Classifications

• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
  • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
  • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
  • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K31/00—Medicinal preparations containing organic active ingredients
  • A61K31/28—Compounds containing heavy metals
  • A61K31/282—Platinum compounds
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K31/00—Medicinal preparations containing organic active ingredients
  • A61K31/33—Heterocyclic compounds
  • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
  • A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
  • A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
  • A61K31/513—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim having oxo groups directly attached to the heterocyclic ring, e.g. cytosine
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K31/00—Medicinal preparations containing organic active ingredients
  • A61K31/33—Heterocyclic compounds
  • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
  • A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
  • A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
  • A61K31/519—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K31/00—Medicinal preparations containing organic active ingredients
  • A61K31/33—Heterocyclic compounds
  • A61K31/555—Heterocyclic compounds containing heavy metals, e.g. hemin, hematin, melarsoprol
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K31/00—Medicinal preparations containing organic active ingredients
  • A61K31/66—Phosphorus compounds
  • A61K31/675—Phosphorus compounds having nitrogen as a ring hetero atom, e.g. pyridoxal phosphate
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K31/00—Medicinal preparations containing organic active ingredients
  • A61K31/70—Carbohydrates; Sugars; Derivatives thereof
  • A61K31/7042—Compounds having saccharide radicals and heterocyclic rings
  • A61K31/7052—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
  • A61K31/706—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
  • A61K31/7064—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
  • A61K31/7068—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K38/00—Medicinal preparations containing peptides
  • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K38/00—Medicinal preparations containing peptides
  • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • A61K38/18—Growth factors; Growth regulators
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K38/00—Medicinal preparations containing peptides
  • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • A61K38/19—Cytokines; Lymphokines; Interferons
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K39/00—Medicinal preparations containing antigens or antibodies
  • A61K39/0005—Vertebrate antigens
  • A61K39/0011—Cancer antigens
  • A61K39/001102—Receptors, cell surface antigens or cell surface determinants
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K39/00—Medicinal preparations containing antigens or antibodies
  • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K39/00—Medicinal preparations containing antigens or antibodies
  • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
  • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
  • A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K39/00—Medicinal preparations containing antigens or antibodies
  • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
  • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
  • A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K39/00—Medicinal preparations containing antigens or antibodies
  • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
  • A61K39/39591—Stabilisation, fragmentation
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
  • A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K49/00—Preparations for testing in vivo
  • A61K49/06—Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations
  • A61K49/08—Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations characterised by the carrier
  • A61K49/10—Organic compounds
  • A61K49/14—Peptides, e.g. proteins
  • A61K49/16—Antibodies; Immunoglobulins; Fragments thereof
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
  • A61P1/02—Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
  • A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
  • A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
  • A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P11/00—Drugs for disorders of the respiratory system
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P13/00—Drugs for disorders of the urinary system
  • A61P13/10—Drugs for disorders of the urinary system of the bladder
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P13/00—Drugs for disorders of the urinary system
  • A61P13/12—Drugs for disorders of the urinary system of the kidneys
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P15/00—Drugs for genital or sexual disorders; Contraceptives
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P17/00—Drugs for dermatological disorders
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P25/00—Drugs for disorders of the nervous system
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P35/00—Antineoplastic agents
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P37/00—Drugs for immunological or allergic disorders
  • A61P37/02—Immunomodulators
  • A61P37/04—Immunostimulants
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P5/00—Drugs for disorders of the endocrine system
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • C07K14/475—Growth factors; Growth regulators
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
  • C07K16/22—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
  • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
  • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
  • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
  • C07K16/2827—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K39/00—Medicinal preparations containing antigens or antibodies
  • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
  • C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
  • C07K2317/55—Fab or Fab'
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
  • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
  • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
  • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
  • C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
• • C—CHEMISTRY; METALLURGY
  • C07—ORGANIC CHEMISTRY
  • C07K—PEPTIDES
  • C07K2317/00—Immunoglobulins specific features
  • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
  • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

• the present application relates to anti-PD-L1 antibodies or antigen binding fragments thereof, nucleic acid encoding the same, therapeutic compositions thereof, and their use to enhance T-cell function to upregulate cell-mediated immune responses and for the treatment of T cell dysfunctional disorders, such as tumor immunity, for the treatment of and cancer.
• lymphocyte development and activation The two major types of lymphocytes in humans are T (thymus-derived) and B (bone marrow derived. These cells are derived from hematopoietic stem cells in the bone marrow and fetal liver that have committed to the lymphoid development pathway. The progeny of these stem cells follow divergent pathways to mature into either B or T lymphocytes. Human B-lymphocyte development takes place entirely within the bone marrow. T cells, on the other hand, develop from immature precursors that leave the marrow and travel through the bloodstream to the thymus, where they proliferate and differentiate into mature T lymphocytes.
• Mature lymphocytes that emerge from the thymus or bone marrow are in a
• quiescent, or "resting” state i.e., they are mitotically inactive.
• these "naive” or “virgin” lymphocytes travel into various secondary or peripheral lymphoid organs, such as the spleen, lymph nodes or tonsils.
• Most virgin lymphocytes have an inherently short life span and die without a few days after leaving the marrow or thymus. However, if such a cell receives signals that indicate the presence of an antigen, they may activate and undergo successive rounds of cell division. Some of the resulting progeny cells then revert to the resting state to become memory lymphocytes - B and T cells that are essentially primed for the next encounter with the stimulating allergen.
• Lymphocyte activation refers to an ordered series of events through which a resting lymphocyte passes as it is stimulated to divide and produce progeny, some of which become effector cells.
• a full response includes both the induction of cell proliferation (mitogenesis) and the expression of immunologic functions.
• Lymphocytes become activated when specific ligands bind to receptors on their surfaces. The ligands are different for T cells and B cells, but the resulting intracellular physiological
• These more common antigens activate B cells when they are co-stimulated with nearby activated helper T- lymphocytes. Such stimulation may occur from lymphokines secreted by the T-cell, but is transmitted most efficiently by direct contact of the B cell with T-cell surface proteins that interact with certain B-cell surface receptors to generate a secondary signal.
• T lymphocytes do not express immunoglobulins, but, instead detect the presence of foreign substances by way of surface proteins called T-cell receptors (TCR). These receptors recognize antigens by either direct contact or through influencing the activity of other immune cells. Together with macrophages, T cells are the primary cell type involved in the cell-mediated immunity.
• T-cells can detect foreign substances only in specific contexts.
• T-lymphocytes will recognize a foreign protein only if it first cleaved into small peptides, which are then displayed on the surface of a second host cell, called an antigen- presenting cell (APC).
• APC antigen-presenting cell
• Many types of host cells can present antigens under some conditions but certain types are more specifically adapted for this purpose and are particularly important in controlling T-cell activity, including macrophages and other B-cells.
• Antigen presentation depends in part on specific proteins, called major histocompatibility complex (MHC) proteins, on the surface of the presenting cells.
• MHC major histocompatibility complex
• T c cells cytotoxic T lymphocytes
• T H helper T cells
• T c cells are important in viral defense, and can kill viruses directly by recognizing certain cell surface expressed viral peptides.
• TH cells promote proliferation, maturation and immunologic function of other cell types, e.g. , lymphokine secretion to control activities of B cells,
• cytotoxic T cells Both virgin and memory T-lymphocytes ordinarily remain in the resting state, and in this state they do not exhibit significant helper or cytotoxic activity. When activated, these cells undergo several rounds of mitotic division to produce daughter cells. Some of these daughter cells return to the resting state as memory cells, but others become effector cells that actively express helper or cytotoxic activity. These daughter cells resemble their parents: CD4+ cells can only product CD4+ progeny, while CD8+ cells yield only CD8+ progeny. Effector T- cells express cell surface markers that are not expressed on resting T-cells, such as CD25, CD28, CD29, CD40L, transferrin receptors and class II MHC proteins.
• T-lymphocyte responses to most antigens also require two types of simultaneous stimuli.
• the first is the antigen, which if appropriately displayed by MHC proteins on an antigen-presenting cell, can be recognized and bound by T-cell receptors. While this antigen-MHC complex does send a signal to the cell interior, it is usually insufficient to result in T-cell activation.
• Full activation such as occurs with helper T-cells, requires costimulation with other specific ligands called costimulators that are expressed on the surface of the antigen-presenting cell.
• Activation of a cytotoxic T cell generally requires IL -2, a cytokine secreted by activated helper T cells.
• PD-1 programmed death-1 receptor
• B7-H1, CD274 PD-L1
• PD-L2 B7-DC, CD273
• the negative regulatory role of PD-1 was revealed by PD-1 knock outs (Pdcdl ' ' ' ), which are prone to autoimmunity.
• PD-1 is related to CD28 and CTLA-4, but lacks the membrane proximal cysteine that allows homodimerization.
• the cytoplasmic domain of PD-1 contains an immunoreceptor tyorine-based inhibition motif (ITIM, V/lxYxxL/V).
• ITIM immunoreceptor tyorine-based inhibition motif
• PD-1 only binds to PD-L1 and PD-L2.
• PD-1 can be expressed on T cells, B cells, natural killer T cells, activated monocytes and dendritic cells (DCs). PD-1 is expressed by activated, but not by unstimulated human CD4 + and CD8 + T cells, B cells and myeloid cells. This stands in contrast to the more restricted expression of CD28 and CTLA-4. Nishimura et al, Int. Immunol. 8: 773-80 (1996); Boettler et al, J. Virol. 80: 3532-40 (2006).
• PD-1 PD-1 that have been cloned from activated human T cells, including transcripts lacking (i) exon 2, (ii) exon 3, (iii) exons 2 and 3 or (iv) exons 2 through 4. Nielsen et al, Cell. Immunol. 235: 109-16 (2005). With the exception of PD-IAex3, all variants are expressed at similar levels as full length PD-1 in resting peripheral blood mononuclear cells (PBMCs). Expression of all variants is significantly induced upon activation of human T cells with anti-CD3 and anti-CD28.
• PBMCs peripheral blood mononuclear cells
• the PD-1Aex3 variants lacks a transmembrane domain, and resembles soluble CTLA-4, which plays an important role in autoimmunity. Ueda et al, Nature 423: 506-11 (2003). This variant is enriched in the synovial fluid and sera of patients with rheumatoid arthritis. Wan et al, J. Immunol. 177: 8844-50 (2006).
• the two PD-1 ligands differ in their expression patterns.
• PD-L1 is constitutively expressed on mouse T and B cells, CDs,
• PD-L1 is expressed on a wide range of nonhematopoietic cells (e.g., cornea, lung, vascular epithelium, liver nonpar enchymal cells, mesenchymal stem cells, pancreatic islets, placental
• JAK2 has also been implicated in PD-L1 induction.
• Loss or inhibition of phosphatase and tensin homolog (PTEN), a cellular phosphatase that modified phosphatidylinosital 3-kinase (PI3K) and Akt signaling increased post- transcriptional PD-L1 expression in cancers.
• PTEN phosphatase and tensin homolog
• PI3K a cellular phosphatase that modified phosphatidylinosital 3-kinase
• Akt signaling increased post- transcriptional PD-L1 expression in cancers.
• PD-L2 expression is more restricted than PD-L1.
• PD-L2 is inducibly expressed on DCs, macrophag
• PD-L2 is also expressed on about half to two-thirds of resting peritoneal Bl cells, but not on conventional B2 B cells. Zhong et al, Eur. J. Immunol. 37: 2405-10 (2007). PD-L2+ Bl cells bind phosphatidylcholine and may be important for innate immune responses against bacterial antigens. Induction of PD-L2 by IFN- ⁇ is partially dependent upon NF -KB. Liang et al, Eur. J. Immunol. 33_: 2706-16 (2003). PD-L2 can also be induced on monocytes and macrophages by GM-CF, IL-4 and and IFN- ⁇ . Yamazaki et al., J. Immunol. 169: 5538-45 (2002); Loke et al, PNAS 100:5336 ⁇ 1 (2003).
• PD-1 signaling typically has a greater effect on cytokine production than on cellular proliferation, with significant effects on IFN- ⁇ , TNF-a and IL-2 production.
