCR is engineered to have dual specificity.
- the TCR subunits, epsilon, delta, alpha, beta, gamma, and epsilon are shown from left to right along the cell membrane.
- White ovals represent anti-BCMA scFvs
- textured ovals represent anti-CD 19 scFvs.
- the scFvs are operatively connected to each other via a first linker and operatively connected to the TCR via a second linker connected to, e.g., an epsilon subunit (shown on left epsilon subunit in the figure).
- the scFvs are each operatively connected to a TCR subunit; shown in this example are an anti -CD 19 scFv operatively connected via a linker to the gamma subunit, and an anti-BCMA scFv operatively connected via a linker to an epsilon subunit (shown on the gamma and right epsilon in the figure).
- FIG. 2 shows surface expression of TFP T cells as measured by FACS.
- FIG. 2A shows surface expression of NKG2D-specific TFP-T cells, as described in Example 5. Both monomeric and dimeric NKG2D CD3s TFP T cells showed expression compared to the non -transduced ("NT"); dimeric NKG2D TFP T cells were the most highly expressed.
- FIG. 2B is a series of images showing FACS analysis of anti-BCMA and/or anti-CD 19-transduced T cells. The cells were sorted by surface expression of CD8 (y-axes) and either anti-Fab (top row) or BCMA-Fc (bottom row) (x-axes).
- FIG. 3A shows a schematic of CD20 + Raji cells being bound by the anti-CD20 antibody rituximab, that is bound in turn by T cells transduced with CD 16 TFPs, resulting in the induction of cell lysis ( Figure 3 A).
- CD16 TFPs cannot bind to the antibody and thus do not induce lysis in the target cell (FIG. 3B).
- FIG. 4A shows confirmation of surface expression of TFPs in cells stained for CD16 (anti- CD 16, x-axis) and CD3 (y-axis). Shown from left to right are cells that were either non -transduced or transduced with: CD16-CD3s TFP, CD16-CD3y TFP, CD16-CD35 TFP, and CD16-CD3 constructs (top row); and non-transduced, CD16-CD28 ⁇ CAR, CD16-41BB ⁇ CAR, and an anti- CD19-CD3s TFP as a positive control.
- the proportion of CD3 + , CD16 + cells is shown in the top right corner of each panel. Exemplary results of Zenon staining are shown in FIG. 4B.
- FIG. 4C shows that both rituximab and a-glycosylated rituximab was able to bind to CD19 + Raji cells.
- FIG. 5 shows an illustration of NKG2D ⁇ -TFP T cell structures and lenti viral vectors bearing NKG2D ⁇ -TFP constructs, both monomeric and dimeric.
- the top panel shows a complete T cell receptor with NKG2D-specific subunits, with either monomeric or dimeric NKG2D binders.
- the bottom panel shows a schematic of the layout of the constructs.
- FIG. 6A is traces of Zenon staining that shows NKG2D-CD3s TFP-T cells proliferate upon ULBP2 peptide stimulation.
- FIG. 6B shows NKG2DL antigen expression on tumor cells: OVCAR3 and OVCAR5 cells have varying levels of NKGD2L expression on the cell surface, while the AE17 mouse cell line was negative for NKG2DL expression. Arrows indicate TFP-T cell proliferation (dilution of CFSE dye after 72 hrs).
- FIGs. 7A-C shows traces of RTCA analysis of monomer and dimer NKG2D ⁇ -TFP T cell activity against NKG2D-hgand positive cells, at a 5: 1 (FIG. 7A), 1 : 1 (FIG. 7B), or 1 :5 (FIG. 7C) effector cell:target cell ratio in ovarian cancer cells lines OVCAR3 and OVCAR5, and AE17 mesothelin + cell line as a negative control.
- the figure shows that NKG2D ⁇ -TFP T cells do not effectively kill non-transduced T cells (NT) but specifically kill NKG2DL + ovarian cancer cells in vitro, most particularly at a higher ratio of effector cells: target cells.
- NT non-transduced T cells
- FIGs. 8A-C is a series of graphs showing tumor cell lysis as measured in a luciferase assay.
- T cells were transduced with an empty expression vector, or the following TFPs: anti-CD19-CD38, anti-BCMA-CD38, anti-BCMA-CD3Y, anti-CD19-CD38 / anti-BCMA-CD38, anti-CD19-CD3s / anti-BCMA-CD3y, anti-CD19-CD3s + anti-BCMA-CD38, or anti-CD19-CD3s + anti-BCMA-CD3y.
- the transduced T cells were incubated with HeLa cells that stably express CD 19 (FIG.
- FIG. 8A HeLa cells that stably express BCMA
- FIG. 8B HeLa cells that stably express both CD 19 and BCMA
- “/” refers to assays with a T cell population transduced with two viruses, one with an anti-BCMA TFP and one with an anti-CD19 TFP
- "+” refers to the use of two populations of T cells, one transduced with an anti-BCMA TFPs and one transduced with anti-CD19 TFPs, that have been combined.
- the T cells were mixed with the target HeLa cells and incubated together for 24 hours.
- the cells were spun into a pellet and resuspended in medium containing the luciferase substrate. Luciferase is released by cell lysis; thus, higher luciferase activity corresponds to a greater percentage of cell death.
- FIGs. 9A-C is a series of graphs showing cytokine production as measured in the supernatant of the cells that were pelleted in the analysis shown in FIG. 8.
- a Luminex® ELISA assay was performed to detect and quantify the amount of IFNy (hatched bars) and IL-2 (solid bars).
- the transduced T cells were incubated with HeLa cells that stably express CD 19 (FIG. 9A), HeLa cells that stably express BCMA (FIG. 9B), or HeLa cells that stably express both CD 19 and BCMA (FIG. 9C).
- / refers to assays with a T cell population transduced with two viruses, one with an anti-BCMA TFP and one with an anti-CD19 TFP;
- + refers to the use of two populations of T cells, one transduced with an anti-BCMA TFPs and one transduced with anti-CD19 TFPs, that have been combined. Total cytokine production is shown on the Y axis.
- FIGs. 10A-D is a series of images showing the results of a Real Time Cytotoxicity Assay (RTCA) as described in Example 9.
- Table 2 summarizes the constructs used in the Example.
- FIG. 11 is two graphs showing that CD16-positive T cells were efficient in CD20-positive tumor lysis in the presence of 1 ⁇ g/ml of anti-CD20 (rituximab) and not in the presence of non- glycosylated CD20.
- FIG. 11A shows Raji cell lysis with the combination of rituximab, and various transduced T cells;
- FIG. 11B shows the same combinations with non-glycosylated rituximab.
- FIG. 12 is two graphs showing that low levels of interferon gamma (IFN- ⁇ , FIG. 12A) and interleukin 2 (IL-2, FIG. 12B) were produced by TFP-transduced T cells in combination with Raji cells and rituximab, as compared to higher levels of cytokines produced by CAR-transduced T cells.
- IFN- ⁇ interferon gamma
- IL-2 interleukin 2
- FIG. 13 is a schematic diagram of ex vivo expansion experimental design and transduction efficiency of NKG2D ⁇ -TFP T cells by flow cytometry with DynabeadsTM + IL-2 condition (FIG. 13A) and corresponding transduction efficiency of the monomer and dimer NKG2D ⁇ -TFP T cells (FIG. 13B).
- An isotype match was used as a negative control.
- FIGs. 14 shows NKG2D ligand expression on multiple solid tumor cell lines and in vitro tumor cell lysis by NKG2D ⁇ -TFP T cells.
- FIG. 14A shows Zenon staining against NKG2D ligands was performed using (from left to right) anti-ULBPl, anti-ULBP2/5/6, anti-ULBP3, anti-ULBP4, and anti- MICA/B on MSTO-MSLN-Luc cells, OVCAR3-Luc, SaOS2-Luc, and SKOV3-Luc cells.
- the top trace is NKG2D ligand
- the middle trace is an isotype control or secondary antibody alone
- the bottom trace is unstained cells.
- FIG. 14B shows in vitro tumor lysis by NKG2D monomer and/or dimer ⁇ -TFP T cells using luciferase assay for 24 h co-culture.
- FIG. 14C shows ULBP2/5/6 and MICA/B expression on A549, A431, U373, and PC-3 tumor cell lines and tumor lysis by NKG2D dimer ⁇ -TFP T cells using luciferase assay for 24 h co-culture.
- FIG. 14D shows graphs of the reults shown in FIG. 14C.
- FIG. 15 is a series of graphs showing in vivo efficacy of NKG2D ⁇ -TFP T cells in mesothelin expressing tumor xenografts in NSG mice.
- FIG. 15A shows NKG2D ligand (ULBP2/5/6 and MICA/B) expression on MSTO-MLSN cells on the day of injection (tumor QC).
- FIG. 15B shows NKG2D expression on NT and NKG2D dimer ⁇ -TFP T cells on the day of injection (T cell QC).
- T cell QC shows NKG2D expression on NT and NKG2D dimer ⁇ -TFP T cells on the day of injection.
- FIG. 15C shows tumor volumes of mice treated with two doses of non-transduced ("NT", left panel) or NKG2D dimer ⁇ - TFP T cells at two doses: 5xl0 6 NKG2D ⁇ -TFP cells and lxlO 6 NKG2D ⁇ -TFP cells. T cells were injected on study days zero and 20. Each line in the graph represents one mouse.
- FIG. 15D shows survival of mice treated with two doses of NT or NKG2D dimer ⁇ -TFP T cells, NT vs NKG2D dimer ⁇ - TFP T, P ⁇ 0.05.
- compositions of matter and methods of use for the treatment of a disease such as cancer, using T-cell receptor (TCR) fusion proteins or T cell populations are provided herein.
- TCR T-cell receptor
- a "T-cell receptor (TCR) fusion protein” or “TFP” includes a recombinant polypeptide derived from the various polypeptides comprising the TCR that is generally capable of i) binding to a surface antigen on target cells and ii) interacting with other polypeptide components of the intact TCR complex, typically when co-located in or on the surface of a T-cell.
- TFPs provide substantial benefits as compared to Chimeric Antigen Receptors.
- CAR Chimeric Antigen Receptor
- a CAR refers to a recombinant polypeptide comprising an extracellular antigen binding domain in the form of a scFv, a transmembrane domain, and cytoplasmic signaling domains (also referred to herein as "an intracellular signaling domains") comprising a functional signaling domain derived from a stimulatory molecule as defined below.
- the central intracellular signaling domain of a CAR is derived from the CD3 zeta chain that is normally found associated with the TCR complex.
- the CD3 zeta signaling domain can be fused with one or more functional signaling domains derived from at least one co-stimulatory molecule such as 4-1BB (i.e., CD137), CD27 and/or CD28.
- TCR subunit comprises a TCR extracellular domain.
- TCR subunit comprises a TCR transmembrane domain.
- TCR subunit comprises a TCR intracellular domain.
- the TCR subunit comprises (i) a TCR extracellular domain, (ii) a TCR transmembrane domain, and (iii) a TCR intracellular domain, wherein at least two of (i), (ii), and (iii) are from the same TCR subunit.
- the TCR subunit comprises a TCR intracellular domain comprising a stimulatory domain selected from an intracellular signaling domain of CD3 epsilon, CD3 gamma or CD3 delta, or an amino acid sequence having at least one, two or three modifications thereto.
- the TCR subunit comprises an intracellular domain comprising a stimulatory domain selected from a functional signaling domain of 4-1BB and/or a functional signaling domain of CD3 zeta, or an amino acid sequence having at least one, two or three modifications thereto.
- the human or humanized antibody domain comprises an antibody fragment. In some embodiments, the human or humanized antibody domain comprises a scFv or a V H domain.
- the isolated nucleic acid molecules comprise (i) a light chain (LC) CDR1, LC CDR2 and LC CDR3 of any anti -tumor-associated antigen light chain binding domain amino acid sequence provided herein, and/or (ii) a heavy chain (HC) CDR1, HC CDR2 and HC CDR3 of any anti-tumor-associated antigen heavy chain binding domain amino acid sequence provided herein.
- the light chain variable region comprises an amino acid sequence having at least one, two or three modifications but not more than 30, 20 or 10 modifications of an amino acid sequence of a light chain variable region provided herein, or a sequence with 95-99% identity to an amino acid sequence provided herein.
- the heavy chain variable region comprises an amino acid sequence having at least one, two or three modifications but not more than 30, 20 or 10 modifications of an amino acid sequence of a heavy chain variable region provided herein, or a sequence with 95-99% identity to an amino acid sequence provided herein.
- the TFP includes an extracellular domain of a TCR subunit that comprises an extracellular domain or portion thereof of a protein selected from the group consisting of the alpha or beta chain of the T-cell receptor, CD3 delta, CD3 epsilon, or CD3 gamma, or a functional fragment thereof, or an amino acid sequence having at least one, two or three
- the encoded TFP includes a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of the alpha, beta chain of the TCR or TCR subunits CD3 epsilon, CD3 gamma and CD3 delta, or a functional fragment thereof, or an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications thereto.
- the encoded TFP includes a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a TCR zeta chain, a CD3 epsilon TCR subunit, a CD3 gamma TCR subunit, a CD3 delta TCR subunit, CD45, CD2, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD28, CD37, CD64, CD80, CD86, CD134, CD137 and CD154, functional fragment(s) thereof, and amino acid sequences thereof having at least one, two or three modifications but not more than 20 modifications thereto.
- a transmembrane domain that comprises a transmembrane domain of a protein selected from the group consisting of a TCR alpha chain, a TCR beta chain, a TCR zeta chain, a CD3 epsilon TCR subunit, a CD3 gamm
- the isolated nucleic acid molecule further comprises a sequence encoding a costimulatory domain.
- the costimulatory domain is a functional signaling domain obtained from a protein selected from the group consisting of DAP10, DAP12, CD30, LIGHT, OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CDl la/CD18), ICOS (CD278), and 4- 1BB (CD 137), and amino acid sequences thereof having at least one but not more than 20 modifications thereto.
- the isolated nucleic acid molecule further comprises a leader sequence.
- the isolated nucleic acid molecule is mRNA.
- the TFP includes an immunoreceptor tyrosine-based activation motif (IT AM) of a TCR subunit that comprises an IT AM or portion thereof of a protein selected from the group consisting of CD3 zeta TCR subunit, CD3 epsilon TCR subunit, CD3 gamma TCR subunit, CD3 delta TCR subunit, TCR zeta chain, Fc epsilon receptor 1 chain, Fc epsilon receptor 2 chain, Fc gamma receptor 1 chain, Fc gamma receptor 2a chain, Fc gamma receptor 2b 1 chain, Fc gamma receptor 2b2 chain, Fc gamma receptor 3a chain, Fc gamma receptor 3b chain, Fc beta receptor 1 chain, TYROBP (DAP12), CD5, CD16a, CD16b, CD22, CD23, CD32, CD64, CD79a, CD79b, CD89, CD278, CD66d,
- the ITAM replaces an ITAM of CD3 gamma, CD3 delta, or CD3 epsilon.
- the ITAM is selected from the group consisting of CD3 zeta TCR subunit, CD3 epsilon TCR subunit, CD3 gamma TCR subunit, and CD3 delta TCR subunit and replaces a different ITAM selected from the group consisting of CD3 zeta TCR subunit, CD3 epsilon TCR subunit, CD3 gamma TCR subunit, and CD3 delta TCR subunit.
- the nucleic acid comprises a nucleotide analog.
- the nucleotide analog is selected from the group consisting of 2'-0-methyl, 2'-0-methoxyethyl (2'-0- MOE), 2'-0-aminopropyl, 2'-deoxy, T-deoxy-2'-fluoro, 2'-0-aminopropyl (2'-0-AP), 2'-0- dimethylaminoethyl (2'-0-DMAOE), 2'-0-dimethylaminopropyl (2'-0-DMAP), T-O- dimethylaminoethyloxyethyl (2'-0-DMAEOE), 2'-0-N-methylacetamido (2'-0-NMA) modified, a locked nucleic acid (LNA), an ethylene nucleic acid (ENA), a peptide nucleic acid (PNA), a ,5' - anhydrohexitol nucleic acid (FIN
- the encoded anti-tumor-associated antigen binding domain is connected to the TCR extracellular domain by a linker sequence.
- the encoded linker sequence comprises a long linker (LL) sequence.
- the encoded linker sequence comprises a short linker (SL) sequence.
- the isolated nucleic acid molecules further comprise a leader sequence.
- isolated T-cell receptor fusion protein (TFP) molecules that comprise a human or humanized anti-tumor-associated antigen binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain.
- the isolated TFP molecules comprises an antibody or antibody fragment comprising a human or humanized anti-tumor-associated antigen binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain.
- the anti-tumor-associated antigen binding domain is a scFv or a V H domain.
- the anti-tumor-associated antigen binding domain comprises a light chain and a heavy chain of an amino acid sequence provided herein, or a functional fragment thereof, or an amino acid sequence having at least one, two or three modifications but not more than 30, 20 or 10 modifications of an amino acid sequence of a light chain variable region provided herein, or a sequence with 95-99% identity with an amino acid sequence provided herein.
- the isolated TFP molecules comprise a TCR extracellular domain that comprises an extracellular domain or portion thereof of a protein selected from the group consisting of the alpha or beta chain of the T-cell receptor, CD3 delta, CD3 epsilon, or CD3 gamma, or an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications thereto.
- the anti-tumor-associated antigen binding domain is connected to the TCR extracellular domain by a linker sequence.
- the linker sequence comprises a long linker (LL) sequence.
- the linker sequence comprises a short linker (SL) sequence.
- the isolated TFP molecules further comprise a sequence encoding a costimulatory domain. In other embodiments, the isolated TFP molecules further comprise a sequence encoding an intracellular signaling domain. In yet other embodiments, the isolated TFP molecules further comprise a leader sequence.
- vectors that comprise a nucleic acid molecule encoding any of the previously described TFP molecules.
- the vector is selected from the group consisting of a DNA, an RNA, a plasmid, a lentivirus vector, adenoviral vector, or a retrovirus vector.
- the vector further comprises a promoter.
- the vector is an in vitro transcribed vector.
- a nucleic acid sequence in the vector further comprises a poly(A) tail.
- a nucleic acid sequence in the vector further comprises a 3'UTR.
- the cell is a human T-cell.
- the cell is a CD8 + or CD4 + T-cell.
- the CD8 + cell is a gamma-delta T cells.
- the CD8 + cell is an NK-T cell.
- the cells further comprise a nucleic acid encoding an inhibitory molecule that comprises a first polypeptide that comprises at least a portion of an inhibitory molecule, associated with a second polypeptide that comprises a positive signal from an intracellular signaling domain.
- the inhibitory molecule comprises a first polypeptide that comprises at least a portion of PD1 and a second polypeptide comprising a costimulatory domain and primary signaling domain.
- TFP molecules that comprise a human or humanized anti-tumor-associated antigen (TAA) binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular signaling domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide.
- TAA anti-tumor-associated antigen
- TFP molecules that comprise a human or humanized anti-TAA binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular signaling domain, wherein the TFP molecule is capable of functionally integrating into an endogenous TCR complex.
- human CD8 + or CD4 + T cells that comprise one or more TFP molecules, the TFP molecules comprising a human or humanized anti-tumor-associated antigen binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T-cell.
- the cells comprise at least two non-identical TFP molecules.
- protein complexes that comprise i) a TFP molecule comprising a human or humanized anti -tumor-associated antigen binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain; and ii) at least one endogenous TCR complex.
- the TCR comprises an extracellular domain or portion thereof of a protein selected from the group consisting of the alpha or beta chain of the T-cell receptor, CD3 delta, CD3 epsilon, or CD3 gamma.
- the anti-tumor-associated antigen binding domain is connected to the TCR extracellular domain by a linker sequence.
- the linker sequence comprises a long linker (LL) sequence.
- the linker sequence comprises a short linker (SL) sequence.
- human CD8 + or CD4 + T cells that comprise at least two different TFP proteins per any of the described protein complexes.
- a population of human CD8 + or CD4 + T cells wherein the T cells of the population individually or collectively comprise at least two TFP molecules, the TFP molecules comprising a human or humanized anti -tumor-associated antigen binding domain, a TCR extracellular domain, a transmembrane domain, and an intracellular domain, wherein the TFP molecule is capable of functionally interacting with an endogenous TCR complex and/or at least one endogenous TCR polypeptide in, at and/or on the surface of the human CD8 + or CD4 + T-cell.
- a population of human CD8 + or CD4 + T cells wherein the T cells of the population individually or collectively comprise at least two TFP molecules encoded by an isolated nucleic acid molecule provided herein.
- RNA - engineered cells comprising introducing a in vitro transcribed RNA or synthetic RNA into a cell, where the RNA comprises nucleic acid encoding one or more of the described TFP molecules.
- kits for providing an anti-tumor immunity in a mammal that comprise administering to the mammal an effective amount of a cell expressing any of the described TFP molecules.
- the cell is an autologous T-cell.
- the cell is an allogeneic T-cell.
- the mammal is a human.
- kits for treating a mammal having a disease associated with expression of tumor-associated antigen comprising administering to the mammal an effective amount of the cell comprising any of the described TFP molecules.
- the disease associated with tumor-associated antigen expression is selected from a proliferative disease such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia, or is a non-cancer related indication associated with expression of tumor-associated antigen.
- a proliferative disease such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia, or is a non-cancer related indication associated with expression of tumor-associated antigen.
- the disease is a hematologic cancer selected from the group consisting of one or more acute leukemias including but not limited to B-cell acute lymphoid leukemia ("B-ALL”), T-cell acute lymphoid leukemia ("T-ALL”), acute lymphoblastic leukemia (ALL); one or more chronic leukemias including but not limited to chronic myelogenous leukemia (CML), chronic lymphocytic leukemia (CLL); additional hematologic cancers or hematologic conditions including, but not limited to B cell prolymphocytic leukemia, blastic plasmacytoid dendritic cell neoplasm, Burkitt's lymphoma, diffuse large B cell lymphoma, follicular lymphoma, hairy cell leukemia, small cell- or a large cell-follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma, marginal zone lymphoma
- B-ALL B-cell
- preleukemia which are a diverse collection of hematological conditions united by ineffective production (or dysplasia) of myeloid blood cells, and to disease associated with tumor-associated antigen expression include, but not limited to atypical and/or non-classical cancers, malignancies, precancerous conditions or proliferative diseases expressing tumor-associated antigen; and combinations thereof.
- the cells expressing any of the described TFP molecules are administered in combination with an agent that ameliorates one or more side effects associated with administration of a cell expressing a TFP molecule. In some embodiments, the cells expressing any of the described TFP molecules are administered in combination with an agent that treats the disease associated with tumor-associated antigen.
- an element means one element or more than one element.
- “about” can mean plus or minus less than 1 or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, or greater than 30 percent, depending upon the situation and known or knowable by one skilled in the art.
- the term “about” or “approximately” can mean within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e. the limitations of the measurement system.
- “about” can mean within 1 or more than 1 standard deviation, per the practice in the art.
- “about” can mean a range of up to 20%, up to 10%, up to 5%, or up to 1% of a given value.
- the term “about” or “approximately” can mean within an order of magnitude, within 5 - fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term “about” meaning within an acceptable error range for the particular value should be assumed.
- the term “about” can have the meaning as commonly understood by one of ordinary skill in the art.
- the term “about” can refer to ⁇ 10%.
- the term “about” can refer to ⁇ 5%.
- subject or “subjects” or “individuals” may include, but are not limited to, mammals such as humans or non-human mammals, e.g., domesticated, agricultural or wild, animals, as well as birds, and aquatic animals.
- persons are subjects suffering from or at risk of developing a disease, disorder or condition or otherwise in need of the
- compositions and methods provided herein are compositions and methods provided herein.
- treating refers to any indicia of success in the treatment or amelioration of the disease or condition. Treating can include, for example, reducing, delaying or alleviating the severity of one or more symptoms of the disease or condition, or it can include reducing the frequency with which symptoms of a disease, defect, disorder, or adverse condition, and the like, are experienced by a patient.
- treat or prevent is sometimes used herein to refer to a method that results in some level of treatment or amelioration of the disease or condition, and contemplates a range of results directed to that end, including but not restricted to prevention of the condition entirely.
- preventing refers to the prevention of the disease or condition, e.g. , tumor formation, in the patient. For example, if an individual at risk of developing a tumor or other form of cancer is treated with the methods of the present invention and does not later develop the tumor or other form of cancer, then the disease has been prevented, at least over a period of time, in that individual.
- the disease or condition e.g. , tumor formation
- a “therapeutically effective amount” is the amount of a composition or an active component thereof sufficient to provide a beneficial effect or to otherwise reduce a detrimental non-beneficial event to the individual to whom the composition is administered.
- therapeutically effective dose herein is meant a dose that produces one or more desired or desirable ⁇ e.g. , beneficial) effects for which it is administered, such administration occurring one or more times over a given period of time. The exact dose will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (see, e.g. Lieberman, Pharmaceutical Dosage Forms (vols. 1 -3, 1992); Lloyd, The Art, Science and Technology of
- a "T-cell receptor (TCR) fusion protein” or “TFP” includes a recombinant polypeptide derived from the various polypeptides comprising the TCR that is generally capable of i) binding to a surface antigen on target cells and ii) interacting with other polypeptide components of the intact TCR complex, typically when co-located in or on the surface of a T-cell.
- BCMA refers to the B-cell maturation antigen” or “BCMA” or “BCM,” also known as tumor necrosis factor receptor superfamily member 17
- TNFRSF17 and Cluster of Differentiation 269 protein (CD269), or TNFRSF13A
- BCMA is a cell surface receptor of the TNF receptor superfamily which recognizes B-cell activating factor (BAFF).
- BAFF B-cell activating factor
- the receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response.
- This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF- ⁇ and MAPK8/JNK activation. It is a non-glycosylated integral membrane receptor for the ligands BAFF and APRIL.
- BCMA's ligands can also bind additional receptors: TACI (Transmembrane Activator and Calcium modulator and cyclophilin ligand Interactor), which binds APRIL and BAFF; as well as BAFF-R (BAFF Receptor or BR3), which shows restricted but high affinity for BAFF.
- TACI Transmembrane Activator and Calcium modulator and cyclophilin ligand Interactor
- BAFF-R BAFF Receptor or BR3
- BCMA's expression is typically restricted to the B-cell lineage and is reported to increase in terminal B-cell differentiation.
- BCMA is expressed by human plasma blasts, plasma cells from tonsils, spleen and bone marrow, but also by tonsillar memory B cells and by germinal center B cells, which have a TACI-BAFFR low phenotype (Darce et al, 2007).
- BCMA is virtually absent on naive and memory B-cells (Novak et al., 2004a and b).
- the BCMA antigen is expressed on the cell surface so is accessible to the antibody, but is also expressed in the golgi.
- BCMA signaling typically linked with B-cell survival and proliferation, is important in the late stages of B-cell differentiation, as well as the survival of long lived bone marrow plasma cells (O'Connor et al, 2004) and plasmablasts (Avery et al, 2003). Furthermore, as BCMA binds APRIL with high affinity, the BCMA- APRIL signaling axis is suggested to predominate at the later stages of B-cell differentiation, perhaps being the most physiologically relevant interaction.
- the human and murine amino acid and nucleic acid sequences can be found in a public database, such as GenBank, UniProt and Swiss-Prot.
- the amino acid sequence of human BCMA can be found as UniProt/Swiss-Prot Accession No. Q02223.
- the human BCMA polypeptide canonical sequence is UniProt Accession No. Q02223-1 :
- the human CD19 polypeptide canonical sequence is UniProt Accession No. P15391 (or P15391-2:
- RMGTWSTR (SEQ ID NO: 104).
- CD19 is expressed on most B lineage cancers, including, e.g., ALL, CLL and non- Hodgkin's lymphoma (NHL). Other cells that express CD 19 are provided below in the definition of "disease associated with expression of CD19.” It is also an early marker of normal B cell progenitors. See, e.g., Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997).
- the antigen-binding portion of TFPs recognizes and binds an epitope within the extracellular domain of the CD19 protein as expressed on a malignant and normal B cell.
- CD22 refers to B-cell receptor CD22, also known as B- lymphocyte cell adhesion molecule (BL-CAM), Sialic acid-binding Ig-like lectin 2 (Siglec-2), and T-cell surface antigen Leu- 14.
- BL-CAM B- lymphocyte cell adhesion molecule
- Siglec-2 Sialic acid-binding Ig-like lectin 2
- CD22 mediates B-cell-to-B-cell interactions and may be involved in the localization of B-cells in lymphoid tissues. It binds sialylated glycoproteins, one of which is CD45, and preferentially binds to alpha-2,6-linked sialic acid.
- the sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface.
- CD22 plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.
- the CD22 canonical sequence is the beta isoform (one of five isoforms) and can be found at UniProt Accession Number P20273-1, and corresponds to the sequence:
- ROR1 may refer to tyrosine-protein kinase transmembrane receptor ROR1, also known as neurotrophic tyrosine kinase, receptor-related 1 (NTRKRl) or dJ537F10.1. It is a protein that in mice and humans is encoded by the ROR1 gene and is a member of the receptor tyrosine kinase-like orphan receptor (ROR) family along with ROR2.
- ROR1 is a glycosylated type I membrane protein; it is a pseudokinase that lacks catalytic activity and may interact with the non-canonical Wnt signaling pathway.
- RORs contain two distinct extracellular cysteine-rich domains and one transmembrane domain. Within the intracellular portion, RORl possesses a tyrosine kinase domain, two serine/threonine -rich domains and a proline-rich domain. This gene is highly expressed during early embryonic development but expressed at very low levels in normal (i.e., non-cancerous) adult tissues. Increased expression of this gene is associated with B- cell chronic lymphocytic leukemia. Alternative splicing results in multiple transcript variants encoding different isoforms.
- human and murine amino acid and nucleic acid sequences can be found in a public database, such as GenBank, UniProt and Swiss-Prot.
- GenBank GenBank
- UniProt UniProt
- Swiss-Prot Swiss-Prot.
- the human RORl polypeptide canonical sequence is UniProt Accession No. Q01973-1 :
- the nucleotide sequence encoding human RORl transcript variant 1 can be found at Accession No. XM_017001376.
- the nucleotide sequence encoding human RORl transcript variant 2 can be found at Accession No. XM 011541526.
- the nucleotide sequence encoding human RORl transcript variant 3 can be found at Accession No. XM_017001377.
- a low level of RORl expression is seen in adipose tissue and to a lesser degree in the pancreas, lung, and a subset of intermediate B cells.
- NKG2D refers to NKG2-D type II integral membrane protein, NKG2-D, Killer cell lectin-like receptor subfamily K member 1 (KLRK), NK cell receptor D, NKG2-D-activating NK receptor, and CD314.
- KLRK Killer cell lectin-like receptor subfamily K member 1
- NK cell receptor D NKG2-D-activating NK receptor
- CD314 CD314.
- Many immune receptors are composed of separate ligand-binding and signal -transducing subunits.
- NK natural killer
- T cells DAP10 was identified as a cell surface adaptor protein in an activating receptor complex with NKG2D, a receptor for the stress-inducible and tumor-associated major histocompatibility complex molecule MICA.
