DK3118318T3 - Anti-tnf-antistoffer, sammensætninger, fremgangsmåder og anvendelser - Google Patents
Anti-tnf-antistoffer, sammensætninger, fremgangsmåder og anvendelser Download PDFInfo
- Publication number
- DK3118318T3 DK3118318T3 DK16179183.5T DK16179183T DK3118318T3 DK 3118318 T3 DK3118318 T3 DK 3118318T3 DK 16179183 T DK16179183 T DK 16179183T DK 3118318 T3 DK3118318 T3 DK 3118318T3
- Authority
- DK
- Denmark
- Prior art keywords
- antibody
- tnf
- human
- antibodies
- cell
- Prior art date
Links
- 239000000203 mixture Substances 0.000 title claims abstract description 151
- 238000000034 method Methods 0.000 title abstract description 112
- 241000282414 Homo sapiens Species 0.000 claims description 170
- 108060008682 Tumor Necrosis Factor Proteins 0.000 claims description 153
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 claims description 152
- 239000012634 fragment Substances 0.000 claims description 84
- 230000027455 binding Effects 0.000 claims description 65
- 238000009739 binding Methods 0.000 claims description 65
- 238000011282 treatment Methods 0.000 claims description 43
- 239000000427 antigen Substances 0.000 claims description 37
- 108091007433 antigens Proteins 0.000 claims description 36
- 102000036639 antigens Human genes 0.000 claims description 36
- 239000003795 chemical substances by application Substances 0.000 claims description 31
- 108060003951 Immunoglobulin Proteins 0.000 claims description 28
- 102000018358 immunoglobulin Human genes 0.000 claims description 28
- 239000003085 diluting agent Substances 0.000 claims description 26
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 24
- 239000003814 drug Substances 0.000 claims description 22
- 102000004127 Cytokines Human genes 0.000 claims description 20
- 108090000695 Cytokines Proteins 0.000 claims description 20
- 229940079593 drug Drugs 0.000 claims description 17
- 239000005557 antagonist Substances 0.000 claims description 10
- ADEBPBSSDYVVLD-UHFFFAOYSA-N donepezil Chemical compound O=C1C=2C=C(OC)C(OC)=CC=2CC1CC(CC1)CCN1CC1=CC=CC=C1 ADEBPBSSDYVVLD-UHFFFAOYSA-N 0.000 claims description 8
- 229940088597 hormone Drugs 0.000 claims description 8
- 239000005556 hormone Substances 0.000 claims description 8
- 239000000041 non-steroidal anti-inflammatory agent Substances 0.000 claims description 8
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 claims description 8
- 108010029961 Filgrastim Proteins 0.000 claims description 7
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 claims description 7
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 claims description 7
- 239000003146 anticoagulant agent Substances 0.000 claims description 7
- 206010012601 diabetes mellitus Diseases 0.000 claims description 7
- 108010038379 sargramostim Proteins 0.000 claims description 7
- 208000003456 Juvenile Arthritis Diseases 0.000 claims description 6
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 claims description 6
- 229940127219 anticoagulant drug Drugs 0.000 claims description 6
- 239000011575 calcium Substances 0.000 claims description 6
- 208000019069 chronic childhood arthritis Diseases 0.000 claims description 6
- 230000002163 immunogen Effects 0.000 claims description 6
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 claims description 6
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 claims description 5
- 239000004599 antimicrobial Substances 0.000 claims description 5
- 229910052791 calcium Inorganic materials 0.000 claims description 5
- 150000003431 steroids Chemical class 0.000 claims description 5
- UCTWMZQNUQWSLP-VIFPVBQESA-N (R)-adrenaline Chemical compound CNC[C@H](O)C1=CC=C(O)C(O)=C1 UCTWMZQNUQWSLP-VIFPVBQESA-N 0.000 claims description 4
- 229930182837 (R)-adrenaline Natural products 0.000 claims description 4
- PFWLFWPASULGAN-UHFFFAOYSA-N 7-methylxanthine Chemical compound N1C(=O)NC(=O)C2=C1N=CN2C PFWLFWPASULGAN-UHFFFAOYSA-N 0.000 claims description 4
- 108010051696 Growth Hormone Proteins 0.000 claims description 4
- 102000018997 Growth Hormone Human genes 0.000 claims description 4
- 239000000150 Sympathomimetic Substances 0.000 claims description 4
- 239000003263 anabolic agent Substances 0.000 claims description 4
- 230000003444 anaesthetic effect Effects 0.000 claims description 4
- 230000000202 analgesic effect Effects 0.000 claims description 4
- 230000001430 anti-depressive effect Effects 0.000 claims description 4
- 230000003474 anti-emetic effect Effects 0.000 claims description 4
- 230000000340 anti-metabolite Effects 0.000 claims description 4
- 230000000561 anti-psychotic effect Effects 0.000 claims description 4
- 230000003356 anti-rheumatic effect Effects 0.000 claims description 4
- 239000000935 antidepressant agent Substances 0.000 claims description 4
- 229940005513 antidepressants Drugs 0.000 claims description 4
- 239000002111 antiemetic agent Substances 0.000 claims description 4
- 229940100197 antimetabolite Drugs 0.000 claims description 4
- 239000002256 antimetabolite Substances 0.000 claims description 4
- 239000003435 antirheumatic agent Substances 0.000 claims description 4
- 239000002249 anxiolytic agent Substances 0.000 claims description 4
- 208000006673 asthma Diseases 0.000 claims description 4
- 229960000265 cromoglicic acid Drugs 0.000 claims description 4
- IMZMKUWMOSJXDT-UHFFFAOYSA-N cromoglycic acid Chemical compound O1C(C(O)=O)=CC(=O)C2=C1C=CC=C2OCC(O)COC1=CC=CC2=C1C(=O)C=C(C(O)=O)O2 IMZMKUWMOSJXDT-UHFFFAOYSA-N 0.000 claims description 4
- 239000000430 cytokine receptor antagonist Substances 0.000 claims description 4
- 229960003530 donepezil Drugs 0.000 claims description 4
- 239000003937 drug carrier Substances 0.000 claims description 4
- 229960005139 epinephrine Drugs 0.000 claims description 4
- 239000002834 estrogen receptor modulator Substances 0.000 claims description 4
- 229960004177 filgrastim Drugs 0.000 claims description 4
- 239000000122 growth hormone Substances 0.000 claims description 4
- 229910052500 inorganic mineral Inorganic materials 0.000 claims description 4
- 239000008141 laxative Substances 0.000 claims description 4
- 230000002475 laxative effect Effects 0.000 claims description 4
- 239000003199 leukotriene receptor blocking agent Substances 0.000 claims description 4
- 235000010755 mineral Nutrition 0.000 claims description 4
- 239000011707 mineral Substances 0.000 claims description 4
- 230000002911 mydriatic effect Effects 0.000 claims description 4
- 239000003158 myorelaxant agent Substances 0.000 claims description 4
- 239000000842 neuromuscular blocking agent Substances 0.000 claims description 4
- 239000012217 radiopharmaceutical Substances 0.000 claims description 4
- 229940121896 radiopharmaceutical Drugs 0.000 claims description 4
- 230000002799 radiopharmaceutical effect Effects 0.000 claims description 4
- 229960002530 sargramostim Drugs 0.000 claims description 4
- 239000000932 sedative agent Substances 0.000 claims description 4
- 230000001624 sedative effect Effects 0.000 claims description 4
- 230000001975 sympathomimetic effect Effects 0.000 claims description 4
- 229960001685 tacrine Drugs 0.000 claims description 4
- 210000001685 thyroid gland Anatomy 0.000 claims description 4
- 229940088594 vitamin Drugs 0.000 claims description 4
- 239000011782 vitamin Substances 0.000 claims description 4
- 235000013343 vitamin Nutrition 0.000 claims description 4
- 229930003231 vitamin Natural products 0.000 claims description 4
- 150000003722 vitamin derivatives Chemical class 0.000 claims description 4
- 239000003112 inhibitor Substances 0.000 claims description 3
- 208000007107 Stomach Ulcer Diseases 0.000 claims description 2
- 102100040247 Tumor necrosis factor Human genes 0.000 claims description 2
- 201000005917 gastric ulcer Diseases 0.000 claims description 2
- 206010011224 Cough Diseases 0.000 claims 1
- 206010012735 Diarrhoea Diseases 0.000 claims 1
- 229940123907 Disease modifying antirheumatic drug Drugs 0.000 claims 1
- 206010026749 Mania Diseases 0.000 claims 1
- 229940030999 antipsoriatics Drugs 0.000 claims 1
- 239000002826 coolant Substances 0.000 claims 1
- 239000003246 corticosteroid Substances 0.000 claims 1
- 229940124570 cycloplegic agent Drugs 0.000 claims 1
- 229960003444 immunosuppressant agent Drugs 0.000 claims 1
- 230000001861 immunosuppressant effect Effects 0.000 claims 1
- 239000003018 immunosuppressive agent Substances 0.000 claims 1
- 239000003589 local anesthetic agent Substances 0.000 claims 1
- 230000011278 mitosis Effects 0.000 claims 1
- 235000015097 nutrients Nutrition 0.000 claims 1
- YLJREFDVOIBQDA-UHFFFAOYSA-N tacrine Chemical compound C1=CC=C2C(N)=C(CCCC3)C3=NC2=C1 YLJREFDVOIBQDA-UHFFFAOYSA-N 0.000 claims 1
- 241001465754 Metazoa Species 0.000 abstract description 68
- 150000007523 nucleic acids Chemical class 0.000 abstract description 54
- 102000039446 nucleic acids Human genes 0.000 abstract description 49