• PD-1 mediated inhibitory signaling also depends on the strength of the TCR signaling, with greater inhibition delivered at low levels of TCR stimulation. This reduction can be overcome by costimulation through CD28 [Freeman et al, J. Exp. Med. 192: 1027-34 (2000)] or the presence of IL-2 [Carter et al, Eur. J. Immunol. 32: 634-43 (2002)]- Evidence is mounting that signaling through PD-L1 and PD-L2 may be bidirectional.
• signaling may also be delivered back to the cells expressing PD-L1 and PD-L2.
• a naturally human anti-PD-L2 antibody isolated from a patient with Waldenstrom's macroglobulinemia was not found to upregulate MHC II or B7 costimulatory molecules, such cells did produce greater amount of proinflammatory cytokines, particularly TNF-a and IL-6, and stimulated T cell proliferation.
• Treatment of mice with this antibody also (1) enhanced resistance to transplated bl6 melanoma and rapidly induced tumor- specific CTL.
• Radhakrishnan et al J. Immunol. 170: 1830-38 (2003); Radhakrishnan et al, Cancer Res. 64: 4965-72 (2004); Heckman et al, Eur. J. Immunol. 37: 1827-35 (2007); (2) blocked development of airway inflammatory disease in a mouse model of allergic asthma. Radhakrishnan et al, J. Immunol. 173: 1360-65 (2004);
• B7.1 has already been identified as a binding partner for PD-L1. Butte et al, Immunity 27: 111-22 (2007). Chemical crosslinking studies suggest that PD-L1 and B7.1 can interact through their IgV-like domains. B7.1 :PD-L1 interactions can induce an inhibitory signal into T cells.
• T cells lacking CD28 and CTLA-4 show decreased proliferation and cytokine production when stimulated by anti-CD3 plus B7.1 coated beads.
• T cells lacking all the receptors for B7.1 i.e., CD28, CTLA-4 and PD-L1
• T-cell proliferation and cytokine production were no longer inhibited by anti-CD3 plus B7.1 coated beads. This indicates that B7.1 acts specifically through PD-L1 on the T- cell in the absence of CD28 and CTLA-4.
• T cells lacking PD-1 showed decreased proliferation and cytokine production when stimulated in the presence of anti-CD3 plus PD-L1 coated beads, demonstrating the inhibitory effect of PD-L1 ligation on B7.1 on T cells.
• T cells lacking all known receptors for PD-L1 i.e., no PD-1 and B7.1
• T cell proliferation was no longer impaired by anti-CD3 plus PD- L1 coated beads.
• PD-L1 can exert an inhibitory effect on T cells either through B7.1 or PD-1.
• T cell PD-L1 may trap or segregate away APC B7.1 from interaction with CD28.
• the antagonism of signaling through PD-L1 including blocking PD-L1 from interacting with either PD-1 , B7.1 or both, thereby preventing PD-L1 from sending a negative co- stimulatory signal to T-cells and other antigen presenting cells is likely to enhance immunity in response to infection (e.g., acute and chronic) and tumor immunity.
• the anti-PD-L1 antibodies of the present invention may be combined with antagonists of other components of PD-1 : PD-L1 signaling, for example, antagonist anti-PD-1 and anti-PD-L2 antibodies.
• the inhibition of PD-L1 signaling has been proposed as a means to enhance T cell immunity for the treatment of cancer (e.g., tumor immunity) and infection, including both acute and chronic (e.g., persistent) infection.
• cancer e.g., tumor immunity
• infection including both acute and chronic (e.g., persistent) infection.
• Inhibitors blocking the PD-L1 : PD-1 interaction are known from, i.a.,
• anti-PD-L1 antibodies including nucleic acids encoding and compositions containing such antibodies, and for their use to enhance T-cell function to upregulate cell-mediated immune responses and for the treatment of T cell dysfunctional disorders, such as tumor immunity.
• ADCC antibody dependent cell-mediated cytotoxicity
• the anti-PD-L1 antibodies according to the present invention which have antibody dependent cell-mediated cytotoxicity (ADCC) activity, directly act on PD-L1 bearing tumor cells by inducing their lysis without showing any significant toxicity.
• ADCC antibody dependent cell-mediated cytotoxicity
• the antibodies do not only block the interaction between human PD-L1 and human PD-1 , but also the interactions between the respective mouse and cynomolgus monkey proteins.
• the invention provides for an isolated heavy chain variable region polypeptide comprising an HVR-H1 , HVR-H2 and HVR-H3 sequence, wherein:
• HVR-H1 sequence is X YX 2 MX 3 (SEQ ID NO:1);
• the HVR-H2 sequence is SIYPSGGX 4 TFYADX 5 VKG (SEQ ID NO:2);
• the HVR-H3 sequence is IKLGTVTTVX 6 Y (SEQ ID NO:3); further wherein: X ⁇ is K, R, T, Q, G, A, W, M, I or S; X 2 is V, R, K, L, or I; X 3 is H ( T, N, Q, A, V, Y, W, F or M; X4 is F or I; X 5 is S or T; X 6 is E or D.
• Xi is M, I or S;
• X 2 is R, K, L, M or I;
• X 3 is F or M;
• X4 is F or l;
• X 5 is S or T;
• X 6 is E or D.
• Xi is M, I or S; X 2 is L, M or I; X 3 is F or M; X4 is I; X 5 is S or T; Xe is D.
• Xi is S; X 2 is I; X3 is M; X4 is I; X5 is T; Xe is D.
• polypeptide further comprises variable region heavy chain framework sequences juxtaposed between the HVRs according to the formula: (HC- FR1)-(HVR-H1)-(HC-FR2)-(HVR-H2)-(HC-FR3)-(HVR-H3)- (HC-FR4).
• the framework sequences are derived from human consensus framework sequences or human germline framework sequences.
• HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:4);
• HC-FR2 is WVRQAPGKG LEWVS (SEQ ID NO:5);
• HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:6);
• HC-FR4 is WGQGTLVTVSS (SEQ ID NO:7).
• the heavy chain polypeptide is further combined with a variable region light chain comprising an an HVR-L1 , HVR-L2 and HVR-L3, wherein: (a) the HVR-L1 sequence is (SEQ ID NO.8);
• HVR-L2 sequence is XioVXnX 12 RPS (SEQ ID NO:9);
• X 7 is N or S
• Xe is T, R or S
• X 9 is A or G
• X10 is E or D
• Xn is I, N or
• the light chain further comprises variable region light chain framework sequences juxtaposed between the HVRs according to the formula: (LC- FR1 MHVR-L1 )-(LC-FR2)-(HVR-L2)-(LC-FR3)-(HVR-L3)-(LC-FR4).
• the light chain framework sequences are derived from human consensus framework sequences or human germline framework sequences.
• the light chain framework sequences are lambda light chain sequences.
• at least one of the framework sequence is the following:
• LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO:11);
• LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO:12);
• LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO:13);
• LC-FR4 is FGTGTKVTVL (SEQ ID NO: 14).
• the invention provides an isolated anti-PD-L1 antibody or antigen binding fragment comprising a heavy chain and a light chain variable region sequence, wherein:
• the heavy chain comprises an HVR-H1 , HVR-H2 and HVR-H3, wherein further: (i) the HVR-H1 sequence is X1YX2MX3 (SEQ ID NO:1); (ii) the HVR-H2 sequence is
• the light chain comprises an HVR-L1 , HVR-L2 and HVR-L3, wherein further: (iv) the HVR-L1 sequence is (SEQ ID NO:8); (v) the HVR-L2 sequence is X 10 VX 11 X 12 RPS (SEQ ID NO:9); (vi) the HVR-L3 sequence is
• Xi is K, R, T, Q, G, A, W, M, I or S
• X 2 is V, R, K, L, M or I
• X 3 is H, T, N, Q, A, V, Y, W, F or M
• X4 is F or I
• X 5 is S or T
• Xe is E or D
• X 7 is N or S
• X 8 is T, R or S
• X 9 is A or G
• X 0 is E or D
• Xn is I, N or S
• X 1 2 is D, H or N
• X 1 3 is F or Y
• X 14 is N or S
• X 15 is R, T or S
• X 6 is G or S
• Xi 7 is I or T.
• Xi is M, I or S; X 2 is R, K, L, M or I; X 3 is F or M; X4 is F or I; X 5 is S or T; Xe is E or D; X 7 is N or S; X 8 is T, R or S; X 9 is A or G; X i0 is E or D; Xn is N or S; X 12 is N; X13 is F or Y; X 14 is S; X15 is S; X 6 is G or S; X 17 is T.
• Xi is M, I or S; X 2 is L, M or I; X 3 is F or M; X4 is I; X 5 is S or T; X 6 is D; X 7 is N or S; X 8 is T, R or S; X 9 is A or G; X 10 is E or D; Xn is N or S; X12 is N; X 3 is F or Y; X14 is S; X15 is S; Xi 6 is G or S; X 17 is T.
• the heavy chain variable region comprises one or more
• framework sequences juxtaposed between the HVRs as: (HC-FR1)-(HVR-H1)-(HC- FR2)-(HVR-H2)-(HC-FR3)-(HVR- H3)-(HC-FR4), and the light chain variable regions comprises one or more framework sequences juxtaposed between the HVRs as: (LC-FR1 MHVR-L1 )-(LC-FR2)-(HVR-l_2)-(LC-FR3)-(HVR- L3)-(LC-FR4).
• framework sequences are derived from human
• one or more of the heavy chain framework sequences is the following:
• HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:4);
• HC-FR2 is WVRQAPGKGLEWVS (SEQ ID NO:5);
• HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:6);
• HC-FR4 is WGQGTLVTVSS (SEQ ID NO:7).
• the light chain framework sequences are lambda light chain sequences.
• one or more of the light chain framework sequences is the following:
• LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO:11);
• LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO:12);
• LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC; (SEQ ID NO: 13);
• LC-FR4 is FGTGTKVTVL (SEQ ID NO: 14).
• the heavy chain variable region polypeptide, antibody or antibody fragment further comprises at least a C H 1 domain. In a more specific aspect, the heavy chain variable region polypeptide, antibody or antibody fragment further comprises a C H 1, a C H 2 and a C H 3 domain.
• variable region light chain, antibody or antibody fragment further comprises a C L domain.
• the antibody further comprises a C H 1, a C H 2, a C H 3 and a C L domain. In a still further specific aspect, the antibody further comprises a human or murine constant region.
• the human constant region is selected from the group consisting of lgG1, lgG2, lgG2, lgG3, lgG4.
• the human or murine constant region is lgG1.
• the invention provides for an anti-PD-L1 antibody comprising a heavy chain and a light chain variable region sequence, wherein:
• the heavy chain comprises an HVR-H1, HVR-H2 and an HVR-H3, having at least 80% overall sequence identity to SYIMM (SEQ ID NO:15), SIYPSGGITFYADTVKG
• the light chain comprises an HVR-L1 , HVR-L2 and an HVR-L3, having at least 80% overall sequence identity to TGTSSDVGGYNYVS (SEQ ID NO:18), DVSNRPS (SEQ ID NO:19) and SSYTSSSTRV (SEQ ID NO:20), respectively.
• sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
• the invention provides for an anti-PD-L1 antibody comprising a heavy chain and a light chain variable region sequence, wherein:
• the heavy chain comprises an HVR-H1 , HVR-H2 and an HVR-H3, having at least 80% overall sequence identity to MYMMM (SEQ ID NO:21), SIYPSGGITFYADSVKG (SEQ ID NO:22) and IKLGTVTTVDY (SEQ ID NO: 17), respectively, and
• the light chain comprises an HVR-L1, HVR-L2 and an HVR-L3, having at least 80% overall sequence identity to TGTSSDVGAYNYVS (SEQ ID NO:23), DVSNRPS (SEQ ID NO: 19) and SSYTSSSTRV (SEQ ID NO.20), respectively.
• sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
• HVR-H1 SEQ ID NO:15
• HVR-H2 SEQ ID NO:16
• HVR-H3 SEQ ID NO:17
• HVR-L1 SEQ ID NO: 18
• HVR-L2 SEQ ID NO: 19
• HVR-L3 SEQ ID NO:20
• the heavy chain variable region comprises one or more framework sequences juxtaposed between the HVRs as: (HC-FR1)- (HVR-H1)-(HC-FR2)-(HVR- H2)-(HC-FR3)-(HVR-H3)-(HC-FR4), and the light chain variable regions comprises one or more framework sequences juxtaposed between the HVRs as: (LC- FR1)- (HVR-L1 )-(LC-FR2)-(HVR-l_2)-(LC-FR3)-(HVR-L3)-(LC-FR4).