- an Src homology 2 (SH2) domain -binding site was capable of recruiting the p85 subunit of the phosphatidylinositol 3-kinase (PI 3-kinase), providing for NKG2D-dependent signal transduction.
- PI 3-kinase phosphatidylinositol 3-kinase
- NKG2D is a homo dimer with C-type, lectin-like, type II transmembrane glycoprotein signals through a positively charged arginine in the transmembrane domain which associates with a negatively charged aspartic acid in the transmembrane domain of the adaptor DAP10(Charles L. Sentman, Cancer Immunity (1 May 2013) Vol. 13, p. 8).
- Increase in NKG2D was observed with higher levels of gamma-chain cytokines such as IL-2, IL-7, IL-12, and IL-15 in human NK and CD8 + T cells.
- IL-21, IFN- ⁇ , and TGF- ⁇ have been shown to decrease NKG2D expression.
- NKG2D Ligands include MHC region encoded MICA/B and a second family of MHC class I-related proteins, the ULBPs, also known as retinoic acid early transcripts (RAETs) (Bahram et al, 1994, Proc. Natl. Acad. Sci. USA 91, 6259-6263; Bauer et al, 1999, Science, Jul 30;285(5428):727-9).
- RAETs retinoic acid early transcripts
- ULBP1-6 have been identified as belonging to the ULBP family (Cosman et al, 2001, Immunity Feb;14(2): 123-33). These molecules are 55-60% homologous in their amino-acid sequences, and are equally distantly related to MICs or MHC. Functionally, the ULBPs do not bind P2-microglobulin or present antigenic peptides and lack an a3 domain (Eagle et al, PLoS One 4: 1-14, 2009; Eagle et al., Eur J
- ULBPs are attached to the cell membrane via a GPI-anchor.
- NKG2D ligands are expressed on surface of tumor cells originating from colon, liver, gastric, breasts, ovary and lung. They are also expressed on non-solid tumors including AML, ALL, CML, CLL. An increase in NKG2DL expression correlates to higher relapse rate among breast cancer patients.
- the human and murine amino acid and nucleic acid sequences can be found in a public database, such as GenBank, UniProt and Swiss-Prot.
- GenBank GenBank
- UniProt UniProt
- Swiss-Prot Swiss-Prot.
- the human canonical NKG2D sequence isoform 1 corresponds to UniProt Accession No.
- the fragment used in TFPs comprises the extracellular domain sequence
- CD16 may refer to a 50-80 kDa glycoprotein that is expressed in two different isoforms: Fc gamma receptor Ilia (known as CD16, CD16a, CD16, CD16A, FcG3, FcGR3, FcGRIII, FcR-10, FcRin, FcRIIIA, IGFR3, IMD20) and Fc-gamma receptor Illb (FCGR3B, UniProtKB Q9ULV2).
- Fc gamma receptor Ilia known as CD16, CD16a, CD16, CD16A, FcG3, FcGR3, FcGRIII, FcR-10, FcRin, FcRIIIA, IGFR3, IMD20
- Fc-gamma receptor Illb FCGR3B, UniProtKB Q9ULV2
- the transmembrane form is found on human NK cells, macrophages, and mast cells, while the glycosylphosphatidylinositol (GPI)-
- V158 allele or "V158 variant” is meant a CD16 polypeptide with valine at residue 158.
- CD16 alleles In human populations, there are two naturally occurring CD16 alleles, one with phenylalanine (F) or valine (V) at residue 158.
- the V158 allele has a higher affinity for the Fc region of IgGl antibodies, and thus in one embodiment the TFPs disclosed herein comprises the V158 CD16 polypeptide.
- human and murine amino acid and nucleic acid sequences can be found in a public database, such as GenBank, UniProt and Swiss-Prot.
- GenBank GenBank
- UniProt UniProt
- Swiss-Prot Swiss-Prot.
- human CD 16 isoform A is UniProt Accession No. P08637 and has the sequence:
- the CD16 TFP composition comprises SEQ ID NO:23.
- the CD 16 TFP composition comprises SEQ ID NO: 24, which is a VI 58 variation of the sequence set forth in SEQ ID NO: 23 and has the sequence
- FCRG3A (CD16) encodes a high-affinity
- immunoglobulin Fc receptor is associated with favorable responses to antibody therapy (see, e.g., Kudo et al, Cancer Res; 74(1); 93-103 (2013), herein incorporated by reference).
- the portion of the TFP composition comprising an antibody or antibody fragment thereof may exist in a variety of forms where the antigen binding domain is expressed as part of a contiguous polypeptide chain including, for example, a single domain antibody fragment (sdAb), a single chain antibody (scFv) derived from a murine, humanized or human antibody (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, N.Y.; Harlow et al, 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, N.Y.; Houston et al, 1988, Proc. Natl. Acad. Sci.
- sdAb single domain antibody fragment
- scFv single chain antibody
- the antigen binding domain of a TFP composition comprises an antibody fragment.
- the TFP comprises an antibody fragment that comprises a scFv or a sdAb.
- antigen or "Ag” may refer to a molecule that is capable of being bound specifically by an antibody, or otherwise provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both.
- cancer antigen or “cancer-related antigen” may refer to any cancer cell marker expressed on the surface of a malignant or tumor cell that can be treated with the combination therapy described herein, including, but not limited to: described herein include, but are not limited to, 5T4, 8H9, ⁇ integrin, ⁇ integrin, alphafetoprotein (AFP), B7-H6, CA-125 carbonic anhydrase 9 (CA9), CD 19, CD20, CD22, CD30, CD33, CD38, CD44, CD44v6, CD44v7/8, CD52, CD123, CD171, carcinoembryonic antigen (CEA), EpCAM (epithelial cell adhesion molecule), E-cadherin, EMA (epithelial membrane antigen), EGFRvlll, epithelial glycoprotein -2 (EGP-2), epithelial glycoprotein-40 (EGP-40), ErbBl/EGFR, ErbB2/HER2/neu/EGFR2,
- antibody refers to a protein, or polypeptide sequences derived from an immunoglobulin molecule, which specifically binds to an antigen.
- Antibodies can be intact immunoglobulins of polyclonal or monoclonal origin, or fragments thereof and can be derived from natural or from recombinant sources.
- antibody fragment refers to at least one portion of an antibody, or recombinant variants thereof, that contains the antigen binding domain, i.e., an antigenic determining variable region of an intact antibody, that is sufficient to confer recognition and specific binding of the antibody fragment to a target, such as an antigen and its defined epitope.
- antibody fragments include, but are not limited to, Fab, Fab', F(ab')2, and Fv fragments, single-chain (sc)Fv (“scFv”) antibody fragments, linear antibodies, single domain antibodies (abbreviated "sdAb”) (either V L or V H ), camelid V HH domains, and multi-specific antibodies formed from antibody fragments.
- scFv refers to a fusion protein comprising at least one antibody fragment comprising a variable region of a light chain and at least one antibody fragment comprising a variable region of a heavy chain, wherein the light and heavy chain variable regions are contiguously linked via a short flexible polypeptide linker, and capable of being expressed as a single polypeptide chain, and wherein the scFv retains the specificity of the intact antibody from which it is derived.
- “Heavy chain variable region” or “V H " (or, in the case of single domain antibodies, e.g., nanobodies, "V HH ”) with regard to an antibody refers to the fragment of the heavy chain that contains three CDRs interposed between flanking stretches known as framework regions, these framework regions are generally more highly conserved than the CDRs and form a scaffold to support the CDRs.
- an scFv may have the V L and V H regions in either order, e.g., with respect to the N-terminal and C-terminal ends of the polypeptide, the scFv may comprise V L -linker-V H or may comprise V H -linker-V L .
- the portion of the TFP composition of the invention comprising an antibody or antibody fragment thereof may exist in a variety of forms where the antigen binding domain is expressed as part of a contiguous polypeptide chain including, for example, a single domain antibody fragment (sdAb) or heavy chain antibodies HCAb 242:423-426).
- the antigen binding domain of a TFP composition of the invention comprises an antibody fragment.
- the TFP comprises an antibody fragment that comprises a scFv or a sdAb.
- antibody heavy chain refers to the larger of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations, and which normally determines the class to which the antibody belongs.
- antibody light chain refers to the smaller of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations. Kappa (“ ⁇ ”) and lambda (“ ⁇ ”) light chains refer to the two major antibody light chain isotypes.
- recombinant antibody refers to an antibody that is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage or yeast expression system.
- the term should also be construed to mean an antibody which has been generated by the synthesis of a DNA molecule encoding the antibody and which DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, wherein the DNA or amino acid sequence has been obtained using recombinant DNA or amino acid sequence technology which is available and well known in the art.
- antigen or “Ag” refers to a molecule that is capable of being bound specifically by an antibody, or otherwise provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both.
- antigens can be derived from recombinant or genomic DNA.
- any DNA which comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an "antigen" as that term is used herein.
- an antigen need not be encoded solely by a full-length nucleotide sequence of a gene.
- the present invention includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to encode polypeptides that elicit the desired immune response.
- an antigen need not be encoded by a "gene” at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample, or might be macromolecule besides a polypeptide.
- a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a fluid with other biological components.
- anti-tumor effect refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of tumor cells, a decrease in the number of metastases, an increase in life expectancy, decrease in tumor cell proliferation, decrease in tumor cell survival, or amelioration of various physiological symptoms associated with the cancerous condition.
- An "anti-tumor effect” can also be manifested by the ability of the peptides, polynucleotides, cells and antibodies of the invention in prevention of the occurrence of tumor in the first place.
- autologous refers to any material derived from the same individual to whom it is later to be re-introduced into the individual.
- allogeneic refers to any material derived from a different animal of the same species or different patient as the individual to whom the material is introduced. Two or more individuals are said to be allogeneic to one another when the genes at one or more loci are not identical. In some aspects, allogeneic material from individuals of the same species may be sufficiently unlike genetically to interact antigenically.
- xenogeneic refers to a graft derived from an animal of a different species.
- cancer may refer to a disease characterized by the rapid and uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers are described herein and include, but are not limited to, prostate cancer, breast cancer, melanoma, sarcoma, colorectal cancer, pancreatic cancer, uterine cancer, ovarian cancer, stomach cancer, gastric cancer, small cell lung cancer, non-small cell lung cancer, bladder cancer, cholangiocarcinoma, squamous cell lung cancer, mesothelioma, adrenocortico carcinoma, esophageal cancer, head & neck cancer, liver cancer, nasopharyngeal carcinoma, neuroepithelial cancer, adenoid cystic carcinoma, thymoma, chronic lymphocytic leukemia, glioma, glioblastoma multiforme, neuroblastoma, papillary
- conservative sequence modifications refers to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody or antibody fragment containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody or antibody fragment of the invention by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
- beta-branched side chains e.g., threonine, valine, isoleucine
- aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine.
- one or more amino acid residues within a TFP of the invention can be replaced with other amino acid residues from the same side chain family and the altered TFP can be tested using the functional assays described herein.
- stimulation refers to a primary response induced by binding of a stimulatory domain or stimulatory molecule (e.g., a TCR/CD3 complex) with its cognate ligand thereby mediating a signal transduction event, such as, but not limited to, signal transduction via the TCR/CD3 complex.
- a stimulatory domain or stimulatory molecule e.g., a TCR/CD3 complex
- signal transduction event such as, but not limited to, signal transduction via the TCR/CD3 complex.
- Stimulation can mediate altered expression of certain molecules, and/or reorganization of cytoskeletal structures, and the like.
- the term "stimulatory molecule” or “stimulatory domain” refers to a molecule or portion thereof expressed by a T-cell that provides the primary cytoplasmic signaling sequence(s) that regulate primary activation of the TCR complex in a stimulatory way for at least some aspect of the T-cell signaling pathway.
- the primary signal is initiated by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, and which leads to mediation of a T-cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
- a primary cytoplasmic signaling sequence (also referred to as a "primary signaling domain") that acts in a stimulatory manner may contain a signaling motif which is known as immunoreceptor tyrosine- based activation motif or "IT AM".
- IT AM immunoreceptor tyrosine- based activation motif
- the term "antigen presenting cell” or “APC” refers to an immune system cell such as an accessory cell (e.g., a B-cell, a dendritic cell, and the like) that displays a foreign antigen complexed with major histocompatibility complexes (MHC's) on its surface.
- T cells may recognize these complexes using their T-cell receptors (TCRs).
- TCRs T-cell receptors
- intracellular signaling domain refers to an intracellular portion of a molecule.
- the intracellular signaling domain generates a signal that promotes an immune effector function of the TFP containing cell, e.g., a TFP-expressing T-cell.
- immune effector function e.g., in a TFP-expressing T-cell
- the intracellular signaling domain can comprise a primary intracellular signaling domain.
- Exemplary primary intracellular signaling domains include those derived from the molecules responsible for primary stimulation, or antigen dependent simulation.
- the intracellular signaling domain can comprise a costimulatory intracellular domain.
- Exemplary costimulatory intracellular signaling domains include those derived from molecules responsible for costimulatory signals, or antigen independent stimulation.
- a primary intracellular signaling domain can comprise an ITAM ("immunoreceptor tyrosine-based activation motif).
- ITAM containing primary cytoplasmic signaling sequences include, but are not limited to, those derived from CD3 zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d DAP10 and DAP12.
- costimulatory molecule refers to the cognate binding partner on a T-cell that specifically binds with a costimulatory ligand, thereby mediating a costimulatory response by the T- cell, such as, but not limited to, proliferation.
- Costimulatory molecules are cell surface molecules other than antigen receptors or their ligands that are required for an efficient immune response.
- Costimulatory molecules include, but are not limited to an MHC class 1 molecule, BTLA and a Toll ligand receptor, as well as OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CDl la/CD18) and 4- 1BB (CD137).
- a costimulatory intracellular signaling domain can be the intracellular portion of a costimulatory molecule.
- a costimulatory molecule can be represented in the following protein families: TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), and activating NK cell receptors.
- Examples of such molecules include CD27, CD28, 4-1BB (CD137), OX40, GITR, CD30, CD40, ICOS, BAFFR, HVEM, lymphocyte function-associated antigen- 1 (LFA-1), CD2, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD 160, B7-H3, and a ligand that specifically binds with CD83, and the like.
- the intracellular signaling domain can comprise the entire intracellular portion, or the entire native intracellular signaling domain, of the molecule from which it is derived, or a functional fragment thereof.
- 4- IBB refers to a member of the TNFR superfamily with an amino acid sequence provided as GenBank Acc. No.
- AAA62478.2 or the equivalent residues from a non- human species, e.g., mouse, rodent, monkey, ape and the like; and a "4-1BB costimulatory domain" is defined as amino acid residues 214-255 of GenBank Acc. No. AAA62478.2, or equivalent residues from non-human species, e.g., mouse, rodent, monkey, ape and the like.
- the term "encoding" refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides ⁇ e.g., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
- a gene, cDNA, or RNA encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
- Both the coding strand the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
- nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
- the phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain one or more introns.
- an effective amount or “therapeutically effective amount” are used interchangeably herein, and refer to an amount of a compound, formulation, material, or composition, as described herein effective to achieve a particular biological or therapeutic result.
- endogenous refers to any material from or produced inside an organism, cell, tissue or system.
- exogenous refers to any material introduced from or produced outside an organism, cell, tissue or system.
- expression refers to the transcription and/or translation of a particular nucleotide sequence driven by a promoter.
- transfer vector refers to a composition of matter which comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell.
- transfer vector includes an autonomously replicating plasmid or a virus.
- the term should also be construed to further include non-plasmid and non-viral compounds which facilitate transfer of nucleic acid into cells, such as, for example, a polylysine compound, liposome, and the like.
- viral transfer vectors include, but are not limited to, adenoviral vectors, adeno- associated virus vectors, retroviral vectors, lentiviral vectors, and the like.
- expression vector refers to a vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed.
- An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system.
- Expression vectors include all those known in the art, including cosmids, plasmids ⁇ e.g. , naked or contained in liposomes) and viruses ⁇ e.g. , lentiviruses, retroviruses, adenoviruses, and adeno- associated viruses) that incorporate the recombinant polynucleotide.
- lenti virus refers to a genus of the Retro viridae family. Lentiviruses are unique among the retroviruses in being able to infect non-dividing cells; they can deliver a significant amount of genetic information into the DNA of the host cell, so they are one of the most efficient methods of a gene delivery vector. HTV, SIV, and FIV are all examples of lentiviruses.
- lentiviral vector refers to a vector derived from at least a portion of a lentivirus genome, including especially a self-inactivating lentiviral vector as provided in Milone et al., Mol. Ther. 17(8): 1453-1464 (2009).
- Other examples of lentivirus vectors that may be used in the clinic include, but are not limited to, e.g. , the LENTIVECTORTM gene delivery technology from Oxford BioMedica, the LENTEVIAXTM vector system from Lentigen, and the like. Nonclinical types of lentiviral vectors are also available and would be known to one skilled in the art.
- homologous refers to the subunit sequence identity between two polymeric molecules, e.g. , between two nucleic acid molecules, such as, two DNA molecules or two RNA molecules, or between two polypeptide molecules.
- nucleic acid molecules such as, two DNA molecules or two RNA molecules
- polypeptide molecules e.g., two amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids,
- positions in two sequences are homologous, the two sequences are 50% homologous; if 90% of the positions ⁇ e.g. , 9 of 10), are matched or homologous, the two sequences are 90% homologous.
- Humanized forms of non-human ⁇ e.g. , murine antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human
- humanized antibodies and antibody fragments thereof are human immunoglobulins (recipient antibody or antibody fragment) in which residues from a
- CDR complementary-determining region
- donor antibody such as mouse, rat or rabbit having the desired specificity, affinity, and capacity.
- Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
- a humanized antibody/antibody fragment can comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. These modifications can further refine and optimize antibody or antibody fragment performance.
- the humanized antibody or antibody fragment thereof will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or a significant portion of the FR regions are those of a human
- the humanized antibody or antibody fragment can also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- Human or “fully human” refers to an immunoglobulin, such as an antibody or antibody fragment, where the whole molecule is of human origin or consists of an amino acid sequence identical to a human form of the antibody or immunoglobulin.
- isolated means altered or removed from the natural state.
- a nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is
- isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
- A refers to adenosine
- C refers to cytosine
- G refers to guanosine
- T refers to thymidine
- U refers to uridine.
- operably linked refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter.
- a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
- a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
- Operably linked DNA sequences can be contiguous with each other and, e.g., where necessary to join two protein coding regions, are in the same reading frame.
- parenteral administration of an immunogenic composition includes, e.g. , subcutaneous (s.c), intravenous (i.v.), intramuscular (i.m.), or intrasternal injection, intratumoral, or infusion techniques.
- nucleic acid refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated.
- DNA deoxyribonucleic acids
- RNA ribonucleic acids
- degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al, Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolim et al., Mol. Cell. Probes 8:91 -98 (1994)).
- peptide refers to a compound comprised of amino acid residues covalently linked by peptide bonds.
- a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence.
- Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds.
- the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types.
- Polypeptides include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others.
- a polypeptide includes a natural peptide, a recombinant peptide, or a combination thereof.
- promoter refers to a DNA sequence recognized by the transcription machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence.
- promoter/regulatory sequence refers to a nucleic acid sequence which is required for expression of a gene product operably linked to the promoter/regulatory sequence. In some instances, this sequence may be the core promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory elements which are required for expression of the gene product.
- the promoter/regulatory sequence may, for example, be one which expresses the gene product in a tissue specific manner.
- constitutive promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell under most or all physiological conditions of the cell.
- inducible promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell substantially only when an inducer which corresponds to the promoter is present in the cell.
- tissue-specific promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide encodes or specified by a gene, causes the gene product to be produced in a cell substantially only if the cell is a cell of the tissue type corresponding to the promoter.
- linker and "flexible polypeptide linker” as used in the context of a scFv refers to a peptide linker that consists of amino acids such as glycine and/or serine residues used alone or in combination, to link variable heavy and variable light chain regions together.
- the flexible polypeptide linkers include, but are not limited to, (Gly 4 Ser) 4 or (Gly 4 Ser) 3 .
- the linkers include multiple repeats of (Gly 2 Ser), (GlySer) or (Gly 3 Ser).
- Also included within the scope of the invention are linkers described in WO2012/138475 (incorporated herein by reference).
- the linker sequence comprises a long linker (LL) sequence.
- the linker sequence comprises a short linker (SL) sequence.
- a 5' cap (also termed an RNA cap, an RNA 7-methylguanosine cap or an RNA m7G cap) is a modified guanine nucleotide that has been added to the "front" or 5 ' end of a eukaryotic messenger RNA shortly after the start of transcription.
- the 5 ' cap consists of a terminal group which is linked to the first transcribed nucleotide. Its presence is critical for recognition by the ribosome and protection from RNases. Cap addition is coupled to transcription, and occurs co- transcriptionally, such that each influences the other.
- RNA polymerase Shortly after the start of transcription, the 5 ' end of the mRNA being synthesized is bound by a cap-synthesizing complex associated with RNA polymerase. This enzymatic complex catalyzes the chemical reactions that are required for mRNA capping. Synthesis proceeds as a multi-step biochemical reaction.
- the capping moiety can be modified to modulate functionality of mRNA such as its stability or efficiency of translation.
- in vitro transcribed RNA refers to RNA, preferably mRNA, which has been synthesized in vitro.
- the in vitro transcribed RNA is generated from an in vitro transcription vector.
- the in vitro transcription vector comprises a template that is used to generate the in vitro transcribed RNA.
- a "poly(A)” is a series of adenosines attached by polyadenylation to the mRNA.
- the polyA is between 50 and 5000, preferably greater than 64, more preferably greater than 100, most preferably greater than 300 or 400.
- Poly(A) sequences can be modified chemically or enzymatically to modulate mRNA functionality such as localization, stability or efficiency of translation.
- polyadenylation refers to the covalent linkage of a polyadenylyl moiety, or its modified variant, to a messenger RNA molecule.
- mRNA messenger RNA
- the 3' poly(A) tail is a long sequence of adenine nucleotides (often several hundred) added to the pre-mRNA through the action of an enzyme, polyadenylate polymerase.
- poly(A) tail is added onto transcripts that contain a specific sequence, the polyadenylation signal.
- Polyadenylation is also important for transcription termination, export of the mRNA from the nucleus, and translation. Polyadenylation occurs in the nucleus immediately after transcription of DNA into RNA, but additionally can also occur later in the cytoplasm.
- the mRNA chain is cleaved through the action of an endonuclease complex associated with RNA polymerase.
- the cleavage site is usually characterized by the presence of the base sequence AAUAAA near the cleavage site.
- adenosine residues are added to the free 3 ' end at the cleavage site.
- transient refers to expression of a non-integrated transgene for a period of hours, days or weeks, wherein the period of time of expression is less than the period of time for expression of the gene if integrated into the genome or contained within a stable plasmid replicon in the host cell.
- signal transduction pathway refers to the biochemical relationship between a variety of signal transduction molecules that play a role in the transmission of a signal from one portion of a cell to another portion of a cell.
- cell surface receptor includes molecules and complexes of molecules capable of receiving a signal and transmitting signal across the membrane of a cell.
- subject is intended to include living organisms in which an immune response can be elicited (e.g., mammals, human).
- substantially purified cell refers to a cell that is essentially free of other cell types.
- a substantially purified cell also refers to a cell which has been separated from other cell types with which it is normally associated in its naturally occurring state.
- a population of substantially purified cells refers to a homogenous population of cells. In other instances, this term refers simply to cell that have been separated from the cells with which they are naturally associated in their natural state.
- the cells are cultured in vitro. In other aspects, the cells are not cultured in vitro.
- terapéutica means a treatment.
- a therapeutic effect is obtained by reduction, suppression, remission, or eradication of a disease state.
- prophylaxis means the prevention of or protective treatment for a disease or disease state.
- tumor antigen or “hyperproliferative disorder antigen” or “antigen associated with a hyperproliferative disorder” refers to antigens that are common to specific hyperproliferative disorders.
- the hyperproliferative disorder antigens of the present invention are derived from, cancers including but not limited to primary or metastatic melanoma, thymoma, lymphoma, sarcoma, lung cancer, liver cancer, NHL, leukemias, uterine cancer, cervical cancer, bladder cancer, kidney cancer and adenocarcinomas such as breast cancer, prostate cancer, ovarian cancer, pancreatic cancer, and the like.
- transfected or transformed or transformed refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
- transfected or transformed or transformed refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
- transformed or transduced cell is one which has been transfected, transformed or transduced with exogenous nucleic acid.
- the cell includes the primary subject cell and its progeny.
- the term "specifically binds,” refers to an antibody, an antibody fragment or a specific ligand, which recognizes and binds a cognate binding partner (e.g., BCMA, NKG2D, ROR1, etc.) present in a sample, but which does not necessarily and substantially recognize or bind other molecules in the sample.
- a cognate binding partner e.g., BCMA, NKG2D, ROR1, etc.
- binding ligand may generally refer to a polypeptide (e.g., a protein), a polynucleotide (e.g., DNA, RNA, or a hybrid of DNA and RNA), a molecule, a chemical compound, a fragment thereof, and/or a hybrid thereof.
- the binding ligand can comprise a polynucleotide, and the polynucleotide can be single stranded, double stranded, or a combination thereof.
- a binding ligand can comprise a biological molecule or a non- biological molecule.
- a biological molecule or non-biological molecule can be a naturally occurring molecule or an artificial molecule.
- a binding ligand include a protein, a carbohydrate, a lipid, or a nucleic acid.
- the binding ligand may associate, bind, and/or couple with an antibody or fragment thereof (e.g., an IgA isotype antibody, an IgD isotype antibody, an IgE isotype antibody, an IgG isotype antibody, an IgM isotype antibody, an IgW isotype antibody, an IgY isotype antibody).
- the antibody or fragment thereof may be an Fc domain of the antibody (e.g., the binding ligand is an Fc receptor).
- the binding ligand can specifically bind to an IgGl antibody.
- the binding ligand may be capable of associating, capable of binding, and/or capable of coupling with an antibody or fragment thereof.
- the binding ligand may comprise a CD16 polypeptide, or a fragment thereof.
- the binding ligand may comprise a CD16 polynucleotide, or a fragment thereof.
- the binding ligand can comprise a CD16 polypeptide, and the CD16 polypeptide comprises at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95% sequence homology the native CD16 polypeptide sequence. In some embodiments, the binding ligand can comprise a CD16 polypeptide, and the CD 16 polypeptide comprises at most about 99%, 95%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, or 10%, sequence homology the native CD 16 polypeptide sequence.
- the binding ligand can comprise a CD16 polynucleotide, and the CD16 polynucleotide comprises at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 95% sequence homology the native CD16 polynucleotide sequence.
- the binding ligand can comprise a CD16 polynucleotide, and the CD16 polynucleotide comprises at most about 99%, 95%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, or 10%, sequence homology the native CD16 polynucleotide sequence.
- the binding ligand can comprise multiple subunits.
- a binding ligand can comprise multiple subunits, and the subunits can be the same. In some embodiments, a binding ligand can comprise multiple different subunits. In some embodiments, a binding ligand can comprise multiple subunits, and at least two of the subunits can be different. In some embodiments, a binding ligand can comprise a dimer, trimer, tetramer, pentamer, hexamer, heptamer, nonamer, or decamer. In some embodiments, a binding ligand can comprise greater than about ten subunits. In some embodiments, a binding ligand can comprise a polymer. In some embodiments, the binding ligand may be non -human (e.g., primate), human, or humanized.
- the binding ligand may be non -human (e.g., primate), human, or humanized.
- Ranges throughout this disclosure, various aspects of the invention can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6.
- a range such as 95-99% identity includes something with 95%, 96%, 97%, 98% or 99% identity, and includes subranges such as 96-99%, 96-98%, 96-97%, 97-99%, 97-98% and 98-99% identity. This applies regardless of the breadth of the range.
- TCR T-cell receptor
- TFP T-cell receptor fusion proteins
- the present invention encompasses recombinant DNA constructs encoding TFPs, wherein the TFP in one aspect comprises an antibody fragment that binds specifically to one or more tumor associated antigens ("TAA"), e.g., a human TAA, wherein the sequence of the antibody fragment is contiguous with and in the same reading frame as a nucleic acid sequence encoding a TCR subunit or portion thereof.
- TAA tumor associated antigens
- the TFPs provided herein are able to associate with one or more endogenous (or alternatively, one or more exogenous, or a combination of endogenous and exogenous) TCR subunits in order to form a functional TCR complex.
- the TFP comprises a CD 16 fragment that binds specifically to the Tc region of an IgGl or IgG4 antibody.
- the TFP of the invention comprises a target-specific binding element otherwise referred to as an antigen binding domain.
- the choice of moiety depends upon the type and number of target antigen that define the surface of a target cell.
- the antigen binding domain may be chosen to recognize a target antigen that acts as a cell surface marker on target cells associated with a particular disease state.
- examples of cell surface markers that may act as target antigens for the antigen binding domain in a TFP of the invention include those associated with viral, bacterial and parasitic infections; autoimmune diseases; and cancerous diseases (e.g., malignant diseases).
- the TFP-mediated T-cell response can be directed to an antigen of interest by way of engineering an antigen-binding domain into the TFP that specifically binds a desired antigen.
- the portion of the TFP comprising the antigen binding domain comprises an antigen binding domain that targets BCMA.
- the antigen binding domain targets human ROR1.
- the antigen binding domain targets human NKG2D.
- the TFP comprises a CD 16 polypeptide as the antigen binding domain, and the target is an anti-TAA antibody that is in turn targeted to a TAA.
- TFP comprises a CD 16 moiety, e.g., a human CD 16 moiety, wherein the sequence of the CD 16 protein or fragment thereof is contiguous with and in the same reading frame as a nucleic acid sequence encoding a TCR subunit or portion thereof.
- the TFPs provided herein are able to associate with one or more endogenous (or alternatively, one or more exogenous, or a combination of endogenous and exogenous) TCR subunits in order to form a functional TCR complex.
- the CD 16 TFP comprises a target-specific binding element otherwise referred to as an Fey receptor.
- the CD16 TFP may be chosen to work with approved anti-cancer monoclonal (IgG) antibodies, thus combining the specificity of the antibody with immune cells that mediate antibody- triggered effector functions.
- the Fc domain acts as a bridge between the specificity dictated by the Fab region and the CD 16 TFP.
- the CD 16 TFP may be combined with the standard of care anti-CD20 antibody rituximab.
- CD20 is primarily found on the surface of immune system B cells.
- Rituximab destroys B cells and is therefore used to treat diseases which are characterized by overactive, dysfunctional, or excessive numbers of B cells. This can include many lymphomas, leukemias, transplant rejection, and autoimmune disorders.
- examples of cell surface markers that may act as target antigens for the antibody combined with a TFP include those associated with viral, bacterial and parasitic infections; autoimmune diseases; and cancerous diseases (e.g. , malignant diseases).
- the CD 16 moiety may be attached to the TFP via a linker.