- 108020004707 nucleic acids Proteins 0.000 abstract description 49
- 239000013598 vector Substances 0.000 abstract description 39
- 230000001225 therapeutic effect Effects 0.000 abstract description 12
- 230000009261 transgenic effect Effects 0.000 abstract description 12
- 210000004027 cell Anatomy 0.000 description 255
- 108090000623 proteins and genes Proteins 0.000 description 152
- 235000018102 proteins Nutrition 0.000 description 74
- 102000004169 proteins and genes Human genes 0.000 description 74
- 238000009472 formulation Methods 0.000 description 57
- 239000000243 solution Substances 0.000 description 53
- 235000001014 amino acid Nutrition 0.000 description 50
- 239000013612 plasmid Substances 0.000 description 50
- 150000001413 amino acids Chemical class 0.000 description 46
- 210000004408 hybridoma Anatomy 0.000 description 46
- 229940024606 amino acid Drugs 0.000 description 45
- -1 rDNA Proteins 0.000 description 42
- 108020004414 DNA Proteins 0.000 description 41
- 241000709655 unidentified tobacco necrosis virus Species 0.000 description 39
- 239000002953 phosphate buffered saline Substances 0.000 description 37
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 36
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 35
- 241000699666 Mus <mouse, genus> Species 0.000 description 35
- 102000057041 human TNF Human genes 0.000 description 35
- 238000004519 manufacturing process Methods 0.000 description 34
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 33
- 239000000872 buffer Substances 0.000 description 33
- 239000000047 product Substances 0.000 description 33
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 33
- 241000699670 Mus sp. Species 0.000 description 32
- 210000004602 germ cell Anatomy 0.000 description 32
- 235000014113 dietary fatty acids Nutrition 0.000 description 31
- 229930195729 fatty acid Natural products 0.000 description 31
- 239000000194 fatty acid Substances 0.000 description 31
- 230000004927 fusion Effects 0.000 description 28
- 239000006228 supernatant Substances 0.000 description 28
- 201000010099 disease Diseases 0.000 description 27
- 230000009467 reduction Effects 0.000 description 27
- 108091034117 Oligonucleotide Proteins 0.000 description 26
- 230000000694 effects Effects 0.000 description 25
- 238000003752 polymerase chain reaction Methods 0.000 description 25
- 210000001519 tissue Anatomy 0.000 description 24
- 238000001890 transfection Methods 0.000 description 24
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 23
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 22
- 108091028043 Nucleic acid sequence Proteins 0.000 description 22
- 238000010367 cloning Methods 0.000 description 22
- 229920001223 polyethylene glycol Polymers 0.000 description 22
- 239000003755 preservative agent Substances 0.000 description 22
- 108090000765 processed proteins & peptides Proteins 0.000 description 22
- 230000002917 arthritic effect Effects 0.000 description 21
- 239000000546 pharmaceutical excipient Substances 0.000 description 21
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 20
- 239000013613 expression plasmid Substances 0.000 description 19
- 239000012091 fetal bovine serum Substances 0.000 description 19
- 101100454807 Caenorhabditis elegans lgg-1 gene Proteins 0.000 description 18
- 239000002202 Polyethylene glycol Substances 0.000 description 18
- 239000002299 complementary DNA Substances 0.000 description 18
- 230000014509 gene expression Effects 0.000 description 18
- 230000002335 preservative effect Effects 0.000 description 18
- 210000002966 serum Anatomy 0.000 description 18
- 241000283707 Capra Species 0.000 description 17
- 238000007912 intraperitoneal administration Methods 0.000 description 17
- 210000000056 organ Anatomy 0.000 description 17
- 102000040430 polynucleotide Human genes 0.000 description 17
- 108091033319 polynucleotide Proteins 0.000 description 17
- 239000002157 polynucleotide Substances 0.000 description 17
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 17
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 16
- 238000004458 analytical method Methods 0.000 description 16
- 239000013604 expression vector Substances 0.000 description 16
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical class O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 15
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 15
- 108700012920 TNF Proteins 0.000 description 15
- 150000001875 compounds Chemical class 0.000 description 15
- 150000004665 fatty acids Chemical class 0.000 description 15
- 230000005847 immunogenicity Effects 0.000 description 15
- 239000007924 injection Substances 0.000 description 15
- 238000002347 injection Methods 0.000 description 15
- 229960000485 methotrexate Drugs 0.000 description 15
- 150000003839 salts Chemical class 0.000 description 15
- 108091026890 Coding region Proteins 0.000 description 14
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 14
- 206010035226 Plasma cell myeloma Diseases 0.000 description 14
- 108700019146 Transgenes Proteins 0.000 description 14
- 230000012010 growth Effects 0.000 description 14
- 230000007170 pathology Effects 0.000 description 14
- 238000003556 assay Methods 0.000 description 13
- 230000003053 immunization Effects 0.000 description 13
- 238000002649 immunization Methods 0.000 description 13
- 238000000338 in vitro Methods 0.000 description 13
- 201000000050 myeloid neoplasm Diseases 0.000 description 13
- 239000002245 particle Substances 0.000 description 13
- 238000000746 purification Methods 0.000 description 13
- 239000004094 surface-active agent Substances 0.000 description 13
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 12
- 241000282412 Homo Species 0.000 description 12
- 208000021017 Weight Gain Diseases 0.000 description 12
- 239000000443 aerosol Substances 0.000 description 12
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical class OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 12
- 125000005647 linker group Chemical group 0.000 description 12
- 239000003550 marker Substances 0.000 description 12
- 239000002773 nucleotide Substances 0.000 description 12
- 125000003729 nucleotide group Chemical group 0.000 description 12
- 239000011780 sodium chloride Substances 0.000 description 12
- 230000004584 weight gain Effects 0.000 description 12
- 235000019786 weight gain Nutrition 0.000 description 12
- 101710117290 Aldo-keto reductase family 1 member C4 Proteins 0.000 description 11
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 11
- 239000000654 additive Substances 0.000 description 11
- 230000003321 amplification Effects 0.000 description 11
- 238000005516 engineering process Methods 0.000 description 11
- 230000000670 limiting effect Effects 0.000 description 11
- 239000006199 nebulizer Substances 0.000 description 11
- 238000003199 nucleic acid amplification method Methods 0.000 description 11
- 102000005962 receptors Human genes 0.000 description 11
- 108020003175 receptors Proteins 0.000 description 11
- 108091008146 restriction endonucleases Proteins 0.000 description 11
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 10
- 238000002965 ELISA Methods 0.000 description 10
- 241000196324 Embryophyta Species 0.000 description 10
- 206010028980 Neoplasm Diseases 0.000 description 10
- 150000001720 carbohydrates Chemical class 0.000 description 10
- 238000004113 cell culture Methods 0.000 description 10
- 238000006243 chemical reaction Methods 0.000 description 10
- 239000003623 enhancer Substances 0.000 description 10
- 108020001507 fusion proteins Proteins 0.000 description 10
- 102000037865 fusion proteins Human genes 0.000 description 10
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 10
- 238000002360 preparation method Methods 0.000 description 10
- 230000008569 process Effects 0.000 description 10
- 239000000523 sample Substances 0.000 description 10
- 239000003053 toxin Substances 0.000 description 10
- 231100000765 toxin Toxicity 0.000 description 10
- 108700012359 toxins Proteins 0.000 description 10
- 230000014616 translation Effects 0.000 description 10
- UZOVYGYOLBIAJR-UHFFFAOYSA-N 4-isocyanato-4'-methyldiphenylmethane Chemical compound C1=CC(C)=CC=C1CC1=CC=C(N=C=O)C=C1 UZOVYGYOLBIAJR-UHFFFAOYSA-N 0.000 description 9
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 9
- 230000037396 body weight Effects 0.000 description 9
- 201000011510 cancer Diseases 0.000 description 9
- 235000014633 carbohydrates Nutrition 0.000 description 9
- 230000008859 change Effects 0.000 description 9
- 230000029087 digestion Effects 0.000 description 9
- 208000035475 disorder Diseases 0.000 description 9
- 208000015181 infectious disease Diseases 0.000 description 9
- 239000007788 liquid Substances 0.000 description 9
- 210000004962 mammalian cell Anatomy 0.000 description 9
- 230000001404 mediated effect Effects 0.000 description 9
- 238000002156 mixing Methods 0.000 description 9