• the framework sequences are derived from human germline sequences.
• one or more of the heavy chain framework sequences is the following:
• HC-FR1 is EVQLLESGGGLVQPGGSLRLSCAASGFTFS (SEQ ID NO:4);
• HC-FR2 is WVRQAPGKG LEWVS (SEQ ID NO:5);
• HC-FR3 is RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR (SEQ ID NO:6); HC-FR4 is WGQGTLVTVSS (SEQ ID NO:7).
• the light chain framework sequences are derived from a lambda light chain sequence.
• one or more of the light chain framework sequences is the following:
• LC-FR1 is QSALTQPASVSGSPGQSITISC (SEQ ID NO:11);
• LC-FR2 is WYQQHPGKAPKLMIY (SEQ ID NO: 12);
• LC-FR3 is GVSNRFSGSKSGNTASLTISGLQAEDEADYYC (SEQ ID NO:13);
• LC-FR4 is FGTGTKVTVL (SEQ ID NO:14).
• the antibody further comprises a human or murine constant region.
• the human constant region is selected from the group consisting of lgG1, lgG2, lgG2, lgG3, lgG4.
• the invention provides for an isolated anti-PD-L1 antibody comprising a heavy chain and a light chain variable region sequence, wherein:
• the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence:
• the light chain sequence has at least 85% sequence identity to the light chain sequence:
• sequence identity is 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
• the invention provides for an isolated anti-PD-L1 antibody comprising a heavy chain and a light chain variable region sequence, wherein:
• the heavy chain sequence has at least 85% sequence identity to the heavy chain sequence:
• the light chain sequence has at least 85% sequence identity to the light chain sequence:
• sequence identity is 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
• the antibody binds to human, mouse or cynomolgus monkey PD-L1.
• the antibody is capable of blocking the interaction between human, mouse or cynomolgus monkey PD-L1 and the respective human, mouse or cynomolgus monkey PD-1 receptors.
• the antibody binds to human PD-L1 with a KD of 5x10 "9 M or less, preferably with a KD of 2x10 "9 M or less, and even more preferred with a KD of 1x10 "9 M or less.
• the invention concerns an isolated anti-PD-L1 antibody or antigen binding fragment thereof which binds to a functional epitope comprising residues Y56 and D61 of human PD-L1 (SEQ ID NO:28).
• the functional epitope further comprises E58, E60, Q66, R113 and M115 of human PD-L1 (SEQ ID NO:28).
• the antibody binds to a conformational epitope, comprising residues 54-66 and 1 2-122 of human PD-L1 (SEQ ID NO:28).
• the invention is related to an anti-PD-L1 antibody, or antigen binding fragment thereof, which cross-competes for binding to PD-L1 with an antibody according to the invention as described herein.
• the invention provides for compositions comprising any of the above described anti-PD-L1 antibodies in combination with at least one pharmaceutically acceptable carrier.
• the invention provides for an isolated nucleic acid encoding a polypeptide, or light chain or a heavy chain variable region sequence of an anti-PD-L1 antibody, or antigen binding fragment thereof, as described herein. In a still further embodiment, the invention provides for an isolated nucleic acid encoding a light chain or a heavy chain variable region sequence of an anti-PD-L1 antibody, wherein:
• the heavy chain comprises an HVR-H1 , HVR-H2 and an HVR-H3 sequence having at least 80% sequence identity to SYIMM (SEQ ID NO: 15),
• SIYPSGGITFYADTVKG SEQ ID NO: 16
• IKLGTVTTVDY SEQ ID NO: 17
• the light chain comprises an HVR-L1 , HVR-L2 and an HVR-L3 sequence having at least 80% sequence identity to TGTSSDVGGYNYVS (SEQ ID NO: 18), DVSNRPS (SEQ ID NO:19) and SSYTSSSTRV (SEQ ID NO:20), respectively.
• sequence identity is 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
• nucleic acid is SEQ ID NO:30 for the heavy chain, and SEQ ID NO:31 for the light chain.
• the nucleic acid further comprises a vector suitable for expression of the nucleic acid encoding any of the previously described anti-PD-L1 antibodies.
• the vector further comprises a host cell suitable for expression of the nucleic acid.
• the host cell is a eukaryotic cell or a prokaryotic cell.
• the eukaryotic cell is a mammalian cell, such as Chinese Hamster Ovary (CHO).
• CHO Chinese Hamster Ovary
• the invention provides for a process of making an anti- PD- L1 antibody or antigen binding fragment thereof, comprising culturing a host cell containing nucleic acid encoding any of the previously described anti-PD-L1 antibodies or antigen-binding fragment in a form suitable for expression, under conditions suitable to produce such antibody or fragment, and recovering the antibody or fragment.
• the invention provides a kit of parts comprising a container enclosing a therapeutically effective amount of a composition disclosed herein and a package insert indicating use for the treatment of a T-cell dysfunctional disorder.
• the invention provides for a kit of parts comprising any of the above described anti-PD-L1 compositions in combination with at least one further therapeutic agent or vaccine, such as a chemotherapeutic agent.
• the at least one chemotherapeutic agent is gemcitabine
• the vaccine is Stimuvax.
• the invention provides for a method of enhancing T-cell function comprising administering an effective amount of any of the above described anti-PD-L1 antibodies or compositions.
• the anti-PD-L1 antibody or composition renders dysfunctional T-cells non-dysfunctional.
• the antibody or composition treats of prevents a symptom of persistent infection, such as viral infection, e.g. by human immunodeficiency virus (HIV), herpes virus, Eppstein-Barr virus or human papilloma virus.
• HIV human immunodeficiency virus
• the invention provides for a method of treating a T-cell dysfunctional disorder comprising administering a therapeutically effective amount of any of the above described anti-PD-L1 antibodies or compositions.
• the T-cell dysfunctional disorder is tumor immunity.
• the method further comprises treatment with a vaccine.
• the PD-L1 antibody or composition is combined with a treatment regimen further comprising a traditional therapy selected from the group consisting of: surgery, radiation therapy, chemotherapy, targeted therapy,
• the tumor immunity results from a cancer selected from the group consisting of: breast, lung, colon, ovarian, melanoma, bladder, kidney, liver, salivary, stomach, gliomas, thyroid, thymic, epithelial, head and neck cancers, gastric, and pancreatic cancer.
• Another aspect of the invention relates to the use of antibody dependent cell- mediated cytotoxicity (ADCC) of an anti-PD-L1 antibody disclosed herein or composition in the treatment of cancer.
• ADCC antibody dependent cell- mediated cytotoxicity
• the invention pertains to method of treating cancer comprising
• an anti-PD-L1 antibody which induces antibody dependent cell-mediated cytotoxicity (ADCC).
• ADCC antibody dependent cell-mediated cytotoxicity
• the constant region of the anti-PD-L1 antibody is lgG1.
• the cancer is selected from the group consisting of: breast, lung, colon, ovarian, melanoma, bladder, kidney, liver, salivary, stomach, gliomas, thyroid, thymic, epithelial, head and neck cancers, gastric and pancreatic cancer.
• the invention relates likewise to the use of an anti-PD-L1 antibody or composition as described above and below for the manufacture of a medicament for ehancing T-cell function, treating a T-cell dysfunctional disorder or treating cancer;
• the invention is directed to engineered antibodies, or engineered antibody fragments, which are fused directly or via a linker molecule to therapeutic agents, such as cytokines (e.g. IL-2, IL-12, TNFa, IFNa, IFNb), or growth factors; which engineered antibodies or engineered antibody fragments may also be used in tumor therapy and immune system related diseases.
• cytokines e.g. IL-2, IL-12, TNFa, IFNa, IFNb
• growth factors e.g. IL-2, IL-12, TNFa, IFNa, IFNb
• Antibody fusion proteins, especially immunocytokines are well known in the art.
• the fusion partner can be bound to the N-terminus of the antibody or antibody fragment or, preferably, to its C-terminus.
• Disfunction in the context of immune dysfunction, refers to a state of immune reduced responsiveness to antigenic stimulation.
• the term includes the common elements of both exhaustion and/or anergy in which antigen recognition may occur, but the ensuing immune response is ineffective to control infection or tumor growth.
• Enhancing T-cell function means to induce, cause or stimulate a T-cell to have a sustained or amplified biological function, or renew or reactivate exhausted or inactive T-cells.
• enhancing T-cell function include: increased secretion of ⁇ -interferon from CD8 + T- cells, increased proliferation, increased antigen responsiveness (e.g., viral or pathogen clearance) relative to such levels before the intervention.
• the level of enhancement is as least 50%, alternatively 60%, 70%, 80%, 90%, 100%, 120%, 150%, 200%. The manner of measuring this enhancement is known to one of ordinary skill in the art.
• T cell dysfunctional disorder is a disorder or condition of T-cells characterized by decreased responsiveness to antigenic stimulation.
• a T- cell dysfunctional disorder is a disorder that is specifically associated with
• T -cell dysfunctional disorder is one in which T-cells are anergic or have decreased ability to secrete cytokines, proliferate, or execute cytolytic activity.
• the decreased responsiveness results in ineffective control of a pathogen or tumor expressing an immunogen.
• T cell dysfunctional disorders characterized by T-cell dysfunction include unresolved acute infection, chronic infection and tumor immunity.
• 'Tumor immunity refers to the process in which tumors evade immune recognition and clearance.
• tumor immunity is "treated” when such evasion is attenuated, and the tumors are recognized and attacked by the immune system.
• tumor recognition include tumor binding, tumor shrinkage and tumor clearance.
• vaccine includes any nonpathogenic immunogen that, when inoculated into a host, induces protective immunity against a specific pathogen.
• Vaccines can take many forms. Vaccines can be whole organisms that share important antigens with the pathogem, but are not pathogenic themselves (e.g., cowpox). Vaccines can also be prepared from killed (e.g., Salk polio vaccine) or attenuated (lost ability to produce disease - e.g., Sabin polio vaccine). Vaccines can also be prepared from purified macromolecules isolated from the pathogenic organism. For example, toxoid vaccines (e.g.
• Subunit vaccines e.g., Hepatitis B
• Hapten conjugate vaccines attaches certain carbohydrate or polypeptide epitopes isolated from the pathogen of interest to immunogenic carriers, such as tetanus toxoid. These strategies essentially use the epitopes as haptens to induce antibody production, which then recognize the same epitope in the native pathogen.
• DNA vaccines exploit the ability of host cells to take up and express DNA encoding pathogenic proteins that is injected intramuscularly. Host responses to immunogens can be enhanced if administered as a mixture with adjuvants.
• Immune adjuvants function in one or more of the following ways: (1) prolonging retention of the immunogen, (2) increased effective size of the immunogen (and hence promoting phagocytosis and presentation to macrophages), (3) stimulating the influx of macrophage or other immune cells to the injection site, or (4) promoting local cytokine production and other immunologic activities.
• Example adjuvants include: complete Freund's adjuvant (CFA), aluminum salts, and mycobacterial derived proteins such as muramyl di- or tri-peptides.
• antibody includes monoclonal antibodies (including full length antibodies which have an immunoglobulin Fc region), antibody compositions with polyepitopic specificity, multispecific antibodies ⁇ e.g., bispecific antibodies, diabodies, and single- chain molecules, as well as antibody fragments (e.g., Fab, F(ab')2, and Fv).
• immunoglobulin Ig
• the basic 4- chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains.
• IgM antibody consists of 5 of the basic heterotetramer units along with an additional polypeptide called a J chain, and contains 10 antigen binding sites, while IgA antibodies comprise from 2-5 of the basic 4-chain units which can polymerize to form polyvalent assemblages in combination with the J chain.
• the 4-chain unit is generally about 150,000 daltons.
• Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype.
• Each H and L chain also has regularly spaced intrachain disulfide bridges.