- the linker sequence comprises sets of glycine and serine repeats such as (Gly 4 Ser) n , where n is a positive integer equal to or greater than 1.
- the linker can be (Gly 4 Ser) 4 or (Gly 4 Ser) 3 .
- the linker sequence comprises a long linker (LL) sequence.
- the linker sequence comprises a short linker (SL) sequence.
- the antigen binding domain can be any domain that binds to the antigen including but not limited to a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody, and a functional fragment thereof, including but not limited to a single- domain antibody such as a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain (V H H) of a camelid derived nanobody, and to an alternative scaffold known in the art to function as antigen binding domain, such as a recombinant fibronectin domain, anticalin, DARPIN and the like.
- VH heavy chain variable domain
- VL light chain variable domain
- V H H variable domain of a camelid derived nanobody
- a natural or synthetic ligand specifically recognizing and binding the target antigen can be used as antigen binding domain for the TFP.
- the antigen -binding domain comprises a humanized or human antibody or an antibody fragment, or a murine antibody or antibody fragment.
- the humanized or human anti-TAA binding domain comprises one or more (e.g., all three) light chain complementary determining region 1 (LC CDRl), light chain complementary determining region 2 (LC CDR2), and light chain complementary determining region 3 (LC CDR3) of a humanized or human anti-TAA binding domain described herein, and/or one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDRl), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary determining region 3 (HC CDR3) of a humanized or human anti-TAA binding domain described herein, e.g., a humanized or human anti-TAA binding domain comprising one or more, e.g., all three, LC CDRs and one or more, e.g., all three, HC CDRs.
- the humanized or human anti-TAA binding domain comprises one or more (e.g., all three) heavy chain complementary determining region 1 (HC CDRl), heavy chain complementary determining region 2 (HC CDR2), and heavy chain complementary determining region 3 (HC CDR3) of a humanized or human anti-TAA binding domain described herein, e.g., the humanized or human anti-tumor-associated antigen binding domain has two variable heavy chain regions, each comprising a HC CDRl, a HC CDR2 and a HC CDR3 described herein.
- HC CDRl heavy chain complementary determining region 1
- HC CDR2 heavy chain complementary determining region 2
- HC CDR3 heavy chain complementary determining region 3
- the humanized or human anti-tumor-associated antigen binding domain comprises a humanized or human light chain variable region described herein and/or a humanized or human heavy chain variable region described herein.
- the humanized or human anti- tumor-associated antigen binding domain comprises a humanized heavy chain variable region described herein, e.g., at least two humanized or human heavy chain variable regions described herein.
- the anti-tumor-associated antigen binding domain is a scFv comprising a light chain and a heavy chain of an amino acid sequence provided herein.
- the anti-tumor-associated antigen binding domain (e.g., an scFv or VHH nb ) comprises: a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions) of an amino acid sequence of a light chain variable region provided herein, or a sequence with 95-99% identity with an amino acid sequence provided herein; and/or a heavy chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions) of an amino acid sequence of a heavy chain variable region provided herein, or a sequence with 95-99% identity to an amino acid sequence provided herein.
- a light chain variable region comprising an amino acid sequence having at least one, two or three modifications (e.g., substitutions) but not more than 30, 20 or 10 modifications (e.g., substitutions) of an amino
- the humanized or human anti-tumor-associated antigen binding domain is a scFv, and a light chain variable region comprising an amino acid sequence described herein, is attached to a heavy chain variable region comprising an amino acid sequence described herein, via a linker, e.g., a linker described herein.
- the humanized anti-tumor- associated antigen binding domain includes a (Gly 4 -Ser) n linker, wherein n is 1, 2, 3, 4, 5, or 6, preferably 3 or 4.
- the light chain variable region and heavy chain variable region of a scFv can be, e.g., in any of the following orientations: light chain variable region-linker-heavy chain variable region or heavy chain variable region-linker-light chain variable region.
- the linker sequence comprises a long linker (LL) sequence.
- the linker sequence comprises a short linker (SL) sequence.
- a non-human antibody is humanized, where specific sequences or regions of the antibody are modified to increase similarity to an antibody naturally produced in a human or fragment thereof.
- the antigen binding domain is humanized.
- a humanized antibody can be produced using a variety of techniques known in the art, including but not limited to, CDR-grafting (see, e.g., European Patent No. EP 239,400; International Publication No. WO 91/09967; and U.S. Pat. Nos. 5,225,539, 5,530,101, and 5,585,089, each of which is incorporated herein in its entirety by reference), veneering or resurfacing (see, e.g., European Patent Nos. EP 592,106 and EP 519,596; Padlan, 1991, Molecular Immunology,
- framework residues in the framework regions will be substituted with the corresponding residue from the CDR donor antibody to alter, for example improve, antigen binding.
- framework substitutions are identified by methods well-known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions (see, e.g., Queen et al, U.S. Pat. No. 5,585,089; and Riechmann et al, 1988, Nature, 332:323, which are incorporated herein by reference in their entireties.)
- a humanized antibody or antibody fragment has one or more amino acid residues remaining in it from a source which is nonhuman. These nonhuman amino acid residues are often referred to as "import” residues, which are typically taken from an "import” variable domain.
- humanized antibodies or antibody fragments comprise one or more CDRs from nonhuman immunoglobulin molecules and framework regions wherein the amino acid residues comprising the framework are derived completely or mostly from human germline.
- variable domains both light and heavy
- the choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is to reduce antigenicity.
- sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences.
- the human sequence which is closest to that of the rodent is then accepted as the human framework (FR) for the humanized antibody (Sims et al, J. Immunol, 151 :2296 (1993); Chothia et al, J. Mol. Biol, 196:901 (1987), the contents of which are
- Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains.
- the same framework may be used for several different humanized antibodies (see, e.g., Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997); Carter et al, Proc. Natl. Acad. Sci. USA, 89:4285 (1992); Presta et al., J. Immunol, 151 :2623 (1993), the contents of which are incorporated herein by reference herein in their entirety).
- the framework region, e.g., all four framework regions, of the heavy chain variable region are derived from a V H 4- 4-59 germline sequence.
- the framework region can comprise, one, two, three, four or five modifications, e.g., substitutions, e.g., from the amino acid at the corresponding murine sequence.
- the framework region, e.g., all four framework regions of the light chain variable region are derived from a VK3-1.25 germline sequence.
- the framework region can comprise, one, two, three, four or five modifications, e.g., substitutions, e.g., from the amino acid at the corresponding murine sequence.
- the portion of a TFP composition of the invention that comprises an antibody fragment is humanized with retention of high affinity for the target antigen and other favorable biological properties.
- humanized antibodies and antibody fragments are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three- dimensional conformational structures of selected candidate immunoglobulin sequences.
- Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, e.g., the analysis of residues that influence the ability of the candidate immunoglobulin to bind the target antigen.
- FR residues can be selected and combined from the recipient and import sequences so that the desired antibody or antibody fragment characteristic, such as increased affinity for the target antigen, is achieved.
- the CDR residues are directly and most substantially involved in influencing antigen binding.
- the anti-tumor-associated antigen binding domain is a fragment, e.g. , a single chain variable fragment (scFv) or a camelid heavy chain (V H H).
- the anti-tumor- associated antigen binding domain is a Fv, a Fab, a (Fab') 2 , or a bi-functional ⁇ e.g. bi-specific) hybrid antibody ⁇ e.g., Lanzavecchia et al., Eur. J. Immunol. 17, 105 (1987)).
- the antibodies and fragments thereof of the invention binds a tumor-associated antigen protein with wild-type or enhanced affinity.
- a target antigen of interest e.g., BCMA, NKG2D, ROR1, or a TAA target of the combination
- VH domains and scFvs can be prepared according to method known in the art (see, for example, Bird et al, (1988) Science 242:423-426 and Huston et al, (1988) Proc. Natl. Acad. Sci. USA 85: 5879-5883).
- scFv molecules can be produced by linking VH and VL regions together using flexible polypeptide linkers.
- the scFv molecules comprise a linker (e.g., a Ser-Gly linker) with an optimized length and/or amino acid composition. The linker length can greatly affect how the variable regions of a scFv fold and interact.
- the linker sequence comprises a long linker (LL) sequence.
- the linker sequence comprises a short linker (SL) sequence.
- a scFv can comprise a linker of about 10, 11, 12, 13, 14, 15 or greater than 15 residues between its V L and V H regions.
- the linker sequence may comprise any naturally occurring amino acid.
- the linker sequence comprises amino acids glycine and serine.
- the linker sequence comprises sets of glycine and serine repeats such as (Gly 4 Ser) n , where n is a positive integer equal to or greater than 1.
- the linker can be (Gly 4 Ser) 4 or (Gly 4 Ser) 3 . Variation in the linker length may retain or enhance activity, giving rise to superior efficacy in activity studies.
- the linker sequence comprises a long linker (LL) sequence.
- the linker sequence comprises a short linker (SL) sequence.
- an anti -tumor-associated antigen binding domain e.g., scFv molecules (e.g. , soluble scFv)
- scFv molecules e.g. , soluble scFv
- biophysical properties e.g., thermal stability
- the humanized or human scFv has a thermal stability that is greater than about 0.1, about 0.25, about 0.5, about 0.75, about 1, about 1.25, about 1.5, about 1.75, about 2, about 2.5, about 3, about 3.5, about 4, about 4.5, about 5, about 5.5, about 6, about 6.5, about 7, about 7.5, about 8, about 8.5, about 9, about 9.5, about 10 degrees, about 11 degrees, about 12 degrees, about 13 degrees, about 14 degrees, or about 15 degrees Celsius than a parent scFv in the described assays.
- the improved thermal stability of the anti -tumor-associated antigen binding domain e.g. , scFv is subsequently conferred to the entire tumor-associated antigen-TFP construct, leading to improved therapeutic properties of the anti-tumor-associated antigen TFP construct.
- the thermal stability of the anti -tumor-associated antigen binding domain, e.g. , scFv can be improved by at least about 2 °C or 3 °C as compared to a conventional antibody.
- the anti-tumor- associated antigen binding domain, e.g. , scFv has a 1 °C improved thermal stability as compared to a conventional antibody.
- the anti-tumor-associated antigen binding domain e.g. , scFv has a 2 °C improved thermal stability as compared to a conventional antibody.
- the scFv has a 4 °C, 5 °C, 6 °C, 7 °C, 8 °C, 9 °C, 10 °C, 11 °C, 12 °C, 13 °C, 14 °C, or 15 °C improved thermal stability as compared to a conventional antibody. Comparisons can be made, for example, between the scFv molecules disclosed herein and scFv molecules or Fab fragments of an antibody from which the scFv VH and VL were derived.
- Thermal stability can be measured using methods known in the art. For example, in one embodiment, T M can be measured. Methods for measuring T M and other methods of determining protein stability are described below.
- the anti -tumor-associated antigen binding domain e.g. , a scFv
- the anti-tumor-associated antigen binding domain comprises at least one mutation arising from the humanization process such that the mutated scFv confers improved stability to the anti-tumor-associated antigen TFP construct.
- the anti-tumor- associated antigen binding domain e.g. , scFv comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 mutations arising from the humanization process such that the mutated scFv confers improved stability to the tumor-associated antigen-TFP construct.
- the antigen binding domain of the TFP comprises an amino acid sequence that is homologous to an antigen binding domain amino acid sequence described herein, and the antigen binding domain retains the desired functional properties of the anti-tumor-associated antigen antibody fragments described herein.
- the TFP composition of the invention comprises an antibody fragment.
- that antibody fragment comprises a scFv.
- the antigen binding domain of the TFP is engineered by modifying one or more amino acids within one or both variable regions ⁇ e.g. , VH and/or VL), for example within one or more CDR regions and/or within one or more framework regions.
- the TFP composition of the invention comprises an antibody fragment.
- that antibody fragment comprises a scFv.
- the antibody or antibody fragment of the invention may further be modified such that they vary in amino acid sequence (e.g., from wild-type), but not in desired activity.
- additional nucleotide substitutions leading to amino acid substitutions at "non-essential" amino acid residues may be made to the protein.
- a nonessential amino acid residue in a molecule may be replaced with another amino acid residue from the same side chain family.
- a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members, e.g., a conservative substitution, in which an amino acid residue is replaced with an amino acid residue having a similar side chain, may be made.
- Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid
- Percent identity in the context of two or more nucleic acids or polypeptide sequences refers to two or more sequences that are the same. Two sequences are "substantially identical" if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (e.g.
- the identity exists over a region that is at least about 50 nucleotides (or 10 amino acids) in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200 or more amino acids) in length.
- sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
- sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman, (1970) Adv. Appl. Math.
- BLAST and BLAST 2.0 algorithms Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al, (1977) Nuc. Acids Res. 25:3389-3402; and Altschul et al., (1990) J. Mol. Biol. 215:403-410, respectively.
- Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.
- the present invention contemplates modifications of the starting antibody or fragment ⁇ e.g., scFv) amino acid sequence that generate functionally equivalent molecules.
- the V H or V L of an anti-tumor-associated antigen binding domain, e.g., scFv, comprised in the TFP can be modified to retain at least about 70%, 71%. 72%.
- the present invention contemplates modifications of the entire TFP construct, e.g., modifications in one or more amino acid sequences of the various domains of the TFP construct in order to generate functionally equivalent molecules.
- the TFP construct can be modified to retain at least about 70%, 71%. 72%.
- the extracellular domain may be derived either from a natural or from a recombinant source. Where the source is natural, the domain may be derived from any protein, but in particular a membrane-bound or transmembrane protein. In one aspect, the extracellular domain is capable of associating with the transmembrane domain.
- An extracellular domain of particular use in this invention may include at least the extracellular region(s) of e.g., the alpha, beta or zeta chain of the T-cell receptor, or CD3 epsilon, CD3 gamma, or CD3 delta, or in alternative embodiments, CD28, CD45, CD2, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.
- a TFP sequence contains an extracellular domain and a transmembrane domain encoded by a single genomic sequence.
- a TFP can be designed to comprise a transmembrane domain that is heterologous to the extracellular domain of the TFP.
- a transmembrane domain can include one or more additional amino acids adjacent to the
- transmembrane region e.g., one or more amino acid associated with the extracellular region of the protein from which the transmembrane was derived ⁇ e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or up to 15 amino acids of the extracellular region) and/or one or more additional amino acids associated with the intracellular region of the protein from which the transmembrane protein is derived (e.g. , 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or up to 15 amino acids of the intracellular region).
- the transmembrane region e.g., one or more amino acid associated with the extracellular region of the protein from which the transmembrane was derived ⁇ e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or up to 15 amino acids of the extracellular region
- additional amino acids associated with the intracellular region of the protein from which the transmembrane protein is derived e.g. , 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or up to 15 amino acids of the intracellular region.
- transmembrane domain is one that is associated with one of the other domains of the TFP is used.
- the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins, e.g. , to minimize interactions with other members of the receptor complex.
- the transmembrane domain is capable of homodimerization with another TFP on the TFP-T-cell surface.
- the amino acid sequence of the transmembrane domain may be modified or substituted so as to minimize interactions with the binding domains of the native binding partner present in the same TFP.
- the transmembrane domain may be derived either from a natural or from a recombinant source. Where the source is natural, the domain may be derived from any membrane -bound or transmembrane protein. In one aspect, the transmembrane domain is capable of signaling to the intracellular domain(s) whenever the TFP has bound to a target.
- a transmembrane domain of particular use in this invention may include at least the transmembrane region(s) of e.g.
- the alpha, beta or zeta chain of the T-cell receptor CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.
- the transmembrane domain can be attached to the extracellular region of the TFP, e.g. , the antigen binding domain of the TFP, via a hinge, e.g. , a hinge from a human protein.
- a hinge e.g. , a hinge from a human protein.
- the hinge can be a human immunoglobulin (Ig) hinge, e.g. , an IgG4 hinge, or a CD8a hinge.
- a short oligo- or polypeptide linker may form the linkage between the transmembrane domain and the cytoplasmic region of the TFP.
- a glycine-serine doublet provides a particularly suitable linker.
- the linker comprises the amino acid sequence of GGGGSGGGGS (SEQ ID NO: 101).
- the linker is encoded by a nucleotide sequence of
- the linker comprises the amino acid sequence of G JGGSG JGGSGGGGSLE (SEQ ID NO: 1). In other embodiments, the linker comprises the amino acid sequence of AAAO JGGSO JGGSO JGGSLE (SEQ ID NO:2). In other embodiments, the linker is a long linker having the sequence
- the linker is encoded by a nucleotide sequence of
- the linker is encoded by a nucleotide sequence of GGAGAGGGTAAATCTTCCGGATCTGGTTCCGAAAGCAAGGCTAGC (SEQ ID NO: 73). Cytoplasmic Domain
- the cytoplasmic domain of the TFP can include an intracellular signaling domain, if the TFP contains CD3 gamma, delta or epsilon polypeptides; TCR alpha and TCR beta subunits are generally lacking in a signaling domain.
- An intracellular signaling domain is generally responsible for activation of at least one of the normal effector functions of the immune cell in which the TFP has been introduced.
- effector function refers to a specialized function of a cell. Effector function of a T-cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
- intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact chain as long as it transduces the effector function signal.
- intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
- intracellular signaling domains for use in the TFP of the invention include the cytoplasmic sequences of the T-cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any recombinant sequence that has the same functional capability.
- TCR T-cell receptor
- co-receptors that act in concert to initiate signal transduction following antigen receptor engagement
- naive T-cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation through the TCR (primary intracellular signaling domains) and those that act in an antigen-independent manner to provide a secondary or costimulatory signal (secondary cytoplasmic domain, e.g., a costimulatory domain).
- a primary signaling domain regulates primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way.
- Primary intracellular signaling domains that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine - based activation motifs (ITAMs).
- ITAMs immunoreceptor tyrosine - based activation motifs
- ITAMs containing primary intracellular signaling domains that are of particular use in the invention include those of CD3 zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d.
- a TFP of the invention comprises an intracellular signaling domain, e.g., a primary signaling domain of CD3 -epsilon.
- a primary signaling domain comprises a modified IT AM domain, e.g., a mutated IT AM domain which has altered ⁇ e.g., increased or decreased) activity as compared to the native IT AM domain.
- a primary signaling domain comprises a modified ITAM- containing primary intracellular signaling domain, e.g., an optimized and/or truncated ITAM- containing primary intracellular signaling domain.
- a primary signaling domain comprises one, two, three, four or more IT AM motifs.
- the intracellular signaling domain of the TFP can comprise the CD3 zeta signaling domain by itself or it can be combined with any other desired intracellular signaling domain(s) useful in the context of a TFP of the invention.
- the intracellular signaling domain of the TFP can comprise a CD3 epsilon chain portion and a costimulatory signaling domain.
- the costimulatory signaling domain refers to a portion of the TFP comprising the intracellular domain of a
- costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that is required for an efficient response of lymphocytes to an antigen.
- CD27 costimulation has been demonstrated to enhance expansion, effector function, and survival of human TFP-T cells in vitro and augments human T-cell persistence and antitumor activity in vivo (Song et al. Blood. 2012; 119(3):696-706).
- the intracellular signaling sequences within the cytoplasmic portion of the TFP of the invention may be linked to each other in a random or specified order.
- a short oligo- or polypeptide linker for example, between 2 and 10 amino acids ⁇ e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids) in length may form the linkage between intracellular signaling sequences.
- a glycine-serine doublet can be used as a suitable linker.
- a single amino acid e.g., an alanine, a glycine, can be used as a suitable linker.
- the TFP-expressing cell described herein can further comprise a second TFP, e.g., a second TFP that includes a different antigen binding domain, e.g., to the same target (e.g., CD22) or a different target (e.g., CD123).
- a second TFP e.g., a second TFP that includes a different antigen binding domain, e.g., to the same target (e.g., CD22) or a different target (e.g., CD123).
- the antigen binding domains of the different TFPs can be such that the antigen binding domains do not interact with one another.
- a cell expressing a first and second TFP can have an antigen binding domain of the first TFP, e.g., as a fragment, e.g., a scFv, that does not associate with the antigen binding domain of the second TFP, e.g., the antigen binding domain of the second TFP is a V HH -
- the TFP-expressing cell described herein can further express another agent, e.g., an agent which enhances the activity of a TFP-expressing cell.
- the agent can be an agent which inhibits an inhibitory molecule.
- Inhibitory molecules e.g., PD1
- Examples of inhibitory molecules include PD1, PD-L1, CTLA4, TFM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD 160, 2B4 and TGFR beta.
- the agent that inhibits an inhibitory molecule comprises a first polypeptide, e.g.
- the agent comprises a first polypeptide, e.g. , of an inhibitory molecule such as PDl, LAG3, CTLA4, CD160, BTLA, LAIR1, TIM3, 2B4 and TIGIT, or a fragment of any of these ⁇ e.g. , at least a portion of an extracellular domain of any of these), and a second polypeptide which is an intracellular signaling domain described herein ⁇ e.g. , comprising a costimulatory domain ⁇ e.g. , 4-1BB, CD27 or CD28, e.g.
- the agent comprises a first polypeptide of PDl or a fragment thereof ⁇ e.g. , at least a portion of an extracellular domain of PDl), and a second polypeptide of an intracellular signaling domain described herein ⁇ e.g. , a CD28 signaling domain described herein and/or a CD3 zeta signaling domain described herein).
- PDl is an inhibitory member of the CD28 family of receptors that also includes CD28, CTLA-4, ICOS, and BTLA.
- PD-1 is expressed on activated B cells, T cells and myeloid cells (Agata et al. 1996 Int. Immunol 8:765-75).
- Two ligands for PDl, PD-L1 and PD-L2 have been shown to downregulate T-cell activation upon binding to PDl (Freeman et al. 2000 J Exp Med 192: 1027-34; Latchman et al. 2001 Nat Immunol 2:261-8; Carter et al. 2002 Eur J Immunol 32:634-43).
- PD-L1 is abundant in human cancers (Dong et al. 2003 J Mol Med 81 :281 -7; Blank et al. 2005 Cancer Immunol. Immunother 54:307-314; Konishi et al. 2004 Clin Cancer Res 10: 5094). Immune suppression can be reversed by inhibiting the local interaction of PDl with PD-L1.
- the agent comprises the extracellular domain (ECD) of an inhibitory molecule, e.g. , Programmed Death 1 (PDl) can be fused to a transmembrane domain and optionally an intracellular signaling domain such as 41BB and CD3 zeta (also referred to herein as a PDl TFP).
- the PDl TFP when used in combinations with an anti -tumor antigen TFP described herein, improves the persistence of the T-cell.
- the TFP is a PDl TFP comprising the extracellular domain of PD 1.
- TFPs containing an antibody or antibody fragment such as a scFv that specifically binds to the Programmed Death- Ligand 1 (PD-L1) or Programmed Death-Ligand 2 (PD-L2).
- the present invention provides a population of TFP-expressing T cells, e.g. , TFP-T cells.
- the population of TFP-expressing T cells comprises a mixture of cells expressing different TFPs.
- the population of TFP- T cells can include a first cell expressing a TFP having an anti-tumor-associated antigen binding domain described herein, and a second cell expressing a TFP having a different anti -tumor- associated antigen binding domain, e.g. , an anti-tumor-associated antigen binding domain described herein that differs from the anti-tumor-associated antigen binding domain in the TFP expressed by the first cell.
- the population of TFP-expressing cells can include a first cell expressing a TFP that includes an anti -tumor-associated antigen binding domain, e.g. , as described herein, and a second cell expressing a TFP that includes an antigen binding domain to a target other than tumor-associated antigen ⁇ e.g. , another tumor-associated antigen).
- the present invention provides a population of cells wherein at least one cell in the population expresses a TFP having an anti-tumor-associated antigen domain described herein, and a second cell expressing another agent, e.g. , an agent which enhances the activity of a TFP-expressing cell.
- the agent can be an agent which inhibits an inhibitory molecule.
- Inhibitory molecules e.g. , can, in some embodiments, decrease the ability of a TFP-expressing cell to mount an immune effector response.
- inhibitory molecules examples include PD1, PD-L1, PD-L2, CTLA4, TEVI3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and TGFR beta.
- the agent that inhibits an inhibitory molecule comprises a first polypeptide, e.g. , an inhibitory molecule, associated with a second polypeptide that provides a positive signal to the cell, e.g. , an intracellular signaling domain described herein.
- the present invention also includes a TFP encoding RNA construct that can be directly transfected into a cell.
- a method for generating mRNA for use in transfection can involve in vitro transcription (IVT) of a template with specially designed primers, followed by polyA addition, to produce a construct containing 3 ' and 5' untranslated sequence ("UTR"), a 5 ' cap and/or Internal Ribosome Entry Site (IRES), the nucleic acid to be expressed, and a polyA tail, typically 50-2000 bases in length.
- RNA so produced can efficiently transfect different kinds of cells.
- the template includes sequences for the TFP.
- the anti-tumor-associated antigen TFP is encoded by a messenger RNA (mRNA).
- mRNA messenger RNA
- the mRNA encoding the anti-tumor-associated antigen TFP is introduced into a T-cell for production of a TFP-T-cell.
- the in vitro transcribed RNA TFP can be introduced to a cell as a form of transient transfection.
- the RNA is produced by in vitro transcription using a polymerase chain reaction (PCR)-generated template. DNA of interest from any source can be directly converted by PCR into a template for in vitro mRNA synthesis using appropriate primers and RNA polymerase.
- PCR polymerase chain reaction
- the source of the DNA can be, for example, genomic DNA, plasmid DNA, phage DNA, cDNA, synthetic DNA sequence or any other appropriate source of DNA.
- the desired template for in vitro transcription is a TFP of the present invention.
- the DNA to be used for PCR contains an open reading frame.
- the DNA can be from a naturally occurring DNA sequence from the genome of an organism.
- the nucleic acid can include some or all of the 5 ' and/or 3' untranslated regions (UTRs).
- the nucleic acid can include exons and introns.
- the DNA to be used for PCR is a human nucleic acid sequence.
- the DNA to be used for PCR is a human nucleic acid sequence including the 5' and 3 ' UTRs.
- the DNA can alternatively be an artificial DNA sequence that is not normally expressed in a naturally occurring organism.
- An exemplary artificial DNA sequence is one that contains portions of genes that are ligated together to form an open reading frame that encodes a fusion protein.
- the portions of DNA that are ligated together can be from a single organism or from more than one organism.
- PCR is used to generate a template for in vitro transcription of mRNA which is used for transfection.
- Methods for performing PCR are well known in the art.
- Primers for use in PCR are designed to have regions that are substantially complementary to regions of the DNA to be used as a template for the PCR.
- “Substantially complementary,” as used herein, refers to sequences of nucleotides where a majority or all of the bases in the primer sequence are complementary, or one or more bases are non-complementary, or mismatched. Substantially complementary sequences are able to anneal or hybridize with the intended DNA target under annealing conditions used for PCR.
- the primers can be designed to be substantially complementary to any portion of the DNA template.
- the primers can be designed to amplify the portion of a nucleic acid that is normally transcribed in cells (the open reading frame), including 5' and 3' UTRs.
- the primers can also be designed to amplify a portion of a nucleic acid that encodes a particular domain of interest.
- the primers are designed to amplify the coding region of a human cDNA, including all or portions of the 5' and 3' UTRs.
- Primers useful for PCR can be generated by synthetic methods that are well known in the art.
- "Forward primers" are primers that contain a region of nucleotides that are substantially complementary to nucleotides on the DNA template that are upstream of the DNA sequence that is to be amplified.
- Upstream is used herein to refer to a location 5, to the DNA sequence to be amplified relative to the coding strand.
- reverse primers are primers that contain a region of nucleotides that are substantially complementary to a double-stranded DNA template that are downstream of the DNA sequence that is to be amplified.
- Downstream is used herein to refer to a location 3 ' to the DNA sequence to be amplified relative to the coding strand.
- Any DNA polymerase useful for PCR can be used in the methods disclosed herein.
- the reagents and polymerase are commercially available from a number of sources.
- the RNA preferably has 5' and 3' UTRs.
- the 5' UTR is between one and 3,000 nucleotides in length.
- the length of 5' and 3' UTR sequences to be added to the coding region can be altered by different methods, including, but not limited to, designing primers for PCR that anneal to different regions of the UTRs. Using this approach, one of ordinary skill in the art can modify the 5' and 3' UTR lengths required to achieve optimal translation efficiency following transfection of the transcribed RNA.
- the 5' and 3' UTRs can be the naturally occurring, endogenous 5' and 3' UTRs for the nucleic acid of interest.
- UTR sequences that are not endogenous to the nucleic acid of interest can be added by incorporating the UTR sequences into the forward and reverse primers or by any other modifications of the template.
- the use of UTR sequences that are not endogenous to the nucleic acid of interest can be useful for modifying the stability and/or translation efficiency of the RNA. For example, it is known that AU-rich elements in 3 'UTR sequences can decrease the stability of mRNA. Therefore, 3 ' UTRs can be selected or designed to increase the stability of the transcribed RNA based on properties of UTRs that are well known in the art.
- the 5' UTR can contain the Kozak sequence of the endogenous nucleic acid.
- a consensus Kozak sequence can be redesigned by adding the 5 ' UTR sequence.
- Kozak sequences can increase the efficiency of translation of some RNA transcripts, but does not appear to be required for all RNAs to enable efficient translation. The requirement for Kozak sequences for many mRNAs is known in the art.
- the 5' UTR can be 5 'UTR of an RNA virus whose RNA genome is stable in cells.
- various nucleotide analogues can be used in the 3' or 5' UTR to impede exonuclease degradation of the mRNA.
- a promoter of transcription should be attached to the DNA template upstream of the sequence to be transcribed.
- the RNA polymerase promoter becomes incorporated into the PCR product upstream of the open reading frame that is to be transcribed.
- the promoter is a T7 polymerase promoter, as described elsewhere herein.
- Other useful promoters include, but are not limited to, T3 and SP6 RNA polymerase promoters. Consensus nucleotide sequences for T7, T3 and SP6 promoters are known in the art.
- the mRNA has both a cap on the 5' end and a 3' poly(A) tail which determine ribosome binding, initiation of translation and stability mRNA in the cell.
- RNA polymerase produces a long concatameric product which is not suitable for expression in eukaryotic cells.
- the transcription of plasmid DNA linearized at the end of the 3 ' UTR results in normal sized mRNA which is not effective in eukaryotic transfection even if it is polyadenylated after transcription.
- phage T7 RNA polymerase can extend the 3 ' end of the transcript beyond the last base of the template (Schenborn and Mierendorf, Nuc Acids Res., 13:6223-36 (1985); Nacheva and Berzal-Herranz, Eur. J. Biochem., 270: 1485-65 (2003).
- the polyA/T segment of the transcriptional DNA template can be produced during PCR by using a reverse primer containing a polyT tail, such as 100 T tail (size can be 50-5000 Ts), or after PCR by any other method, including, but not limited to, DNA ligation or in vitro recombination.
- Poly(A) tails also provide stability to RNAs and reduce their degradation. Generally, the length of a poly(A) tail positively correlates with the stability of the transcribed RNA. In one embodiment, the poly(A) tail is between 100 and 5000 adenosines.