- 229920000642 polymer Polymers 0.000 description 9
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 9
- 230000035939 shock Effects 0.000 description 9
- 238000006467 substitution reaction Methods 0.000 description 9
- 239000000725 suspension Substances 0.000 description 9
- 238000011830 transgenic mouse model Methods 0.000 description 9
- 102000004190 Enzymes Human genes 0.000 description 8
- 108090000790 Enzymes Proteins 0.000 description 8
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 8
- 229920001213 Polysorbate 20 Polymers 0.000 description 8
- 229910002092 carbon dioxide Inorganic materials 0.000 description 8
- 230000001419 dependent effect Effects 0.000 description 8
- 230000009977 dual effect Effects 0.000 description 8
- 229940088598 enzyme Drugs 0.000 description 8
- 229940072221 immunoglobulins Drugs 0.000 description 8
- 230000001965 increasing effect Effects 0.000 description 8
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 8
- 239000002609 medium Substances 0.000 description 8
- 108020004999 messenger RNA Proteins 0.000 description 8
- 230000003472 neutralizing effect Effects 0.000 description 8
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 8
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 8
- 102000004196 processed proteins & peptides Human genes 0.000 description 8
- 230000002685 pulmonary effect Effects 0.000 description 8
- 230000004044 response Effects 0.000 description 8
- 239000002904 solvent Substances 0.000 description 8
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 8
- 239000000758 substrate Substances 0.000 description 8
- 208000011580 syndromic disease Diseases 0.000 description 8
- 238000003786 synthesis reaction Methods 0.000 description 8
- 238000013519 translation Methods 0.000 description 8
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 7
- 208000035143 Bacterial infection Diseases 0.000 description 7
- 101100112922 Candida albicans CDR3 gene Proteins 0.000 description 7
- 108020004635 Complementary DNA Proteins 0.000 description 7
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 7
- 241000699660 Mus musculus Species 0.000 description 7
- 229930182555 Penicillin Natural products 0.000 description 7
- 230000000845 anti-microbial effect Effects 0.000 description 7
- 208000022362 bacterial infectious disease Diseases 0.000 description 7
- 238000010790 dilution Methods 0.000 description 7
- 239000012895 dilution Substances 0.000 description 7
- 238000009396 hybridization Methods 0.000 description 7
- 238000003018 immunoassay Methods 0.000 description 7
- 238000001727 in vivo Methods 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 7
- 239000005022 packaging material Substances 0.000 description 7
- 229940049954 penicillin Drugs 0.000 description 7
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 7
- 229920000053 polysorbate 80 Polymers 0.000 description 7
- 239000000843 powder Substances 0.000 description 7
- 239000000126 substance Substances 0.000 description 7
- 238000013518 transcription Methods 0.000 description 7
- 230000035897 transcription Effects 0.000 description 7
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide Chemical compound CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 6
- CFKMVGJGLGKFKI-UHFFFAOYSA-N 4-chloro-m-cresol Chemical compound CC1=CC(O)=CC=C1Cl CFKMVGJGLGKFKI-UHFFFAOYSA-N 0.000 description 6
- 206010006895 Cachexia Diseases 0.000 description 6
- 108020004705 Codon Proteins 0.000 description 6
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 6
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 6
- 241000124008 Mammalia Species 0.000 description 6
- 229930195725 Mannitol Natural products 0.000 description 6
- 241001529936 Murinae Species 0.000 description 6
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 6
- 108010076504 Protein Sorting Signals Proteins 0.000 description 6
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 6
- 206010052779 Transplant rejections Diseases 0.000 description 6
- 102100033732 Tumor necrosis factor receptor superfamily member 1A Human genes 0.000 description 6
- 230000003213 activating effect Effects 0.000 description 6
- 238000007792 addition Methods 0.000 description 6
- 206010003246 arthritis Diseases 0.000 description 6
- 230000004071 biological effect Effects 0.000 description 6
- 238000012512 characterization method Methods 0.000 description 6
- 238000003776 cleavage reaction Methods 0.000 description 6
- 108010067396 dornase alfa Proteins 0.000 description 6
- 239000000839 emulsion Substances 0.000 description 6
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 6
- 238000002955 isolation Methods 0.000 description 6
- 239000000594 mannitol Substances 0.000 description 6
- 235000010355 mannitol Nutrition 0.000 description 6
- QWVGKYWNOKOFNN-UHFFFAOYSA-N o-cresol Chemical compound CC1=CC=CC=C1O QWVGKYWNOKOFNN-UHFFFAOYSA-N 0.000 description 6
- IWDCLRJOBJJRNH-UHFFFAOYSA-N p-cresol Chemical compound CC1=CC=C(O)C=C1 IWDCLRJOBJJRNH-UHFFFAOYSA-N 0.000 description 6
- 230000008488 polyadenylation Effects 0.000 description 6
- 229920001282 polysaccharide Polymers 0.000 description 6
- 239000003380 propellant Substances 0.000 description 6
- 238000010188 recombinant method Methods 0.000 description 6
- 230000007017 scission Effects 0.000 description 6
- 238000012216 screening Methods 0.000 description 6
- 230000003248 secreting effect Effects 0.000 description 6
- 238000002741 site-directed mutagenesis Methods 0.000 description 6
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 6
- 210000000952 spleen Anatomy 0.000 description 6
- 238000002560 therapeutic procedure Methods 0.000 description 6
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 5
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 5
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 5
- 241000588724 Escherichia coli Species 0.000 description 5
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 5
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 5
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 5
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 5
- 239000012980 RPMI-1640 medium Substances 0.000 description 5
- 206010040047 Sepsis Diseases 0.000 description 5
- 238000012300 Sequence Analysis Methods 0.000 description 5
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 5
- 239000002671 adjuvant Substances 0.000 description 5
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 5
- 125000000539 amino acid group Chemical group 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 230000001684 chronic effect Effects 0.000 description 5
- 239000002552 dosage form Substances 0.000 description 5
- 238000004520 electroporation Methods 0.000 description 5
- 239000007789 gas Substances 0.000 description 5
- 239000000499 gel Substances 0.000 description 5
- 229920001477 hydrophilic polymer Polymers 0.000 description 5
- 208000026278 immune system disease Diseases 0.000 description 5
- 230000002458 infectious effect Effects 0.000 description 5
- 230000004054 inflammatory process Effects 0.000 description 5
- 238000005304 joining Methods 0.000 description 5
- 239000008101 lactose Substances 0.000 description 5
- 229940071648 metered dose inhaler Drugs 0.000 description 5
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 5
- 238000010172 mouse model Methods 0.000 description 5
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 5
- 229960000951 mycophenolic acid Drugs 0.000 description 5
- 229910052757 nitrogen Inorganic materials 0.000 description 5
- 239000008188 pellet Substances 0.000 description 5
- 238000001050 pharmacotherapy Methods 0.000 description 5
- 239000008363 phosphate buffer Substances 0.000 description 5
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 5
- 239000013615 primer Substances 0.000 description 5
- 229940116176 remicade Drugs 0.000 description 5
- 206010039073 rheumatoid arthritis Diseases 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 235000000346 sugar Nutrition 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- 239000003981 vehicle Substances 0.000 description 5
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 4
- 102000009027 Albumins Human genes 0.000 description 4
- 108010088751 Albumins Proteins 0.000 description 4
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical class OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 4
- 208000024172 Cardiovascular disease Diseases 0.000 description 4
- 241000699802 Cricetulus griseus Species 0.000 description 4
- 241000701022 Cytomegalovirus Species 0.000 description 4
- 101150074155 DHFR gene Proteins 0.000 description 4
- 229920002307 Dextran Polymers 0.000 description 4
- 102100031780 Endonuclease Human genes 0.000 description 4
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 4
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 4
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- 108091006905 Human Serum Albumin Proteins 0.000 description 4