• Each H chain has at the N-terminus, a variable domain (V H ) followed by three constant domains (C H ) for each of the a and ⁇ chains and four C H domains for ⁇ and ⁇ isotypes.
• Each L chain has at the N-terminus, a variable domain (V L ) followed by a constant domain at its other end.
• the V L is aligned with the V H and the C L is aligned with the first constant domain of the heavy chain (C H 1).
• Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
• the pairing of a V H and V L together forms a single antigen-binding site.
• L chain from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains.
• immunoglobulins can be assigned to different classes or isotypes.
• immunoglobulins There are five classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, having heavy chains designated ⁇ , ⁇ , ⁇ , ⁇ and ⁇ , respectively.
• the Y and a classes are further divided into subclasses on the basis of relatively minor differences in the CH sequence and function, e.g., humans express the following subclasses: lgG1, lgG2A, lgG2B, lgG3, lgG4, lgA1 and lgK1.
• An “isolated” antibody is one that has been identified, separated and/or recovered from a component of its production environment (E.g., natural or recombinant).
• the isolated polypeptide is free of association with all other components from its production environment.
• Contaminant components of its production environment such as that resulting from recombinant transfected cells, are materials that would typically interfere with research, diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or non- proteinaceous solutes.
• the polypeptide will be purified: (1) to greater than 95% by weight of antibody as determined by, for example, the Lowry method, and in some embodiments, to greater than 99% by weight; (1) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie blue or, preferably, silver stain.
• Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present.
• variable region or “variable domain” of an antibody refers to the amino-terminal domains of the heavy or light chain of the antibody.
• the variable domains of the heavy chain and light chain may be referred to as "VH” and “VL”, respectively. These domains are generally the most variable parts of the antibody (relative to other antibodies of the same class) and contain the antigen binding sites.
• variable refers to the fact that certain segments of the variable domains differ extensively in sequence among antibodies.
• the V domain mediates antigen binding and defines the specificity of a particular antibody for its particular antigen.
• variability is not evenly distributed across the entire span of the variable domains. Instead, it is concentrated in three segments called hypervariable regions (HVRs) both in the light-chain and the heavy chain variable domains.
• HVRs hypervariable regions
• the more highly conserved portions of variable domains are called the framework regions (FR).
• the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three HVRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure.
• the HVRs in each chain are held together in close proximity by the FR regions and, with the HVRs from the other chain, contribute to the formation of the antigen binding site of antibodies (see Kabat et al, Sequences of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, MD (1991)).
• the constant domains are not involved directly in the binding of antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
• monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations and/or post-translation modifications (e.g., isomerizations, amidations) that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. In contrast to polyclonal antibody
• each monoclonal antibody is directed against a single determinant on the antigen.
• the monoclonal antibodies are advantageous in that they are synthesized by the hybridoma culture, uncontaminated by other immunoglobulins.
• the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
• the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including, for example, the hybridoma method (e.g., Kohler and Milstein., Nature, 256:495-97 (1975); Hongo et al, Hybridoma, 14 (3): 253-260 (1995), Harlow et al, Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2 nd ed. 1988); Hammerling et al, in: Monoclonal Antibodies and T-Cell Hybridomas 563- 681 (Elsevier, N. Y., 1981)), recombinant DNA methods (see, e.g., U.S. Patent No.
• phage-display technologies see, e.g., Clackson et al, Nature, 352: 624- 628 (1991); Marks et al, J. Mol Biol. 222: 581-597 (1992); Sidhu et al, J. Mol Biol. 338(2): 299-310 (2004); Lee et al, J. Mol Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. ScL USA 101(34): 12467-12472 (2004); and Lee et al, J. Immunol. Methods 284(1-2): 119-132 (2004), and technologies for producing human or humanlike antibodies in animals that have parts or all of the human immunoglobulin loci or genes encoding human immunoglobulin sequences (see, e.g., WO
• antibody fragment comprises a portion of an intact antibody, preferably the antigen binding and/or the variable region of the intact antibody.
• antibody fragments include Fab, Fab * , F(ab') 2 and Fv fragments; diabodies; linear antibodies (see U.S. Patent 5,641,870, Example 2; Zapata et al, Protein Eng. 8HO): 1057-1062 [1995]); single-chain antibody molecules and multispecific antibodies formed from antibody fragments. Papain digestion of antibodies produced two identical antigen-binding fragments, called “Fab” fragments, and a residual "Fc” fragment, a designation reflecting the ability to crystallize readily.
• the Fab fragment consists of an entire L chain along with the variable region domain of the H chain (V H ), and the first constant domain of one heavy chain (CH1).
• V H variable region domain
• CH1 first constant domain of one heavy chain
• Each Fab fragment is monovalent with respect to antigen binding, i.e., it has a single antigen-binding site.
• Pepsin treatment of an antibody yields a single large F(ab')2 fragment which roughly corresponds to two disulfide linked Fab fragments having different antigen-binding activity and is still capable of cross-linking antigen.
• Fab' fragments differ from Fab fragments by having a few additional residues at the carboxy terminus of the CH1 domain including one or more cysteines from the antibody hinge region.
• Fab '-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
• F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
• the Fc fragment comprises the carboxy-terminal portions of both H chains held together by disulfides.
• the effector functions of antibodies are determined by sequences in the Fc region, the region which is also recognized by Fc receptors (FcR) found on certain types of cells.
• Fv is the minimum antibody fragment which contains a complete antigen- recognition and -binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 bops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three HVRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
• Single-chain Fv also abbreviated as “sFv” or “scFv” are antibody fragments that comprise the VH and V
• the sFv polypeptide further comprises a polypeptide linker between the VH and V u domains which enables the sFv to form the desired structure for antigen binding.
• sFv Single-chain Fv
• “Functional fragments” of the antibodies of the invention comprise a portion of an intact antibody, generally including the antigen binding or variable region of the intact antibody or the Fc region of an antibody which retains or has modified FcR binding capability.
• antibody fragments include linear antibody, single-chain antibody molecules and multispecific antibodies formed from antibody fragments.
• diabodies refers to small antibody fragments prepared by constructing sFv fragments (see preceding paragraph) with short linkers (about 5-10) residues) between the VH and VL domains such that inter-chain but not intra-chain pairing of the V domains is achieved, thereby resulting in a bivalent fragment, i.e., a fragment having two antigen-binding sites.
• Bispecific diabodies are heterodimers of two "crossover" sFv fragments in which the VH and VL domains of the two antibodies are present on different polypeptide chains.
• Diabodies are described in greater detail in, for example, EP 404,097; WO 93/11161 ; Hollinger et al, Proc. Natl. Acad. ScL USA 90: 6444-6448 (1993).
• the term "nanobodies” refers to single-domain antibodies which are antibody fragments consisting of a single monomeric variable antibody domain. Like a whole antibody, they are able to bind selectively to a specific antigen. With a molecular weight of only 12-15 kDa, single-domain antibodies are much smaller than common antibodies (150-160 kDa). The first single-domain antibodies were engineered from heavy-chain antibodies found in camelids. Gibbs, W. Wayt (August 2005).
• the monoclonal antibodies herein specifically include “chimeric” antibodies
• immunoglobulins in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is(are) identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; Morrison et al, Proc. Natl. Acad. ScL USA, 81 :6851-6855 (1984)).
• humanized antibody is used a subset of “chimeric antibodies.”
• “Humanized” forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
• a humanized antibody is a human immunoglobulin (recipient antibody) in which residues from an HVR (hereinafter defined) of the recipient are replaced by residues from an HVR of a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate having the desired specificity, affinity, and/or capacity.
• donor antibody such as mouse, rat, rabbit or non-human primate having the desired specificity, affinity, and/or capacity.
• framework (“FR") residues of the human immunoglobulin are replaced by corresponding non-human residues.
• humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications may be made to further refine antibody performance, such as binding affinity.
• a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin sequence, and all or substantially all of the FR regions are those of a human immunoglobulin sequence, although the FR regions may include one or more individual FR residue substitutions that improve antibody performance, such as binding affinity, isomerization, immunogenicity, etc.
• the number of these amino acid substitutions in the FR are typically no more than 6 in the H chain, and in the L chain, no more than 3.
• the humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
• Fc immunoglobulin constant region
• human antibody is an antibody that possesses an amino-acid sequence corresponding to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody
• Human antibodies can be produced using various techniques known in the art, including phage-display libraries.
• Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., immunized xenomice (see, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 regarding XENOMOUSETM
• hypervariable region when used herein refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops.
• antibodies comprise six HVRs; three in the VH (H1, H2, H3), and three in the VL (L1, 12, L3).
• H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies. See, e.g., Xu et al, Immunity 13:37-45 (2000); Johnson and Wu, in Methods in Molecular Biology 248:1-25 (Lo, ed., Human Press, Totowa, NJ, 2003).
• camelid antibodies consisting of a heavy chain only are functional and stable in the absence of light chain. See, e.g., Hamers-Casterman et al., Nature 363:446-448 (1993); Sheriff et al, Nature Struct. Biol. 3:733-736 (1996).
• CDRs Kabat Complementarity Determining Regions
• HVRs may comprise "extended HVRs" as follows: 24-36 or 24-34 (L1), 46-56 or 50- 56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 (H1), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH.
• the variable domain residues are numbered according to Kabat et al., supra, for each of these definitions.
• variable-domain residue -numbering as in Kabat or “amino-acid- position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy-chain variable domains or light-chain variable domains of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain.
• a heavy-chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc.
• a "human consensus framework” or “acceptor human framework” is a framework that represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences. Generally, the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
• the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, 5 th Ed. Public Health Service, National Institutes of Health, Bethesda, D (1991). Examples include for the VL, the subgroup may be subgroup kappa I, kappa II, kappa III or kappa IV as in Kabat et al, supra. Additionally, for the VH, the subgroup may be subgroup I, subgroup II, or subgroup III as in Kabat et al., supra.
• a human consensus framework can be derived from the above in which particular residues, such as when a human framework residue is selected based on its homology to the donor framework by aligning the donor framework sequence with a collection of various human framework sequences.
• An acceptor human framework "derived from" a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain preexisting amino acid sequence changes. In some embodiments, the number of pre-existing amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
• amino-acid modification at a specified position, e.g. of the Fc region, refers to the substitution or deletion of the specified residue, or the insertion of at least one amino acid residue adjacent the specified residue. Insertion "adjacent" to a specified residue means insertion within one to two residues thereof. The insertion may be N- terminal or C-terminal to the specified residue.
• the preferred amino acid modification herein is a substitution.
• an “affinity-matured” antibody is one with one or more alterations in one or more HVRs thereof that result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody that does not possess those alteration(s).
• an affinity-matured antibody has nanomolar or even picomolar affinities for the target antigen.
• Affinity-matured antibodies are produced by procedures known in the art. For example, Marks et al, Bio/Technology 10:779-783 (1992) describes affinity maturation by VH- and VL-domain shuffling. Random mutagenesis of HVR and/or framework residues is described by, for example: Barbas et al. Proc Nat. Acad. ScL USA 91 :3809-3813 (1994); Schier et al. Gene 169:147-155 (1995);
• the term “specifically binds to” or is "specific for” refers to measurable and reproducible interactions such as binding between a target and an antibody, which is determinative of the presence of the target in the presence of a
• an antibody that specifically binds to a target is an antibody that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets.
• the extent of binding of an antibody to an unrelated target is less than about 10% of the binding of the antibody to the target as measured, e.g., by a radioimmunoassay (RIA).
• RIA radioimmunoassay
• an antibody specifically binds to an epitope on a protein that is conserved among the protein from different species.
• specific binding can include, but does not require exclusive binding.
• ADCC antibody-dependent cell-mediated cytotoxicity
• FcRs Fc receptors
• cytotoxic cells e.g., natural killer (NK) cells, neutrophils and macrophages
• NK cells natural killer cells
• monocytes express FcyRI, FcyRII and FcyRIII.
• Fc expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9: 457-92 (1991).
• an in vitro ADCC assay such as that described in U.S. Patent No. 5,500,362 or 5,821,337 may be performed.
• Useful effector cells for such assays include peripheral blood
• PBMC mononuclear cells
• NK natural killer cells
• ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al, PNAS USA 95:652-656 (1998).