- Poly(A) tails of RNAs can be further extended following in vitro transcription with the use of a poly(A) polymerase, such as E. coli polyA polymerase (E-PAP).
- E-PAP E. coli polyA polymerase
- increasing the length of a poly(A) tail from 100 nucleotides to between 300 and 400 nucleotides results in about a two-fold increase in the translation efficiency of the RNA.
- the attachment of different chemical groups to the 3 ' end can increase mRNA stability. Such attachment can contain
- ATP analogs can be incorporated into the poly(A) tail using poly(A) polymerase. ATP analogs can further increase the stability of the RNA.
- RNAs produced by the methods disclosed herein include a 5' cap.
- the 5' cap is provided using techniques known in the art and described herein (Cougot, et al., Trends in Biochem. Sci., 29:436-444 (2001); Stepinski, et al., RNA, 7: 1468-95 (2001); Elango, et al., Biochim. Biophys. Res. Commun., 330:958- 966 (2005)).
- RNAs produced by the methods disclosed herein can also contain an internal ribosome entry site (IRES) sequence.
- IRES sequence may be any viral, chromosomal or artificially designed sequence which initiates cap-independent ribosome binding to mRNA and facilitates the initiation of translation. Any solutes suitable for cell electroporation, which can contain factors facilitating cellular permeability and viability such as sugars, peptides, lipids, proteins, antioxidants, and surfactants can be included.
- RNA can be introduced into target cells using any of a number of different methods, for instance, commercially available methods which include, but are not limited to, electroporation (Amaxa Nucleofector-II (Amaxa Biosystems, Cologne, Germany)), (ECM 830 (BTX) (Harvard Instruments, Boston, Mass.) or the Gene Pulser ⁇ (BioRad, Denver, Colo.), Multiporator
- the present invention also provides nucleic acid molecules encoding one or more TFP constructs described herein.
- the nucleic acid molecule is provided as a messenger RNA transcript.
- the nucleic acid molecule is provided as a DNA construct. Exemplary DNA sequences encoding binders, linkers, and TFPs in their expression plasmids are disclosed in Appendix A.
- nucleic acid sequences coding for the desired molecules can be obtained using recombinant methods known in the art, such as, for example by screening libraries from cells expressing the gene, by deriving the gene from a vector known to include the same, or by isolating directly from cells and tissues containing the same, using standard techniques.
- the gene of interest can be produced synthetically, rather than cloned.
- the present invention also provides vectors in which a DNA of the present invention is inserted.
- Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long- term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells.
- Lentiviral vectors have the added advantage over vectors derived from onco- retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of low immunogenicity.
- the vector comprising the nucleic acid encoding the desired TFP of the invention is an adenoviral vector (A5/35).
- one or more domains of the TFP construct are engineered using a gene editing technique such as clustered regularly interspaced short palindromic repeats (CRISPR®, see, e.g., US Patent No.
- CRISPR® clustered regularly interspaced short palindromic repeats
- TALEN transcription activator-like effector nucleases
- meganucleases naturally occurring endodeoxyribonucleases having large recognition sites comprising double-stranded DNA sequences of 12 to 40 base pairs
- ZFN zinc finger nuclease
- one or more of the extracellular domain, the transmembrane domain, or the cytoplasmic domain of a TFP subunit are engineered to have aspects of more than one natural TCR subunit domain (i.e., are chimeric).
- the expression constructs of the present invention may also be used for nucleic acid immunization and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art (see, e.g., U.S. Pat. Nos. 5,399,346, 5,580,859, 5,589,466, incorporated by reference herein in their entireties).
- the invention provides a gene therapy vector.
- the nucleic acid can be cloned into a number of types of vectors.
- the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid.
- Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
- the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, e.g.
- Viruses which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses.
- a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers ⁇ e.g. , WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).
- retroviruses provide a convenient platform for gene delivery systems.
- a selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art.
- the recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo.
- retroviral systems are known in the art.
- adenovirus vectors are used.
- a number of adenovirus vectors are known in the art.
- lentivirus vectors are used.
- Additional promoter elements e.g. , enhancers, regulate the frequency of transcriptional initiation.
- these are located in the region 30-110 bp upstream of the start site, although a number of promoters have been shown to contain functional elements downstream of the start site as well.
- the spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another.
- tk thymidine kinase
- the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
- individual elements can function either cooperatively or independently to activate transcription.
- a promoter that is capable of expressing a TFP transgene in a mammalian T- cell is the EF1 a promoter.
- the native EF1 a promoter drives expression of the alpha subunit of the elongation factor- 1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome.
- the EF1 a promoter has been extensively used in mammalian expression plasmids and has been shown to be effective in driving TFP expression from transgenes cloned into a lentiviral vector (see, e.g. , Milone et al., Mol. Ther. 17(8): 1453-1464 (2009)).
- CMV immediate early cytomegalovirus
- This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto.
- other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the elongation factor- la promoter, the hemoglobin promoter, and the creatine kinase promoter.
- SV40 simian virus 40
- MMTV mouse mammary tumor virus
- HSV human immunodeficiency virus
- inducible promoters are also contemplated as part of the invention.
- the use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired.
- inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline-regulated promoter.
- the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors.
- the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells.
- Useful selectable markers include, for example, antibiotic-resistance genes, such as neo and the like.
- Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences.
- a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g. , enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells.
- Suitable reporter genes may include genes encoding luciferase, beta-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene ⁇ e.g.
- Suitable expression systems are well known and may be prepared using known techniques or obtained commercially.
- the construct with the minimal 5 ' flanking region showing the highest level of expression of reporter gene is identified as the promoter.
- Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
- the vector can be readily introduced into a host cell, e.g. , mammalian, bacterial, yeast, or insect cell by any method in the art.
- the expression vector can be transferred into a host cell by physical, chemical, or biological means.
- Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like.
- Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors.
- Viral vectors, and especially retroviral vectors have become the most widely used method for inserting genes into mammalian, e.g., human cells.
- Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno -associated viruses, and the like (see, e.g., U.S. Pat. Nos. 5,350,674 and 5,585,362).
- Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome ⁇ e.g., an artificial membrane vesicle).
- Other methods of state-of-the-art targeted delivery of nucleic acids are available, such as delivery of polynucleotides with targeted nanoparticles or other suitable sub-micron sized delivery system.
- an exemplary delivery vehicle is a liposome.
- lipid formulations is contemplated for the introduction of the nucleic acids into a host cell ⁇ in vitro, ex vivo or in vivo).
- the nucleic acid may be associated with a lipid.
- the nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid.
- compositions are not limited to any particular structure in solution. For example, they may be present in a bilayer structure, as micelles, or with a "collapsed" structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape.
- Lipids are fatty substances which may be naturally occurring or synthetic lipids.
- lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
- Lipids suitable for use can be obtained from commercial sources.
- DMPC dimyristyl phosphatidylcholine
- DCP dicetyl phosphate
- Choi cholesterol
- DMPG dimyristyl phosphatidylglycerol
- Stock solutions of lipids in chloroform or chloroform/methanol can be stored at about -20 °C.
- Liposome is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution.
- compositions that have different structures in solution than the normal vesicular structure are also encompassed.
- the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules.
- lipofectamine-nucleic acid complexes are also contemplated.
- assays include, for example, "molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR; "biochemical” assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention.
- molecular biological assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR
- biochemical assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention.
- the present invention further provides a vector comprising a TFP encoding nucleic acid molecule.
- a TFP vector can be directly transduced into a cell, e.g., a T-cell.
- the vector is a cloning or expression vector, e.g., a vector including, but not limited to, one or more plasmids (e.g., expression plasmids, cloning vectors, minicircles, minivectors, double minute chromosomes), retroviral and lentiviral vector constructs.
- the vector is capable of expressing the TFP construct in mammalian T cells.
- the mammalian T-cell is a human T-cell.
- a source of T cells is obtained from a subject.
- the term "subject” is intended to include living organisms in which an immune response can be elicited (e.g., mammals). Examples of subjects include humans, dogs, cats, mice, rats, and transgenic species thereof.
- T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In certain aspects of the present invention, any number of T-cell lines available in the art, may be used.
- T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll ® separation.
- cells from the circulating blood of an individual are obtained by apheresis.
- the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
- the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
- the cells are washed with phosphate buffered saline (PBS).
- PBS phosphate buffered saline
- the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations. Initial activation steps in the absence of calcium can lead to magnified activation.
- a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated "flow-through” centrifuge (for example, the COBE® 2991 cell processor, the Baxter CytoMate®, or the Haemonetics® Cell Saver® 5) according to the
- the cells may be resuspended in a variety of cells
- biocompatible buffers such as, for example, Ca-free, Mg-free PBS, PlasmaLyte® A, or other saline solution with or without buffer.
- the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
- T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a Percoll® gradient or by counterflow centrifugal elutriation.
- a specific subpopulation of T cells such as CD3 + , CD28 + , CD4 + , CD8 + , CD45RA + , and CD45RO + T cells, can be further isolated by positive or negative selection techniques.
- T cells are isolated by incubation with anti-CD3/anti-CD28 (e.g., 3x28)-conjugated beads, such as Dynabeads® M-450 CD3/CD28 T, for a time period sufficient for positive selection of the desired T cells.
- the time period is about 30 minutes.
- the time period ranges from 30 minutes to 36 hours or longer and all integer values there between.
- the time period is at least 1, 2, 3, 4, 5, or 6 hours.
- the time period is 10 to 24 hours.
- the incubation time period is 24 hours.
- TIL tumor infiltrating lymphocytes
- subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points.
- multiple rounds of selection can also be used in the context of this invention. In certain aspects, it may be desirable to perform the selection procedure and use the "unselected" cells in the activation and expansion process. "Unselected" cells can also be subjected to further rounds of selection.
- Enrichment of a T-cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells.
- One method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected.
- a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CDl lb, CD16, HLA-DR, and CD8.
- it may be desirable to enrich for or positively select for regulatory T cells which typically express CD4 + , CD25+, CD62Lhi, GITR + , and FoxP3 + .
- T regulatory cells are depleted by anti-C25 conjugated beads or other similar method of selection.
- a T-cell population can be selected that expresses one or more of IFN- ⁇ , TNF-alpha, IL-17A, IL-2, IL-3, IL-4, GM-CSF, IL-10, IL-13, granzyme B, and perforin, or other appropriate molecules, e.g., other cytokines.
- Methods for screening for cell expression can be determined, e.g., by the methods described in PCT Publication No.: WO2013/126712.
- the concentration of cells and surface can be varied.
- a concentration of 2 billion cells/mL is used.
- a concentration of 1 billion cells/mL is used.
- greater than 100 million cells/mL is used.
- a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/mL is used.
- a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/mL is used.
- concentrations of 125 or 150 million cells/mL can be used.
- Using high concentrations can result in increased cell yield, cell activation, and cell expansion.
- use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present ⁇ e.g., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain.
- using high concentration of cells allows more efficient selection of CD8 + T cells that normally have weaker CD28 expression.
- the concentration of cells used is 5xl0 6 /mL. In other aspects, the concentration used can be from about lxloVmL to lxl0 6 /mL, and any integer value in between. In other aspects, the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10 °C or at room temperature.
- T cells for stimulation can also be frozen after a washing step.
- the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population.
- the cells may be suspended in a freezing solution.
- one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% Dextrose 5%, 0.45% NaCl, 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin, and 7.5% DMSO or other suitable cell freezing media containing for example, Hespan® and PlasmaLyte® A, the cells then are frozen to -80 °C at a rate of 1 per minute and stored in the vapor phase of a liquid nitrogen storage tank.
- cryopreserved cells are thawed and washed as described herein and allowed to rest for one hour at room temperature prior to activation using the methods of the present invention.
- a blood sample or an apheresis product is taken from a generally healthy subject.
- a blood sample or an apheresis is taken from a generally healthy subject who is at risk of developing a disease, but who has not yet developed a disease, and the cells of interest are isolated and frozen for later use.
- the T cells may be expanded, frozen, and used at a later time.
- samples are collected from a patient shortly after diagnosis of a particular disease as described herein but prior to any treatments.
- the cells are isolated from a blood sample or an apheresis from a subject prior to any number of relevant treatment modalities, including but not limited to treatment with agents such as
- immunosuppressive agents such as cyclosporin, azathioprine, methotrexate, mycophenolate, and tacrolimus (FK506)
- antibodies, or other immunoablative agents such as alemtuzumab, anti-CD3 antibodies, cyclophosphamide, fludarabine, cyclosporin, rapamycin, mycophenolic acid, steroids, romidepsin (formerly
- T cells are obtained from a patient directly following treatment that leaves the subject with functional T cells.
- the quality of T cells obtained may be optimal or improved for their ability to expand ex vivo.
- these cells may be in a preferred state for enhanced engraftment and in vivo expansion.
- mobilization for example, mobilization with GM-CSF
- conditioning regimens can be used to create a condition in a subject wherein repopulation, recirculation, regeneration, and/or expansion of particular cell types is favored, especially during a defined window of time following therapy.
- Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system.
- T cells may be activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681;
- the T cells of the invention may be expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a costimulatory molecule on the surface of the T cells.
- T-cell populations may be stimulated as described herein, such as by contact with an anti-CD3 antibody, or antigen- binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator ⁇ e.g., bryostatin) in conjunction with a calcium ionophore.
- a ligand that binds the accessory molecule is used for co- stimulation of an accessory molecule on the surface of the T cells.
- a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
- an anti-CD3 antibody and an anti- CD28 antibody can stimulate proliferation of either CD4 + T cells or CD8 + T cells.
- an anti-CD28 antibody include 9.3, B-T3, XR-CD28 (Diaclone, Besancon, France) can be used as can other methods commonly known in the art (Berg et al, Transplant Proc. 30(8):3975-3977, 1998; Haanen et al, J. Exp. Med. 190(9): 13191328, 1999;
- T cells that have been exposed to varied stimulation times may exhibit different
- TH helper T-cell population
- TC cytotoxic or suppressor T-cell population
- TH helper T-cell population
- TC cytotoxic or suppressor T-cell population
- TH helper T-cell population
- TC cytotoxic or suppressor T-cell population
- Ex vivo expansion of T cells by stimulating CD3 and CD28 receptors produces a population of T cells that prior to about days 8-9 consists predominately of TH cells, while after about days 8-9, the population of T cells comprises an increasingly greater population of TC cells. Accordingly, depending on the purpose of treatment, infusing a subject with a T-cell population comprising predominately of TH cells may be advantageous. Similarly, if an antigen- specific subset of TC cells has been isolated it may be beneficial to expand this subset to a greater degree.
- an anti-tumor-associated antigen TFP is constructed, various assays can be used to evaluate the activity of the molecule, such as but not limited to, the ability to expand T cells following antigen stimulation, sustain T-cell expansion in the absence of re-stimulation, and anticancer activities in appropriate in vitro and animal models. Assays to evaluate the effects of an anti- tumor-associated antigen TFP are described in further detail below
- TFP expression in primary T cells can be used to detect the presence of monomers and dimers (see, e.g. , Milone et al, Molecular Therapy 17(8): 1453-1464 (2009)).
- T cells (1 : 1 mixture of CD4 + and CD8 + T cells) expressing the TFPs are expanded in vitro for more than 10 days followed by lysis and SDS-PAGE under reducing conditions.
- TFPs are detected by Western blotting using an antibody to a TCR chain. The same T- cell subsets are used for SDS-PAGE analysis under non-reducing conditions to permit evaluation of covalent dimer formation.
- TFP + T cells following antigen stimulation can be measured by flow cytometry. For example, a mixture of CD4 + and CD8 + T cells are stimulated with
- alphaCD3/alphaCD28 and APCs followed by transduction with lentiviral vectors expressing GFP under the control of the promoters to be analyzed.
- exemplary promoters include the CMV IE gene, EF-1 alpha, ubiquitin C, or phosphoglycerokinase (PGK) promoters.
- GFP fluorescence is evaluated on day 6 of culture in the CD4 + and/or CD8 + T-cell subsets by flow cytometry (see, e.g. , Milone et al, Molecular Therapy 17(8): 1453-1464 (2009)).
- a mixture of CD4 + and CD8 + T cells are stimulated with alphaCD3/alphaCD28 coated magnetic beads on day 0, and transduced with TFP on day 1 using a bicistronic lentiviral vector expressing TFP along with eGFP using a 2A ribosomal skipping sequence.
- TFP + T-cell expansion in the absence of re-stimulation can also be measured (see, e.g. , Milone et al., Molecular Therapy 17(8): 1453-1464 (2009)). Briefly, mean T-cell volume (fl) is measured on day 8 of culture using a Coulter Multisizer ⁇ particle counter following stimulation with alphaCD3/alphaCD28 coated magnetic beads on day 0, and transduction with the indicated TFP on day 1.
- mice can also be used to measure a TFP-T activity.
- xenograft model using human BCMA-specific TFP + T cells to treat a cancer in immunodeficient mice see, e.g. , Milone et al., Molecular Therapy 17(8): 1453-1464 (2009).
- mice are randomized as to treatment groups. Different numbers of engineered T cells are coinjected at a 1 : 1 ratio into NOD/SCID/y-/- mice bearing cancer. The number of copies of each vector in spleen DNA from mice is evaluated at various times following T-cell injection. Animals are assessed for cancer at weekly intervals.
- Peripheral blood tumor-associated antigen + cancer cell counts are measured in mice that are injected with alpha tumor-associated antigen-zeta TFP + T cells or mock-transduced T cells. Survival curves for the groups are compared using the log-rank test.
- absolute peripheral blood CD4 + and CD8 + T-cell counts 4 weeks following T-cell injection in NOD/SCID/y-/- mice can also be analyzed.
- Mice are injected with cancer cells and 3 weeks later are injected with T cells engineered to express TFP by a bicistronic lentiviral vector that encodes the TFP linked to eGFP.
- T cells are normalized to 45-50% input GFP+ T cells by mixing with mock- transduced cells prior to injection, and confirmed by flow cytometry. Animals are assessed for cancer at 1-week intervals. Survival curves for the TFP+ T-cell groups are compared using the log- rank test.
- Dose dependent TFP treatment response can be evaluated (see, e.g. , Milone et al, Molecular Therapy 17(8): 1453-1464 (2009)).
- peripheral blood is obtained 35-70 days after establishing cancer in mice injected on day 21 with TFP T cells, an equivalent number of mock- transduced T cells, or no T cells. Mice from each group are randomly bled for determination of peripheral blood + cancer cell counts and then killed on days 35 and 49. The remaining animals are evaluated on days 57 and 70.
- TFP-mediated proliferation is performed in microtiter plates by mixing washed T cells with cells expressing BCMA or CD32 and CD137 (KT32-BBL) for a final T-cell:cell expressing BCMA ratio of 2: 1.
- Cells expressing BCMA cells are irradiated with gamma-radiation prior to use.
- Anti-CD3 (clone OKT3) and anti-CD28 (clone 9.3) monoclonal antibodies are added to cultures with KT32-BBL cells to serve as a positive control for stimulating T-cell proliferation since these signals support long-term CD8 + T-cell expansion ex vivo.
- T cells are enumerated in cultures using CountBrightTM fluorescent beads (Invitrogen) and flow cytometry as described by the manufacturer.
- TFP+ T cells are identified by GFP expression using T cells that are engineered with eGFP-2A linked TFP-expressing lentiviral vectors. For TFP+ T cells not expressing GFP, the TFP+ T cells are detected with biotinylated recombinant BCMA protein and a secondary avidin-PE conjugate. CD4 + and CD8 + expression on T cells are also simultaneously detected with specific monoclonal antibodies (BD Biosciences).
- Cytokine measurements are performed on supernatants collected 24 hours following re-stimulation using the human TH1/TH2 cytokine cytometric bead array kit (BD Biosciences) according the manufacturer's instructions. Fluorescence is assessed using a FACScaliburTM flow cytometer, and data is analyzed according to the manufacturer's instructions.
- Cytotoxicity can be assessed by a standard 51 Cr-release assay (see, e.g., Milone et al., Molecular Therapy 17(8): 1453-1464 (2009)). Briefly, target cells are loaded with 51 Cr (as NaCr0 4 , New England Nuclear) at 37 °C for 2 hours with frequent agitation, washed twice in complete RPMI and plated into microtiter plates. Effector T cells are mixed with target cells in the wells in complete RPMI at varying ratios of effector cell:target cell (E:T). Additional wells containing media only (spontaneous release, SR) or a 1% solution of triton-X 100 detergent (total release, TR) are also prepared.
- 51 Cr as NaCr0 4 , New England Nuclear
- % Lysis (ER-SR)/(TR-SR), where ER represents the average 51 Cr released for each experimental condition.
- Imaging technologies can be used to evaluate specific trafficking and proliferation of TFPs in tumor-bearing animal models. Such assays have been described, e.g., in Barrett et al, Human Gene Therapy 22: 1575-1586 (2011). Briefly, NOD/SdD/yc-/- (NSG) mice are injected IV with cancer cells followed 7 days later with T cells 4 hour after electroporation with the TFP constructs. The T cells are stably transfected with a lentiviral construct to express firefly luciferase, and mice are imaged for bioluminescence.
- therapeutic efficacy and specificity of a single injection of TFP+ T cells in a cancer xenograft model can be measured as follows: NSG mice are injected with cancer cells transduced to stably express firefly luciferase, followed by a single tail- vein injection of T cells electroporated with BCMA TFP 7 days later. Animals are imaged at various time points post injection. For example, photon-density heat maps of firefly luciferase positive cancer in representative mice at day 5 (2 days before treatment) and day 8 (24 hours post TFP+ PBLs) can be generated.
- the invention provides methods for treating a disease associated with a TAA, e.g., ROR1 or NKG2D ligand (NKG2DL) expression.
- a disease associated with a TAA e.g., ROR1 or NKG2D ligand (NKG2DL) expression.
- the invention provides methods for treating a disease wherein part of the tumor is negative for NKG2DL and part of the tumor is positive for NKG2DL.
- the TFP is useful for treating subjects that have undergone treatment for a disease associated with elevated expression of NKG2DL, wherein the subject that has undergone treatment for elevated levels of NKG2DL exhibits a disease associated with elevated levels of NKG2DL.
- the invention pertains to a vector comprising a TAA-binding TFP operably linked to promoter for expression in mammalian T cells.
- the invention provides a recombinant T-cell expressing the, e.g., NKG2D TFP for use in treating NKG2DL-expressing tumors, wherein the recombinant T-cell expressing the NKG2D TFP is termed a NKG2D TFP-T.
- the NKG2D TFP-T is capable of contacting a tumor cell with at least one NKG2DL expressed on its surface such that the TFP-T targets the tumor cell and growth of the tumor is inhibited.
- Tumor associated antigen targets for anti-TAA TFP-T cells, dual specificity anti-TAA TFP T cells, or for CD-I 6 TFP T cells in combination with an anti-TAA antibody
- tumor-associated antigens include, but are not limited to, oncofetal antigens ⁇ e.g. , those expressed in fetal tissues and in cancerous somatic cells), oncoviral antigens ⁇ e.g., those encoded by tumorigenic transforming viruses), overexpressed/ accumulated antigens ⁇ e.g.
- cancer-testis antigens ⁇ e.g., those expressed only by cancer cells and adult reproductive tissues such as testis and placenta
- lineage-restricted antigens ⁇ e.g., those expressed largely by a single cancer histotype
- mutated antigens ⁇ e.g., those expressed by cancer as a result of genetic mutation or alteration in transcription
- post-translationally altered antigens ⁇ e.g., those tumor- associated alterations in glycosylation, etc.
- idiotypic antigens ⁇ e.g., those from highly polymorphic genes where a tumor cell expresses a specific clonotype, e.g., as in B cell, T cell lymphoma/1 eukemi a resulting from clonal aberrancies).
- tumor-associated antigens include, but are not limited to, antigens of alpha-actinin-4, ARTCl, BCR-ABL fusion protein (b3a2), B-RAF, CASP-5, CASP-8, beta-catenin, Cdc27, CDK4, CDK12, CDKN2A, CLPP, COA-1, CSNK1A1, dek-can fusion protein, EFTUD2, Elongation factor 2, ETV6-AML1 fusion protein, FLT3-ITD, FNDC3B, FN1, GAS7, GPNMB, HAUS3, HSDL1, LDLR-fucosyltransferase AS fusion protein, HLA-A2d, HLA-A1 Id, hsp70-2, MART2, MATN, ME1, MUM- If, MUM-2, MUM-3, neo- PAP, Myosin class I, NFYC, OGT, OS-9, p53, pml-RARalpha
- the invention provides methods for treating a disease associated with at least one tumor-associated antigen expression.
- the invention provides methods for treating a disease wherein part of the tumor is negative for the tumor associated antigen and part of the tumor is positive for the tumor associated antigen.
- the antibody or TFP of the invention is useful for treating subjects that have undergone treatment for a disease associated with elevated expression of said tumor antigen, wherein the subject that has undergone treatment for elevated levels of the tumor associated antigen exhibits a disease associated with elevated levels of the tumor associated antigen.
- the invention pertains to a vector comprising an anti-tumor-associated antigen antibody or TFP operably linked to promoter for expression in mammalian T cells.
- the invention provides a recombinant T-cell expressing a tumor-associated antigen TFP for use in treating tumor-associated antigen-expressing tumors, wherein the recombinant T-cell expressing the tumor-associated antigen TFP is termed a tumor-associated antigen TFP-T.
- the tumor- associated antigen TFP-T of the invention is capable of contacting a tumor cell with at least one tumor-associated antigen TFP of the invention expressed on its surface such that the TFP-T targets the tumor cell and growth of the tumor is inhibited.
- the invention pertains to a method of inhibiting growth of a tumor-associated antigen-expressing tumor cell, comprising contacting the tumor cell with a tumor-associated antigen antibody or TFP T-cell of the present invention such that the TFP-T is activated in response to the antigen and targets the cancer cell, wherein the growth of the tumor is inhibited.
- the invention pertains to a method of treating cancer in a subject.
- the method comprises administering to the subject a tumor-associated antigen antibody, bispecific antibody, or TFP T-cell of the present invention such that the cancer is treated in the subject.
- An example of a cancer that is treatable by the tumor-associated antigen TFP T-cell of the invention is a cancer associated with expression of tumor-associated antigen.
- the cancer is a myeloma.
- the cancer is a lymphoma.
- the cancer is colon cancer.
- tumor-associated antigen antibodies or TFP therapy can be used in combination with one or more additional therapies.
- additional therapies comprise a chemotherapeutic agent, e.g., cyclophosphamide.
- additional therapies comprise surgical resection or radiation treatment.
- T cells are genetically modified to express a TFP and the TFP-expressing T-cell is infused to a recipient in need thereof.
- the infused cell is able to kill tumor cells in the recipient.
- TFP- expressing T cells are able to replicate in vivo resulting in long-term persistence that can lead to sustained tumor control.
- the T cells administered to the patient, or their progeny persist in the patient for at least four months, five months, six months, seven months, eight months, nine months, ten months, eleven months, twelve months, thirteen months, fourteen month, fifteen months, sixteen months, seventeen months, eighteen months, nineteen months, twenty months, twenty-one months, twenty -two months, twenty-three months, two years, three years, four years, or five years after administration of the T-cell to the patient.
- T cells are modified, e.g., by in vitro transcribed RNA, to transiently express a TFP and the TFP-expressing T-cell is infused to a recipient in need thereof.
- the infused cell is able to kill tumor cells in the recipient.
- the T cells administered to the patient is present for less than one month, e.g., three weeks, two weeks, or one week, after administration of the T-cell to the patient.
- the anti-tumor immunity response elicited by the TFP-expressing T cells may be an active or a passive immune response, or alternatively may be due to a direct vs indirect immune response.
- the TFP transduced T cells exhibit specific proinflammatory cytokine secretion and potent cytolytic activity in response to human cancer cells expressing the tumor-associated antigen, resist soluble tumor-associated antigen inhibition, mediate bystander killing and/or mediate regression of an established human tumor.
- antigen-less tumor cells within a heterogeneous field of tumor-associated antigen-expressing tumor may be susceptible to indirect destruction by tumor-associated antigen- redirected T cells that has previously reacted against adjacent antigen-positive cancer cells.
- the human TFP-modified T cells of the invention may be a type of vaccine for ex vivo immunization and/or in vivo therapy in a mammal.
- the mammal is a human.
- TFP-modified cell can be administered to a mammalian recipient to provide a therapeutic benefit.
- the mammalian recipient may be a human and the TFP-modified cell can be autologous with respect to the recipient.
- the cells can be allogeneic, syngeneic or xenogeneic with respect to the recipient.
- ex vivo culture and expansion of T cells comprises: (1) collecting CD34+ hematopoietic stem and progenitor cells from a mammal from peripheral blood harvest or bone marrow explants; and (2) expanding such cells ex vivo.
- other factors such as flt3-L, IL-1, IL-3 and c-kit ligand, can be used for culturing and expansion of the cells.
- the present invention also provides compositions and methods for in vivo immunization to elicit an immune response directed against an antigen in a patient.
- the cells activated and expanded as described herein may be utilized in the treatment and prevention of diseases that arise in individuals who are immunocompromised.
- the TFP-modified T cells of the invention are used in the treatment of diseases, disorders and conditions associated with expression of tumor-associated antigens.
- the cells of the invention are used in the treatment of patients at risk for developing diseases, disorders and conditions associated with expression of tumor-associated antigens.
- the present invention provides methods for the treatment or prevention of diseases, disorders and conditions associated with expression of tumor-associated antigens comprising administering to a subject in need thereof, a therapeutically effective amount of the TFP-modified T cells of the invention.
- the antibodies or TFP-T cells of the inventions may be used to treat a proliferative disease such as a cancer or malignancy or is a precancerous condition.
- a proliferative disease such as a cancer or malignancy or is a precancerous condition.
- the cancer is a myeloma.
- the cancer is a lymphoma.
- the cancer is a colon cancer.
- a disease associated with tumor-associated antigen expression includes, but is not limited to, e.g., atypical and/or non-classical cancers, malignancies, precancerous conditions or proliferative diseases expressing tumor-associated antigens.
- Non-cancer related indications associated with expression of tumor-associated antigens vary depending on the antigen, but are not limited to, e.g., infectious disease, autoimmune disease, (e.g., lupus), inflammatory disorders (allergy and asthma) and transplantation.
- the antibodies or TFP-modified T cells of the present invention may be administered either alone, or as a pharmaceutical composition in combination with diluents and/or with other components such as IL-2, IL-7, IL-12, IL-15 or other cytokines or cell populations.
- the present invention also provides methods for inhibiting the proliferation or reducing a tumor-associated antigen-expressing cell population, the methods comprising contacting a population of cells comprising a tumor-associated antigen-expressing cell with an anti-tumor- associated antigen TFP-T-cell of the invention that binds to the tumor-associated antigen-expressing cell.
- the present invention provides methods for inhibiting the proliferation or reducing the population of cancer cells expressing tumor-associated antigen, the methods comprising contacting the tumor-associated antigen-expressing cancer cell population with an anti -tumor- associated antigen antibody or TFP-T-cell of the invention that binds to the tumor-associated antigen-expressing cell.