- 102000008100 Human Serum Albumin Human genes 0.000 description 4
- 206010061218 Inflammation Diseases 0.000 description 4
- 229930182816 L-glutamine Natural products 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 208000012902 Nervous system disease Diseases 0.000 description 4
- 102000057297 Pepsin A Human genes 0.000 description 4
- 108090000284 Pepsin A Proteins 0.000 description 4
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 4
- 229930006000 Sucrose Natural products 0.000 description 4
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 4
- 239000004098 Tetracycline Substances 0.000 description 4
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 4
- APKFDSVGJQXUKY-INPOYWNPSA-N amphotericin B Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/C=C/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-INPOYWNPSA-N 0.000 description 4
- 210000000628 antibody-producing cell Anatomy 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 210000003719 b-lymphocyte Anatomy 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 4
- 210000000349 chromosome Anatomy 0.000 description 4
- 238000011260 co-administration Methods 0.000 description 4
- 230000000875 corresponding effect Effects 0.000 description 4
- 238000012258 culturing Methods 0.000 description 4
- 230000007423 decrease Effects 0.000 description 4
- 238000012217 deletion Methods 0.000 description 4
- 230000037430 deletion Effects 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 108020001096 dihydrofolate reductase Proteins 0.000 description 4
- 238000010494 dissociation reaction Methods 0.000 description 4
- 230000005593 dissociations Effects 0.000 description 4
- 239000002158 endotoxin Substances 0.000 description 4
- 231100000655 enterotoxin Toxicity 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 239000007943 implant Substances 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- 238000001990 intravenous administration Methods 0.000 description 4
- 239000002502 liposome Substances 0.000 description 4
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 230000001575 pathological effect Effects 0.000 description 4
- 229940111202 pepsin Drugs 0.000 description 4
- 239000012071 phase Substances 0.000 description 4
- 239000013600 plasmid vector Substances 0.000 description 4
- 229920001451 polypropylene glycol Polymers 0.000 description 4
- 239000005017 polysaccharide Substances 0.000 description 4
- 150000004804 polysaccharides Chemical class 0.000 description 4
- 238000003259 recombinant expression Methods 0.000 description 4
- 150000003384 small molecules Chemical class 0.000 description 4
- 210000004989 spleen cell Anatomy 0.000 description 4
- 210000004988 splenocyte Anatomy 0.000 description 4
- 229960005322 streptomycin Drugs 0.000 description 4
- 238000007920 subcutaneous administration Methods 0.000 description 4
- 239000005720 sucrose Substances 0.000 description 4
- 150000008163 sugars Chemical class 0.000 description 4
- 229960002180 tetracycline Drugs 0.000 description 4
- 229930101283 tetracycline Natural products 0.000 description 4
- 235000019364 tetracycline Nutrition 0.000 description 4
- 150000003522 tetracyclines Chemical class 0.000 description 4
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 4
- 229940033663 thimerosal Drugs 0.000 description 4
- 238000011144 upstream manufacturing Methods 0.000 description 4
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 4
- BSIMZHVOQZIAOY-SCSAIBSYSA-N 1-carbapenem-3-carboxylic acid Chemical compound OC(=O)C1=CC[C@@H]2CC(=O)N12 BSIMZHVOQZIAOY-SCSAIBSYSA-N 0.000 description 3
- ZAVJTSLIGAGALR-UHFFFAOYSA-N 2-(2,2,2-trifluoroacetyl)cyclooctan-1-one Chemical compound FC(F)(F)C(=O)C1CCCCCCC1=O ZAVJTSLIGAGALR-UHFFFAOYSA-N 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 101100217502 Caenorhabditis elegans lgg-3 gene Proteins 0.000 description 3
- 229930186147 Cephalosporin Natural products 0.000 description 3
- 208000035473 Communicable disease Diseases 0.000 description 3
- 208000011231 Crohn disease Diseases 0.000 description 3
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 3
- 108010036949 Cyclosporine Proteins 0.000 description 3
- 230000006820 DNA synthesis Effects 0.000 description 3
- 102100024746 Dihydrofolate reductase Human genes 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- 108010008165 Etanercept Proteins 0.000 description 3
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 3
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 3
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 3
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 3
- 108091092195 Intron Proteins 0.000 description 3
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 3
- 206010025323 Lymphomas Diseases 0.000 description 3
- 229940121849 Mitotic inhibitor Drugs 0.000 description 3
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 3
- 244000061176 Nicotiana tabacum Species 0.000 description 3
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 3
- 238000012408 PCR amplification Methods 0.000 description 3
- 108010039918 Polylysine Proteins 0.000 description 3
- 241000288906 Primates Species 0.000 description 3
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 3
- MUPFEKGTMRGPLJ-RMMQSMQOSA-N Raffinose Natural products O(C[C@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O[C@@]2(CO)[C@H](O)[C@@H](O)[C@@H](CO)O2)O1)[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 MUPFEKGTMRGPLJ-RMMQSMQOSA-N 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- 241000283984 Rodentia Species 0.000 description 3
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 3
- 239000004288 Sodium dehydroacetate Substances 0.000 description 3
- 229920002472 Starch Polymers 0.000 description 3
- 239000007983 Tris buffer Substances 0.000 description 3
- MUPFEKGTMRGPLJ-UHFFFAOYSA-N UNPD196149 Natural products OC1C(O)C(CO)OC1(CO)OC1C(O)C(O)C(O)C(COC2C(C(O)C(O)C(CO)O2)O)O1 MUPFEKGTMRGPLJ-UHFFFAOYSA-N 0.000 description 3
- 241000607598 Vibrio Species 0.000 description 3
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 230000001154 acute effect Effects 0.000 description 3
- 238000001042 affinity chromatography Methods 0.000 description 3
- 230000002776 aggregation Effects 0.000 description 3
- 238000004220 aggregation Methods 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 125000000217 alkyl group Chemical group 0.000 description 3
- 229940100198 alkylating agent Drugs 0.000 description 3
- 239000002168 alkylating agent Substances 0.000 description 3
- 229940126575 aminoglycoside Drugs 0.000 description 3
- 230000000954 anitussive effect Effects 0.000 description 3
- 208000022531 anorexia Diseases 0.000 description 3
- 230000001142 anti-diarrhea Effects 0.000 description 3
- 230000000843 anti-fungal effect Effects 0.000 description 3
- 230000002141 anti-parasite Effects 0.000 description 3
- 230000002682 anti-psoriatic effect Effects 0.000 description 3
- 230000000767 anti-ulcer Effects 0.000 description 3
- 230000000840 anti-viral effect Effects 0.000 description 3
- 229940121375 antifungal agent Drugs 0.000 description 3
- 239000000228 antimanic agent Substances 0.000 description 3
- 239000003963 antioxidant agent Substances 0.000 description 3
- 235000006708 antioxidants Nutrition 0.000 description 3
- 239000003096 antiparasitic agent Substances 0.000 description 3
- 229940124584 antitussives Drugs 0.000 description 3
- 230000000949 anxiolytic effect Effects 0.000 description 3
- 206010003119 arrhythmia Diseases 0.000 description 3
- 229940127225 asthma medication Drugs 0.000 description 3
- AUJRCFUBUPVWSZ-XTZHGVARSA-M auranofin Chemical compound CCP(CC)(CC)=[Au]S[C@@H]1O[C@H](COC(C)=O)[C@@H](OC(C)=O)[C@H](OC(C)=O)[C@H]1OC(C)=O AUJRCFUBUPVWSZ-XTZHGVARSA-M 0.000 description 3
- 229960005207 auranofin Drugs 0.000 description 3
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 3
- 229960002170 azathioprine Drugs 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 229960004669 basiliximab Drugs 0.000 description 3
- 229960000686 benzalkonium chloride Drugs 0.000 description 3
- 229960001950 benzethonium chloride Drugs 0.000 description 3
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 3
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 3
- 229940125388 beta agonist Drugs 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 3
- 125000004432 carbon atom Chemical group C* 0.000 description 3
- 150000007942 carboxylates Chemical class 0.000 description 3
- 230000007910 cell fusion Effects 0.000 description 3
- 230000010261 cell growth Effects 0.000 description 3
- 229940124587 cephalosporin Drugs 0.000 description 3
- 150000001780 cephalosporins Chemical class 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 229960002242 chlorocresol Drugs 0.000 description 3
- 229960001265 ciclosporin Drugs 0.000 description 3
- 238000002648 combination therapy Methods 0.000 description 3