• the numbering of the residues in an immunoglobulin heavy chain is that of the EU index as in Kabat et al, supra.
• the "EU index as in Kabat” refers to the residue numbering of the human tgG1 EU antibody. In many cancers the tumor cells express high levels of PD-L1 on their surface.
• anti-PD-L1 antibodies with ADCC potential can trigger ADCC which may lead to the death of these tumor cells.
• Fc region herein is used to define a C-terminal region of an
• immunoglobulin heavy chain including native-sequence Fc regions and variant Fc regions.
• the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy- chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof.
• the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody.
• a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue.
• Suitable native-sequence Fc regions for use in the antibodies of the invention include human lgG1, lgG2 (lgG2A, JgG2B), lgG3 and lgG4.
• "Fc receptor” or "FcR” describes a receptor that binds to the Fc region of an antibody.
• the preferred FcR is a native sequence human FcR.
• a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and
• FcyRII receptors include FcyRIIA (an “activating receptor”) and FcyRI IB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
• Activating receptor FcyRIIA contains an immunoreceptor tyrosine -based activation motif (ITAM) in its cytoplasmic domain.
• Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine -based activation motif
• ITIM immunoreceptor tyrosine -based inhibition motif
• Fc receptor or “FcR” also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus.
• FcRn the neonatal receptor
• Methods of measuring binding to FcRn are known (see, e.g., Ghetie and Ward, Immunol. Today 18: (12): 592-8 (1997); Ghetie et al, Nature Biotechnology 15 (7): 637-40 (1997); Hinton et al, J. Biol. Chem.
• Binding to FcRn in vivo and serum half-life of human FcRn high- affinity binding polypeptides can be assayed, e.g., in transgenic mice or transfected human cell lines expressing human FcRn, or in primates to which the polypeptides having a variant Fc region are administered.
• WO 2004/42072 (Presta) describes antibody variants which improved or diminished binding to FcRs. See also, e.g., Shields et al, J. Biol. Chem. 9(2):
• “Effector cells” are leukocytes which express one or more FcRs and perform effector functions.
• the effector cells express at least FcyRIII and perform ADCC effector function.
• human leukocytes which mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, cytotoxic T cells and neutrophils.
• PBMC peripheral blood mononuclear cells
• NK natural killer cells
• monocytes cytotoxic T cells
• neutrophils neutrophils.
• the effector cells may be isolated from a native source, e.g., blood. Effector cells generally are lymphocytes associated with the effector phase, and function to produce cytokines (helper T cells), killing cells in infected with pathogens (cytotoxic T cells) or secreting antibodies (differentiated B cells).
• Binding affinity generally refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., of an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity”, “bind to”, “binds to” or “binding to” refers to intrinsic binding affinity that reflects a 1 : 1 interaction between members of a binding pair (e.g. , antibody Fab fragment and antigen).
• the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K D ). Affinity can be measured by common methods known in the art, including those described herein.
• binding affinity generally bind antigen slowly and tend to dissociate readily, whereas high- affinity antibodies generally bind antigen faster and tend to remain bound longer.
• a variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present invention. Specific illustrative and exemplary embodiments for measuring binding affinity, i.e. binding strength are described in the following.
• the "KD" or "KD value” according to this invention is in one embodiment measured by a radiolabeled antigen binding assay (RIA) performed with the Fab version of the antibody and antigen molecule as described by the following assay that measures solution binding affinity of Fabs for antigen by equilibrating Fab with a minimal concentration of ( 125 l)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti- Fab antibody-coated plate (Chen, et al, (1999) J. ol Biol 293:865-881).
• RIA radiolabeled antigen binding assay
• microtiter plates (Dynex) are coated overnight with 5 ug/ml of a capturing anti- Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23°C).
• a non-adsorbant plate (Nunc #269620) 100 pM or 26 pM [ 125 l]-antigen are mixed with serial dilutions of a Fab of interest
• the K D is measured by using surface-plasmon resonance assays using a BIACORE ® -2000 or a
• CM5 chips immobilized antigen CM5 chips at -10 response units (RU).
• carboxymethylated dextran biosensor chips CM5, BIAcore Inc.
• EDC N- ethyl-N'- (3-dimethylaminopropyl)-carbodiimide hydrochloride
• NHS N- hydroxysuccinimide
• Antigen is diluted with 10 mM sodium acetate, pH 4.8, to 5 pg/ml (-0.2 ⁇ ) before injection at a flow rate of 5 ptJminute to achieve approximately 10 response units (RU) of coupled protein.
• 1 M ethanolamine is injected to block unreacted groups.
• K D equilibrium dissociation constant
• a spectrometer such as a stop-flow- equipped spectrophotometer (Aviv Instruments) or a 8000-series SLM-AMINCOTM spectrophotometer (ThermoSpectronic) with a stirred cuvette.
• a spectrometer such as a stop-flow- equipped spectrophotometer (Aviv Instruments) or a 8000-series SLM-AMINCOTM spectrophotometer (ThermoSpectronic) with a stirred cuvette.
• CM5 carboxymethylated dextran biosensor ships
• ECD N-ethyl-N'-(3- dimethylamino propyl )-carbodiimide hydrochloride
• NHS N-hydroxysuccinimide
• Antigen is diluted with 10 mM sodium acetate, ph 4.8, into 5 mg/ml ( ⁇ 0.2 mM) before injection at a flow rate of 5 ml/min. to achieve approximately 10 response units (RU) of coupled protein.
• IM ethanolamine is added to block unreacted groups.
• two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in PBS with 0.05% Tween 20 (PBST) at 25°C at a flow rate of approximately 25ul/min.
• association rates (k on ) and dissociation rates (k 0 ff) are calculated using a simple one-to-one Langmuir binding model (BIAcore Evaluation Software version 3.2) by simultaneous fitting the association and dissociation sensorgram.
• the equilibrium dissociation constant (KD) was calculated as the ratio k 0f i/k on . See, e.g., Chen, Y., et al, (1999) J. ol Biol 293:865-881.
• the term "functional epitope” as used herein refers to amino acid residues of an antigen that contribute energetically to the binding of an antibody, i.e. forming an "energetic epitope”. Mutation of any one of the energetically contributing residues of the antigen to alanine will disrupt the binding of the antibody such that the relative KD ratio (KD mutant PD-L1 / KD wild type PD-L1) of the antibody will be greater than 4 (see Example 3.x(b)).
• conformation epitope refers to amino acid residues of the PD-L1 antigen that come together on the surface when the polypeptide chain folds to form the native protein, and show a significantly reduced rate of HD exchange due to Fab binding, as described in the experimental section.
• the conformation epitope contains, but is not limited to, the functional epitope.
• the difference between the two values is, for example, greater than about 10%, greater than about 20%, greater than about 30%, greater than about 40%, and/or greater than about 50% as a function of the value for the reference/comparator molecule.
• substantially similar denotes a sufficiently high degree of similarity between two numeric values (for example, one associated with an antibody of the invention and the other associated with a reference/comparator antibody), such that one of skill in the art would consider the difference between the two values to be of little or no biological and/or statistical significance within the context of the biological characteristic measured by said values ⁇ e.g., KD values).
• the difference between said two values is, for example, less than about 50%, less than about 40%, less than about 30%, less than about 20%, and/or less than about 10% as a function of the reference/comparator value.
• Percent (%) amino acid sequence identity and “homology” with respect to a peptide, polypeptide or antibody sequence are defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2 or ALIGN software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
• blocking antibody or an “antagonist” antibody is one that inhibits or reduces a biological activity of the antigen it binds to.
• blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen.
• the anti-PD-L1 antibodies of the invention block the
• agonist or activating antibody is one that enhances or initiates signaling by the antigen to which it binds.
• agonist antibodies cause or activate signaling without the presence of the natural ligand.
• cross-compete means the ability of an antibody or fragment thereof to interfere with the binding directly or indirectly through allosteric modulation of the anti-PD-L1 antibodies of the invention to the target human PD-L1.
• the extent to which an an antibody or fragment thereof is able to interfere with the binding of another to the target, and therefore whether it can be said to cross-block or cross-compete according to the invention, can be determined using competition binding assays.
• One particularly suitable quantitative cross-competition assay uses a FACS- or an AlphaScreen-based approach to measure competition between the labelled (e.g.
• a suitable assay for determining whether a binding molecule cross-competes or is capable of cross-competing with an antibody or fragment thereof.
• a cross-competing antibody or fragment thereof is for example one which will bind to the target in the cross-competition assay such that, during the assay and in the presence of a second antibody or fragment thereof, the recorded displacement of the immunoglobulin single variable domain or polypeptide according to the invention is up to 100% (e.g. in FACS based
• cross-competing antibodies or fragments thereof have a recorded displacement that is between 10% and 100%, more preferred between 50% to 100%.
• an "isolated" nucleic acid molecule encoding the antibodies herein is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the environment in which it was produced. Preferably, the isolated nucleic acid is free of association with all components associated with the production environment.
• the isolated nucleic acid molecules encoding the polypeptides and antibodies herein is in a form other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from nucleic acid encoding the polypeptides and antibodies herein existing naturally in cells.
• control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism.
• control sequences that are suitable for prokaryotes include a promoter, optionally an operator sequence, and a ribosome binding site.
• Eukaryotic cells are known to utilize promoters, polyadenylation signals, and enhancers.
• Nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence.
• DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
• "operably linked" means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites.
• a “stable" formulation is one in which the protein therein essentially retains its physical and chemical stability and integrity upon storage.
• Various analytical techniques for measuring protein stability are available in the art and are reviewed in Peptide and Protein Drug Delivery, 247-301 , Vincent Lee Ed., Marcel Dekker, Inc., New York, New York, Pubs. (1991) and Jones, A. Adv. Drug Delivery Rev. 10: 29-90 (1993). Stability can be measured at a selected temperature for a selected time period. For rapid screening, the formulation may be kept at 40°C for 2 weeks to 1 month, at which time stability is measured.
• the formulation should be stable at 30°C or 40°C for at least 1 month and/or stable at 2-8°C for at least 2 years.
• the formulation should be stable for at least 2 years at 30°C and/or stable at 40°C for at least 6 months.
• the extent of aggregation during storage can be used as an indicator of protein stability.
• a "stable" formulation may be one wherein less than about 10% and preferably less than about 5% of the protein are present as an aggregate in the formulation. In other embodiments, any increase in aggregate formation during storage of the formulation can be determined.
• a "reconstituted" formulation is one which has been prepared by dissolving a lyophilized protein or antibody formulation in a diluent such that the protein is dispersed throughout.
• the reconstituted formulation is suitable for administration (e.g. subscutaneous administration) to a patient to be treated with the protein of interest and, in certain embodiments of the invention, may be one which is suitable for parenteral or intravenous administration.
• An "isotonic" formulation is one which has essentially the same osmotic pressure as human blood. Isotonic formulations will generally have an osmotic pressure from about 250 to 350 mOsm.
• the term “hypotonic” describes a formulation with an osmotic pressure below that of human blood.
• the term “hypertonic” is used to describe a formulation with an osmotic pressure above that of human blood. Isotonicity can be measured using a vapor pressure or ice-freezing type osmometer, for example.
• the formulations of the present invention are hypertonic as a result of the addition of salt and/or buffer.
• Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution.
• physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as
• polyvinylpyrrolidone amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt- forming counterions such as sodium; and/or nonionic surfactants such as TWEENTM, polyethylene glycol (PEG), and PLURONICSTM.
• amino acids such as glycine, glutamine, asparagine, arginine or lysine
• monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins chelating agents such as EDTA
• sugar alcohols such as mannitol or sorbitol
• salt- forming counterions such as sodium
• nonionic surfactants such as TWEENTM, polyethylene glycol (PEG), and PLURONICSTM
• a “pharmaceutically acceptable acid” includes inorganic and organic acids which are non toxic at the concentration and manner in which they are formulated.
• suitable inorganic acids include hydrochloric, perchloric, hydrobromic, hydroiodic, nitric, sulfuric, sulfonic, sulfuric, sulfanilic, phosphoric, carbonic, etc.