- the present invention provides methods for inhibiting the proliferation or reducing the population of cancer cells expressing tumor-associated antigen, the methods comprising contacting the tumor-associated antigen-expressing cancer cell population with an anti-tumor-associated antigen antibody or TFP-T-cell of the invention that binds to the tumor- associated antigen-expressing cell.
- the anti -tumor-associated antigen antibody or TFP-T-cell of the invention reduces the quantity, number, amount or percentage of cells and/or cancer cells by at least 25%, at least 30%, at least 40%, at least 50%, at least 65%, at least 75%, at least 85%, at least 95%, or at least 99% in a subject with or animal model for multiple myeloma or another cancer associated with tumor-associated antigen-expressing cells relative to a negative control.
- the subject is a human.
- the present invention also provides methods for preventing, treating and/or managing a disease associated with tumor-associated antigen-expressing cells (e.g., a cancer expressing tumor- associated antigen), the methods comprising administering to a subject in need an anti-tumor- associated antigen antibody or TFP-T-cell of the invention that binds to the tumor-associated antigen-expressing cell.
- the subject is a human.
- disorders associated with tumor-associated antigen-expressing cells include autoimmune disorders (such as lupus), inflammatory disorders (such as allergies and asthma) and cancers (such as hematological cancers or atypical cancers expressing tumor-associated antigen).
- the present invention also provides methods for preventing, treating and/or managing a disease associated with tumor-associated antigen-expressing cells, the methods comprising administering to a subject in need an anti-tumor-associated antigen antibody or TFP-T-cell of the invention that binds to the tumor-associated antigen-expressing cell.
- the subject is a human.
- the present invention provides methods for preventing relapse of cancer associated with tumor-associated antigen-expressing cells, the methods comprising administering to a subject in need thereof an anti-tumor-associated antigen antibody and/or TFP-T-cell of the invention that binds to the tumor-associated antigen-expressing cell.
- the methods comprise administering to the subject in need thereof an effective amount of an anti-tumor-associated antigen antibody or TFP-T-cell described herein that binds to the tumor-associated antigen-expressing cell in
- an antibody or TFP-expressing cell described herein may be used in combination with other known agents and therapies.
- Administered "in combination”, as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated or treatment has ceased for other reasons.
- the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as “simultaneous" or "concurrent delivery".
- the delivery of one treatment ends before the delivery of the other treatment begins.
- the treatment is more effective because of combined administration.
- the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment or the analogous situation is seen with the first treatment.
- delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other.
- the effect of the two treatments can be partially additive, wholly additive, or greater than additive.
- the delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
- the CD16 TFPs disclosed herein are administered in combination with an anti -cancer antibody.
- Any IgGl or IgG4 anti-cancer antibody against a tumor-associated antigen expressed on the surface of a tumor cell is suitable for use in the combinations and methods disclosed herein.
- Such antibodies include, but are not limited to, antibodies against 5T4, 8H9, ⁇ integrin, ⁇ integrin, alphafetoprotein (AFP), B7-H6, CA-125 carbonic anhydrase 9 (CA9), CD19, CD20, CD22, CD30, CD33, CD38, CD44, CD44v6, CD44v7/8, CD52, CD123, CD171, carcinoembryonic antigen (CEA), EpCAM (epithelial cell adhesion molecule), E-cadherin, EMA (epithelial membrane antigen), EGFRvlll, epithelial glycoprotein-2 (EGP-2), epithelial glycoprotein-40 (EGP-40), ErbBl/EGFR, ErbB2/HER2/neu/EGFR2, ErbB3/HER3, ErbB4, epithelial tumor antigen (ETA), folate binding protein (FBP), fetal acetylcholine receptor (AchR), folate receptor-a, G250/CAIX, gangli
- the tumor-associated antigen is an antigen not expressed on the cell surface of cells of normal (i.e., non-cancerous) tissue. In another embodiment, the tumor-associated antigen is expressed on the cell surface of cells of normal tissue at a much lower level (e.g., fewer receptors per cell) than the antigen is expressed on tumor cells.
- the "at least one additional therapeutic agent” includes a TFP- expressing cell.
- T cells that express multiple TFPs, which bind to the same or different target antigens, or same or different epitopes on the same target antigen.
- populations of T cells in which a first subset of T cells expresses a first TFP and a second subset of T cells express a second TFP.
- a TFP-expressing cell described herein and the at least one additional therapeutic agent can be administered simultaneously, in the same or in separate compositions, or sequentially.
- the TFP-expressing cell described herein can be administered first, and the additional agent can be administered second, or the order of administration can be reversed.
- a TFP-expressing cell described herein may be used in a treatment regimen in combination with surgery, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, antibodies, or other immunoablative agents such as alemtuzumab, anti-CD3 antibodies or other antibody therapies, cyclophosphamide, fludarabine, cyclosporin, tacrolimus (fujimycin), rapamycin, mycophenolic acid, steroids, romidepsin (also known as FR901228), cytokines, and irradiation, peptide vaccine, such as that described in Izumoto et al. 2008 J Neurosurg 108:963-971.
- immunosuppressive agents such as cyclosporin, azathioprine, methotrexate, mycophenolate, antibodies, or other immunoablative agents such as alemtuzumab, anti-CD3 antibodies or other antibody therapies, cyclo
- the subject can be administered an agent which reduces or ameliorates a side effect associated with the administration of a TFP-expressing cell.
- Side effects associated with the administration of a TFP-expressing cell include, but are not limited to cytokine release syndrome (CRS), and hemophagocytic lymphohistiocytosis (HLH), also termed Macrophage Activation Syndrome (MAS).
- CRS cytokine release syndrome
- HHL hemophagocytic lymphohistiocytosis
- MAS Macrophage Activation Syndrome
- Symptoms of CRS include high fevers, nausea, transient hypotension, hypoxia, and the like.
- the methods described herein can comprise administering a TFP- expressing cell described herein to a subject and further administering an agent to manage elevated levels of a soluble factor resulting from treatment with a TFP-expressing cell.
- the soluble factor elevated in the subject is one or more of IFN- ⁇ , TNFa, IL-2, IL-6, and
- an agent administered to treat this side effect can be an agent that neutralizes one or more of these soluble factors.
- agents include, but are not limited to a steroid, an inhibitor of TNFa, and an inhibitor of IL-6.
- TNFa inhibitor is etanercept (marketed under the name ENBREL®).
- IL-6 inhibitor is tocilizumab (marketed under the name
- the subject can be administered an agent which enhances the activity of a TFP-expressing cell.
- the agent can be an agent which inhibits an inhibitory molecule.
- Inhibitory molecules e.g. , Programmed Death 1 (PD1)
- PD1 can, in some embodiments, decrease the ability of a TFP-expressing cell to mount an immune effector response.
- Examples of inhibitory molecules include PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and TGFR beta.
- Inhibition of an inhibitory molecule e.g. , by inhibition at the DNA, RNA or protein level, can optimize a TFP-expressing cell performance.
- an inhibitory nucleic acid e.g. , an inhibitory nucleic acid, e.g. , a dsRNA, e.g. , an siRNA or shRNA
- an inhibitory nucleic acid e.g. , an inhibitory nucleic acid, e.g. , a dsRNA, e.g. , an siRNA or shRNA
- the inhibitor is a shRNA.
- the inhibitory molecule is inhibited within a TFP-expressing cell.
- a dsRNA molecule that inhibits expression of the inhibitory molecule is linked to the nucleic acid that encodes a component, e.g. , all of the components, of the TFP.
- the inhibitor of an inhibitory signal can be, e.g.
- an antibody or antibody fragment that binds to an inhibitory molecule can be an antibody or antibody fragment that binds to PD1, PD-L1, PD-L2 or CTLA4 ⁇ e.g. , ipilimumab (also referred to as MDX-010 and MDX-101, and marketed as YERVOY ® ); Bristol-Myers Squibb; tremelimumab (IgG2 monoclonal antibody available from Pfizer, formerly known as ticilimumab, CP-675,206)).
- the agent is an antibody or antibody fragment that binds to T-cell immunoglobulin and mucin-domain containing-3 (TIM3).
- the agent is an antibody or antibody fragment that binds to Lymphocyte-activation gene 3 (LAG3).
- an agent suitable for use in combination with the TFP T cells disclosed herein is an agent that modulates myeloid suppressor cells, e.g., CCR2 antibodies.
- Other therapeutics, e.g, nanoparticle therapeutics, are known in the art.
- the agent which enhances the activity of a TFP-expressing cell can be, e.g., a fusion protein comprising a first domain and a second domain, wherein the first domain is an inhibitory molecule, or fragment thereof, and the second domain is a polypeptide that is associated with a positive signal, e.g., a polypeptide comprising an intracellular signaling domain as described herein.
- the polypeptide that is associated with a positive signal can include a costimulatory domain of CD28, CD27, ICOS, e.g., an intracellular signaling domain of CD28, CD27 and/or ICOS, and/or a primary signaling domain, e.g., of CD3 zeta, e.g., described herein.
- the fusion protein is expressed by the same cell that expressed the TFP.
- the fusion protein is expressed by a cell, e.g., a T-cell that does not express an anti-tumor-associated antigen TFP.
- compositions of the present invention may comprise a TFP-expressing cell, e.g., a plurality of TFP-expressing cells, as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
- Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like;
- compositions of the present invention are in one aspect formulated for intravenous administration.
- compositions of the present invention may be administered in a manner appropriate to the disease to be treated (or prevented).
- the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
- the pharmaceutical composition is substantially free of, e.g., there are no detectable levels of a contaminant, e.g., selected from the group consisting of endotoxin, mycoplasma, replication competent lentivirus (RCL), p24, VSV-G nucleic acid, HIV gag, residual anti-CD3/anti-CD28 coated beads, mouse antibodies, pooled human serum, bovine serum albumin, bovine serum, culture media components, vector packaging cell or plasmid components, a bacterium and a fungus.
- a contaminant e.g., selected from the group consisting of endotoxin, mycoplasma, replication competent lentivirus (RCL), p24, VSV-G nucleic acid, HIV gag, residual anti-CD3/anti-CD28 coated beads, mouse antibodies, pooled human serum, bovine serum albumin, bovine serum, culture media components, vector packaging cell or plasmid components, a bacterium and a fungus.
- the bacterium is at least one selected from the group consisting of Alcaligenes faecalis, Candida albicans, Escherichia coli, Haemophilus influenza, Neisseria meningitides, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus pneumonia, and Streptococcus pyogenes group A.
- an immunologically effective amount When “an immunologically effective amount,” “an anti -tumor effective amount,” “a tumor- inhibiting effective amount,” or “therapeutic amount” is indicated, the precise amount of the compositions of the present invention to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the T cells described herein may be administered at a dosage of 10 4 to 10 9 cells/kg body weight, in some instances 10 5 to 10 6 cells/kg body weight, including all integer values within those ranges. T-cell compositions may also be administered multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g. , Rosenberg et al, New Eng. J. of Med. 319: 1676, 1988).
- T cells can be activated from blood draws of from 10 cc to 400 cc.
- T cells are activated from blood draws of 20 cc, 30 cc, 40 cc, 50 cc, 60 cc, 70 cc, 80 cc, 90 cc, or 100 cc.
- compositions described herein may be administered to a patient trans arterially, subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally.
- the T-cell compositions of the present invention are administered to a patient by intradermal or subcutaneous injection.
- the T-cell compositions of the present invention are administered by i.v. injection.
- the compositions of T cells may be injected directly into a tumor, lymph node, or site of infection.
- subjects may undergo leukapheresis, wherein leukocytes are collected, enriched, or depleted ex vivo to select and/or isolate the cells of interest, e.g., T cells.
- T-cell isolates may be expanded by methods known in the art and treated such that one or more TFP constructs of the invention may be introduced, thereby creating a TFP-expressing T-cell of the invention.
- Subjects in need thereof may subsequently undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation.
- subjects receive an infusion of the expanded TFP T cells of the present invention.
- expanded cells are administered before or following surgery.
- the dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment.
- the scaling of dosages for human administration can be performed according to art-accepted practices.
- the dose for alemtuzumab (CAMPATH®), for example, will generally be in the range 1 to about 100 mg for an adult patient, usually administered daily for a period between 1 and 30 days.
- the preferred daily dose is 1 to 10 mg per day although in some instances larger doses of up to 40 mg per day may be used (described in U.S. Pat. No. 6,120,766).
- the TFP is introduced into T cells, e.g. , using in vitro transcription, and the subject ⁇ e.g.
- human receives an initial administration of TFP T cells of the invention, and one or more subsequent administrations of the TFP T cells of the invention, wherein the one or more subsequent administrations are administered less than 15 days, e.g. , 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2 days after the previous administration.
- more than one administration of the TFP T cells of the invention are administered to the subject ⁇ e.g. , human) per week, e.g. , 2, 3, or 4 administrations of the TFP T cells of the invention are administered per week.
- the subject e.g. , human subject
- receives more than one administration of the TFP T cells per week e.g.
- TFP T cells are administered every other day for 3 administrations per week.
- the TFP T cells of the invention are administered for at least two, three, four, five, six, seven, eight or more weeks.
- tumor-associated antigen TFP T cells are generated using lentiviral viral vectors, such as lentivirus. TFP-T cells generated that way will have stable TFP expression.
- TFP T cells transiently express TFP vectors for 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 days after transduction.
- Transient expression of TFPs can be effected by RNA TFP vector delivery.
- the TFP RNA is transduced into the T-cell by electroporation.
- a potential issue that can arise in patients being treated using transiently expressing TFP T cells is anaphylaxis after multiple treatments.
- anaphylactic response might be caused by a patient developing humoral anti-TFP response, i.e., anti-TFP antibodies having an anti-IgE isotype. It is thought that a patient's antibody producing cells undergo a class switch from IgG isotype (that does not cause anaphylaxis) to IgE isotype when there is a ten- to fourteen-day break in exposure to antigen.
- TFP T-cell infusion breaks should not last more than ten to fourteen days.
- Anti-TAA TFP constructs are engineered by cloning one or more anti-TAA scFv DNA fragment or CD 16 fragment linked to a CD3 or TCR DNA fragment by either a DNA sequence encoding a short linker (SL): AA AGGGGS GGGGS GGGGSLE (SEQ ID NO:2) or a long linker (LL): AA AIEVMYPPPYLGGGGS GGGGS GGGGSLE (SEQ ID NO:3) into, e.g., p510 vector ((System Biosciences (SBI)) at Xbal and EcoRl sites.
- SL short linker
- LL long linker
- CAR constructs are generated by cloning synthesized DNA encoding an anti-TAA antibody (e.g., NKG2D or anti-RORl), partial CD28 extracellular domain, CD28 transmembrane domain, CD28 intracellular domain and CD3 zeta into, e.g., a p510 vector at Xbal and EcoRl sites.
- CD3s TFP constructs disclosed herein comprise the sequence set forth in SEQ ID NO: 97, which has an N-terminal truncation in reference to the full sequence (SEQ ID NO: 4).
- the anti-RORl, NKG2D, etc. TFPs are generated as described above.
- the anti- ROR1TFP constructs generated are p510_antiRORl_LL_TCRa (anti-RORl scFv - long linker- human full length T cell receptor a chain), p510_antiRORl_LL_TCR aC (anti-RORl scFv - long linker- human T cell receptor a constant domain chain), p510_antiRORl_LL_TCRP (anti-RORl scFv - long linker- human full length T cell receptor ⁇ chain), p510_antiRORl_LL_TCRpC (anti- RORl scFv - long linker- human T cell receptor ⁇ constant domain chain),
- p510_antiRORl_SL_TCRP anti-RORl scFv - short linker- human full length T cell receptor ⁇ chain
- p510_antiRORl_SL_CD3Y anti-RORl scFv - short linker- human CD3y chain
- p510_antiRORl_SL_CD3 ⁇ anti-RORl scFv - short linker- human CD3 ⁇ chain
- p510_antiRORl_SL_CD38 anti-RORl scFv - short linker- human CD3s chain.
- the anti-RORl CAR construct, p510_antiRORl_28 ⁇ is generated by cloning synthesized DNA encoding anti-RORl, partial CD28 extracellular domain, CD28 transmembrane domain, CD28 intracellular domain and CD3 zeta into p510 vector at Xbal and EcoRl sites.
- Dual specificity TFP constructs wherein both scFvs are expressed in the same TCR are engineered.
- a first anti-tumor antigen scFv DNA fragment is linked to a CD3 or TCR DNA fragment by either a DNA sequence encoding a short linker (SL): A AAGGGGS GGGGS GGGGSLE or a long linker (LL):
- a second anti-tumor antigen scFv DNA fragment is operatively linked to the first anti-tumor antigen fragment by a SL or LL.
- a first anti-tumor antigen scFv DNA fragment is linked to a first CD3 or TCR fragment by either a DNA sequence encoding a SL or an LL in a first expression construct
- a second anti-tumor antigen scFv DNA fragment is linked to a first CD3 or TCR fragment by either a DNA sequence encoding a SL or an LL in a second expression construct.
- an anti-CD20 or anti-CD22 antigen scFv DNA fragment is operatively connected to a CD3s DNA fragment
- an anti-CD 19 scFv DNA fragment is operatively connected to a CD3y scFv DNA fragment, each in its own viral expression construct.
- Any combination of CD3 subunits may be used, such as CD3s/ CD3s, CD3s/ CD3 , CD3s/CD35, CD3s/CD3a and the like.
- both viral expression constructs are used to transduce the same population of T cells such that one population of T cells will have TFPs specific to more than one tumor-associated antigen.
- the viral expression constructs are each used to transduce a separate population of T cells, and the two populations of transduced T cells are then mixed before using. Exemplary strategies of producing dual specificity T cell populations are shown in FIGs. 1A and IB
- an anti-tumor-associated antigen CAR construct is generated as a comparator.
- a p510_antitumor-associated mtigen_2 ⁇ CAR is generated by cloning synthesized DNA encoding anti-tumor-associated antigen, partial CD28 extracellular domain, CD28
- transmembrane domain transmembrane domain, CD28 intracellular domain and CD3 zeta into p510 vector at Xbal and EcoRl sites.
- Anti-BCMA TFP constructs were engineered by cloning an anti-BCMA scFv DNA fragment linked to a CD3 DNA fragment by a DNA sequence encoding the linker:
- GGGGS GGGGS GGGGSLE (SEQ ID NO: 1) into p510 vector (SBI) at Xbal and EcoRl sites.
- the anti-BCMA TFP constructs generated were p510_antiBCMA_CD3y (anti-BCMA scFv (or V H H) - linker- human CD3y chain) and p510_anti-BCMA_CD38 (anti-BCMA scFv (or V H H) - linker- human CD3s chain).
- Anti-CD19 TFP constructs were engineered by cloning an anti-CD19 scFv DNA fragment linked to a CD3 or TCR DNA fragment by either a DNA sequence encoding a short linker (SL): A AAGGGGS GGGGS GGGGSLE (SEQ ID NO:2) or a long linker (LL):
- SL short linker
- LL long linker
- AAAIEVMYPPPYLGGGGSGGGGSGGGGSLE (SEQ ID NO: 3) into p510 vector ((System Biosciences (SBI)) at Xbal and EcoRl sites.
- the anti-CD19 TFP constructs generated were p510_antiCD19_LL_TCRa (anti-CD19 scFv - long linker- human full length T cell receptor a chain), p510_antiCD19_LL_TCR aC (anti-CD19 scFv - long linker- human T cell receptor a constant domain chain), p510_antiCD19_LL_TCR ⁇ $ (anti-CD 19 scFv - long linker- human full length T cell receptor ⁇ chain),
- p510_antiCD19_LL_TCR C anti-CD19 scFv - long linker- human T cell receptor ⁇ constant domain chain
- p510_antiCD19_LL_CD3Y anti-CD19 scFv - long linker- human CD3y chain
- p510_antiCD19_LL_CD35 anti-CD19 scFv - long linker- human CD35 chain
- p510_antiCD19_SL_TCRP anti-CD19 scFv - short linker- human full length T cell receptor ⁇ chain
- p510_antiCD19_SL_CD3Y anti-CD19 scFv - short linker- human CD3y chain
- p510_antiCD19_SL_CD3 ⁇ anti-CD19 scFv - short linker- human CD3 ⁇ chain
- p510_antiCD19_SL_CD38 anti-CD19 scFv - short linker- human CD3s chain.
- the anti-CD19 CAR construct, ⁇ 510_3 ⁇ ⁇ 19_28 ⁇ was generated by cloning synthesized DNA encoding anti-CD19, partial CD28 extracellular domain, CD28 transmembrane domain, CD28 intracellular domain and CD3 zeta into p510 vector at Xbal and EcoRl sites.
- Anti-CD22 TFP constructs were engineered by cloning an anti-CD 19 scFv DNA fragment linked to a CD3 or TCR DNA fragment by either a DNA sequence encoding a short linker (SL): A AAGGGGS GGGGS GGGGSLE or a long linker (LL):
- SL short linker
- LL long linker
- Anti-TAA antibodies that are capable of specifically binding to the human TAA polypeptide(s), and fragments or domains thereof.
- Anti-TAA antibodies can be generated using diverse technologies (see, e.g., (Nicholson et al, 1997). Where murine anti-TAA antibodies are used as a starting material, humanization of murine anti-TAA antibodies is desired for the clinical setting, where the mouse-specific residues may induce a human-anti-mouse antigen (HAMA) response in subjects who receive T-cell receptor (TCR) fusion protein (TFP) treatment, i.e., treatment with T cells transduced with the TFP.TAA construct.
- TCR T-cell receptor
- TFP TFP fusion protein
- Humanization is accomplished by grafting CDR regions from murine anti-TAA antibody onto appropriate human germline acceptor frameworks, optionally including other modifications to CDR and/or framework regions.
- antibody and antibody fragment residue numbering follows Kabat (Kabat E. A. et al, 1991; Chothia et al, 1987).
- the human BCMA polypeptide canonical sequence is UniProt Accession No. Q02223.
- the human ROR1 polypeptide canonical sequence is UniProt Accession No. Q01973-1.
- the human NKG2D polypeptide canonical sequence is UniProt Accession No. P26718-1 (isoform 1).
- polypeptides that are capable of specifically binding to the Fc portion of human IgGs, and fragments or domains thereof.
- Human or humanized anti-TAA IgGs are used to generate scFv sequences for TFP constructs.
- DNA sequences coding for human or humanized V L and V H domains are obtained, and the codons for the constructs are, optionally, optimized for expression in cells from Homo sapiens.
- the order in which the VL and VH domains appear in the scFv is varied (i.e., VL-VH, or VH-VL orientation), and three copies of the "G4S" or "G 4 S" subunit (G 4 S) 3 connect the variable domains to create the scFv domain.
- Anti-BCMA scFv plasmid constructs can have optional Flag, His or other affinity tags, and are electroporated into HEK-293 or other suitable human or mammalian cell lines and purified.
- Validation assays include binding analysis by FACS, kinetic analysis using Proteon, and staining of TAA-expressing cells.
- Exemplary anti-RORl VL and VH domains, CDRs, and the nucleotide sequences encoding them, can be those described in U.S. Patent No. : U.S. 9,316,646, U.S. Patent Publication No.
- anti-RORl VL and VH domains, CDRs, and the nucleotide sequences encoding them, respectively, can be those of the following monoclonal antibodies: mouse anti-RORl antibody 2H6, mouse anti-RORl antibody 2A2, and the following polyclonal antibodies: anti-RORl goat anti-RORl antibody Catalog Number: AF2000 (R&D Systems), Antibody No. ABIN2869437, mouse anti-RORl Antibody No. ABIN969385, anti-RORl Antibody No. ABIN1108893, and rabbit polyclonal anti-RORl antibody Cat. No. ABIN359929 (Antibodies Online).
- Exemplary anti-BMCA and anti-CD19 antibodies are disclosed in co-pending International Patent Publication No. WO/2017/187349, herein incorporated by reference.
- Exemplary anti-BMCA and anti-CD19 CDRs of V L and V H domains and the nucleotide sequences encoding them, respectively, are shown below:
- CD16 TFPs disclosed herein comprise the amino acid sequence set forth in SEQ ID NO:23. In other embodiments, CD16 TFPs disclosed herein comprise the extracellular domain of CD16 only, as set forth in SEQ ID NO: 106.
- the antibodies or fragments thereof disclosed herein comprise single domain antibodies (sdAbs) such as camelids.
- the anti-RORl sdAbs for use in the TFP constructs disclosed herein are encoded by any one of SEQ ID Nos: 80-96.
- the anti-RORl antibodies or fragments thereof are scFvs.
- An exemplary anti-RORl binder is encoded by SEQ ID NO: 65, which encodes scFv "2-7" in the orientation VH linker VL.
- Another exemplary binder is encoded by NO: 69, which encodes scFv "2-9" in the orientation VH_linker_VL.
- Another exemplary binder is encoded by NO:79, which encodes scFv "3-6" in the orientation VL linker VH.
- NKG2D binders of NKG2D Ugand (NKG2DL)
- the NKG2DL binder is a monomer, e.g., one that is encoded by the sequence set forth in SEQ ID NO: 107. In other embodiments, the NKG2DL binder is a dimer, e.g., one that is encoded by the sequence set forth in SEQ ID NO: 108.
- Amino acid sequence AETSHVPWT (SEQ ID NO:46)
- Subunits of the human T Cell Receptor (TCR) complex all contain an extracellular domain, a transmembrane domain, and an intracellular domain.
- a human TCR complex contains the CD3 - epsilon polypeptide, the CD3 -gamma polypeptide, the CD3 -delta polypeptide, the CD3-zeta polypeptide, the TCR alpha chain polypeptide and the TCR beta chain polypeptide.
- the human CD3 -epsilon polypeptide canonical sequence is UniProt Accession No. P07766.
- the human CD3- gamma polypeptide canonical sequence is UniProt Accession No. P09693.
- the human CD3 -delta polypeptide canonical sequence is UniProt Accession No. P043234.
- the human CD3-zeta polypeptide canonical sequence is UniProt Accession No. P20963.
- the human TCR alpha chain canonical sequence is UniProt Accession No. Q6ISU1.
- the human TCR beta chain C region canonical sequence is UniProt Accession No. P01850, a human TCR beta chain V region sequence is P04435.
- the human CD3 -epsilon polypeptide canonical sequence is:
- the human CD3 -epsilon fragment used in the TFPs is DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFS ELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWS KNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI (SEQ ID NO:97)
- the human CD3 -gamma polypeptide canonical sequence is:
- the human CD3-gamma fragment used in the TFPs is:
- the human CD3 -delta polypeptide canonical sequence is:
- the human CD3-delta fragment used in the TFPs is:
- the human CD3-zeta polypeptide canonical sequence is:
- the human CD3-zeta fragment used in the TFPs is:
- the human TCR alpha chain canonical sequence is:
- the human TCR alpha chain C region canonical sequence is:
- the human TCR alpha chain V region CTL-L17 canonical sequence is:
- the human TCR beta chain C region canonical sequence is:
- the human TCR beta chain V region CTL-L17 canonical sequence is:
- the human TCR beta chain V region YT35 canonical sequence is:
- An exemplary dual specificity TFP is a TFP with scFvs with binding specificity to BCMA and CD19. Another exemplary dual specificity TFP is a TFP with scFvs with binding specificity to BCMA and CD20. Another exemplary dual specificity TFP is a TFP with scFvs with binding specificity to BCMA and CD22. Another exemplary dual specificity TFP is a TFP with scFvs with binding specificity to CD19 and CD22.
- Anti-TAA scFvs are recombinantly linked to CD3-epsilon or other TCR subunits (see 1C) using a linker sequence, such as G 4 S, or (GiS Various linkers and scFv configurations are used.
- TCR alpha and TCR beta chains are used for generation of TFPs either as full-length polypeptides or as only their constant domains. Any variable sequence of TCR alpha and TCR beta chains is suitable for making TFPs.
- CD 19 scFvs are recombinantly linked to a second CD3-epsilon or other TCR subunit using a linker sequence as described above.
- CD 16 peptides are recombinantly linked to CD3-epsilon or other TCR subunits (see 1C) using a linker sequence, such as G 4 S, or (GiS Various linkers and scFv
- TCR alpha and TCR beta chains were used for generation of TFPs either as full-length polypeptides or only their constant domains. Any variable sequence of TCR alpha and TCR beta chains is allowed for making TFPs.
- TFP Expression Vectors are utilized.
- Expression vectors include: a promoter (Cytomegalovirus (CMV) enhancer-promoter), a signal sequence to enable secretion, a polyadenylation signal and transcription terminator (Bovine Growth Hormone (BGH) gene), an element allowing episomal replication and replication in prokaryotes ⁇ e.g., SV40 origin and ColEl or others known in the art) and elements to allow selection (ampicillin resistance gene and zeocin marker).
- CMV Cytomegalovirus
- BGH Bovine Growth Hormone
- the TFP-encoding nucleic acid construct or constructs is/are cloned into one or more lentiviral expression vectors and expression validated based on the quantity and quality of the effector T-cell response of transduced T cells in response to TAA+ target cells.
- Effector T-cell responses include, but are not limited to, cellular expansion, proliferation, doubling, cytokine production and target cell lysis or cytolytic activity (i.e., degranulation).
- the single or dual specificity TFP lentiviral transfer vectors are used to produce the genomic material packaged into the VSVg pseudotyped lentiviral particles.
- Lentiviral transfer vector DNA is mixed with the three packaging components of VSVg, gag/pol and rev in combination with
- Lipofectamine® reagent to transfect them together into 293 cells. After 24 and 48 hours, the media is collected, filtered and concentrated by ultracentrifugation. The resulting viral preparation is stored at -80°C. The number of transducing units is determined by titration on SupTl cells (T cell lymphoblastic lymphoma, (ATCC® CRL-1942TM). Redirected dual specificity TFP T cells are produced by activating fresh naive T cells with anti-CD3x anti-CD28 beads for 24 hrs and then adding the appropriate number of transducing units to obtain the desired percentage of transduced T cells. These modified T cells are allowed to expand until they become rested and come down in size at which point they are cryopreserved for later analysis.
- the cell numbers and sizes are measured using a Coulter Counter® MultisizerTM 3 (Beckman Coulter). Before cryopreserving, percentage of cells transduced (expressing TFP.BCMA on the cell surface) and their relative fluorescence intensity of that expression are determined by flow cytometric analysis. From the histogram plots, the relative expression levels of the TFPs are examined by comparing percentage transduced with their relative fluorescent intensity.
- multiple TFPs are introduced by T-cell transduction with multiple viral vectors.
- TFP.TAA T cells The functional abilities of TFP.TAA T cells to produce cell-surface-expressed TFPs, and to kill target tumor cells, proliferate and secrete cytokines are determined using assays known in the art.
- Human PBMCs e.g., blood from a normal apheresed donor whose naive T cells are obtained by negative selection for T cells, CD4 + and CD8 + lymphocytes
- IL-2 human interleukin-2
- Flow cytometry assays are utilized to confirm cell surface presence of a TFP, such as by an anti-FLAG antibody or an anti-murine variable domain antibody.