- 238000007796 conventional method Methods 0.000 description 3
- 238000013211 curve analysis Methods 0.000 description 3
- 230000003500 cycloplegic effect Effects 0.000 description 3
- 229930182912 cyclosporin Natural products 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- 231100000433 cytotoxic Toxicity 0.000 description 3
- 230000001472 cytotoxic effect Effects 0.000 description 3
- 229960002806 daclizumab Drugs 0.000 description 3
- 206010061428 decreased appetite Diseases 0.000 description 3
- 230000007850 degeneration Effects 0.000 description 3
- PCHPORCSPXIHLZ-UHFFFAOYSA-N diphenhydramine hydrochloride Chemical compound [Cl-].C=1C=CC=CC=1C(OCC[NH+](C)C)C1=CC=CC=C1 PCHPORCSPXIHLZ-UHFFFAOYSA-N 0.000 description 3
- 238000004090 dissolution Methods 0.000 description 3
- 238000012377 drug delivery Methods 0.000 description 3
- 239000000147 enterotoxin Substances 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 229960000403 etanercept Drugs 0.000 description 3
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 3
- 210000003527 eukaryotic cell Anatomy 0.000 description 3
- 238000011156 evaluation Methods 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 229940015045 gold sodium thiomalate Drugs 0.000 description 3
- 229960002927 hydroxychloroquine sulfate Drugs 0.000 description 3
- 230000000147 hypnotic effect Effects 0.000 description 3
- 230000001506 immunosuppresive effect Effects 0.000 description 3
- 230000008676 import Effects 0.000 description 3
- 230000006698 induction Effects 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 230000000968 intestinal effect Effects 0.000 description 3
- VHOGYURTWQBHIL-UHFFFAOYSA-N leflunomide Chemical compound O1N=CC(C(=O)NC=2C=CC(=CC=2)C(F)(F)F)=C1C VHOGYURTWQBHIL-UHFFFAOYSA-N 0.000 description 3
- 229960000681 leflunomide Drugs 0.000 description 3
- 229940087875 leukine Drugs 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 231100000053 low toxicity Toxicity 0.000 description 3
- 239000003120 macrolide antibiotic agent Substances 0.000 description 3
- 210000002540 macrophage Anatomy 0.000 description 3
- 230000003211 malignant effect Effects 0.000 description 3
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 3
- 239000011859 microparticle Substances 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 210000001616 monocyte Anatomy 0.000 description 3
- 201000006417 multiple sclerosis Diseases 0.000 description 3
- 238000002703 mutagenesis Methods 0.000 description 3
- 231100000350 mutagenesis Toxicity 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- 208000010125 myocardial infarction Diseases 0.000 description 3
- 230000003533 narcotic effect Effects 0.000 description 3
- 229940029345 neupogen Drugs 0.000 description 3
- 231100000252 nontoxic Toxicity 0.000 description 3
- 230000003000 nontoxic effect Effects 0.000 description 3
- 235000016709 nutrition Nutrition 0.000 description 3
- 239000003921 oil Substances 0.000 description 3
- 235000019198 oils Nutrition 0.000 description 3
- 210000001672 ovary Anatomy 0.000 description 3
- 210000005259 peripheral blood Anatomy 0.000 description 3
- 239000011886 peripheral blood Substances 0.000 description 3
- 239000008194 pharmaceutical composition Substances 0.000 description 3
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 3
- 239000002504 physiological saline solution Substances 0.000 description 3
- 229920000656 polylysine Polymers 0.000 description 3
- 229920000136 polysorbate Polymers 0.000 description 3
- 229940068977 polysorbate 20 Drugs 0.000 description 3
- 229940068968 polysorbate 80 Drugs 0.000 description 3
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 3
- 238000000159 protein binding assay Methods 0.000 description 3
- 229940107568 pulmozyme Drugs 0.000 description 3
- MUPFEKGTMRGPLJ-ZQSKZDJDSA-N raffinose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO[C@@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)O)O1 MUPFEKGTMRGPLJ-ZQSKZDJDSA-N 0.000 description 3
- 230000008707 rearrangement Effects 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 230000011664 signaling Effects 0.000 description 3
- 229940079839 sodium dehydroacetate Drugs 0.000 description 3
- 235000019259 sodium dehydroacetate Nutrition 0.000 description 3
- 239000001488 sodium phosphate Substances 0.000 description 3
- 229910000162 sodium phosphate Inorganic materials 0.000 description 3
- 229940054269 sodium pyruvate Drugs 0.000 description 3
- DSOWAKKSGYUMTF-GZOLSCHFSA-M sodium;(1e)-1-(6-methyl-2,4-dioxopyran-3-ylidene)ethanolate Chemical compound [Na+].C\C([O-])=C1/C(=O)OC(C)=CC1=O DSOWAKKSGYUMTF-GZOLSCHFSA-M 0.000 description 3
- AGHLUVOCTHWMJV-UHFFFAOYSA-J sodium;gold(3+);2-sulfanylbutanedioate Chemical compound [Na+].[Au+3].[O-]C(=O)CC(S)C([O-])=O.[O-]C(=O)CC(S)C([O-])=O AGHLUVOCTHWMJV-UHFFFAOYSA-J 0.000 description 3
- 239000007790 solid phase Substances 0.000 description 3
- 238000013112 stability test Methods 0.000 description 3
- 235000019698 starch Nutrition 0.000 description 3
- 239000008223 sterile water Substances 0.000 description 3
- 150000005846 sugar alcohols Chemical class 0.000 description 3
- 229940124530 sulfonamide Drugs 0.000 description 3
- 150000003456 sulfonamides Chemical class 0.000 description 3
- 230000002459 sustained effect Effects 0.000 description 3
- 230000009885 systemic effect Effects 0.000 description 3
- YLJREFDVOIBQDA-UHFFFAOYSA-O tacrine(1+) Chemical compound C1=CC=C2C([NH3+])=C(CCCC3)C3=NC2=C1 YLJREFDVOIBQDA-UHFFFAOYSA-O 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- 238000011269 treatment regimen Methods 0.000 description 3
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 3
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 3
- 230000006433 tumor necrosis factor production Effects 0.000 description 3
- 241001515965 unidentified phage Species 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- 229910052725 zinc Inorganic materials 0.000 description 3
- 239000011701 zinc Substances 0.000 description 3
- LVGUZGTVOIAKKC-UHFFFAOYSA-N 1,1,1,2-tetrafluoroethane Chemical compound FCC(F)(F)F LVGUZGTVOIAKKC-UHFFFAOYSA-N 0.000 description 2
- UUUHXMGGBIUAPW-UHFFFAOYSA-N 1-[1-[2-[[5-amino-2-[[1-[5-(diaminomethylideneamino)-2-[[1-[3-(1h-indol-3-yl)-2-[(5-oxopyrrolidine-2-carbonyl)amino]propanoyl]pyrrolidine-2-carbonyl]amino]pentanoyl]pyrrolidine-2-carbonyl]amino]-5-oxopentanoyl]amino]-3-methylpentanoyl]pyrrolidine-2-carbon Chemical compound C1CCC(C(=O)N2C(CCC2)C(O)=O)N1C(=O)C(C(C)CC)NC(=O)C(CCC(N)=O)NC(=O)C1CCCN1C(=O)C(CCCN=C(N)N)NC(=O)C1CCCN1C(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C1CCC(=O)N1 UUUHXMGGBIUAPW-UHFFFAOYSA-N 0.000 description 2
- GHCZTIFQWKKGSB-UHFFFAOYSA-N 2-hydroxypropane-1,2,3-tricarboxylic acid;phosphoric acid Chemical compound OP(O)(O)=O.OC(=O)CC(O)(C(O)=O)CC(O)=O GHCZTIFQWKKGSB-UHFFFAOYSA-N 0.000 description 2
- 108020005065 3' Flanking Region Proteins 0.000 description 2
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 2
- LRFVTYWOQMYALW-UHFFFAOYSA-N 9H-xanthine Chemical compound O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 2
- 206010069754 Acquired gene mutation Diseases 0.000 description 2
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 2
- 101150078577 Adora2b gene Proteins 0.000 description 2
- 241000607534 Aeromonas Species 0.000 description 2
- YYSWCHMLFJLLBJ-ZLUOBGJFSA-N Ala-Ala-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YYSWCHMLFJLLBJ-ZLUOBGJFSA-N 0.000 description 2
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 2
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 2
- 208000024827 Alzheimer disease Diseases 0.000 description 2
- 229930183010 Amphotericin Natural products 0.000 description 2
- QGGFZZLFKABGNL-UHFFFAOYSA-N Amphotericin A Natural products OC1C(N)C(O)C(C)OC1OC1C=CC=CC=CC=CCCC=CC=CC(C)C(O)C(C)C(C)OC(=O)CC(O)CC(O)CCC(O)C(O)CC(O)CC(O)(CC(O)C2C(O)=O)OC2C1 QGGFZZLFKABGNL-UHFFFAOYSA-N 0.000 description 2
- APKFDSVGJQXUKY-KKGHZKTASA-N Amphotericin-B Natural products O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1C=CC=CC=CC=CC=CC=CC=C[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-KKGHZKTASA-N 0.000 description 2
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 description 2
- 101150045895 Apela gene Proteins 0.000 description 2
- AMIQZQAAYGYKOP-FXQIFTODSA-N Arg-Ser-Asn Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O AMIQZQAAYGYKOP-FXQIFTODSA-N 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 206010003591 Ataxia Diseases 0.000 description 2
- 208000012657 Atopic disease Diseases 0.000 description 2
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 2
- 238000011752 CBA/J (JAX™ mouse strain) Methods 0.000 description 2
- 101100454808 Caenorhabditis elegans lgg-2 gene Proteins 0.000 description 2
- 102000014914 Carrier Proteins Human genes 0.000 description 2
- 206010007733 Catabolic state Diseases 0.000 description 2