• Suitable organic acids include straight and branched-chain alkyl, aromatic, cyclic, cycloaliphatic, arylaliphatic, heterocyclic, saturated, unsaturated, mono, di- and tricarboxylic, including for example, formic, acetic, 2-hydroxyacetic, trifluoroacetic, phenylacetic, trimethylacetic, t-butyl acetic, anthranilic, propanoic, 2- hydroxypropanoic, 2-oxopropanoic, propandioic, cyclopentanepropionic,
• camphorsulphonic 4-methylbicyclo[2.2.2]-oct-2-ene-l-carboxylic, glucoheptonic, 4,4'- methylenebis-3-(hydroxy-2-ene-l-carboxylic acid), hydroxynapthoic.
• “Pharmaceutically-acceptable bases” include inorganic and organic bases which are non-toxic at the concentration and manner in which they are formulated.
• suitable bases include those formed from inorganic base forming metals such as lithium, sodium, potassium, magnesium, calcium, ammonium, iron, zinc, copper, manganese, aluminum, N- methylglucamine, morpholine, piperidine and organic nontoxic bases including, primary, secondary and tertiary amines, substituted amines, cyclic amines and basic ion exchange resins, [e.g., N(R') 4 + (where R' is independently H or C1-4 alkyl, e.g., ammonium, Tris)], for example, isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, ethanolamine, 2- diethylaminoethanol, trimethamine, dicyclohexylamine, lysine, arginine, histidine, caffeine, pro
• organic non-toxic bases are isopropylamine, diethylamine, ethanolamine, trimethamine, dicyclohexylamine, choline, and caffeine.
• Additional pharmaceutically acceptable acids and bases useable with the present invention include those which are derived from the amino acids, for example, histidine, glycine, phenylalanine, aspartic acid, glutamic acid, lysine and asparagine.
• "Pharmaceutically acceptable" buffers and salts include those derived from both acid and base addition salts of the above indicated acids and bases. Specific buffers and/ or salts include histidine, succinate and acetate.
• a "pharmaceutically acceptable sugar” is a molecule which, when combined with a protein of interest, significantly prevents or reduces chemical and/or physical instability of the protein upon storage.
• “pharmaceutically acceptable sugars” may also be known as a "lyoprotectant”.
• “Exemplary sugars and their corresponding sugar alcohols include: an amino acid such as monosodium glutamate or histidine; a methylamine such as betaine; a lyotropic salt such as magnesium sulfate; a polyol such as trihydric or higher molecular weight sugar alcohols, e.g. glycerin, dextran, erythritol, glycerol, arabitol, xylitol, sorbitol, and mannitol; propylene glycol;
• polyethylene glycol polyethylene glycol; PLURONICS ® ; and combinations thereof.
• Additional exemplary lyoprotectants include glycerin and gelatin, and the sugars mellibiose, melezitose, raffmose, mannotriose and stachyose.
• reducing sugars include glucose, maltose, lactose, maltulose, iso-maltulose and lactulose.
• non-reducing sugars include non-reducing glycosides of polyhydroxy compounds selected from sugar alcohols and other straight chain polyalcohols.
• Preferred sugar alcohols are monoglycosides, especially those compounds obtained by reduction of disaccharides such as lactose, maltose, lactulose and maltulose.
• the glycosidic side group can be either glucosidic or galactosidic. Additional examples of sugar alcohols are glucitol, maltitol, lactitol and iso-maltulose.
• the preferred pharmaceutically-acceptable sugars are the non-reducing sugars trehalose or sucrose.
• Pharmaceutically acceptable sugars are added to the formulation in a "protecting amount" (e.g. pre-lyophilization) which means that the protein essentially retains its physical and chemical stability and integrity during storage (e.g., after reconstitution and storage).
• the "diluent" of interest herein is one which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation, such as a formulation reconstituted after lyophilization.
• exemplary diluents include sterile water, bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
• BWFI bacteriostatic water for injection
• a pH buffered solution e.g. phosphate-buffered saline
• sterile saline solution e.g. phosphate-buffered saline
• Ringer's solution or dextrose solution e.g. phosphate-buffered saline
• diluents can include aqueous solutions of salts and/or buffers.
• a "preservative” is a compound which can be added to the formulations herein to reduce bacterial activity.
• the addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
• potential preservatives include octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride (a mixture of alkylbenzyldimethylammonium chlorides in which the alkyl groups are long-chain compounds), and benzethonium chloride.
• preservatives include aromatic alcohols such as phenol, butyl and benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, and w-cresol.
• aromatic alcohols such as phenol, butyl and benzyl alcohol
• alkyl parabens such as methyl or propyl paraben
• catechol resorcinol
• cyclohexanol 3-pentanol
• w-cresol w-cresol
• the most preferred preservative herein is benzyl alcohol.
• 'Treatment' refers to clinical intervention designed to alter the natural course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology.
• Desirable effects of treatment include preventing occurrence or recurrence of disease, preventing metastasis, decreasing the rate of disease progression, ameliorating or palliating the disease state, and remission or improved prognosis.
• antibodies of the invention are used to delay development of a disease or disorder.
• a subject is successfully "treated", for example, using the apoptotic anti-PD-L1 antibodies of the invention if one or more symptoms associated with a T-cell dysfunctional disorder is mitigated.
• an “effective amount' refers to at least an amount effective, at dosages and for periods of time necessary, to achieve the desired or indicated effect, including a therapeutic or prophylactic result.
• an effective amount of the anti-PD-L1 antibodies of the present invention is at least the minimum concentration that results in inhibition of signaling from PD-L1, either through PD-1 on T-cells or B7.1 on other APCs or both.
• a “therapeutically effective amount' is at least the minimum concentration required to effect a measurable improvement or prevention of a particular disorder.
• therapeutically effective amount herein may vary according to factors such as the disease state, age, sex, and weight of the patient, and the ability of the antibody to elicit a desired response in the individual.
• a therapeutically effective amount is also one in which any toxic or detrimental effects of the antibody are outweighed by the therapeutically beneficial effects.
• a therapeutically effective amount of the anti-PD-L1 antibodies of the present invention is at least the minimum
• prophylactically effective amount refers to an amount effective, at the dosages and for periods of time necessary, to achieve the desired prophylactic result.
• a prophylactically effective amount of the anti-PD-L1 antibodies of the present invention is at least the minimum concentration that prevents or attenuates the development of at least one symptom of a T cell dysfunctional disorder.
• “Mammal” for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, rabbits, cattle, pigs, hamsters, gerbils, mice, ferrets, rats, cats, etc.
• the mammal is human.
• 'pharmaceutical formulation refers to a preparation that is in such form as to permit the biological activity of the active ingredient to be effective, and that contains no additional components that are unacceptably toxic to a subject to which the formulation would be administered. Such formulations are sterile.
• a "sterile" formulation is aseptic or free from all living microorganisms and their spores.
• autoimmune disorder is a disease or disorder arising from and directed against an individual's own tissues or organs or a co-segregation or manifestation thereof or resulting condition therefrom.
• Autoimmune diseases can be an organ-specific disease (i.e., the immune response is specifically directed against an organ system such as the endocrine system, the hematopoietic system, the skin, the cardiopulmonary system, the gastrointestinal and liver systems, the renal system, the thyroid, the ears, the neuromuscular system, the central nervous system, etc.) or a systemic disease that can affect multiple organ systems (for example, systemic lupus erythematosus (SLE), rheumatoid arthritis (RA), polymyositis, etc.).
• SLE systemic lupus erythematosus
• RA rheumatoid arthritis
• Preferred such diseases include autoimmune rheumatologic disorders (such as, for example, RA, Sjogren's syndrome, scleroderma, lupus such as SLE and lupus nephritis,
• polymyositis-dermatomyositis, cryoglobulinemia, anti-phospholipid antibody syndrome, and psoriatic arthritis autoimmune gastrointestinal and liver disorders (such as, for example, inflammatory bowel diseases ⁇ e.g., ulcerative colitis and Crohn's disease), autoimmune gastritis and pernicious anemia, autoimmune hepatitis, primary biliary cirrhosis, primary sclerosing cholangitis, and celiac disease), vasculitis (such as, for example, ANCA-negative vasculitis and ANCA-associated vasculitis, including Churg-Strauss vasculitis, Wegener's granulomatosis, and microscopic polyangiitis), autoimmune neurological disorders (such as, for example, multiple sclerosis, opsoclonus myoclonus syndrome, myasthenia gravis,
• neuromyelitis optica Parkinson's disease, Alzheimer's disease, and autoimmune polyneuropathies
• renal disorders such as, for example, glomerulonephritis
• autoimmune dermatologic disorders such as, for example, psoriasis, urticaria, hives, pemphigus vulgaris, bullous pemphigoid, and cutaneous lupus erythematosus
• hematologic disorders such as, for example, thrombocytopenic purpura, thrombotic thrombocytopenic purpura, post-transfusion purpura, and autoimmune hemolytic anemia
• Atherosclerosis uveitis
• autoimmune hearing diseases such as, for example, inner ear disease and hearing loss
• Behcet's disease Raynaud's syndrome
• organ transplant organ transplant
• autoimmune endocrine disorders such as, for example, diabetic- related autoimmune diseases such as insulin-dependent diabetes mellitus (IDDM), Addison's disease, and autoimmune thyroid disease (e.g., Graves' disease and thyroiditis)
• IDDM insulin-dependent diabetes mellitus
• Addison's disease e.g., Graves' disease and thyroiditis
• More preferred such diseases include, for example, RA, ulcerative colitis, ANCA-associated vasculitis, lupus, multiple sclerosis, Sjogren's syndrome, Graves' disease, IDDM, pernicious anemia, thyroiditis, and glomerulonephritis.
• cytotoxic agent refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells.
• the term includes radioactive isotopes (e.g. At 211 , 1 131 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 and radioactive isotopes of Lu), and toxins such as small-molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, or fragments thereof.
• a "chemotherapeutic agent” is a chemical compound useful in the treatment of cancer.
• chemotherapeutic agents include alkylating agents such as thiotepa and cyclophosphamide; alkyl sulfonates such as busulfan, improsulfan, and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and butlatacinone); delta-9-tetrahydrocannabinol (dronabinol); beta-lapachone; lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue topotecan (CPT-11 (irinotecan),
• pemetrexed including its adozelesin, carzelesin and bizelesin synthetic analogues); podophyllotoxin; podophyllinic acid; teniposide; cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; TLK- 286; CDP323, an oral alpha-4 integrin inhibitor; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenestenne, prednimustine, trofosfamide, uracil mustard
• antibiotics such as the enediyne antibiotics (e. g., calicheamicin, especially calicheamicin gammall and calicheamicin omegall (see, e.g., Nicolaou et ah, Angew. Chem Intl. Ed.
• dynemicin including dynemicin A; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5- oxo-L-norleucine, doxorubicin (including morpholino-doxorubicin, cyanomorpholino- doxorubicin, 2-pyrrolino- doxorubicin, doxorubicin HCI liposome injection and deoxydoxorubicin), epirubicin, esorubicin
• amsacrine bestrabucil
• bisantrene edatraxate
• defofamine demecolcine
• diaziquone diaziquone; elfornithine; elliptinium acetate; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins;
• mitoguazone mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet;
• trichothecenes especially T-2 toxin, verracurin A, roridin A and anguidine
• urethan vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman;
• gacytosine arabinoside ("Ara-C”); thiotepa; taxoids, e.g., paclitaxel, albumin- engineered nanoparticle formulation of paclitaxel, and doxetaxel; chloranbucil; 6- thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitoxantrone;
• retinoids such as retinoic acid
• pharmaceutically acceptable salts, acids or derivatives of any of the above as well as combinations of two or more of the above such as CHOP, an abbreviation for a combined therapy of cyclophosphamide, doxorubicin, vincristine, and prednisolone, and FOLFOX, an abbreviation for a treatment regimen with oxaliplatin combined with 5-FU and leucovovin.