- Cytokine e.g., IFN- ⁇
- production is measured using ELISA or other assays.
- Primary human ALL cells can be grown in immune compromised mice (e.g., NSG or NOD) without having to culture them in vitro. Likewise, cultured human ALL cell lines can induce leukemia in such mice. ALL-bearing mice can be used to test the efficacy of human TFP.TAA T cells, for instance, in the model HALLX5447. The readout in this model is the survival of mice after intravenous (i.v.) infusion of ALL cells in the absence and presence of i.v. administered human TFP.TAA T cells.
- Example 4 Human TFP T-cell Treatment in an In Vivo Solid Tumor Xenograft Mouse Model
- TFP.TAA T cells can also be tested in immune compromised mouse models bearing subcutaneous solid tumors derived from human TAA-expressing human cell lines. Tumor shrinkage in response to human TFP.TAA T-cell treatment can be either assessed by caliper measurement of tumor size, or by following the intensity of a GFP fluorescence signal emitted by GFP-expressing tumor cells.
- Exemplary solid cancer cells include solid tumor cell lines, such as provided in The Cancer Genome Atlas (TCGA) and/or the Broad Cancer Cell Line Encyclopedia (CCLE, see Barretina et al, Nature 483:603 (2012)).
- Exemplary solid cancer cells include primary tumor cells isolated from mesothelioma, renal cell carcinoma, stomach cancer, breast cancer, lung cancer, ovarian cancer, prostate cancer, colon cancer, cervical cancer, brain cancer, liver cancer, pancreatic cancer, kidney, endometrial, or stomach cancer.
- the cancer to be treated is selected from the group consisting of mesotheliomas, papillary serous ovarian
- adenocarcinomas clear cell ovarian carcinomas, mixed Mullerian ovarian carcinomas, endometroid mucinous ovarian carcinomas, pancreatic adenocarcinomas, ductal pancreatic adenocarcinomas, uterine serous carcinomas, lung adenocarcinomas, extrahepatic bile duct carcinomas, gastric adenocarcinomas, esophageal adenocarcinomas, colorectal adenocarcinomas and breast
- mice can be used to test the efficacy of TFP.
- tumor-associated antigen T cells in the human tumor xenograft models (see, e.g., Morton et al., Nat. Procol. 2:247 (2007)).
- Ixl0 6 -lxl0 7 primary cells collagenase-treated bulk tumor suspensions in EC matrix material
- tumor fragments primary tumor fragments in EC matrix material
- Lentivirus encoding the appropriate constructs are prepared as follows. 5x10 6 HEK-293FT cells are seeded into a 100 mm dish and allowed to reach 70-90% confluency overnight. 2.5 ⁇ g of the indicated DNA plasmids and 20 ⁇ Lentivirus Packaging Mix (ALSTEM, cat# VP100) are diluted in 0.5 mL DMEM or Opti-MEM® I Medium without serum and mixed gently. In a separate tube, 30 uL of NanoFect® transfection reagent (ALSTEM, cat# NFIOO) is diluted in 0.5 mL DMEM or Opti-MEM I Medium without serum and mixed gently.
- ALSTEM Lentivirus Packaging Mix
- NanoFect 'DMEM and DNA/DMEM solutions are then mixed together and vortexed for 10-15 seconds prior to incubation of the DMEM- plasmid-NanoFect mixture at room temperature for 15 minutes.
- the complete transfection complex from the previous step is added dropwise to the plate of cells and rocked to disperse the transfection complex evenly in the plate.
- the plate is then incubated overnight at 37°C in a humidified 5% C02 incubator. The following day, the supernatant is replaced with 10 mL fresh media and supplemented with 20 ⁇ of ViralBoostTM (500x, ALSTEM, cat# VB100). The plates are then incubated at 37°C for an additional 24 hours.
- ViralBoostTM 500x, ALSTEM, cat# VB100
- the lentivirus containing supernatant is then collected into a 50 mL sterile, capped conical centrifuge tube and put on ice. After centrifugation at 3000 rpm for 15 minutes at 4°C, the cleared supernatant is filtered with a low-protein binding 0.45 ⁇ sterile filter and virus is subsequently isolated by ultracentrifugation at 25,000 rpm (Beckmann, L8-70M) for 1.5 hours, at 4°C. The pellet is removed and re-suspended in DMEM media and lentivirus
- concentrations/titers are established by quantitative RT-PCR, using the Lenti-XTM qRT-PCR
- Titration kit (Clontech®; catalog number 631235). Any residual plasmid DNA is removed by treatment with DNasel. The virus stock preparation is either used for infection immediately or aliquoted and stored at -80°C for future use.
- Lentivirus titers were established by transducing Jurkat cells with different amount of virus preparation. The DNA was then isolated from the transduced Jurkat cells 24 hours after transduction. The virus titer was determined by quantitative real-time PCR, with in-house designed primers/probe specific for Woodchuck Hepatitis Virus (WHP) Posttranscriptional Regulatory Element (WPRE) as well for albumin (internal quantitation control).
- WP Woodchuck Hepatitis Virus
- WPRE Posttranscriptional Regulatory Element
- PBMCs Peripheral Blood Mononuclear Cells
- PBMCs Peripheral Blood Mononuclear Cells
- Whole blood is collected in 10 rriL Heparin vacutainers and either processed immediately or stored overnight at 4 °C.
- Approximately 10 mL of whole anti -coagulated blood is mixed with sterile phosphate buffered saline (PBS) buffer for a total volume of 20 mL in a 50 mL conical centrifuge tube (PBS, pH 7.4, without Ca 2+ /Mg 2+ ).
- PBS sterile phosphate buffered saline
- Buffy coat is purchased from Research Blood Components (Boston, MA). LeucoSepTM tubes (Greiner bio-one) are prepared by adding 15 mL Ficoll-Paque® (GE Health Care) and centrifuged at lOOOg for 1 minute. Buffy coat is diluted 1 :3 in PBS (pH 7.4, without Ca 2+ or Mg 2+ ). The diluted buffy coat is transferred to LeucoSep tube and centrifuged at lOOOg for 15 minutes with no brake application. The layer of cells containing PBMCs, seen at the diluted plasma/Ficoll interface, is removed carefully to minimize contamination by Ficoll®.
- Residual Ficoll, platelets, and plasma proteins are then removed by washing the PBMCs three times with 40 mL of PBS by centrifugation at 200g for 10 minutes at room temperature. The cells are then counted with a hemocytometer. CD4 + and CD8 + T cells are then frozen down in freezing medium (90% FBS+10% DMS0 at a
- PBMCs prepared from either whole blood or buffy coat are stimulated with anti-human CD28 and CD3 antibody-conjugated magnetic beads for 24 hours prior to viral transduction.
- Freshly isolated PBMCs are washed once in CAR-T medium (AFM V-AlbuMAX(BSA, Life Technologies), with 5% AB serum and 1.25 ⁇ g/mL amphotericin B (Gemini Bioproducts), 100 U/mL penicillin, and 100 ⁇ g/mL streptomycin) without huIL-2, before being re-suspended at a final concentration of lxlO 6 cells/mL in CAR-T medium with 300 IU/mL human IL-2, IL-7, or IL-15 (from a lOOOx stock; Invitrogen).
- frozen CD4 + /CD8 + T cells are thawed in pre-warmed DMEM + 10 % FBS, spun down, and then resuspended in complete T cell expansion medium supplemented with 300 IU/mL huIL2 (Thermo Fisher®) at a final concentration of 1 x 106 cells/mL.
- huIL2 300 IU/mL huIL2
- anti -human CD28 and anti -human CD3 antibody-conjugated magnetic beads Prior to being used to activate T cells, anti -human CD28 and anti -human CD3 antibody-conjugated magnetic beads (Dynabeads®, Thermo Fisher) are washed three times with sterile 1 x PBS (pH7.4), using a magnetic rack to isolate beads from the solution.
- T cells were then mixed with the beads at 1 : 1 ratio, by transferring 25 ⁇ (lxlO 6 beads) of beads to 1 mL of T cell suspension.
- the beads/cells mixture is then dispensed to single wells of a non-TC treated 12-well plate, and incubated at 37oC [0372] Prior to activation, anti -human CD28 and CD3 antibody-conjugated magnetic beads
- PBMC and beads are then mixed at a 1 : 1 bead-to-cell ratio, by transferring 25 ⁇ L (lxlO 6 beads) of beads to 1 mL of PBMC. The desired number of aliquots are then dispensed to single wells of a 12-well low- attachment or non-treated cell culture plate, and incubated at 37 °C, with 5% C02, for 24 hours before viral transduction.
- Lentivirus was thawed on ice and then added to activated T cells at indicated MOI in the presence of 10 ⁇ g/ml Polybrene (Sigma). Cells were spinoculated with the lentivirus at 200 g for 100 minutes at room temperature. The transduced T cells were incubated for an additional 24 hr before an additional lentivirus transduction. After the 2nd round of lentivirus transduction, the T cells were expanded in T cell expansion medium supplemented with 300 IU/mL of hIL-2 and sub-cultured every other day at 5 x 10 5 cells/mL.
- activated PBMCs are electroporated with in vitro transcribed (IVT) mRNA.
- Human PBMCs are stimulated with Dynabeads® (Thermo Fisher®) at 1-to-l ratio for 3 days in the presence of 300 IU/ml recombinant human IL-2 (R&D System). The beads are removed before electroporation. The cells are washed and re-suspended in OPTI-MEM® medium (Thermo Fisher) or AimV medium (Invitrogen) in 5% hAB serum (Gemini Bio-Products) and 1% antibiotics at the concentration of 2.5xl0 7 cells/ mL.
- OPTI-MEM® medium Thermo Fisher
- AimV medium Invitrogen
- TFPs e.g., ROR1, NKG2D, CD 16, or dual specificity TFPs
- T cells are stained using anti-CD3 APC (Clone, UCHTl), anti-CD4-Pacific blue (Clone, RPAT4), anti-CD8-APCCY7 (Clone), and e.g., human NKG2D/CD314-APC (R&D systems, LOT #LCO061321) and their respective isotype controls (BD biosciences).
- T cells are washed three times in 3 mL staining buffer (PBS, 4% BSA) and re-suspended in PBS at lxl 0 6 cells per well.
- staining buffer PBS, 4% BSA
- cells are incubated with LIVE/DEAD® Fixable Aqua Dead Cell Stain (Invitrogen) for 30 minutes on ice.
- Cells are washed twice with PBS and re- suspended in 50 ⁇ staining buffer.
- 1 ⁇ of 1 : 100 diluted normal goat lgG (BD Bioscience) is added to each tube and incubated in ice for 10 minutes.
- scFv TFPs 1.0 rriL FACS buffer is added to each tube, mixed well, and cells are pelleted by centrifugation at 300g for 5 min.
- Surface expression of scFv TFPs is detected by Zenon® R-Phycoerythrin-labeled human NKG2D IgGl Fc or human IgGl isotype control. 1 ⁇ g antibodies are added to the respective samples and incubated for 30 minutes on ice. Cells are then washed twice, and stained for surface markers using Anti-CD3 APC (clone, UCHT1), anti-CD4-Pacific blue (Clone RPA-T4), anti-CD8 APCCy7(Clone SKI), from BD bioscience.. Flow cytometry is performed using BD-LSRII Fortessa® X20 (BD
- FIG. 2A shows the surface expression analysis of activated PBMC cells stained for CD 8 (anti-CD8 APCCy7, y-axes) and NKG2D ("NKG2D”) (Zenon® R-Phycoerythrin-labeled hNKG2D IgG, x-axes). Shown from left to right are cells that were either non-transduced or transduced with NKG2D-CD3s, ⁇ 02 ⁇ 28 ⁇ , and NKG2D- 41 ⁇ constructs. The proportion of CD8 + , NKG2D + cells is shown in the top right corner of each panel.
- TFP carrying anti-CD 19 or anti-BCMA scFv is detected with biotinylated goat anti-mouse F(ab')2 (Thermo Fisher) at 4.5 ⁇ g per sample for 30 minutes at 4 °C. After 3 washes with staining buffer, the cells are stained with PE-conjugated streptavidin (BD Biosciences, at 1: 1000 dilution). The surface expression of TFP bearing an anti -tumor-associated antigen (Ag) scFv is also detected by staining with Ag Fc fusion protein.
- biotinylated goat anti-mouse F(ab')2 Thermo Fisher
- the Ag Fc fusion protein e.g., a BCMA-Fc fusion protein
- a BCMA-Fc fusion protein is expressed in-house and labelled with Zenon®-PE (Thermo Fisher) according to manufacturer's protocol.
- the T cells are stained with LIVE/DEAD® Fixable Aqua Dead Cell Stain, blocked with Human BD Fc BlockTM and then stained with 1 ⁇ g of labelled BCMA Fc fusion sample per sample.
- the T cell markers are stained with APC mouse anti -human CD3 antibody (Clone-UCHTl, BD Biosciences, at 1: 100 dilution), PerCP/Cy5.5 mouse anti-human CD8 antibody (Clone-SKl, BD Biosciences, at 1: 100 dilution) and Pacific BlueTM mouse anti -human CD4 antibody (Clone-RPA-T4, BD Biosciences, at 1 : 1000 dilution) for 30 minutes at 4°C. After 2 washes with staining buffer, the cells are then run on LSRFortessaTM X20 (BD Biosciences). The data are acquired using FACSDiva® and analyzed with FlowJo® (Treestar, Inc. Ashland, OR).
- Results are shown in FIG. 2B, which confirmed expression of the TCRs.
- the cells were sorted by surface expression of CD8 (y-axes) and either anti-Fab (top row) or BCMA-Fc (bottom row) (x-axes). Shown are results from cells transduced with empty vector, anti-CD 19-CD3s, anti- BCMA-CD38, anti-BCMA-CD3Y, both anti-CD19-CD38 and anti-BCMA-CD38, or anti-CD19- CD3s + anti-BCMA-CD3y.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Epidemiology (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biotechnology (AREA)
- Wood Science & Technology (AREA)
- Hematology (AREA)
- Cell Biology (AREA)
- General Engineering & Computer Science (AREA)
- Diabetes (AREA)
- Microbiology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Oncology (AREA)
- Rheumatology (AREA)
- Obesity (AREA)
- Virology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Communicable Diseases (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/462,492 US11851491B2 (en) | 2016-11-22 | 2017-11-22 | Compositions and methods for TCR reprogramming using fusion proteins |
| EP17812183.6A EP3544996A2 (en) | 2016-11-22 | 2017-11-22 | Compositions and methods for tcr reprogramming using fusion proteins |
| CN201780083288.5A CN110177803A (zh) | 2016-11-22 | 2017-11-22 | 用于使用融合蛋白进行tcr重新编程的组合物和方法 |
| CA3044593A CA3044593A1 (en) | 2016-11-22 | 2017-11-22 | Compositions and methods for tcr reprogramming using fusion proteins |
| AU2017363311A AU2017363311A1 (en) | 2016-11-22 | 2017-11-22 | Compositions and methods for TCR reprogramming using fusion proteins |
| JP2019527363A JP7291396B2 (ja) | 2016-11-22 | 2017-11-22 | 融合タンパク質を用いたtcrの再プログラミングのための組成物及び方法 |
| JP2023087484A JP2023109968A (ja) | 2016-11-22 | 2023-05-29 | 融合タンパク質を用いたtcrの再プログラミングのための組成物及び方法 |
Applications Claiming Priority (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662425535P | 2016-11-22 | 2016-11-22 | |
| US201662425407P | 2016-11-22 | 2016-11-22 | |
| US62/425,407 | 2016-11-22 | ||
| US62/425,535 | 2016-11-22 | ||
| US201662425884P | 2016-11-23 | 2016-11-23 | |
| US201662425697P | 2016-11-23 | 2016-11-23 | |
| US62/425,884 | 2016-11-23 | ||
| US62/425,697 | 2016-11-23 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2018098365A2 true WO2018098365A2 (en) | 2018-05-31 |
| WO2018098365A3 WO2018098365A3 (en) | 2018-07-12 |
Family
ID=60655125
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/063137 Ceased WO2018098365A2 (en) | 2016-11-22 | 2017-11-22 | Compositions and methods for tcr reprogramming using fusion proteins |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US11851491B2 (https=) |
| EP (1) | EP3544996A2 (https=) |
| JP (2) | JP7291396B2 (https=) |
| CN (1) | CN110177803A (https=) |
| AU (1) | AU2017363311A1 (https=) |
| CA (1) | CA3044593A1 (https=) |
| WO (1) | WO2018098365A2 (https=) |
Cited By (41)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10208285B2 (en) | 2016-10-07 | 2019-02-19 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| CN109627340A (zh) * | 2018-12-05 | 2019-04-16 | 上海交通大学 | Cd3和prlr双特异性抗体及其构建与应用 |
| US10358474B2 (en) | 2015-05-18 | 2019-07-23 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| WO2019161281A1 (en) | 2018-02-17 | 2019-08-22 | Flagship Pioneering Innovations V, Inc. | Compositions and methods for membrane protein delivery |
| WO2019173693A1 (en) * | 2018-03-09 | 2019-09-12 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| WO2020033630A1 (en) * | 2018-08-08 | 2020-02-13 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind bcma, nkg2d and cd16, and methods of use |
| WO2020023888A3 (en) * | 2018-07-26 | 2020-07-30 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using target specific fusion proteins |
| WO2020142672A3 (en) * | 2019-01-04 | 2020-08-20 | Elstar Therapeutics, Inc. | Anti-tcr antibody molecules and uses thereof |
| WO2020181221A1 (en) * | 2019-03-07 | 2020-09-10 | Children's Medical Center Corporation | Targeted delivery of immune-modulating vhh and vhh-fusion protein |
| EP3715368A1 (en) | 2019-03-28 | 2020-09-30 | Albert-Ludwigs-Universität Freiburg | Chimeric antigen receptors, vectors coding for such receptors and their use in the modification of t cells |
| WO2020201527A1 (en) | 2019-04-04 | 2020-10-08 | Umc Utrecht Holding B.V. | Modified immune receptor constructs |
| WO2020210816A1 (en) * | 2019-04-12 | 2020-10-15 | Methodist Hospital Research Institute | Therapeutic particles that enable antigen presenting cells to attack cancer cells |
| CN112292147A (zh) * | 2018-06-19 | 2021-01-29 | 南京传奇生物科技有限公司 | 工程化的细胞及其用途 |
| WO2021022327A1 (en) * | 2019-08-05 | 2021-02-11 | Cartherics Pty. Ltd. | Immune cells expressing modified cell receptors and methods of making |
| WO2021050948A1 (en) * | 2019-09-12 | 2021-03-18 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| CN113728095A (zh) * | 2019-04-22 | 2021-11-30 | 南京传奇生物科技有限公司 | 工程化的细胞及其用途 |
| JP2022501074A (ja) * | 2018-10-01 | 2022-01-06 | アディセット バイオ, インコーポレイテッド | 血液腫瘍を治療するための遺伝子操作しているγδ−T細胞及び遺伝子操作していないγδ−T細胞に関する組成物及び方法 |
| US11242376B2 (en) | 2016-08-02 | 2022-02-08 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| WO2022140665A1 (en) * | 2020-12-23 | 2022-06-30 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| WO2022147481A1 (en) | 2020-12-30 | 2022-07-07 | Ansun Biopharma Inc. | Combination therapy of an oncolytic virus delivering a foreign antigen and an engineered immune cell expressing a chimeric receptor targeting the foreign antigen |
| CN115806625A (zh) * | 2021-09-15 | 2023-03-17 | 广州百暨基因科技有限公司 | T细胞限定表达的嵌合抗原受体及其应用 |
| WO2023081767A1 (en) | 2021-11-05 | 2023-05-11 | Precision Biosciences, Inc. | Methods for immunotherapy |
| WO2023091910A1 (en) | 2021-11-16 | 2023-05-25 | Precision Biosciences, Inc. | Methods for cancer immunotherapy |
| WO2023108150A1 (en) | 2021-12-10 | 2023-06-15 | Precision Biosciences, Inc. | Methods for cancer immunotherapy |
| US11834506B2 (en) | 2017-02-08 | 2023-12-05 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind NKG2D, CD16, and a tumor-associated antigen for activation of natural killer cells and therapeutic uses thereof to treat cancer |
| US11845797B2 (en) | 2018-07-03 | 2023-12-19 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
| US11851491B2 (en) | 2016-11-22 | 2023-12-26 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11884732B2 (en) | 2017-02-20 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Proteins binding HER2, NKG2D and CD16 |
| US11884733B2 (en) | 2018-02-08 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US12152073B2 (en) | 2018-03-14 | 2024-11-26 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
| US12157771B2 (en) | 2020-05-06 | 2024-12-03 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and CLEC12A |
| US12215157B2 (en) | 2018-02-20 | 2025-02-04 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use |
| US12247060B2 (en) | 2018-01-09 | 2025-03-11 | Marengo Therapeutics, Inc. | Calreticulin binding constructs and engineered T cells for the treatment of diseases |
| US12275791B2 (en) | 2018-08-08 | 2025-04-15 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use |
| US12358982B2 (en) | 2019-02-21 | 2025-07-15 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to T cell related cancer cells and uses thereof |
| US12378318B2 (en) | 2018-08-08 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and a tumor-associated antigen |
| US12377144B2 (en) | 2021-03-03 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen |
| US12384842B2 (en) | 2019-02-21 | 2025-08-12 | Marengo Therapeutics, Inc. | Antibody molecules that bind to NKP30 and uses thereof |
| US12384847B2 (en) | 2018-02-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen |
| US12486326B2 (en) | 2020-01-03 | 2025-12-02 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
| US12496274B2 (en) | 2018-11-14 | 2025-12-16 | Flagship Pioneering Innovations V, Inc. | Compositions and methods for compartment-specific cargo delivery |
Families Citing this family (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3615574A4 (en) | 2017-04-26 | 2021-02-24 | Eureka Therapeutics, Inc. | SPECIFIC GLYPICAN 3 RECOGNIZING CONSTRUCTS AND THEIR USE |
| JP7538601B2 (ja) | 2017-04-26 | 2024-08-22 | ユーリカ セラピューティックス, インコーポレイテッド | キメラ活性化受容体及びキメラ刺激受容体を発現する細胞並びにその使用 |
| CN114615886A (zh) * | 2019-08-29 | 2022-06-10 | 得克萨斯大学体系董事会 | 细胞冷冻保存培养基 |
| CN112500492B (zh) * | 2019-09-13 | 2023-08-04 | 中国科学院分子细胞科学卓越创新中心 | 一种嵌合抗原受体及其用途 |
| WO2021155034A1 (en) * | 2020-01-29 | 2021-08-05 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using muc16 specific fusion proteins |
| CA3171906A1 (en) * | 2020-03-16 | 2021-09-23 | University Of Southern California | Novel antigen binding domains and synthetic antigen receptors incorporating the same |
| WO2021226289A2 (en) * | 2020-05-05 | 2021-11-11 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using cd70 specific fusion proteins |
| CA3184784A1 (en) | 2020-05-27 | 2021-12-02 | The Medical College Of Wisconsin, Inc. | Improved lentiviral vector transfer plasmid and methods of use |
| CN113980136B (zh) * | 2020-07-27 | 2023-08-22 | 中国科学院分子细胞科学卓越创新中心 | 一种包含具有Y/F突变的CD3ε胞内区的嵌合抗原受体及其用途 |
| CN111995689B (zh) * | 2020-08-27 | 2023-05-05 | 深圳市体内生物医药科技有限公司 | 一种基因修饰的免疫细胞及其制备方法和应用 |
| US20220098616A1 (en) * | 2020-09-29 | 2022-03-31 | NeuExcell Therapeutics Inc. | ISL1 and LHX3 VECTOR |
| WO2022072325A1 (en) * | 2020-09-29 | 2022-04-07 | NeuExcell Therapeutics Inc. | Neurod1 combination vector |
| EP4222270A4 (en) * | 2020-09-29 | 2025-02-26 | Neuexcell Therapeutics Inc. | NEUROD1-VECTOR |
| CN114957481A (zh) * | 2021-02-25 | 2022-08-30 | 华夏英泰(北京)生物技术有限公司 | 针对cd19和cd22的双靶点star |
| WO2023010436A1 (zh) * | 2021-08-05 | 2023-02-09 | 卡瑞济(北京)生命科技有限公司 | Tcr表达构建体以及其制备方法和用途 |
| IL312204A (en) | 2021-10-28 | 2024-06-01 | Lyell Immunopharma Inc | Methods for culturing cells expressing ror1-binding protein |
| WO2024064952A1 (en) | 2022-09-23 | 2024-03-28 | Lyell Immunopharma, Inc. | Methods for culturing nr4a-deficient cells overexpressing c-jun |
| WO2024064958A1 (en) | 2022-09-23 | 2024-03-28 | Lyell Immunopharma, Inc. | Methods for culturing nr4a-deficient cells |
| WO2024077174A1 (en) | 2022-10-05 | 2024-04-11 | Lyell Immunopharma, Inc. | Methods for culturing nr4a-deficient cells |
| CN120435501A (zh) * | 2022-12-30 | 2025-08-05 | 上药生物治疗(香港)有限公司 | 细胞原位分泌抗体及其用途 |
| WO2025217398A1 (en) | 2024-04-10 | 2025-10-16 | Lyell Immunopharma, Inc. | Methods for culturing cells with improved culture medium |
Citations (51)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR901228A (fr) | 1943-01-16 | 1945-07-20 | Deutsche Edelstahlwerke Ag | Système d'aimant à entrefer annulaire |
| EP0239400A2 (en) | 1986-03-27 | 1987-09-30 | Medical Research Council | Recombinant antibodies and methods for their production |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| WO1991009967A1 (en) | 1989-12-21 | 1991-07-11 | Celltech Limited | Humanised antibodies |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| US5199942A (en) | 1991-06-07 | 1993-04-06 | Immunex Corporation | Method for improving autologous transplantation |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1993017105A1 (en) | 1992-02-19 | 1993-09-02 | Scotgen Limited | Altered antibodies, products and processes relating thereto |
| EP0592106A1 (en) | 1992-09-09 | 1994-04-13 | Immunogen Inc | Resurfacing of rodent antibodies |
| US5350674A (en) | 1992-09-04 | 1994-09-27 | Becton, Dickinson And Company | Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof |
| US5399346A (en) | 1989-06-14 | 1995-03-21 | The United States Of America As Represented By The Department Of Health And Human Services | Gene therapy |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5580859A (en) | 1989-03-21 | 1996-12-03 | Vical Incorporated | Delivery of exogenous DNA sequences in a mammal |
| US5585362A (en) | 1989-08-22 | 1996-12-17 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5858358A (en) | 1992-04-07 | 1999-01-12 | The United States Of America As Represented By The Secretary Of The Navy | Methods for selectively stimulating proliferation of T cells |
| US6120766A (en) | 1991-12-04 | 2000-09-19 | Hale; Geoffrey | CDW52-specific antibody for treatment of multiple sclerosis |
| WO2001029058A1 (en) | 1999-10-15 | 2001-04-26 | University Of Massachusetts | Rna interference pathway genes as tools for targeted genetic interference |
| US6326193B1 (en) | 1999-11-05 | 2001-12-04 | Cambria Biosciences, Llc | Insect control agent |
| WO2001096584A2 (en) | 2000-06-12 | 2001-12-20 | Akkadix Corporation | Materials and methods for the control of nematodes |
| US6352694B1 (en) | 1994-06-03 | 2002-03-05 | Genetics Institute, Inc. | Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells |
| US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
| US6534055B1 (en) | 1988-11-23 | 2003-03-18 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US6548640B1 (en) | 1986-03-27 | 2003-04-15 | Btg International Limited | Altered antibodies |
| US6692964B1 (en) | 1995-05-04 | 2004-02-17 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US6797514B2 (en) | 2000-02-24 | 2004-09-28 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US20050042664A1 (en) | 2003-08-22 | 2005-02-24 | Medimmune, Inc. | Humanization of antibodies |
| US20050048617A1 (en) | 2003-08-18 | 2005-03-03 | Medimmune, Inc. | Humanization of antibodies |
| US6867041B2 (en) | 2000-02-24 | 2005-03-15 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US20050100543A1 (en) | 2003-07-01 | 2005-05-12 | Immunomedics, Inc. | Multivalent carriers of bi-specific antibodies |
| US6905874B2 (en) | 2000-02-24 | 2005-06-14 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6905680B2 (en) | 1988-11-23 | 2005-06-14 | Genetics Institute, Inc. | Methods of treating HIV infected subjects |
| US20050175606A1 (en) | 2001-04-11 | 2005-08-11 | Hua-Liang Huang | Cyclic single-chain trispecific antibody |
| WO2006020258A2 (en) | 2004-07-17 | 2006-02-23 | Imclone Systems Incorporated | Novel tetravalent bispecific antibody |
| US7067318B2 (en) | 1995-06-07 | 2006-06-27 | The Regents Of The University Of Michigan | Methods for transfecting T cells |