- 208000015879 Cerebellar disease Diseases 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- 241000193403 Clostridium Species 0.000 description 2
- 108091033380 Coding strand Proteins 0.000 description 2
- 102000008186 Collagen Human genes 0.000 description 2
- 108010035532 Collagen Proteins 0.000 description 2
- 241000699800 Cricetinae Species 0.000 description 2
- 229920000858 Cyclodextrin Polymers 0.000 description 2
- RGHNJXZEOKUKBD-SQOUGZDYSA-N D-gluconic acid Chemical class OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O RGHNJXZEOKUKBD-SQOUGZDYSA-N 0.000 description 2
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 2
- 102000053602 DNA Human genes 0.000 description 2
- 238000001712 DNA sequencing Methods 0.000 description 2
- 201000004624 Dermatitis Diseases 0.000 description 2
- 206010012442 Dermatitis contact Diseases 0.000 description 2
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical class OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 2
- 229930182566 Gentamicin Natural products 0.000 description 2
- IALQAMYQJBZNSK-WHFBIAKZSA-N Gly-Ser-Asn Chemical compound [H]NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O IALQAMYQJBZNSK-WHFBIAKZSA-N 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- 239000007995 HEPES buffer Substances 0.000 description 2
- 239000012981 Hank's balanced salt solution Substances 0.000 description 2
- 206010019280 Heart failures Diseases 0.000 description 2
- 208000032843 Hemorrhage Diseases 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 206010020751 Hypersensitivity Diseases 0.000 description 2
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 241000880493 Leptailurus serval Species 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- FPQMQEOVSKMVMA-ACRUOGEOSA-N Lys-Tyr-Tyr Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)O)NC(=O)[C@H](CCCCN)N)O FPQMQEOVSKMVMA-ACRUOGEOSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 2
- 206010060880 Monoclonal gammopathy Diseases 0.000 description 2
- 208000016285 Movement disease Diseases 0.000 description 2
- 241000204031 Mycoplasma Species 0.000 description 2
- UFWIBTONFRDIAS-UHFFFAOYSA-N Naphthalene Chemical compound C1=CC=CC2=CC=CC=C21 UFWIBTONFRDIAS-UHFFFAOYSA-N 0.000 description 2
- 206010028851 Necrosis Diseases 0.000 description 2
- 229930193140 Neomycin Natural products 0.000 description 2
- 206010029164 Nephrotic syndrome Diseases 0.000 description 2
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 2
- 108700026244 Open Reading Frames Proteins 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 208000002774 Paraproteinemias Diseases 0.000 description 2
- 241001494479 Pecora Species 0.000 description 2
- 102000004270 Peptidyl-Dipeptidase A Human genes 0.000 description 2
- 108090000882 Peptidyl-Dipeptidase A Proteins 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 229920000954 Polyglycolide Polymers 0.000 description 2
- 206010036105 Polyneuropathy Diseases 0.000 description 2
- 102000007327 Protamines Human genes 0.000 description 2
- 108010007568 Protamines Proteins 0.000 description 2
- 206010037660 Pyrexia Diseases 0.000 description 2
- 230000006819 RNA synthesis Effects 0.000 description 2
- 208000012322 Raynaud phenomenon Diseases 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 206010063837 Reperfusion injury Diseases 0.000 description 2
- 241000219061 Rheum Species 0.000 description 2
- 206010039085 Rhinitis allergic Diseases 0.000 description 2
- 241000714474 Rous sarcoma virus Species 0.000 description 2
- 241000607142 Salmonella Species 0.000 description 2
- 206010040070 Septic Shock Diseases 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 208000003954 Spinal Muscular Atrophies of Childhood Diseases 0.000 description 2
- 206010051379 Systemic Inflammatory Response Syndrome Diseases 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- 208000001871 Tachycardia Diseases 0.000 description 2
- 108010006785 Taq Polymerase Proteins 0.000 description 2
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Chemical class [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 2
- YOOAQCZYZHGUAZ-KATARQTJSA-N Thr-Leu-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O YOOAQCZYZHGUAZ-KATARQTJSA-N 0.000 description 2
- DXPURPNJDFCKKO-RHYQMDGZSA-N Thr-Lys-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)[C@@H](C)O)C(O)=O DXPURPNJDFCKKO-RHYQMDGZSA-N 0.000 description 2
- 108010022394 Threonine synthase Proteins 0.000 description 2
- 101710101607 Toxic shock syndrome toxin-1 Proteins 0.000 description 2
- QUIXRGCMQOXUSV-SZMVWBNQSA-N Trp-Pro-Pro Chemical compound O=C([C@@H]1CCCN1C(=O)[C@H](CC=1C2=CC=CC=C2NC=1)N)N1CCC[C@H]1C(O)=O QUIXRGCMQOXUSV-SZMVWBNQSA-N 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 206010047115 Vasculitis Diseases 0.000 description 2
- 206010047400 Vibrio infections Diseases 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 2
- 240000008042 Zea mays Species 0.000 description 2
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 2
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 208000018254 acute transverse myelitis Diseases 0.000 description 2
- 239000011543 agarose gel Substances 0.000 description 2
- 150000001298 alcohols Chemical class 0.000 description 2
- 235000010443 alginic acid Nutrition 0.000 description 2
- 229920000615 alginic acid Polymers 0.000 description 2
- 208000026935 allergic disease Diseases 0.000 description 2
- 201000010105 allergic rhinitis Diseases 0.000 description 2
- 229960003896 aminopterin Drugs 0.000 description 2
- 229940009444 amphotericin Drugs 0.000 description 2
- 229960003942 amphotericin b Drugs 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- 229960000723 ampicillin Drugs 0.000 description 2
- 230000009830 antibody antigen interaction Effects 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 2
- 239000011668 ascorbic acid Chemical class 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 108010069205 aspartyl-phenylalanine Proteins 0.000 description 2
- 108010047857 aspartylglycine Proteins 0.000 description 2
- 238000000889 atomisation Methods 0.000 description 2
- 208000010668 atopic eczema Diseases 0.000 description 2
- WZSDNEJJUSYNSG-UHFFFAOYSA-N azocan-1-yl-(3,4,5-trimethoxyphenyl)methanone Chemical compound COC1=C(OC)C(OC)=CC(C(=O)N2CCCCCCC2)=C1 WZSDNEJJUSYNSG-UHFFFAOYSA-N 0.000 description 2
- 208000018300 basal ganglia disease Diseases 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- 229920001400 block copolymer Polymers 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 210000001124 body fluid Anatomy 0.000 description 2
- 239000010839 body fluid Substances 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 229940098773 bovine serum albumin Drugs 0.000 description 2
- 239000008366 buffered solution Substances 0.000 description 2
- 239000006172 buffering agent Substances 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 239000001569 carbon dioxide Substances 0.000 description 2
- 210000000845 cartilage Anatomy 0.000 description 2
- 239000005018 casein Substances 0.000 description 2
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 2
- 235000021240 caseins Nutrition 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- 125000003636 chemical group Chemical group 0.000 description 2
- 239000003638 chemical reducing agent Substances 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 235000012000 cholesterol Nutrition 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 235000015165 citric acid Nutrition 0.000 description 2
- 238000012761 co-transfection Methods 0.000 description 2
- 229920001436 collagen Polymers 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000013270 controlled release Methods 0.000 description 2
- 230000001086 cytosolic effect Effects 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 150000001991 dicarboxylic acids Chemical class 0.000 description 2
- 102000004419 dihydrofolate reductase Human genes 0.000 description 2
- MUCZHBLJLSDCSD-UHFFFAOYSA-N diisopropyl fluorophosphate Chemical compound CC(C)OP(F)(=O)OC(C)C MUCZHBLJLSDCSD-UHFFFAOYSA-N 0.000 description 2
- DGXRZJSPDXZJFG-UHFFFAOYSA-N docosanedioic acid Chemical compound OC(=O)CCCCCCCCCCCCCCCCCCCCC(O)=O DGXRZJSPDXZJFG-UHFFFAOYSA-N 0.000 description 2
- 230000005684 electric field Effects 0.000 description 2
- 208000030172 endocrine system disease Diseases 0.000 description 2
- 230000000688 enterotoxigenic effect Effects 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 201000001155 extrinsic allergic alveolitis Diseases 0.000 description 2
- 125000005313 fatty acid group Chemical group 0.000 description 2
- 230000001605 fetal effect Effects 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 235000013355 food flavoring agent Nutrition 0.000 description 2
- 235000003599 food sweetener Nutrition 0.000 description 2
- 238000007499 fusion processing Methods 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 229960002518 gentamicin Drugs 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 208000006454 hepatitis Diseases 0.000 description 2