• anti-PD-L1 antibodies of the invention are bisphosphonates such as clodronate, NE-58095, zoledronic acid/zoledronate, alendronate, pamidronate, tiludronate, or risedronate; as well as troxacitabine (a 1 ,3-dioxolane nucleoside cytosine analog); anti-sense oligonucleotides, particularly those that inhibit expression of genes in signaling pathways implicated in abherant cell proliferation, such as, for example, PKC-alpha, Raf, H-Ras, and epidermal growth factor receptor (EGF-R); vaccines such as
• Stimuvax vaccine for example, Allovectin vaccine, Leuvectin vaccine, and Vaxid vaccine; topoisomerase 1 inhibitor; an anti-estrogen such as fulvestrant; a Kit inhibitor such as imatinib or EXEL-0862 (a tyrosine kinase inhibitor); EGFR inhibitor such as erlotinib or cetuximab; an anti- VEGF inhibitor such as bevacizumab; arinotecan; rmRH; lapatinib and lapatinib ditosylate (an ErbB-2 and EGFR dual tyrosine kinase small-molecule inhibitor also known as GW572016); 17AAG (geldanamycin derivative that is a heat shock protein (Hsp) 90 poison), and pharmaceutically acceptable salts, acids or derivatives of any of the above.
• Hsp heat shock protein
• Stimuvax is a BLP25 liposome cancer vaccine designed to induce an immune response to cancer cells that express MUC1 , a protein antigen widely expressed on common cancers. MUC1 is over expressed on many cancers such as lung cancer, breast cancer, prostate cancer and colorectal cancer. Stimuvax is thought to work by stimulating the body's immune system to identify and destroy cancer cells expressing MUC1.
• Figure 1 shows that A09-246-2 efficiently blocks 125 I-PD-L1 binding to immobilized PD-1-Fc .
• Inactive mutant Mutant VL-A31G,D52E,R99Y of A09-188-1.
• Figure 2 shows sequence of the extracellular domain (fused to a 6 amino acid His tag, SEQ ID NO:29) of PD-L1. Peptides that could be identified by MS are indicated by grey bars. Those that showed protection from HD exchange in the presence of Fab are represented by black bars. Peptides that could not be analyzed are highlighted by underlining and italicizing in the sequence.
• Figure 3 shows the epitope of A09-246-2 on PD-L1. The backbone of PD-L1 is shown in a ribbon representation. Amino acids which, when mutated to alanine, destabilize the A09-246-2 - PD-L1 binding by more than 0.7 kcal/mol are shown as sticks.
• Figure 4 shows that A09-246-2 efficiently enhances T cell activities represented by IL-2 production as shown by SEA human PBMC assay.
• FIGS. 5-16 show that A09-246-2 increases ADCC in different tumor lines
• Antibodies were selected from phage Fab display libraries. The selection included two different arms one utilizing biotinylated human PD-L1 on the different selection rounds and other alternating human and mouse PD-L1 as target on different rounds. 3840 clones were screened by ELISA to identify 170 individual PD-L1 binders. Based on the inhibition of PD-1 ligand binding, 48 hits were selected and were expressed in medium scale for further characterization.
• Hit optimization candidates were selected based on the potency to block binding of PD-1 to PD-L1 and the ability of binding to both human and mouse versions of PD-L1. Binding to PD-L1 was originally determined by ELISA and later quantified by Biacore and binding to PD-L1 expressing cells by FACS. Four candidates fitted the predefined profile, including A09-188-1 which contained a lambda light chain.
• A09-188-1 was chosen for affinity maturation and sequence optimization.
• the goals of the affinity maturation were increased affinity to the human target, cross-reactivity to the murine target, and improvement of manufacturabiiity.
• Heavy chain mutations in the HVR's were introduced by codon based randomization. This heavy chain diversity was combined with light chain diversity introduced by light chain shuffling to generate the affinity maturation library. Further heavy and light chain FR and HVR residues were mutated to increase stability of the antibody and introduce amino acids found in the germline, such as the heavy chain FR mutation 193V.
• HVR-H1 sequence is X1YX2MX3 (SEQ ID NO:1);
• HVR-H2 sequence is SIYPSGGX4TFYADX5VKG (SEQ ID NO:2);
• HVR-H3 sequence is IKLGTVTTVX 6 Y (SEQ ID NO:3);
• X ! is K, R, T, Q, G, A, W, M, I or S
• X 2 is V, R, K, L, M or I
• X 3 is H, T, N, Q, A, V, Y, W, F or M
• X4 is F or I
• X5 is S or T
• Xe is E or D
• HVR-L1 sequence is TGTXyXeDVGXgYNYVS (SEQ ID NO:8);
• HVR-L2 sequence is X 10 VXnXi 2 RPS (SEQ ID NO:9);
• HVR-L3 sequence is SSX 13 TX 14 Xi5Xi6Xi7RV (SEQ ID NO: 10);
• X 7 is N or S
• X 8 is T, R or S
• X 9 is A or G
• X 10 is E or D
• Xn is I, N or S
• Xi 2 is D, H or N
• X13 is F or Y
• X i4 is N or S
• X15 is R, T or S
• X i6 is G or S
• X17 is I or T.
• Cell cultures were conducted in batch mode in a 250L Single-use-Bioreactor (SUB) (Table 2-2). Cells were grown in ProCH05 growth media supplemented with 4 m L- Glutamine + 25 pg/mL puromycin at 37 °C. The cultures were fed with 15% Efficient Feed B and 1.0 mM valproic acid 3 days after inoculation.
• Millistak+ Pod D0HC (Millipore MD0HC10FS1) and 0.11 m2 Millistak+ Pod A1HC (Millipore MA1HC01FS1) filters, followed by terminal filtration with a Sartopore 2 filter (Sartorius 5445307H8-SS).
• Pod D0HC (Millipore MD0HC10FS1)
• 0.11 m2 Millistak+ Pod A1HC (Millipore MA1HC01FS1) filters
• terminal filtration with a Sartopore 2 filter (Sartorius 5445307H8-SS).
• the purification process consisted of two chromatography steps; (a) MabSelect Protein A to capture the antibody from the clarified harvest, and (b) Hydroxyapatite Type II polish step to remove remaining aggregated product, host cell proteins and DNA, and product related impurities.
• An intermediate Q-filtration step was inserted between the 2 chromatography steps to further reduce DNA.
• SDS-PAGE and size exclusion chromatography SE-HPLC were used to analyze in-process samples during purification. Protein content of the Mabselect in-process samples was performed using the Protein A HPLC method while UVA is spectroscopy was used for all other process steps.
• Post Mabselect eluates were subjected to 30 min of low pH viral inactivation (pH 3.7) and subsequently neutralized to pH 7.0 prior to the next purification step.
• the final polishing step was the hydroxyapatite Type II chromatography.
• the conductivity of the Sartobind Q filtrate was adjusted to ⁇ 3 mS/cm with water, and pH reduced to 6.5 with acetic acid before sample loading.
• Bound anti-PD-L1 product was eluted with a NaCI step gradient. Aggregated product-related impurities was eluted with the Strip Buffer.
• Purified anti-PDL1 from the hydroxyapatite polishing step were concentrated and then diafiltered into their respective buffers according to the Table below.
• the bulk products were then sterile-filtered through 0.2 filter units and further diluted with formulation buffer to their final concentrations.
• Formulated bulk substance were further tested for endotoxin and checked by SE-HPLC.
• the formulation contains antioxidative excipients and was shown to be sufficiently stable at the following stress conditions:
• Binding affinity and selectivity was determined by Biacore assays.
• the affinity of the lead antibody candidate for human and non human orthologues is summarized in the table below.
• the binding affinity of anti PD-L1 antibody A09-246-2 according to this invention for human, mouse and cynomolgus monkey proteins was statistically similar but highly reduced for dog, rat and rabbit proteins that displayed a very fast dissociation profile.
• ka d/M sl kd d/sl * KD(M> KD(nM) : .+/- STD
• VL-A31G VH-
• VL-A31G VH-
• VL-A31G VH-
• VL-A31G VH-
• VL-A31G VH-
• VL-A31G VH-
• VL-A31G VH-
• VL-A31G VH-
• VL-A31G VH-
• Selectivity was determined by evaluating the binding to members of the B7 family including hu-PD- L1-huFc, hu-PDL-2-huFc, hu-B7.1-huFc, hu-B7.2-huFc, huB7-H2- huFc and huB7-H3-huFc by Biacore.
• Binding Buffer 50 mM Hepes, pH 7.5, 130 mM NaCI, 5.1 mM KCI, 1.3 mM MgS0 4 Assay buffer: binding buffer + 0.5% BSA
• A09-246-2 The ability of A09-246-2 to block soluble B7.1 binding to PD-L1 on cell surface was measured by FACS. Results indicated A09-246-2 efficiently blocks the interaction of B7.1 and PD-L1 with an IC50 of 0.2 ⁇ 0.004nM (0.03 ⁇ 0.0006 ⁇ g/ml).
• the extracellular domain of PD-L1 antigen (SEQ ID NO:29) was incubated in heavy water (D 2 0) solution to allow amide protons on the protein backbone to exchange with deuterons from the solvent, in either the presence or absence of excess anti- PD-L1 Fab or a non-specific Fab.
• the samples were digested with protease and analysed by liquid chromatography-mass spectrometry (LC-MS) to determine the level of deuteration in each peptide.
• the Fab corresponding to A09-246-2 was used instead of the full IgG in order to simplify the mass spectrometry analysis by decreasing the number of peptides generated by protease digestion.
• HD exchange identified two peptides
• the antigens were injected at concentrations of 100 nM, 50 nM, 25 nM, 12.5 nM and 6.25 nM (except for Y56 and D61 mutants, which were injected at 1 uM, 500 nM, 250 nM, 125 nM and 62.5 nM). Between each cycle, the chip was regenerated with low pH buffer and fresh A09-246-2 was captured prior to injecting the next concentration of antigen. The rate constants were determined by iterative fitting of the data to a 1 :1 binding model by an algorithm that minimizes Chi- squared.
• K D The equilibrium dissociation constant
• Mutants of Y56 and D61 displayed minimal destabilization of the antigen indicated by a small decrease in the T V2 of fluorescence monitored unfolding (table above). This confirms that Y56 and D61 are true binding hotspots for A09-246-2. The structural integrity of most of the other mutant proteins was also confirmed by this method (table above). The observation that most mutant proteins behaved similarly to wild type on analytical size exclusion chromatography (last column in the above table) provides further support for native structure of mutant antigen proteins. 3.6 Binding to Tumor Cells and Primary Cells
• A09-246-2 demonstrated reactivity to human PD-L1 on all seven tested human tumor lines (A431 , epithelial carcinoma cell line; A549, lung adenocarcinoma epithelial cells; BxPC3, pancreatic cancer cells; HCT116, colorectal carcinoma; M24, melanoma cell lines; PC3mm2, prostate cancer cell line; U-87 MG, glioblastoma- astrocytoma) of which PD-L1 was up-regulated by interferon treatment to enable detection.
• human tumor lines A431 , epithelial carcinoma cell line; A549, lung adenocarcinoma epithelial cells; BxPC3, pancreatic cancer cells; HCT116, colorectal carcinoma; M24, melanoma cell lines; PC3mm2, prostate cancer cell line; U-87 MG, glioblastoma- astrocytoma
• A09-246-2 efficiently binds to human PD-L1 expressed on the HEK cell surface with an EC50 of 0.3 ⁇ 0.02nM (0.04 ⁇ 0.003 Mg/ml); to cynomolgus monkey expressed on the HEK cell surface with an EC50 of 0.94 ⁇ 0.015nM (0.14 ⁇ 0.002 ⁇ g/ml); to mouse PD-L1 expressed on the HEK293 cell surface with an EC50 of 0.34 ⁇ 0.08 nM (0.05 ⁇ 0.012 ⁇ g/ml) and mouse PD-L1 expressed on the EL4 cell surface with an EC50 of 0.91 ⁇ 0.21 nM (0.13 ⁇ 0.03 ⁇ g/ml).
• the assays qualitatively described the dose dependent binding characteristics of anti-PD-L1.