| US20070014794A1 (en) | 1995-03-01 | 2007-01-18 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US7175843B2 (en) | 1994-06-03 | 2007-02-13 | Genetics Institute, Llc | Methods for selectively stimulating proliferation of T cells |
| WO2007024715A2 (en) | 2005-08-19 | 2007-03-01 | Abbott Laboratories | Dual variable domain immunoglobin and uses thereof |
| US7572631B2 (en) | 2000-02-24 | 2009-08-11 | Invitrogen Corporation | Activation and expansion of T cells |
| WO2012076066A1 (en) | 2010-12-10 | 2012-06-14 | Bioinvent International Ab | Anti-ror1 antibodies and uses thereof |
| WO2012138475A1 (en) | 2011-04-08 | 2012-10-11 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer |
| WO2013126712A1 (en) | 2012-02-22 | 2013-08-29 | The Trustees Of The University Of Pennsylvania | Compositions and methods for generating a persisting population of t cells useful for the treatment of cancer |
| US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| US9217040B2 (en) | 2011-01-14 | 2015-12-22 | The Regents Of The University Of California | Therapeutic antibodies against ROR-1 protein and methods for use of same |
| WO2016016344A1 (en) | 2014-07-29 | 2016-02-04 | Cellectis | Ror1(ntrkr1)specific chimeric antigen receptors for cancer immunotherapy |
| US9316646B2 (en) | 2009-04-23 | 2016-04-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-human ROR1 antibodies |
| US9393257B2 (en) | 2013-03-01 | 2016-07-19 | Regents Of The University Of Minnesota | TALEN-based gene correction |
| US20160208018A1 (en) | 2015-01-16 | 2016-07-21 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for ror1 |
| WO2016187349A1 (en) | 2015-05-18 | 2016-11-24 | Tcr2, Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| US9758586B2 (en) | 2010-12-01 | 2017-09-12 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Chimeric rabbit/human ROR1 antibodies |
Family Cites Families (201)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5906936A (en) | 1988-05-04 | 1999-05-25 | Yeda Research And Development Co. Ltd. | Endowing lymphocytes with antibody specificity |
| IL104570A0 (en) | 1992-03-18 | 1993-05-13 | Yeda Res & Dev | Chimeric genes and cells transformed therewith |
| WO1993019163A1 (en) | 1992-03-18 | 1993-09-30 | Yeda Research And Development Co, Ltd. | Chimeric receptor genes and cells transformed therewith |
| GB9809658D0 (en) | 1998-05-06 | 1998-07-01 | Celltech Therapeutics Ltd | Biological products |
| EP2011801A1 (en) | 1999-05-27 | 2009-01-07 | Government of the United States as represented by the Secretary, Department of Health and Human Services | Immunoconjugates having high binding affinity |
| JP2003502341A (ja) | 1999-06-16 | 2003-01-21 | マイアロス コーポレイション | 白血病阻害因子に由来するレトロ−インベルソなペプチド |
| US6822082B2 (en) | 2000-06-30 | 2004-11-23 | Zymogenetics, Inc. | Polynucleotides for mammalian secreted protein, Z1055G2P |
| ATE338124T1 (de) | 2000-11-07 | 2006-09-15 | Hope City | Cd19-spezifische umgezielte immunzellen |
| JP4213586B2 (ja) | 2001-09-13 | 2009-01-21 | 株式会社抗体研究所 | ラクダ抗体ライブラリーの作製方法 |
| AU2003208839A1 (en) | 2002-02-13 | 2003-09-04 | Micromet Ag | De-immunized (poly)peptide constructs |
| DE10244457A1 (de) | 2002-09-24 | 2004-04-01 | Johannes-Gutenberg-Universität Mainz | Verfahren zur rationalen Mutagenese von alpha/beta T-Zell Rezeptoren und entsprechend mutierte MDM2-Protein spezifische alpha/beta T-Zell Rezeptoren |
| WO2004041863A2 (en) | 2002-11-08 | 2004-05-21 | Ablynx N.V. | Single domain antibodies directed against interferon- gamma and uses therefor |
| US20050129671A1 (en) | 2003-03-11 | 2005-06-16 | City Of Hope | Mammalian antigen-presenting T cells and bi-specific T cells |
| US7251470B2 (en) | 2003-06-25 | 2007-07-31 | Nokia Corporation | Emergency response system with personal emergency device |
| US7902338B2 (en) | 2003-07-31 | 2011-03-08 | Immunomedics, Inc. | Anti-CD19 antibodies |
| MXPA06004035A (es) | 2003-10-16 | 2006-08-31 | Micromet Ag | Aglutinantes cd3 de-inmunizados multi-especificos. |
| US20130266551A1 (en) | 2003-11-05 | 2013-10-10 | St. Jude Children's Research Hospital, Inc. | Chimeric receptors with 4-1bb stimulatory signaling domain |
| US7982011B2 (en) | 2003-11-25 | 2011-07-19 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Mutated anti-cd22 antibodies and immunoconjugates |
| US20050238626A1 (en) * | 2004-04-01 | 2005-10-27 | Lili Yang | Antigen specific T cell therapy |
| WO2006018833A2 (en) | 2004-08-16 | 2006-02-23 | Tadiran Spectralink Ltd. | A wearable device, system and method for measuring a pulse while a user is in motion |
| US9707302B2 (en) | 2013-07-23 | 2017-07-18 | Immunomedics, Inc. | Combining anti-HLA-DR or anti-Trop-2 antibodies with microtubule inhibitors, PARP inhibitors, bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
| EP1861425B1 (en) | 2005-03-10 | 2012-05-16 | Morphotek, Inc. | Anti-mesothelin antibodies |
| EP1885758A2 (en) | 2005-05-12 | 2008-02-13 | The Government of the United States of America as Represented by The Department of Health and Human Services | Anti-mesothelin antibodies useful for immunological assays |
| AT503861B1 (de) | 2006-07-05 | 2008-06-15 | F Star Biotech Forsch & Entw | Verfahren zur manipulation von t-zell-rezeptoren |
| SI2856876T1 (en) | 2007-03-30 | 2018-04-30 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes |
| GB0721686D0 (en) | 2007-11-05 | 2007-12-12 | Medinnova As | Polypeptides |
| MX2010005603A (es) | 2007-11-26 | 2010-08-02 | Bayer Schering Pharma Ag | Anticuerpos antimesotelina y usos de los mismos. |
| WO2009070642A1 (en) | 2007-11-28 | 2009-06-04 | Medimmune, Llc | Protein formulation |
| KR20090092900A (ko) | 2008-02-28 | 2009-09-02 | 신준호 | 어린이 및 노약자 안전보호시스템 |
| US20090322513A1 (en) | 2008-06-27 | 2009-12-31 | Franklin Dun-Jen Hwang | Medical emergency alert system and method |
| EP2331566B1 (en) | 2008-08-26 | 2015-10-07 | City of Hope | Method and compositions for enhanced anti-tumor effector functioning of t cells |
| US9181342B2 (en) | 2008-09-12 | 2015-11-10 | Isis Innovation Limited | PD-1 specific antibodies and uses thereof |
| EP2370467B1 (en) | 2008-10-01 | 2016-09-07 | Amgen Research (Munich) GmbH | Cross-species-specific pscaxcd3, cd19xcd3, c-metxcd3, endosialinxcd3, epcamxc d3, igf-1rxcd3 or fapalpha xcd3 bispecific single chain antibody |
| KR101695327B1 (ko) * | 2008-11-07 | 2017-01-11 | 암젠 리서치 (뮌헨) 게엠베하 | 급성 림프구성 백혈병의 치료방법 |
| CN102421800A (zh) | 2009-02-23 | 2012-04-18 | 格兰马克药品股份有限公司 | 结合cd19的人源化抗体及其用途 |
| MX341884B (es) | 2009-03-10 | 2016-09-07 | Biogen Ma Inc | Anticuerpos anti-antigeno de maduracion de celulas b (bcma). |
| EP2258719A1 (en) | 2009-05-19 | 2010-12-08 | Max-Delbrück-Centrum für Molekulare Medizin (MDC) | Multiple target T cell receptor |
| US20130066283A1 (en) | 2009-10-23 | 2013-03-14 | Nexisvision, Inc. | Corneal Denervation for Treatment of Ocular Pain |
| WO2011059836A2 (en) | 2009-10-29 | 2011-05-19 | Trustees Of Dartmouth College | T cell receptor-deficient t cell compositions |
| EP2361936B1 (en) | 2010-02-25 | 2016-04-20 | Affimed GmbH | Antigen-binding molecule and uses thereof |
| CA3255551A1 (en) | 2010-03-26 | 2025-04-15 | Memorial Sloan-Kettering Cancer Center | MUC16 ANTIBODIES AND METHODS OF USE |
| EP2593796A4 (en) | 2010-07-16 | 2016-07-27 | Auckland Uniservices Ltd | BACTERIAL NITROREDUCTASE ENZYMES AND METHOD THEREFOR |
| WO2012033885A1 (en) | 2010-09-08 | 2012-03-15 | Baylor College Of Medicine | Immunotherapy of cancer using genetically engineered gd2-specific t cells |
| MX2013004792A (es) | 2010-10-27 | 2013-08-27 | Baylor College Medicine | Receptor cd27 quimericos para redirigir celulas t a malignidades cd70-positivas. |
| CN103459425B (zh) | 2010-10-27 | 2015-11-25 | 安进研发(慕尼黑)股份有限公司 | 用于治疗dlbcl的组合物 |
| PH12013501201A1 (en) | 2010-12-09 | 2013-07-29 | Univ Pennsylvania | Use of chimeric antigen receptor-modified t cells to treat cancer |
| BR112013014527A2 (pt) | 2010-12-20 | 2017-03-07 | Genentech Inc | anticorpo isolado, ácido nucleico isolado, célula hospedeira, método para produzir um anticorpo, imunoconjugado, formulação farmacêutica, uso do imunoconjugado, método para tratamento de um indivíduo que tem um câncer positivo para mesotelina, para inibição de proliferação de uma célula positiva para mesotelina, para detecção de mesotelina humana em uma amostra biológica e para detectar um câncer positivo para mesotelina |
| KR20140004174A (ko) | 2011-01-18 | 2014-01-10 | 더 트러스티스 오브 더 유니버시티 오브 펜실바니아 | 암 치료를 위한 조성물 및 방법 |
| KR101551555B1 (ko) | 2011-03-17 | 2015-09-08 | 밀테니 비오텍 게앰베하 | Tcr 알파/베타가 고갈된 세포 제제 |
| MX2014001222A (es) | 2011-07-29 | 2014-09-15 | Univ Pennsylvania | Receptores coestimuladores de cambio. |
| CN103946952A (zh) | 2011-09-16 | 2014-07-23 | 宾夕法尼亚大学董事会 | 用于治疗癌症的rna改造的t细胞 |
| US9688740B2 (en) | 2011-10-26 | 2017-06-27 | National Cancer Center | Mutant CTLA4 gene transfected T cell and composition including same for anticancer immunotherapy |
| US9272002B2 (en) | 2011-10-28 | 2016-03-01 | The Trustees Of The University Of Pennsylvania | Fully human, anti-mesothelin specific chimeric immune receptor for redirected mesothelin-expressing cell targeting |
| US9422351B2 (en) | 2011-11-03 | 2016-08-23 | The Trustees Of The University Of Pennsylvania | Isolated B7-H4 specific compositions and methods of use thereof |
| WO2013070468A1 (en) | 2011-11-08 | 2013-05-16 | The Trustees Of The University Of Pennsylvania | Glypican-3-specific antibody and uses thereof |
| TWI679212B (zh) * | 2011-11-15 | 2019-12-11 | 美商安進股份有限公司 | 針對bcma之e3以及cd3的結合分子 |
| CA2861491C (en) | 2012-02-13 | 2020-08-25 | Seattle Children's Hospital D/B/A Seattle Children's Research Institute | Bispecific chimeric antigen receptors and therapeutic uses thereof |
| WO2013126729A1 (en) | 2012-02-22 | 2013-08-29 | The Trustees Of The University Of Pennsylvania | Use of the cd2 signaling domain in second-generation chimeric antigen receptors |
| EP2828290B1 (en) | 2012-03-23 | 2018-08-15 | The United States of America, represented by the Secretary, Department of Health and Human Services | Anti-mesothelin chimeric antigen receptors |
| RU2766608C2 (ru) | 2012-04-11 | 2022-03-15 | Дзе Юнайтед Стейтс Оф Америка, Эз Репрезентед Бай Дзе Секретари, Департмент Оф Хелс Энд Хьюман Сёрвисез | Химерные антигенные рецепторы, нацеленные на антиген созревания b-клеток |
| US20130280220A1 (en) | 2012-04-20 | 2013-10-24 | Nabil Ahmed | Chimeric antigen receptor for bispecific activation and targeting of t lymphocytes |
| BR112014029417B1 (pt) | 2012-05-25 | 2023-03-07 | Cellectis | Método ex vivo para a preparação de células t para imunoterapia |
| JP6482461B2 (ja) | 2012-07-13 | 2019-03-13 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | 投与に関する形質導入t細胞の適合性の評価方法 |
| JP2015524255A (ja) | 2012-07-13 | 2015-08-24 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | 二重特異性抗体を共導入することによってcart細胞の活性を強化する方法 |
| EP2872617A4 (en) | 2012-07-13 | 2015-12-09 | Univ Pennsylvania | EPITOP SPREADING IN CONNECTION WITH CAR T CELLS |
| BR122020002986A8 (pt) | 2012-08-20 | 2023-04-18 | Seattle Childrens Hospital Dba Seattle Childrens Res Inst | Método e composições para imunoterapia celular |
| CN104955845B (zh) | 2012-09-27 | 2018-11-16 | 美国政府(由卫生和人类服务部的部长所代表) | 间皮素抗体和引起有效的抗肿瘤活性的方法 |
| WO2014055442A2 (en) | 2012-10-01 | 2014-04-10 | The Trustees Of The University Of Pennsylvania | Compositions and methods for targeting stromal cells for the treatment of cancer |
| MX370148B (es) | 2012-10-02 | 2019-12-03 | Memorial Sloan Kettering Cancer Center | Composiciones y su uso para inmunoterapia. |
| WO2014055657A1 (en) | 2012-10-05 | 2014-04-10 | The Trustees Of The University Of Pennsylvania | Use of a trans-signaling approach in chimeric antigen receptors |
| US9562110B2 (en) | 2012-11-21 | 2017-02-07 | Wuhan Yzy Biopharma Co., Ltd. | Bispecific antibody |
| US20150329640A1 (en) | 2012-12-20 | 2015-11-19 | Bluebird Bio, Inc. | Chimeric antigen receptors and immune cells targeting b cell malignancies |
| WO2014122143A1 (en) | 2013-02-05 | 2014-08-14 | Engmab Ag | Method for the selection of antibodies against bcma |
| CN113005091A (zh) | 2013-02-06 | 2021-06-22 | 细胞基因公司 | 具有改进特异性的修饰的t淋巴细胞 |
| DK2956175T3 (da) | 2013-02-15 | 2017-11-27 | Univ California | Kimærisk antigenreceptor og fremgangsmåder til anvendelse deraf |
| US9573988B2 (en) | 2013-02-20 | 2017-02-21 | Novartis Ag | Effective targeting of primary human leukemia using anti-CD123 chimeric antigen receptor engineered T cells |
| EP2961773B1 (en) | 2013-02-26 | 2019-03-20 | Roche Glycart AG | Bispecific t cell activating antigen binding molecules |
| CN113684185A (zh) | 2013-02-26 | 2021-11-23 | 纪念斯隆-凯特琳癌症中心 | 用于免疫疗法的组合物和方法 |
| WO2014138306A1 (en) | 2013-03-05 | 2014-09-12 | Baylor College Of Medicine | Engager cells for immunotherapy |
| ES2671004T3 (es) * | 2013-03-07 | 2018-06-04 | Baylor College Of Medicine | Dirección a CD138 en cáncer |
| AR095374A1 (es) | 2013-03-15 | 2015-10-14 | Amgen Res Munich Gmbh | Moléculas de unión para bcma y cd3 |
| US9446105B2 (en) | 2013-03-15 | 2016-09-20 | The Trustees Of The University Of Pennsylvania | Chimeric antigen receptor specific for folate receptor β |
| IL311390A (en) | 2013-03-15 | 2024-05-01 | Memorial Sloan Kettering Cancer Center | Preparations and methods for immunotherapy |
| JP6493692B2 (ja) | 2013-03-15 | 2019-04-10 | セルジーン コーポレイション | 修飾されたtリンパ球 |
| US10150800B2 (en) | 2013-03-15 | 2018-12-11 | Zyngenia, Inc. | EGFR-binding modular recognition domains |
| UY35468A (es) | 2013-03-16 | 2014-10-31 | Novartis Ag | Tratamiento de cáncer utilizando un receptor quimérico de antígeno anti-cd19 |
| WO2014165707A2 (en) | 2013-04-03 | 2014-10-09 | Memorial Sloan-Kettering Cancer Center | Effective generation of tumor-targeted t-cells derived from pluripotent stem cells |
| FI2997141T3 (fi) | 2013-05-13 | 2022-12-15 | CD19-spesifinen kimeerinen antigeenireseptori ja sen käyttöjä | |
| US11311575B2 (en) | 2013-05-13 | 2022-04-26 | Cellectis | Methods for engineering highly active T cell for immunotherapy |
| CA2913052A1 (en) | 2013-05-24 | 2014-11-27 | Board Of Regents, The University Of Texas System | Chimeric antigen receptor-targeting monoclonal antibodies |
| ES2883131T3 (es) | 2013-05-29 | 2021-12-07 | Cellectis | Métodos para la modificación de células T para inmunoterapia utilizando el sistema de nucleasa CAS guiado por ARN |
| WO2014191128A1 (en) | 2013-05-29 | 2014-12-04 | Cellectis | Methods for engineering t cells for immunotherapy by using rna-guided cas nuclease system |
| WO2015006749A2 (en) | 2013-07-12 | 2015-01-15 | Zymeworks Inc. | Bispecific cd3 and cd19 antigen binding contructs |
| EP3027755B1 (en) | 2013-08-02 | 2019-10-09 | The Regents of The University of California | Engineering antiviral t cell immunity through stem cells and chimeric antigen receptors |
| GB201317929D0 (en) | 2013-10-10 | 2013-11-27 | Ucl Business Plc | Chimeric antigen receptor |
| CN105829349B (zh) | 2013-10-15 | 2023-02-03 | 斯克利普斯研究所 | 肽嵌合抗原受体t细胞开关和其用途 |
| CN105814083A (zh) | 2013-10-15 | 2016-07-27 | 加州生物医学研究所 | 嵌合抗原受体t细胞开关和其用途 |
| WO2015092024A2 (en) | 2013-12-20 | 2015-06-25 | Cellectis | Method of engineering multi-input signal sensitive t cell for immunotherapy |
| EP3087101B1 (en) | 2013-12-20 | 2024-06-05 | Novartis AG | Regulatable chimeric antigen receptor |
| NZ759969A (en) | 2013-12-20 | 2022-12-23 | Fred Hutchinson Cancer Center | Tagged chimeric effector molecules and receptors thereof |
| US10519251B2 (en) | 2013-12-30 | 2019-12-31 | Epimab Biotherapeutics, Inc. | Fabs-in-tandem immunoglobulin and uses thereof |
| ES2701846T3 (es) | 2014-01-14 | 2019-02-26 | Cellectis | Receptor de antígeno quimérico que usa dominios de reconocimiento de antígenos derivados de pez cartilaginoso |
| WO2015112626A1 (en) | 2014-01-21 | 2015-07-30 | June Carl H | Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules |
| TWI681969B (zh) | 2014-01-23 | 2020-01-11 | 美商再生元醫藥公司 | 針對pd-1的人類抗體 |
| US20160333422A1 (en) | 2014-01-24 | 2016-11-17 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Serv | Anti-ny-br-1 polypeptides, proteins, and chimeric antigen receptors |
| AU2015214145A1 (en) | 2014-02-04 | 2016-08-25 | Kite Pharma. Inc. | Methods for producing autologous T cells useful to treat B cell malignancies and other cancers and compositions thereof |
| KR102375998B1 (ko) | 2014-02-14 | 2022-03-21 | 더 보드 오브 리젠츠 오브 더 유니버시티 오브 텍사스 시스템 | 키메라 항원 수용체 및 제조방법 |
| WO2015121454A1 (en) | 2014-02-14 | 2015-08-20 | Cellectis | Cells for immunotherapy engineered for targeting antigen present both on immune cells and pathological cells |
| CA2939711C (en) | 2014-02-21 | 2020-09-29 | Cellectis | Method for in situ inhibition of regulatory t cells |
| CA2935748A1 (en) | 2014-02-25 | 2015-09-03 | Immunomedics, Inc. | Humanized rfb4 anti-cd22 antibody |
| KR101605421B1 (ko) | 2014-03-05 | 2016-03-23 | 국립암센터 | B 세포 림프종 세포를 특이적으로 인지하는 단일클론항체 및 이의 용도 |
| ES2857226T3 (es) | 2014-03-15 | 2021-09-28 | Novartis Ag | Receptor de antígeno quimérico regulable |
| US20170335281A1 (en) | 2014-03-15 | 2017-11-23 | Novartis Ag | Treatment of cancer using chimeric antigen receptor |
| EP3131927B8 (en) | 2014-04-14 | 2020-12-23 | Cellectis | Bcma (cd269) specific chimeric antigen receptors for cancer immunotherapy |
| HUE049514T2 (hu) | 2014-04-25 | 2020-09-28 | Bluebird Bio Inc | Javított eljárások adoptív sejtterápiák kialakítására |
| CN113604491A (zh) | 2014-05-02 | 2021-11-05 | 宾夕法尼亚大学董事会 | 嵌合自身抗体受体t细胞的组合物和方法 |
| WO2015179801A1 (en) | 2014-05-23 | 2015-11-26 | University Of Florida Research Foundation, Inc. | Car based immunotherapy |
| US10287360B2 (en) | 2014-05-23 | 2019-05-14 | INSERM (Institut National de la Santé et de la Recherche Médicale | Anti-EGFR conformational single domain antibodies and uses thereof |
| EP4166148B1 (en) | 2014-06-06 | 2026-02-18 | Memorial Sloan-Kettering Cancer Center | Mesothelin-targeted chimeric antigen receptors and uses thereof |
| KR20170032406A (ko) | 2014-07-15 | 2017-03-22 | 주노 쎄러퓨티크스 인코퍼레이티드 | 입양 세포 치료를 위한 조작된 세포 |
| BR112017001183A2 (pt) * | 2014-07-21 | 2017-11-28 | Novartis Ag | tratamento de câncer usando receptor de antígeno quimérico anti-bcma humanizado |
| ES2878449T3 (es) | 2014-07-24 | 2021-11-18 | 2Seventy Bio Inc | Receptores antigénicos quiméricos de BCMA |
| EP2982692A1 (en) | 2014-08-04 | 2016-02-10 | EngMab AG | Bispecific antibodies against CD3epsilon and BCMA |
| EP3177711B1 (en) | 2014-08-07 | 2024-04-24 | Northwestern University | Use of ligands for the programmed cell death receptor conjugated to solid supports for the expansion of human regulatory t cells |
| WO2016019969A1 (en) | 2014-08-08 | 2016-02-11 | Ludwig-Maximilians-Universität München | Subcutaneously administered bispecific antibodies for use in the treatment of cancer |
| PT3177640T (pt) | 2014-08-08 | 2020-08-31 | Univ Leland Stanford Junior | Agentes pd-1 de alta afinidade e métodos de utilização |
| US20180080008A1 (en) | 2014-08-12 | 2018-03-22 | Anthrogenesis Corporation | Car-t lymphocytes engineered to home to lymph node b cell zone, skin, or gastrointestinal tract |
| DK4074735T3 (da) | 2014-08-28 | 2025-07-14 | Bioatla Inc | Betinget aktive kimæriske antigenreceptorer til modificerede t-celler |
| GB201415347D0 (en) | 2014-08-29 | 2014-10-15 | Ucl Business Plc | Signalling system |
| WO2016036678A1 (en) | 2014-09-02 | 2016-03-10 | Medimmune, Llc | Formulations of bispecific antibodies |
| CA2972714A1 (en) | 2014-09-09 | 2016-03-17 | Unum Therapeutics | Chimeric receptors and uses thereof in immune therapy |
| BR112017005631A2 (pt) | 2014-09-19 | 2018-06-26 | City Of Hope | células t com receptor de antígeno coestimulador quimérico direcionadas à il13ra2 |
| WO2016054520A2 (en) | 2014-10-03 | 2016-04-07 | The California Institute For Biomedical Research | Engineered cell surface proteins and uses thereof |
| BR112017007003A2 (pt) | 2014-10-07 | 2017-12-19 | Cellectis | método para modulação de atividade de células imunes induzidas por car |
| MX392487B (es) | 2014-10-20 | 2025-03-21 | Juno Therapeutics Inc | Métodos y composiciones para dosificación en terapia celular adoptiva. |
| CA2964958A1 (en) | 2014-10-31 | 2016-05-06 | The Trustees Of The University Of Pennsylvania | Methods and compositions for modified t cells |
| WO2016073381A1 (en) | 2014-11-03 | 2016-05-12 | Cerus Corporation | Compositions and methods for improved car-t cell therapies |
| ES2987570T3 (es) | 2014-11-05 | 2024-11-15 | Juno Therapeutics Inc | Métodos para la transducción y el procesamiento de células |
| IL297773B2 (en) | 2014-11-17 | 2024-07-01 | Adicet Bio Inc | Engineered gamma delta t-cells |
| DK3221357T3 (da) | 2014-11-20 | 2020-08-10 | Hoffmann La Roche | Fælles letkæder og fremgangsmåder til anvendelse |
| EP3023437A1 (en) | 2014-11-20 | 2016-05-25 | EngMab AG | Bispecific antibodies against CD3epsilon and BCMA |
| US10201606B2 (en) | 2014-11-26 | 2019-02-12 | Miltenyi Biotec Gmbh | Combination immunotherapy of antigen-recognizing receptors and hematopoietic cells for the treatment of diseases |
| EP3029067A1 (en) | 2014-12-01 | 2016-06-08 | Deutsches Krebsforschungszentrum | Use of blocking-reagents for reducing unspecific T cell-activation |
| US20180334490A1 (en) | 2014-12-03 | 2018-11-22 | Qilong H. Wu | Methods for b cell preconditioning in car therapy |
| EP3029068A1 (en) | 2014-12-03 | 2016-06-08 | EngMab AG | Bispecific antibodies against CD3epsilon and BCMA for use in the treatment of diseases |
| ES2819553T3 (es) | 2014-12-03 | 2021-04-16 | Juno Therapeutics Inc | Métodos y composiciones para terapia celular adoptiva |
| SI3226897T1 (sl) | 2014-12-05 | 2021-08-31 | Memorial Sloan Kettering Cancer Center | Protitelesa, ki ciljajo na B-celični maturacijski antigen, in postopki uporabe |
| CN118271463A (zh) | 2014-12-05 | 2024-07-02 | 纪念斯隆-凯特琳癌症中心 | 靶向g-蛋白偶联受体的嵌合抗原受体及其用途 |
| MY191537A (en) | 2014-12-05 | 2022-06-30 | Memorial Sloan Kettering Cancer Center | Chimeric antigen receptors targeting b-cell maturation antigen and uses thereof |
| CA2969384A1 (en) | 2014-12-17 | 2016-06-23 | Cellectis | Inhibitory chimeric antigen receptor (icar or n-car) expressing non-t cell transduction domain |
| EP3037170A1 (en) | 2014-12-27 | 2016-06-29 | Miltenyi Biotec GmbH | Multisort cell separation method |
| RU2021118125A (ru) | 2014-12-29 | 2022-04-06 | Новартис Аг | Способы получения экспрессирующих химерный антигенный рецептор клеток |
| CA2973720A1 (en) | 2015-01-14 | 2016-07-21 | Compass Therapeutics Llc | Multispecific immunomodulatory antigen-binding constructs |
| US11459390B2 (en) | 2015-01-16 | 2022-10-04 | Novartis Ag | Phosphoglycerate kinase 1 (PGK) promoters and methods of use for expressing chimeric antigen receptor |
| GB201501175D0 (en) | 2015-01-23 | 2015-03-11 | Univ Oslo Hf | A universal T-cell for personalised medicine |
| WO2016123143A1 (en) | 2015-01-26 | 2016-08-04 | The University Of Chicago | CAR T-CELLS RECOGNIZING CANCER-SPECIFIC IL 13Rα2 |
| WO2016126608A1 (en) | 2015-02-02 | 2016-08-11 | Novartis Ag | Car-expressing cells against multiple tumor antigens and uses thereof |
| EP3253414A4 (en) | 2015-02-05 | 2018-07-11 | The University Of Queensland | Targeting constructs for delivery of payloads |
| CN107635578A (zh) | 2015-02-05 | 2018-01-26 | Stc.Unm 公司 | 抗前‑bcr拮抗剂和方法 |
| US20160228547A1 (en) | 2015-02-06 | 2016-08-11 | Batu Biologics, Inc. | Chimeric antigen receptor targeting of tumor endothelium |
| EP3256492A4 (en) * | 2015-02-09 | 2018-07-11 | University of Florida Research Foundation, Inc. | Bi-specific chimeric antigen receptor and uses thereof |
| WO2016127257A1 (en) | 2015-02-12 | 2016-08-18 | University Health Network | Chimeric antigen receptors |
| US20160237407A1 (en) | 2015-02-17 | 2016-08-18 | Batu Biologics, Inc. | Universal donor chimeric antigen receptor cells |
| EP3865139B1 (en) | 2015-02-18 | 2023-05-03 | Enlivex Therapeutics Rdo Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
| KR102624023B1 (ko) | 2015-02-24 | 2024-01-11 | 더 리젠츠 오브 더 유니버시티 오브 캘리포니아 | 결합-촉발된 전사 스위치 및 이들의 이용 방법 |
| JP7237449B2 (ja) * | 2015-02-27 | 2023-03-13 | アイセル・ジーン・セラピューティクス・エルエルシー | 血液系腫瘍を標的としたキメラ抗体受容体(CARs)の構成およびその使用方法 |
| WO2016138846A1 (en) | 2015-03-02 | 2016-09-09 | Shanghai Sidansai Biotechnology Co., Ltd | Reducing immune tolerance induced by pd‐l1 |
| EP4406604A3 (en) | 2015-03-05 | 2024-10-23 | Fred Hutchinson Cancer Center | Immunomodulatory fusion proteins and uses thereof |
| GB201504840D0 (en) | 2015-03-23 | 2015-05-06 | Ucl Business Plc | Chimeric antigen receptor |
| CA2981304C (en) | 2015-04-02 | 2024-01-02 | Memorial Sloan Kettering Cancer Center | Tnfrsf14/hvem proteins and methods of use thereof |
| DK3909972T5 (da) | 2015-06-19 | 2024-08-05 | Sebastian Kobold | Pd1-cd28-fusionsproteiner og disses anvendelse i medicin |
| KR20180019725A (ko) | 2015-06-23 | 2018-02-26 | 메모리얼 슬로안-케터링 캔서 센터 | 신규의 피디 1 면역 조절제 |
| US11173179B2 (en) * | 2015-06-25 | 2021-11-16 | Icell Gene Therapeutics Llc | Chimeric antigen receptor (CAR) targeting multiple antigens, compositions and methods of use thereof |
| US11655452B2 (en) * | 2015-06-25 | 2023-05-23 | Icell Gene Therapeutics Inc. | Chimeric antigen receptors (CARs), compositions and methods of use thereof |
| JP2018520679A (ja) | 2015-06-29 | 2018-08-02 | ザ・ジョンズ・ホプキンス・ユニバーシティー | 免疫チェックポイントキメラ抗原受容体療法 |
| US11667691B2 (en) | 2015-08-07 | 2023-06-06 | Novartis Ag | Treatment of cancer using chimeric CD3 receptor proteins |
| CA2997551A1 (en) | 2015-09-04 | 2017-03-09 | Memorial Sloan Kettering Cancer Center | Immune cell compositions and methods of use |
| JP6816133B2 (ja) | 2015-10-05 | 2021-01-20 | プレシジョン バイオサイエンシズ,インク. | 改変ヒトt細胞受容体アルファ定常領域遺伝子を含む遺伝子改変細胞 |
| US11020429B2 (en) | 2015-11-05 | 2021-06-01 | Juno Therapeutics, Inc. | Vectors and genetically engineered immune cells expressing metabolic pathway modulators and uses in adoptive cell therapy |
| CN105331585A (zh) | 2015-11-13 | 2016-02-17 | 科济生物医药(上海)有限公司 | 携带pd-l1阻断剂的嵌合抗原受体修饰的免疫效应细胞 |
| JP7123794B2 (ja) | 2015-12-09 | 2022-08-23 | メモリアル スローン ケタリング キャンサー センター | 免疫細胞組成物及びそれを使用する方法 |
| EP4643874A3 (en) | 2015-12-22 | 2026-02-11 | Novartis AG | Mesothelin chimeric antigen receptor (car) and antibody against pd-l1 inhibitor for combined use in anticancer therapy |
| EP3433269B1 (en) | 2016-03-23 | 2023-09-27 | Helmholtz Zentrum München - Deutsches Forschungszentrum für Gesundheit und Umwelt (GmbH) | Fusion proteins of pd-1 and 4-1bb |
| ES2891578T3 (es) | 2016-04-01 | 2022-01-28 | Kite Pharma Inc | Antígeno quimérico y receptores de células T y métodos de uso |