- 231100000283 hepatitis Toxicity 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 208000022098 hypersensitivity pneumonitis Diseases 0.000 description 2
- VKOBVWXKNCXXDE-UHFFFAOYSA-N icosanoic acid Chemical compound CCCCCCCCCCCCCCCCCCCC(O)=O VKOBVWXKNCXXDE-UHFFFAOYSA-N 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 210000004201 immune sera Anatomy 0.000 description 2
- 229940042743 immune sera Drugs 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 238000011065 in-situ storage Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- FZWBNHMXJMCXLU-BLAUPYHCSA-N isomaltotriose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)O1 FZWBNHMXJMCXLU-BLAUPYHCSA-N 0.000 description 2
- 230000003902 lesion Effects 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 239000008176 lyophilized powder Substances 0.000 description 2
- 239000011777 magnesium Substances 0.000 description 2
- 235000019359 magnesium stearate Nutrition 0.000 description 2
- 235000009973 maize Nutrition 0.000 description 2
- 239000000845 maltitol Substances 0.000 description 2
- 235000010449 maltitol Nutrition 0.000 description 2
- VQHSOMBJVWLPSR-WUJBLJFYSA-N maltitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-WUJBLJFYSA-N 0.000 description 2
- 229940035436 maltitol Drugs 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 229940127554 medical product Drugs 0.000 description 2
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 2
- 230000002503 metabolic effect Effects 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 239000004005 microsphere Substances 0.000 description 2
- 150000002772 monosaccharides Chemical class 0.000 description 2
- 208000017972 multifocal atrial tachycardia Diseases 0.000 description 2
- 239000007923 nasal drop Substances 0.000 description 2
- 229940100662 nasal drops Drugs 0.000 description 2
- 230000017074 necrotic cell death Effects 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 229960004927 neomycin Drugs 0.000 description 2
- 238000006386 neutralization reaction Methods 0.000 description 2
- 210000000440 neutrophil Anatomy 0.000 description 2
- 239000002736 nonionic surfactant Substances 0.000 description 2
- BNJOQKFENDDGSC-UHFFFAOYSA-N octadecanedioic acid Chemical compound OC(=O)CCCCCCCCCCCCCCCCC(O)=O BNJOQKFENDDGSC-UHFFFAOYSA-N 0.000 description 2
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 2
- NOUWNNABOUGTDQ-UHFFFAOYSA-N octane Chemical compound CCCCCCC[CH2+] NOUWNNABOUGTDQ-UHFFFAOYSA-N 0.000 description 2
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 2
- 229920001542 oligosaccharide Polymers 0.000 description 2
- 150000002482 oligosaccharides Chemical class 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 201000005737 orchitis Diseases 0.000 description 2
- 125000000962 organic group Chemical group 0.000 description 2
- 230000003204 osmotic effect Effects 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 229940090048 pen injector Drugs 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 229940124531 pharmaceutical excipient Drugs 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- XNGIFLGASWRNHJ-UHFFFAOYSA-N phthalic acid Chemical compound OC(=O)C1=CC=CC=C1C(O)=O XNGIFLGASWRNHJ-UHFFFAOYSA-N 0.000 description 2
- 229940012957 plasmin Drugs 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical group [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 229920000747 poly(lactic acid) Polymers 0.000 description 2
- 229920001515 polyalkylene glycol Polymers 0.000 description 2
- 239000004633 polyglycolic acid Substances 0.000 description 2
- 239000004626 polylactic acid Substances 0.000 description 2
- 230000007824 polyneuropathy Effects 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 239000002244 precipitate Substances 0.000 description 2
- 108010066381 preproinsulin Proteins 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000000750 progressive effect Effects 0.000 description 2
- 229940048914 protamine Drugs 0.000 description 2
- 238000001243 protein synthesis Methods 0.000 description 2
- 238000003908 quality control method Methods 0.000 description 2
- 238000001525 receptor binding assay Methods 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 239000012146 running buffer Substances 0.000 description 2
- 201000000306 sarcoidosis Diseases 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 239000006152 selective media Substances 0.000 description 2
- 238000013207 serial dilution Methods 0.000 description 2
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 2
- 229910000029 sodium carbonate Inorganic materials 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 230000037439 somatic mutation Effects 0.000 description 2
- 239000007921 spray Substances 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 239000012089 stop solution Substances 0.000 description 2
- TYFQFVWCELRYAO-UHFFFAOYSA-N suberic acid Chemical compound OC(=O)CCCCCCC(O)=O TYFQFVWCELRYAO-UHFFFAOYSA-N 0.000 description 2
- 229910052717 sulfur Inorganic materials 0.000 description 2
- 239000013589 supplement Substances 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 239000003765 sweetening agent Substances 0.000 description 2
- 238000010189 synthetic method Methods 0.000 description 2
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- 230000006794 tachycardia Effects 0.000 description 2
- 239000011975 tartaric acid Chemical class 0.000 description 2
- 235000002906 tartaric acid Nutrition 0.000 description 2
- HQHCYKULIHKCEB-UHFFFAOYSA-N tetradecanedioic acid Chemical compound OC(=O)CCCCCCCCCCCCC(O)=O HQHCYKULIHKCEB-UHFFFAOYSA-N 0.000 description 2
- TUNFSRHWOTWDNC-UHFFFAOYSA-N tetradecanoic acid Chemical compound CCCCCCCCCCCCCC(O)=O TUNFSRHWOTWDNC-UHFFFAOYSA-N 0.000 description 2
- 229940104230 thymidine Drugs 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 230000014621 translational initiation Effects 0.000 description 2
- 208000009174 transverse myelitis Diseases 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 238000003211 trypan blue cell staining Methods 0.000 description 2
- 241001430294 unidentified retrovirus Species 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 239000012808 vapor phase Substances 0.000 description 2
- 210000003556 vascular endothelial cell Anatomy 0.000 description 2
- 229920002554 vinyl polymer Polymers 0.000 description 2
- 208000016261 weight loss Diseases 0.000 description 2
- 230000004580 weight loss Effects 0.000 description 2
- 239000002023 wood Substances 0.000 description 2
- 239000000811 xylitol Substances 0.000 description 2
- 235000010447 xylitol Nutrition 0.000 description 2
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 2
- 229960002675 xylitol Drugs 0.000 description 2
- MJIBOYFUEIDNPI-HBNMXAOGSA-L zinc 5-[2,3-dihydroxy-5-[(2R,3R,4S,5R,6S)-4,5,6-tris[[3,4-dihydroxy-5-(3,4,5-trihydroxybenzoyl)oxybenzoyl]oxy]-2-[[3,4-dihydroxy-5-(3,4,5-trihydroxybenzoyl)oxybenzoyl]oxymethyl]oxan-3-yl]oxycarbonylphenoxy]carbonyl-3-hydroxybenzene-1,2-diolate Chemical class [Zn++].Oc1cc(cc(O)c1O)C(=O)Oc1cc(cc(O)c1O)C(=O)OC[C@H]1O[C@@H](OC(=O)c2cc(O)c(O)c(OC(=O)c3cc(O)c(O)c(O)c3)c2)[C@H](OC(=O)c2cc(O)c(O)c(OC(=O)c3cc(O)c(O)c(O)c3)c2)[C@@H](OC(=O)c2cc(O)c(O)c(OC(=O)c3cc(O)c(O)c(O)c3)c2)[C@@H]1OC(=O)c1cc(O)c(O)c(OC(=O)c2cc(O)c([O-])c([O-])c2)c1 MJIBOYFUEIDNPI-HBNMXAOGSA-L 0.000 description 2
- IZUAHLHTQJCCLJ-UHFFFAOYSA-N (2-chloro-1,1,2,2-tetrafluoroethyl) hypochlorite Chemical compound FC(F)(Cl)C(F)(F)OCl IZUAHLHTQJCCLJ-UHFFFAOYSA-N 0.000 description 1
- OOIBFPKQHULHSQ-UHFFFAOYSA-N (3-hydroxy-1-adamantyl) 2-methylprop-2-enoate Chemical compound C1C(C2)CC3CC2(O)CC1(OC(=O)C(=C)C)C3 OOIBFPKQHULHSQ-UHFFFAOYSA-N 0.000 description 1
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- FFJCNSLCJOQHKM-CLFAGFIQSA-N (z)-1-[(z)-octadec-9-enoxy]octadec-9-ene Chemical compound CCCCCCCC\C=C/CCCCCCCCOCCCCCCCC\C=C/CCCCCCCC FFJCNSLCJOQHKM-CLFAGFIQSA-N 0.000 description 1
- YFMFNYKEUDLDTL-UHFFFAOYSA-N 1,1,1,2,3,3,3-heptafluoropropane Chemical compound FC(F)(F)C(F)C(F)(F)F YFMFNYKEUDLDTL-UHFFFAOYSA-N 0.000 description 1
- 150000005207 1,3-dihydroxybenzenes Chemical class 0.000 description 1
- TUSDEZXZIZRFGC-UHFFFAOYSA-N 1-O-galloyl-3,6-(R)-HHDP-beta-D-glucose Natural products OC1C(O2)COC(=O)C3=CC(O)=C(O)C(O)=C3C3=C(O)C(O)=C(O)C=C3C(=O)OC1C(O)C2OC(=O)C1=CC(O)=C(O)C(O)=C1 TUSDEZXZIZRFGC-UHFFFAOYSA-N 0.000 description 1
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- OHMHBGPWCHTMQE-UHFFFAOYSA-N 2,2-dichloro-1,1,1-trifluoroethane Chemical compound FC(F)(F)C(Cl)Cl OHMHBGPWCHTMQE-UHFFFAOYSA-N 0.000 description 1
- HBEDSQVIWPRPAY-UHFFFAOYSA-N 2,3-dihydrobenzofuran Chemical compound C1=CC=C2OCCC2=C1 HBEDSQVIWPRPAY-UHFFFAOYSA-N 0.000 description 1
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical compound O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 1