• Antigen-specific CD8 T cells were generated by stimulating splenocytes from OT-1 transgenic mice with Ova peptide SIINFEKL and cyropreserved. mPD-L1 over- expressing EL4 cells were used as antigen presenting cells. Serial dilutions of tested compounds were incubated with thawed OT-1 T cells and SIINFEKL-loaded APC for 48 hours. IFN- ⁇ in the supernatant was measured using mlFN ⁇ y ELISA. Anti-PD-L1 (A09-246-2) efficiently enhanced T cell activities represented by IFN- ⁇ production with an EC50 of 0.28 ⁇ 0.1 nM (0.04 ⁇ 0.015 ⁇ g/ml) b) SEA Assay
• ADCC Antibody dependent cell-mediated Cytotoxicity
• ADCC was measured utilizing two different human tumor lines A431 and A549 as target cells and human PBMC as effector cells. In some cases, tests were performed using target cells following stimulation with Interferon-gamma to increase the expression of PD-L1.
• the anti-EGFR antibody, cetuximab was used as an ADCC positive control. Given the fact that the Fcyllla receptor 158V allotype displays a higher affinity for human lgG1 and increases ADCC, the observed results were correlated with the donor's allotype.
• ADCC activity of A09-246-2 was comparable to that mediated with the anti-EGFR antibody cetuximab, inducing approximately 50% of maximum lysis in both cell lines.
• INF- ⁇ treatment did not alter the response of A431 cells for all the different allotypes tested (VA , V/F and F/F).
• a significant difference (almost twice) between stimulated and not stimulated cells was observed when A549 cells were employed for PBMC from V V and V/F donors. No ADCC was observed when PBMC from F/F donors were analyzed with A549 cells.
• the selected antibody has demonstrated significant activity as a monotherapy and in various combination therapy settings.
• the antitumor activity of the anti-PD-L1 antibody demonstrated a dose-dependent trend when given as a monotherapy against MC38 tumors.
• the anti-PD-L1 antibody In combination with fractionated radiotherapy against MC38 tumors, the anti-PD-L1 antibody showed strong synergistic activity, with curative potential. Combination with a single low-dose of cyclophosphamide resulted in enhanced anti-tumor effects in the MC-38 model that were associated with an increased frequency of tumor-antigen specific CD8 + T cells. Anti-PD-L1 therapy significantly extended survival time when combined with Gemcitabine in the PANC02 orthotopic tumor model of pancreatic cancer. When anti-PD-L1 was combined with cyclophosphamide pre-treatment followed by vaccination with Stimuvax, a significant increase in tumor growth inhibition was achieved in both the MC38/MUC1 and PANC02/MUC1 tumor models.
• mice were inoculated subcutaneously in the right flank with 1x10 6 MC38 colon carcinoma cells.
• N 14
• Groups were administered A09-246-2 intravenously at dose levels of 100, 200, 400, or 800 pg on days 0, 3, and 6.
• a control group was treated with 200 pg of an inactive isotype antibody. Tumors were measured twice weekly for the study duration. All treatment groups demonstrated significant efficacy (P ⁇ 0.050) when compared to the isotype control group.
• the 800 pg dose group did not show enhanced efficacy over the 400 pg group, a significant trend toward a dose-dependent effect was observed.
• the primary endpoint of this study was survival based on the onset of clinical signs, indicative of metastatic dissemination, which warranted euthanasia.
• At the end of the study (day 76), 20% of mice (1/5) were still alive in the isotype antibody treated group, and 80% (4/5) survivors remained in the A09-246-2 treated group.
• GEM was dosed at 150 mg/kg in all studies and A09-246-2 was dosed at 400 pg per mouse.
• a 28 day cycle of GEM was modeled (administration on days 5, 19, 26), with a 14 day holiday period during which A09-246-2 was given on days 8, 11, 14.
• a 21 day cycle of GEM was modeled (administration on days 5, 12, 26, 33), with a 14 day holiday period during which A09-246-2 was given on days 13, 16, 19.
• Monotherapy with GEM or anti-PD-L1 failed to extend survival time in this model.
• the combination of GEM and A09-246-2 significantly extended mean survival time (P ⁇ 0.02).
• Immunophenotyping revealed several effects in groups receiving A09-246-2, both as a monotherapy and in combination with GEM, that were consistent with the proposed MOA of anti-PD-L1 including increased percentages of CD8 + T EM in spleens, an increased ratio of splenic CD8 + T E M to T REG cells, and increased percentages of splenic PD-1 + CD8 + T cells. Furthermore, immunophenotyping of tumor infiltrating lymphocytes (TIL) showed significantly increased percentages of CD8 + TIL in the combination group.
• TIL tumor infiltrating lymphocytes
• Low-dose CPA is known to enhance anti-tumor immune responses through the inhibition of immunosuppressive regulatory T cells.
• the potential for low-dose CPA pre-treatment was investigated to enhance the efficacy of the anti-PD-L1 Ab (A09- 246-2) in the MC38 subcutaneous tumor model. Mice were inoculated
• a control treatment group received 100 pg of an inactive isotype antibody in combination with CPA pretreatment.
• the combination treatment group demonstrated a statistically significant enhancement (p ⁇ 0.050) of anti-tumor activity when compared against the isotype and monotherapy control groups.
• ELISPOT assay the effects of treatment on the magnitude of CD8 + T cell responses directed against the well-characterized p15E tumor antigen were measured.
• Both CPA and A09-246-2 showed substantially increased levels of p15E- reactive CD8 + T cells ( ⁇ 100 spots in both groups) when compared to the isotype control (-25 spots), with the combination group showing a further enhancement (-250 spots).
• the anti-tumor efficacy of the CPA plus A09-246-2 combination was associated with increased frequencies of tumor-antigen reactive CTL.
• Stimuvax is a vaccine against the human MUC1 antigen, which is commonly overexpressed by solid tumors.
• Mice transgenic for the human MUC1 protein (MUCl .tg mice) are immunologically tolerant of the antigen, and, when inoculated with murine tumors that also express human MUC1, provide a relevant model of the clinical vaccination setting.
• cyclophosphamide (CPA) pre-treatment is used in combination with Stimuvax as a strategy for transiently depleting immunosuppressive T reg cells that can inhibit the vaccine response.
• mice were inoculated subcutaneously in the right rear flank with 1x10 6 MC38/ UC1 colon carcinoma cells.
• Five days after tumor cell inoculation, mice were randomized into treatment groups (N 10) on day -3.
• Vaccination was initiated on day 0 and was repeated weekly.
• Anti-PD-L1 Ab (A09-246-2) was dosed by i.p. injection on days 0, 3, and 6. Tumors were measured twice weekly.
• the combination of CPA/Stimuvax and A09-246-2 demonstrated significantly enhanced (p ⁇ 0.050) tumor growth inhibition when compared against treatment with CPA/Stimuvax.
• Radiotherapy has been demonstrated to enhance the immunogenicity of tumor cells, through increased expression of MHC class I and diversification of the intracellular peptide pool.
• MC38 colon carcinoma cells (1x10 5 ) were inoculated intramuscularly into the right quadriceps of C57BL/6 female mice.
• the tumor-bearing legs were isolated and treated with 360 cGy of gamma irradiation from a cesium-137 source on days 0, 1, 2, 3, and 4 (total dose of 1800 cGy).
• Anti-PD-L1 Ab (A09-246-2) was dosed i.v. at 400 pg on days 3, 6, and 9.
• the A09-246-2 and radiotherapy combination resulted in a high rate of tumor regressions, ultimately leading to 6/10 complete responses (CR).
• Mice with CR were re-challenged by inoculation of MC38 tumor cells, and 3/6 mice remained tumor-free seventy-four days after the re-challenge, indicating that effective immune memory was generated by the combination therapy.
• a control group treated with an isotype control antibody in combination with radiation showed significant tumor growth inhibition, but did not induce regressions.
• CD8 + T cells completely abrogated the synergy of the combination, confirming that the mechanism involves the stimulation of anti-tumor CD8 + T cell responses. This observation was further supported by increased frequencies of CD8 + T cells reactive to the p15E tumor antigen. Immunophenotyping by FACS revealed increased percentages of CD8 + T cell proliferation in spleens, and increased splenic percentages of CD8 + T E M and CD8+ T CM -
• FOLFOX is a combination chemotherapy regimen, consisting of folinic acid, 5- fluorouracil (5-FU), and oxaliplatin (OX), used in the treatment of stage III colorectal cancer.
• 5- fluorouracil 5-FU
• OX oxaliplatin
• FOLFOX 5-fluorouracil and oxaliplatin
• mice were inoculated in the right subcutaneous flank with 1x10 6 MC38 colon carcinoma cells.
• 5-FU 60 mg/kg i.v.
• OX 5 mg/kg i.p.
• 5-FU 60 mg/kg i.v.
• OX 5 mg/kg i.p.
• Anti-PD-L1 Ab (A09-246-2) (400 pg i.v.) was given on days 3, 6, and 9.
• the combination treatment was observed to have significantly greater efficacy (p ⁇ 0.050) when compared to A09-246-2 given alone, or 5-FU and OX given in combination with an isotype antibody.
• a repeat of the anti-PD-L1 Ab and FOLFOX combination study was performed and, again, the combination demonstrated significantly greater (p ⁇ 0.050) anti-tumor activity than either of the monotherapy regimens.
• FACS-based immunophenotyping conducted in these studies revealed increases in several immunological markers consistent with a CD8 + T cell driven MOA, including increased splenic levels of p15E tumor antigen specific CD8 + T cells, an increase in the splenic ratio of TEM to regulatory T cells (T re g), and increased splenic percentages of CD8 + PD-1 + T cells. Furthermore, the percentage of tumor infiltrating natural killer (NK) cells and CD8 + T cells was observed to increase significantly in the combination group.
• NK tumor infiltrating natural killer
• the TK evaluation indicates that all animals were exposed to the test material throughout the study.
• the exposure levels increased roughly proportionally to dose increasing at both 1 st and 4 th dose, without any relevant accumulation or gender- dependency at any dose.
• Anti drug antibody were detected in 2/4 and 1/4 monkeys at 20 and 140 mg/kg levels respectively. There was no premature animal death in the study. No treatment related changes were noted in the 20 and 60 mg/kg dosing groups for all parameters evaluated in the study.
• treatment related findings include slight decrease of lymphocytes in haematology testing, slight decrease in lymphocyte count together with a decrease in NK cell count on study day 30. There were no significant histological changes in major organs/tissues except moderate perivascular hemorrhage and inflammation/vessel necrosis observed at local injection site at the 140 mg/kg. There was no clear trend or change observed in multicytokine analysis at this dose level. Based on the results from this study the No Observable Adverse Effect Level (NOAEL) was identified as 140 mg/kg.
• NOAEL No Observable Adverse Effect Level

Landscapes

• Health & Medical Sciences (AREA)
• Chemical & Material Sciences (AREA)
• Life Sciences & Earth Sciences (AREA)
• Medicinal Chemistry (AREA)
• General Health & Medical Sciences (AREA)
• Animal Behavior & Ethology (AREA)
• Veterinary Medicine (AREA)
• Public Health (AREA)
• Pharmacology & Pharmacy (AREA)
• Organic Chemistry (AREA)
• Immunology (AREA)
• Engineering & Computer Science (AREA)
• Bioinformatics & Cheminformatics (AREA)
• Epidemiology (AREA)
• Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
• Chemical Kinetics & Catalysis (AREA)
• General Chemical & Material Sciences (AREA)
• Molecular Biology (AREA)
• Proteomics, Peptides & Aminoacids (AREA)
• Microbiology (AREA)
• Mycology (AREA)
• Genetics & Genomics (AREA)
• Biophysics (AREA)
• Biochemistry (AREA)
• Gastroenterology & Hepatology (AREA)
• Oncology (AREA)
• Endocrinology (AREA)
• Zoology (AREA)
• Biomedical Technology (AREA)
• Cell Biology (AREA)
• Urology & Nephrology (AREA)
• Toxicology (AREA)
• Diabetes (AREA)
• Reproductive Health (AREA)
• Dermatology (AREA)
• Pulmonology (AREA)
• Neurology (AREA)
• Neurosurgery (AREA)
• Radiology & Medical Imaging (AREA)
• Biotechnology (AREA)

Priority Applications (34)

Applications Claiming Priority (2)

Related Child Applications (4)

Publications (1)

Family

ID=47221305

Family Applications (1)

Country Status (28)

Cited By (752)