| WO2017214452A1 (en) | 2016-06-08 | 2017-12-14 | Xencor, Inc. | Treatment of igg4-related diseases with anti-cd19 antibodies crossbinding to cd32b |
| CA3032498A1 (en) | 2016-08-02 | 2018-02-08 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| CN109863242A (zh) | 2016-08-30 | 2019-06-07 | 纪念斯隆-凯特林癌症中心 | 用于治疗病毒感染和其它感染的免疫细胞组合物和使用方法 |
| WO2018067993A1 (en) | 2016-10-07 | 2018-04-12 | TCR2 Therapeutics Inc. | Compositions and methods for t-cell receptors reprogramming using fusion proteins |
| JP7291396B2 (ja) | 2016-11-22 | 2023-06-15 | ティーシーアール2 セラピューティクス インク. | 融合タンパク質を用いたtcrの再プログラミングのための組成物及び方法 |
| JP2020513754A (ja) | 2016-12-21 | 2020-05-21 | ティーシーアール2 セラピューティクス インク. | がん治療用に操作されたt細胞 |
| AU2017382243A1 (en) | 2016-12-22 | 2019-05-02 | Windmil Therapeutics, Inc. | Compositions and methods for modulating the immune system |
| WO2018133877A1 (zh) | 2017-01-23 | 2018-07-26 | 科济生物医药(上海)有限公司 | 靶向bcma的抗体及其应用 |
| JP7538601B2 (ja) | 2017-04-26 | 2024-08-22 | ユーリカ セラピューティックス, インコーポレイテッド | キメラ活性化受容体及びキメラ刺激受容体を発現する細胞並びにその使用 |
| WO2018232020A1 (en) | 2017-06-13 | 2018-12-20 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| KR20200027508A (ko) | 2017-07-07 | 2020-03-12 | 에이치 리 모피트 캔서 센터 앤드 리서어치 인스티튜트 아이엔씨 | 돌연변이된 cd28 공동자극 도메인을 갖는 키메라 항원 수용체 |
| JP2021500859A (ja) | 2017-09-22 | 2021-01-14 | エイチ リー モフィット キャンサー センター アンド リサーチ インスティテュート インコーポレイテッド | Nfkbシグナル伝達の増強を伴うキメラ抗原受容体 |
| AU2019224051A1 (en) | 2018-02-26 | 2020-09-03 | Fred Hutchinson Cancer Center | Compositions and methods for cellular immunotherapy |
| MX2020009371A (es) | 2018-03-09 | 2021-01-08 | Tcr2 Therapeutics Inc | Composiciones y métodos para la reprogramación de tcr mediante el uso de proteínas de fusión. |
| WO2019222275A2 (en) | 2018-05-14 | 2019-11-21 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using inducible fusion proteins |
| BR112021001338A2 (pt) | 2018-07-26 | 2021-05-04 | TCR2 Therapeutics Inc. | composições e métodos para reprogramação de tcr usando proteínas de fusão específicas para o alvo |
| KR20210069048A (ko) | 2018-08-30 | 2021-06-10 | 티씨알2 테라퓨틱스 인크. | 융합 단백질을 이용하는 tcr 재프로그래밍을 위한 조성물 및 방법 |
-
2017
- 2017-11-22 JP JP2019527363A patent/JP7291396B2/ja active Active
- 2017-11-22 WO PCT/US2017/063137 patent/WO2018098365A2/en not_active Ceased
- 2017-11-22 EP EP17812183.6A patent/EP3544996A2/en not_active Withdrawn
- 2017-11-22 CA CA3044593A patent/CA3044593A1/en active Pending
- 2017-11-22 AU AU2017363311A patent/AU2017363311A1/en not_active Abandoned
- 2017-11-22 US US16/462,492 patent/US11851491B2/en active Active
- 2017-11-22 CN CN201780083288.5A patent/CN110177803A/zh active Pending
-
2023
- 2023-05-29 JP JP2023087484A patent/JP2023109968A/ja active Pending
Patent Citations (60)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR901228A (fr) | 1943-01-16 | 1945-07-20 | Deutsche Edelstahlwerke Ag | Système d'aimant à entrefer annulaire |
| US6331415B1 (en) | 1983-04-08 | 2001-12-18 | Genentech, Inc. | Methods of producing immunoglobulins, vectors and transformed host cells for use therein |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US6548640B1 (en) | 1986-03-27 | 2003-04-15 | Btg International Limited | Altered antibodies |
| EP0239400A2 (en) | 1986-03-27 | 1987-09-30 | Medical Research Council | Recombinant antibodies and methods for their production |
| US7144575B2 (en) | 1988-11-23 | 2006-12-05 | The Regents Of The University Of Michigan | Methods for selectively stimulating proliferation of T cells |
| US6534055B1 (en) | 1988-11-23 | 2003-03-18 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US6905680B2 (en) | 1988-11-23 | 2005-06-14 | Genetics Institute, Inc. | Methods of treating HIV infected subjects |
| US7232566B2 (en) | 1988-11-23 | 2007-06-19 | The United States As Represented By The Secretary Of The Navy | Methods for treating HIV infected subjects |
| US5883223A (en) | 1988-11-23 | 1999-03-16 | Gray; Gary S. | CD9 antigen peptides and antibodies thereto |
| US6887466B2 (en) | 1988-11-23 | 2005-05-03 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5589466A (en) | 1989-03-21 | 1996-12-31 | Vical Incorporated | Induction of a protective immune response in a mammal by injecting a DNA sequence |
| US5580859A (en) | 1989-03-21 | 1996-12-03 | Vical Incorporated | Delivery of exogenous DNA sequences in a mammal |
| US5399346A (en) | 1989-06-14 | 1995-03-21 | The United States Of America As Represented By The Department Of Health And Human Services | Gene therapy |
| US5585362A (en) | 1989-08-22 | 1996-12-17 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy |
| WO1991009967A1 (en) | 1989-12-21 | 1991-07-11 | Celltech Limited | Humanised antibodies |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| US5199942A (en) | 1991-06-07 | 1993-04-06 | Immunex Corporation | Method for improving autologous transplantation |
| US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US6120766A (en) | 1991-12-04 | 2000-09-19 | Hale; Geoffrey | CDW52-specific antibody for treatment of multiple sclerosis |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| WO1993017105A1 (en) | 1992-02-19 | 1993-09-02 | Scotgen Limited | Altered antibodies, products and processes relating thereto |
| US5858358A (en) | 1992-04-07 | 1999-01-12 | The United States Of America As Represented By The Secretary Of The Navy | Methods for selectively stimulating proliferation of T cells |
| US5350674A (en) | 1992-09-04 | 1994-09-27 | Becton, Dickinson And Company | Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof |
| EP0592106A1 (en) | 1992-09-09 | 1994-04-13 | Immunogen Inc | Resurfacing of rodent antibodies |
| US6352694B1 (en) | 1994-06-03 | 2002-03-05 | Genetics Institute, Inc. | Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells |
| US7175843B2 (en) | 1994-06-03 | 2007-02-13 | Genetics Institute, Llc | Methods for selectively stimulating proliferation of T cells |
| US6905681B1 (en) | 1994-06-03 | 2005-06-14 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US20070014794A1 (en) | 1995-03-01 | 2007-01-18 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US7172869B2 (en) | 1995-05-04 | 2007-02-06 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US6692964B1 (en) | 1995-05-04 | 2004-02-17 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US7067318B2 (en) | 1995-06-07 | 2006-06-27 | The Regents Of The University Of Michigan | Methods for transfecting T cells |
| WO2001029058A1 (en) | 1999-10-15 | 2001-04-26 | University Of Massachusetts | Rna interference pathway genes as tools for targeted genetic interference |
| US6326193B1 (en) | 1999-11-05 | 2001-12-04 | Cambria Biosciences, Llc | Insect control agent |
| US6905874B2 (en) | 2000-02-24 | 2005-06-14 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US7572631B2 (en) | 2000-02-24 | 2009-08-11 | Invitrogen Corporation | Activation and expansion of T cells |
| US6867041B2 (en) | 2000-02-24 | 2005-03-15 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6797514B2 (en) | 2000-02-24 | 2004-09-28 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| WO2001096584A2 (en) | 2000-06-12 | 2001-12-20 | Akkadix Corporation | Materials and methods for the control of nematodes |
| US20050175606A1 (en) | 2001-04-11 | 2005-08-11 | Hua-Liang Huang | Cyclic single-chain trispecific antibody |
| US20050100543A1 (en) | 2003-07-01 | 2005-05-12 | Immunomedics, Inc. | Multivalent carriers of bi-specific antibodies |
| US20050048617A1 (en) | 2003-08-18 | 2005-03-03 | Medimmune, Inc. | Humanization of antibodies |
| US20050042664A1 (en) | 2003-08-22 | 2005-02-24 | Medimmune, Inc. | Humanization of antibodies |
| WO2006020258A2 (en) | 2004-07-17 | 2006-02-23 | Imclone Systems Incorporated | Novel tetravalent bispecific antibody |
| WO2007024715A2 (en) | 2005-08-19 | 2007-03-01 | Abbott Laboratories | Dual variable domain immunoglobin and uses thereof |
| US9316646B2 (en) | 2009-04-23 | 2016-04-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-human ROR1 antibodies |
| US9758586B2 (en) | 2010-12-01 | 2017-09-12 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Chimeric rabbit/human ROR1 antibodies |
| WO2012076066A1 (en) | 2010-12-10 | 2012-06-14 | Bioinvent International Ab | Anti-ror1 antibodies and uses thereof |
| US9217040B2 (en) | 2011-01-14 | 2015-12-22 | The Regents Of The University Of California | Therapeutic antibodies against ROR-1 protein and methods for use of same |
| WO2012138475A1 (en) | 2011-04-08 | 2012-10-11 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer |
| WO2013126712A1 (en) | 2012-02-22 | 2013-08-29 | The Trustees Of The University Of Pennsylvania | Compositions and methods for generating a persisting population of t cells useful for the treatment of cancer |
| US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| US9393257B2 (en) | 2013-03-01 | 2016-07-19 | Regents Of The University Of Minnesota | TALEN-based gene correction |
| WO2016016344A1 (en) | 2014-07-29 | 2016-02-04 | Cellectis | Ror1(ntrkr1)specific chimeric antigen receptors for cancer immunotherapy |
| US20160208018A1 (en) | 2015-01-16 | 2016-07-21 | Juno Therapeutics, Inc. | Antibodies and chimeric antigen receptors specific for ror1 |
| WO2016187349A1 (en) | 2015-05-18 | 2016-11-24 | Tcr2, Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
Non-Patent Citations (94)
| Title |
|---|
| AGATA ET AL., INT. IMMUNOL, vol. 8, 1996, pages 765 - 775 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUC. ACIDS RES., vol. 25, 1977, pages 3389 - 3402 |
| BACA ET AL., J. BIOL. CHEM., vol. 272, no. 16, 1997, pages 10678 - 10684 |
| BAHRAM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 6259 - 6263 |
| BARRETINA ET AL., NATURE, vol. 483, 2012, pages 603 |
| BARRETT ET AL., HUMAN GENE THERAPY, vol. 22, 2011, pages 1575 - 1586 |
| BATZER ET AL., NUCLEIC ACID RES., vol. 19, 1991, pages 5081 |
| BAUER ET AL., SCIENCE, vol. 285, no. 5428, 30 July 1999 (1999-07-30), pages 727 - 729 |
| BERG ET AL., TRANSPLANT PROC., vol. 30, no. 8, 1998, pages 3975 - 3977 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BLANK ET AL., CANCER IMMUNOL. IMMUNOTHER, vol. 54, 2005, pages 307 - 314 |
| BORCHERDING, N. ET AL., PROTEIN CELL, vol. 5, no. 7, 2014, pages 496 - 502 |
| BRENT ET AL: "Current Protocols in Molecular Biology", 2003 |
| CALDAS ET AL., PROTEIN ENG., vol. 13, no. 5, 2000, pages 353 - 360 |
| CARTER ET AL., EUR J IMMUNOL, vol. 32, 2002, pages 634 - 643 |
| CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285 |
| CHARLES L. SENTMAN, CANCER IMMUNITY, vol. 13, 1 May 2013 (2013-05-01), pages 8 |
| CHOI, M. ET AL., CLINICAL LYMPHOMA, MYELOMA & LEUKEMIA, vol. 15, no. S1, 2015, pages S167 - S169 |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 |
| COSMAN ET AL., IMMUNITY, vol. 14, no. 2, February 2001 (2001-02-01), pages 123 - 133 |
| COUGOT ET AL., TRENDS IN BIOCHEM. SCI., vol. 29, 2001, pages 436 - 444 |
| COUTO ET AL., CANCER RES., vol. 55, no. 23, 1995, pages 5973s - 5977s |
| COUTO ET AL., CANCER RES., vol. 55, no. 8, 1995, pages 1717 - 1722 |
| CUI, B. ET AL., CANCER RESEARCH, vol. 73, no. 12, 2015, pages 3649 - 3660 |
| DATABASE GenBank [O] retrieved from ncbi Database accession no. AAA62478.2 |
| DATABASE UniProt [O] Database accession no. P20273-1 |
| DATABASE UniProt [O] Database accession no. P26718-1 |
| DATABASE UniProt [O] Database accession no. Q02223 |
| DATABASE UniProt/Swiss-Prot [O] Database accession no. Q02223-1 |
| DENIGER, D. ET AL., PLOS ONE, vol. 10, no. 6, 2015, pages 1 - 19 |
| DONG ET AL., J MOL MED, vol. 81, 2003, pages 281 - 287 |
| EAGLE ET AL., EUR J IMMUNOL, vol. 39, no. 3207-30164, 2009, pages 1 - 14 |
| EAGLE ET AL., PLOS ONE, vol. 4, 2009, pages 1 - 14 |
| ELANGO ET AL., BIOCHIM. BIOPHYS. RES. COMMUN., vol. 330, 2005, pages 958 - 966 |
| FREEMAN ET AL., J EXP MED, vol. 192, 2000, pages 1027 - 1034 |
| GARLAND ET AL., J. IMMUNOL. METH., vol. 227, no. 1-2, 1999, pages 53 - 63 |
| GHOSH ET AL., GLYCOBIOLOGY, vol. 5, 1991, pages 505 - 510 |
| HAANEN ET AL., J. EXP. MED., vol. 190, no. 9, 1999, pages 1319 - 1328 |
| HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1989, COLD SPRING HARBOR |
| HARLOW ET AL.: "Using Antibodies: A Laboratory Manual", 1999, COLD SPRING HARBOR LABORATORY PRESS |
| HOLLINGER ET AL., PROC NATL ACAD. SCI. U.S.A., vol. 90, 1993, pages 6444 - 6448 |
| HOUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| HUDECEK, M. ET AL., BLOOD, vol. 116, no. 22, 2010, pages 4532 - 4541 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| IZUMOTO ET AL., J NEUROSURG, vol. 108, 2008, pages 963 - 971 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| JUNE ET AL.: "9.10", NATURE REVIEWS IMMUNOL, 2009, pages 704 - 716 |
| KONISHI ET AL., CLIN CANCER RES, vol. 10, 2004, pages 5094 |
| KUDO ET AL., CANCER RES, vol. 74, no. 1, 2013, pages 1 - 11 |
| KUDO ET AL., CANCER RES, vol. 74, no. 1, 2013, pages 93 - 103 |
| LANZAVECCHIA ET AL., EUR. J. IMMUNOL., vol. 17, 1987, pages 105 |
| LATCHMAN ET AL., NAT IMMUNOL, vol. 2, 2001, pages 261 - 268 |
| LIEBERMAN, PHARMACEUTICAL DOSAGE FORMS, vol. 1-3, 1992 |
| LLOYD, THE ART, SCIENCE AND TECHNOLOGY OF PHARMACEUTICAL COMPOUNDING, 1999 |
| MATO, A.; PORTER, D., BLOOD, vol. 126, no. 4, 2015, pages 478 - 485 |
| MILONE ET AL., MOL. THER., vol. 17, no. 8, 2009, pages 1453 - 1464 |
| MILONE ET AL., MOLECULAR THERAPY, vol. 17, no. 8, 2009, pages 1453 - 1464 |
| MOREA ET AL., METHODS, vol. 20, no. 3, 2000, pages 267 - 279 |
| MORTON ET AL., NAT. PROCOL., vol. 2, 2007, pages 247 |
| NACHEVA; BERZAL-HERRANZ, EUR. J. BIOCHEM., vol. 270, 2003, pages 1485 - 1465 |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| NICHOLSON ET AL., MOL. IMMUN., vol. 34, no. 16-17, 1997, pages 1157 - 1165 |
| NISHIKAWA ET AL., HUM GENE THER., vol. 12, no. 8, 2001, pages 861 - 870 |
| OHTSUKA ET AL., J. BIOL. CHEM., vol. 260, 1985, pages 2605 - 2608 |
| PADLAN, MOLECULAR IMMUNOLOGY, vol. 28, no. 4/5, 1991, pages 489 - 498 |
| PEARSON; LIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444 |
| PEDERSEN ET AL., J. MOL. BIOL., vol. 235, no. 3, 1994, pages 959 - 973 |
| PICKAR, DOSAGE CALCULATIONS, 1999 |
| PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623 |
| PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596 |
| REICHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327 |
| ROGUSKA ET AL., PNAS, vol. 91, 1994, pages 969 - 973 |
| ROGUSKA ET AL., PROTEIN ENG., vol. 9, no. 10, 1996, pages 895 - 904 |
| ROSENBERG ET AL., NEW ENG. J. OF MED., vol. 319, 1988, pages 1676 |
| ROSSOLINI ET AL., MOL. CELL. PROBES, vol. 8, 1994, pages 91 - 98 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", vol. 1-4, 2012, COLD SPRING HARBOR PRESS |
| SANDER; JOUNG, NAT. BIOTECH., vol. 32, 2014, pages 347 - 355 |
| SANDHU J S, GENE, vol. 150, no. 2, 1994, pages 409 - 410 |
| SCHENBORN; MIERENDORF, NUC ACIDS RES., vol. 13, 1985, pages 6223 - 36 |
| See also references of EP3544996A2 |
| SIMS ET AL., J. IMMUNOL., vol. 151, 1993, pages 2296 |
| SMITH; WATERMAN, ADV. APPL. MATH., vol. 2, 1970, pages 482c |
| SONG ET AL., BLOOD, vol. 119, no. 3, 2012, pages 696 - 706 |
| STEPINSKI ET AL., RNA, vol. 7, 2001, pages 1468 - 1495 |
| STUDNICKA ET AL., PROTEIN ENGINEERING, vol. 7, no. 6, 1994, pages 805 - 814 |
| TAN ET AL., J. IMMUNOL., vol. 169, 2002, pages 1119 - 1125 |
| UI-TEI ET AL., FEBS LETTERS, vol. 479, 2000, pages 79 - 82 |
| URNOV ET AL., NAT. REV. GENETICS, vol. l 1, 2010, pages 636 - 646 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| YU, J. ET AL., JOURNAL OF CLINICAL INVESTIGATION, vol. 10, no. 1172, 2015, pages 1 - 34 |
| ZHANG, S. ET AL., THE AMERICAN JOURNAL OF PATHOLOGY, vol. 181, no. 6, 2012, pages 1903 - 1910 |
Cited By (73)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10442849B2 (en) | 2015-05-18 | 2019-10-15 | Tcr2 Therabeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US10358474B2 (en) | 2015-05-18 | 2019-07-23 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US10358473B2 (en) | 2015-05-18 | 2019-07-23 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11965012B2 (en) | 2015-05-18 | 2024-04-23 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11028142B2 (en) | 2015-05-18 | 2021-06-08 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11242376B2 (en) | 2016-08-02 | 2022-02-08 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US10208285B2 (en) | 2016-10-07 | 2019-02-19 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11377638B2 (en) | 2016-10-07 | 2022-07-05 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11085021B2 (en) | 2016-10-07 | 2021-08-10 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11851491B2 (en) | 2016-11-22 | 2023-12-26 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
| US11834506B2 (en) | 2017-02-08 | 2023-12-05 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind NKG2D, CD16, and a tumor-associated antigen for activation of natural killer cells and therapeutic uses thereof to treat cancer |
| US11884732B2 (en) | 2017-02-20 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Proteins binding HER2, NKG2D and CD16 |
| US12247060B2 (en) | 2018-01-09 | 2025-03-11 | Marengo Therapeutics, Inc. | Calreticulin binding constructs and engineered T cells for the treatment of diseases |
| US12264200B2 (en) | 2018-02-08 | 2025-04-01 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US11884733B2 (en) | 2018-02-08 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US12384847B2 (en) | 2018-02-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen |
| US11939384B1 (en) | 2018-02-08 | 2024-03-26 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US12129300B2 (en) | 2018-02-08 | 2024-10-29 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| WO2019161281A1 (en) | 2018-02-17 | 2019-08-22 | Flagship Pioneering Innovations V, Inc. | Compositions and methods for membrane protein delivery |
| US12215157B2 (en) | 2018-02-20 | 2025-02-04 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use |
| WO2019173693A1 (en) * | 2018-03-09 | 2019-09-12 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| US12152073B2 (en) | 2018-03-14 | 2024-11-26 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
| JP7477112B2 (ja) | 2018-06-19 | 2024-05-01 | ナンジン レジェンド バイオテック カンパニー,リミテッド | 操作された細胞およびその使用 |
| JP2021528049A (ja) * | 2018-06-19 | 2021-10-21 | ナンジン レジェンド バイオテック カンパニー,リミテッドNanjing Legend Biotech Co.,Ltd. | 操作された細胞およびその使用 |
| CN112292147A (zh) * | 2018-06-19 | 2021-01-29 | 南京传奇生物科技有限公司 | 工程化的细胞及其用途 |
| JP2024095775A (ja) * | 2018-06-19 | 2024-07-10 | ナンジン レジェンド バイオテック カンパニー,リミテッド | 操作された細胞およびその使用 |
| EP3810190A4 (en) * | 2018-06-19 | 2022-03-02 | Nanjing Legend Biotech Co., Ltd. | Engineered cells and uses thereof |
| US12351632B2 (en) | 2018-07-03 | 2025-07-08 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
| US12286477B2 (en) | 2018-07-03 | 2025-04-29 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
| US11965025B2 (en) | 2018-07-03 | 2024-04-23 | Marengo Therapeutics, Inc. | Method of treating solid cancers with bispecific interleukin-anti-TCRß molecules |
| US11845797B2 (en) | 2018-07-03 | 2023-12-19 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
| WO2020023888A3 (en) * | 2018-07-26 | 2020-07-30 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using target specific fusion proteins |
| WO2020033630A1 (en) * | 2018-08-08 | 2020-02-13 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind bcma, nkg2d and cd16, and methods of use |
| US12384851B2 (en) | 2018-08-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind BCMA, NKG2D and CD16, and methods of use |
| US12378318B2 (en) | 2018-08-08 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and a tumor-associated antigen |
| US12275791B2 (en) | 2018-08-08 | 2025-04-15 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use |
| JP2022501074A (ja) * | 2018-10-01 | 2022-01-06 | アディセット バイオ, インコーポレイテッド | 血液腫瘍を治療するための遺伝子操作しているγδ−T細胞及び遺伝子操作していないγδ−T細胞に関する組成物及び方法 |
| JP7687952B2 (ja) | 2018-10-01 | 2025-06-03 | アディセット セラピューティクス, インク. | 血液腫瘍を治療するための遺伝子操作しているγδ-T細胞及び遺伝子操作していないγδ-T細胞に関する組成物及び方法 |
| US12496274B2 (en) | 2018-11-14 | 2025-12-16 | Flagship Pioneering Innovations V, Inc. | Compositions and methods for compartment-specific cargo delivery |
| CN109627340B (zh) * | 2018-12-05 | 2021-02-12 | 上海交通大学 | Cd3和prlr双特异性抗体及其构建与应用 |
| CN109627340A (zh) * | 2018-12-05 | 2019-04-16 | 上海交通大学 | Cd3和prlr双特异性抗体及其构建与应用 |
| WO2020142672A3 (en) * | 2019-01-04 | 2020-08-20 | Elstar Therapeutics, Inc. | Anti-tcr antibody molecules and uses thereof |
| CN113543807A (zh) * | 2019-01-04 | 2021-10-22 | 马伦戈治疗公司 | 抗tcr抗体分子及其用途 |
| GB2595980A (en) * | 2019-01-04 | 2021-12-15 | Marengo Therapeutics Inc | Anti-TCR antibody molecules and uses thereof |
| US20220064255A1 (en) * | 2019-01-04 | 2022-03-03 | Marengo Therapeutics, Inc. | Anti-tcr antibody molecules and uses thereof |
| EP3906057A4 (en) * | 2019-01-04 | 2022-09-14 | Marengo Therapeutics, Inc. | ANTI-TCR ANTIBODY MOLECULES AND THEIR USES |
| GB2595980B (en) * | 2019-01-04 | 2023-06-14 | Marengo Therapeutics Inc | Anti-TCR antibody molecules and uses thereof |
| US12358982B2 (en) | 2019-02-21 | 2025-07-15 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to T cell related cancer cells and uses thereof |
| US12384842B2 (en) | 2019-02-21 | 2025-08-12 | Marengo Therapeutics, Inc. | Antibody molecules that bind to NKP30 and uses thereof |
| WO2020181221A1 (en) * | 2019-03-07 | 2020-09-10 | Children's Medical Center Corporation | Targeted delivery of immune-modulating vhh and vhh-fusion protein |
| WO2020193506A1 (en) | 2019-03-28 | 2020-10-01 | Albert-Ludwigs-Universitaet Freiburg | Chimeric antigen receptors, vectors coding for such receptors and their use in the modification of t cells |
| EP3715368A1 (en) | 2019-03-28 | 2020-09-30 | Albert-Ludwigs-Universität Freiburg | Chimeric antigen receptors, vectors coding for such receptors and their use in the modification of t cells |
| WO2020201527A1 (en) | 2019-04-04 | 2020-10-08 | Umc Utrecht Holding B.V. | Modified immune receptor constructs |
| EP3946382A1 (en) * | 2019-04-04 | 2022-02-09 | UMC Utrecht Holding B.V. | Modified immune receptor constructs |
| WO2020210816A1 (en) * | 2019-04-12 | 2020-10-15 | Methodist Hospital Research Institute | Therapeutic particles that enable antigen presenting cells to attack cancer cells |
| CN113728095A (zh) * | 2019-04-22 | 2021-11-30 | 南京传奇生物科技有限公司 | 工程化的细胞及其用途 |
| EP3959307A4 (en) * | 2019-04-22 | 2023-08-23 | Nanjing Legend Biotech Co., Ltd. | Engineered cells and uses thereof |
| US20220242929A1 (en) * | 2019-08-05 | 2022-08-04 | Cartherics Pty. Ltd. | Immune cells expressing modified cell receptors and methods of making |
| WO2021022327A1 (en) * | 2019-08-05 | 2021-02-11 | Cartherics Pty. Ltd. | Immune cells expressing modified cell receptors and methods of making |
| CN114828862A (zh) * | 2019-09-12 | 2022-07-29 | T细胞受体治疗公司 | 使用融合蛋白进行tcr重编程的组合物和方法 |
| WO2021050948A1 (en) * | 2019-09-12 | 2021-03-18 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| US12486326B2 (en) | 2020-01-03 | 2025-12-02 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
| US12157771B2 (en) | 2020-05-06 | 2024-12-03 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and CLEC12A |
| WO2022140665A1 (en) * | 2020-12-23 | 2022-06-30 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| EP4267733A4 (en) * | 2020-12-23 | 2025-01-01 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| WO2022147480A1 (en) | 2020-12-30 | 2022-07-07 | Ansun Biopharma, Inc. | Oncolytic virus encoding sialidase and multispecific immune cell engager |
| WO2022147481A1 (en) | 2020-12-30 | 2022-07-07 | Ansun Biopharma Inc. | Combination therapy of an oncolytic virus delivering a foreign antigen and an engineered immune cell expressing a chimeric receptor targeting the foreign antigen |
| US12377144B2 (en) | 2021-03-03 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen |
| CN115806625A (zh) * | 2021-09-15 | 2023-03-17 | 广州百暨基因科技有限公司 | T细胞限定表达的嵌合抗原受体及其应用 |
| CN115806625B (zh) * | 2021-09-15 | 2023-08-04 | 广州百暨基因科技有限公司 | T细胞限定表达的嵌合抗原受体及其应用 |
| WO2023081767A1 (en) | 2021-11-05 | 2023-05-11 | Precision Biosciences, Inc. | Methods for immunotherapy |
| WO2023091910A1 (en) | 2021-11-16 | 2023-05-25 | Precision Biosciences, Inc. | Methods for cancer immunotherapy |
| WO2023108150A1 (en) | 2021-12-10 | 2023-06-15 | Precision Biosciences, Inc. | Methods for cancer immunotherapy |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2018098365A3 (en) | 2018-07-12 |
| AU2017363311A1 (en) | 2019-06-13 |
| JP2019536452A (ja) | 2019-12-19 |
| JP7291396B2 (ja) | 2023-06-15 |
| JP2023109968A (ja) | 2023-08-08 |
| CN110177803A (zh) | 2019-08-27 |
| EP3544996A2 (en) | 2019-10-02 |
| US20190276540A1 (en) | 2019-09-12 |
| US11851491B2 (en) | 2023-12-26 |
| CA3044593A1 (en) | 2018-05-31 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11851491B2 (en) | Compositions and methods for TCR reprogramming using fusion proteins | |
| US11085021B2 (en) | Compositions and methods for TCR reprogramming using fusion proteins | |
| US11242376B2 (en) | Compositions and methods for TCR reprogramming using fusion proteins | |
| EP3298033B1 (en) | Compositions and medical uses for tcr reprogramming using fusion proteins | |
| WO2019222275A2 (en) | Compositions and methods for tcr reprogramming using inducible fusion proteins | |
| AU2017382902A1 (en) | Engineered T cells for the treatment of cancer | |
| US20210253666A1 (en) | Compositions and methods for tcr reprogramming using fusion proteins | |
| HK40045811A (en) | Compositions and methods for tcr reprogramming using fusion proteins | |
| HK40008051A (en) | Compositions and methods for tcr reprogramming using fusion proteins | |
| HK40007902A (en) | Compositions and methods for tcr reprogramming using fusion proteins | |
| HK1252643B (en) | Compositions and medical uses for tcr reprogramming using fusion proteins | |
| EA043737B1 (ru) | Композиции и способы репрограммирования т-клеточных рецепторов с помощью гибридных белков |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17812183 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 3044593 Country of ref document: CA Ref document number: 2019527363 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2017363311 Country of ref document: AU Date of ref document: 20171122 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017812183 Country of ref document: EP Effective date: 20190624 |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17812183 Country of ref document: EP Kind code of ref document: A2 |