- HVAUUPRFYPCOCA-AREMUKBSSA-N 2-O-acetyl-1-O-hexadecyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCCOC[C@@H](OC(C)=O)COP([O-])(=O)OCC[N+](C)(C)C HVAUUPRFYPCOCA-AREMUKBSSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- QCDWFXQBSFUVSP-UHFFFAOYSA-N 2-phenoxyethanol Chemical compound OCCOC1=CC=CC=C1 QCDWFXQBSFUVSP-UHFFFAOYSA-N 0.000 description 1
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 1
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N 4-hydroxybenzoic acid Chemical compound OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 108020005029 5' Flanking Region Proteins 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 1
- 206010065040 AIDS dementia complex Diseases 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 208000009304 Acute Kidney Injury Diseases 0.000 description 1
- 206010000830 Acute leukaemia Diseases 0.000 description 1
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 206010001052 Acute respiratory distress syndrome Diseases 0.000 description 1
- 208000026872 Addison Disease Diseases 0.000 description 1
- 241000607516 Aeromonas caviae Species 0.000 description 1
- 241000607528 Aeromonas hydrophila Species 0.000 description 1
- 241000607522 Aeromonas sobria Species 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- BUDNAJYVCUHLSV-ZLUOBGJFSA-N Ala-Asp-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O BUDNAJYVCUHLSV-ZLUOBGJFSA-N 0.000 description 1
- FUSPCLTUKXQREV-ACZMJKKPSA-N Ala-Glu-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O FUSPCLTUKXQREV-ACZMJKKPSA-N 0.000 description 1
- PAIHPOGPJVUFJY-WDSKDSINSA-N Ala-Glu-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O PAIHPOGPJVUFJY-WDSKDSINSA-N 0.000 description 1
- PUBLUECXJRHTBK-ACZMJKKPSA-N Ala-Glu-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O PUBLUECXJRHTBK-ACZMJKKPSA-N 0.000 description 1
- RDIKFPRVLJLMER-BQBZGAKWSA-N Ala-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C)N RDIKFPRVLJLMER-BQBZGAKWSA-N 0.000 description 1
- MAEQBGQTDWDSJQ-LSJOCFKGSA-N Ala-Met-His Chemical compound C[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N MAEQBGQTDWDSJQ-LSJOCFKGSA-N 0.000 description 1
- BFMIRJBURUXDRG-DLOVCJGASA-N Ala-Phe-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CC1=CC=CC=C1 BFMIRJBURUXDRG-DLOVCJGASA-N 0.000 description 1
- WNHNMKOFKCHKKD-BFHQHQDPSA-N Ala-Thr-Gly Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O WNHNMKOFKCHKKD-BFHQHQDPSA-N 0.000 description 1
- REWSWYIDQIELBE-FXQIFTODSA-N Ala-Val-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O REWSWYIDQIELBE-FXQIFTODSA-N 0.000 description 1
- ZDILXFDENZVOTL-BPNCWPANSA-N Ala-Val-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O ZDILXFDENZVOTL-BPNCWPANSA-N 0.000 description 1
- 208000007848 Alcoholism Diseases 0.000 description 1
- 208000035285 Allergic Seasonal Rhinitis Diseases 0.000 description 1
- 201000004384 Alopecia Diseases 0.000 description 1
- 206010002383 Angina Pectoris Diseases 0.000 description 1
- 206010002388 Angina unstable Diseases 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 108010039627 Aprotinin Proteins 0.000 description 1
- YZXBAPSDXZZRGB-DOFZRALJSA-M Arachidonate Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC([O-])=O YZXBAPSDXZZRGB-DOFZRALJSA-M 0.000 description 1
- GIVATXIGCXFQQA-FXQIFTODSA-N Arg-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCN=C(N)N GIVATXIGCXFQQA-FXQIFTODSA-N 0.000 description 1
- XVLLUZMFSAYKJV-GUBZILKMSA-N Arg-Asp-Arg Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O XVLLUZMFSAYKJV-GUBZILKMSA-N 0.000 description 1
- NXDXECQFKHXHAM-HJGDQZAQSA-N Arg-Glu-Thr Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O NXDXECQFKHXHAM-HJGDQZAQSA-N 0.000 description 1
- IZSMEUDYADKZTJ-KJEVXHAQSA-N Arg-Tyr-Thr Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O IZSMEUDYADKZTJ-KJEVXHAQSA-N 0.000 description 1
- 200000000007 Arterial disease Diseases 0.000 description 1
- 206010003210 Arteriosclerosis Diseases 0.000 description 1
- 206010003226 Arteriovenous fistula Diseases 0.000 description 1
- 206010053555 Arthritis bacterial Diseases 0.000 description 1
- 208000006740 Aseptic Meningitis Diseases 0.000 description 1
- JJGRJMKUOYXZRA-LPEHRKFASA-N Asn-Arg-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(=O)N)N)C(=O)O JJGRJMKUOYXZRA-LPEHRKFASA-N 0.000 description 1
- LWXJVHTUEDHDLG-XUXIUFHCSA-N Asn-Leu-Leu-Ser Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O LWXJVHTUEDHDLG-XUXIUFHCSA-N 0.000 description 1
- UGXYFDQFLVCDFC-CIUDSAMLSA-N Asn-Ser-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O UGXYFDQFLVCDFC-CIUDSAMLSA-N 0.000 description 1
- JBDLMLZNDRLDIX-HJGDQZAQSA-N Asn-Thr-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O JBDLMLZNDRLDIX-HJGDQZAQSA-N 0.000 description 1
- NZWDWXSWUQCNMG-GARJFASQSA-N Asp-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)N)C(=O)O NZWDWXSWUQCNMG-GARJFASQSA-N 0.000 description 1
- NWAHPBGBDIFUFD-KKUMJFAQSA-N Asp-Tyr-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(O)=O NWAHPBGBDIFUFD-KKUMJFAQSA-N 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 108010011485 Aspartame Proteins 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 206010003658 Atrial Fibrillation Diseases 0.000 description 1
- 208000002102 Atrial Premature Complexes Diseases 0.000 description 1
- 206010003662 Atrial flutter Diseases 0.000 description 1
- 206010003671 Atrioventricular Block Diseases 0.000 description 1
- XHVAWZZCDCWGBK-WYRLRVFGSA-M Aurothioglucose Chemical compound OC[C@H]1O[C@H](S[Au])[C@H](O)[C@@H](O)[C@@H]1O XHVAWZZCDCWGBK-WYRLRVFGSA-M 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 208000037157 Azotemia Diseases 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000031729 Bacteremia Diseases 0.000 description 1
- 231100000699 Bacterial toxin Toxicity 0.000 description 1
- KWIUHFFTVRNATP-UHFFFAOYSA-N Betaine Natural products C[N+](C)(C)CC([O-])=O KWIUHFFTVRNATP-UHFFFAOYSA-N 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 1
- 208000006386 Bone Resorption Diseases 0.000 description 1
- 206010006002 Bone pain Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 206010006578 Bundle-Branch Block Diseases 0.000 description 1
- 208000011691 Burkitt lymphomas Diseases 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- 206010007559 Cardiac failure congestive Diseases 0.000 description 1
- 208000031229 Cardiomyopathies Diseases 0.000 description 1
- 102000011632 Caseins Human genes 0.000 description 1
- 108010076119 Caseins Proteins 0.000 description 1
- 102000016289 Cell Adhesion Molecules Human genes 0.000 description 1
- 108010067225 Cell Adhesion Molecules Proteins 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 229920002101 Chitin Polymers 0.000 description 1
- 229920001661 Chitosan Polymers 0.000 description 1
- 108020004998 Chloroplast DNA Proteins 0.000 description 1
- 108020005133 Chloroplast RNA Proteins 0.000 description 1
- 206010008631 Cholera Diseases 0.000 description 1
- 206010008748 Chorea Diseases 0.000 description 1
- 206010008909 Chronic Hepatitis Diseases 0.000 description 1
- 208000006545 Chronic Obstructive Pulmonary Disease Diseases 0.000 description 1
- 241000193155 Clostridium botulinum Species 0.000 description 1
- 241000193468 Clostridium perfringens Species 0.000 description 1
- 101100007328 Cocos nucifera COS-1 gene Proteins 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 206010056370 Congestive cardiomyopathy Diseases 0.000 description 1
- 206010010741 Conjunctivitis Diseases 0.000 description 1
- 206010010744 Conjunctivitis allergic Diseases 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 201000006306 Cor pulmonale Diseases 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 208000020406 Creutzfeldt Jacob disease Diseases 0.000 description 1
- 208000003407 Creutzfeldt-Jakob Syndrome Diseases 0.000 description 1
- 208000010859 Creutzfeldt-Jakob disease Diseases 0.000 description 1
- 241001559589 Cullen Species 0.000 description 1
- 206010011703 Cyanosis Diseases 0.000 description 1
- SZQCDCKIGWQAQN-FXQIFTODSA-N Cys-Arg-Ala Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O SZQCDCKIGWQAQN-FXQIFTODSA-N 0.000 description 1
- 201000003883 Cystic fibrosis Diseases 0.000 description 1
- GUBGYTABKSRVRQ-CUHNMECISA-N D-Cellobiose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-CUHNMECISA-N 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- RGHNJXZEOKUKBD-UHFFFAOYSA-N D-gluconic acid Chemical class OCC(O)C(O)C(O)C(O)C(O)=O RGHNJXZEOKUKBD-UHFFFAOYSA-N 0.000 description 1
- QWIZNVHXZXRPDR-UHFFFAOYSA-N D-melezitose Natural products O1C(CO)C(O)C(O)C(O)C1OC1C(O)C(CO)OC1(CO)OC1OC(CO)C(O)C(O)C1O QWIZNVHXZXRPDR-UHFFFAOYSA-N 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 208000006313 Delayed Hypersensitivity Diseases 0.000 description 1
- 206010067889 Dementia with Lewy bodies Diseases 0.000 description 1
- 208000016192 Demyelinating disease Diseases 0.000 description 1
- 206010012310 Dengue fever Diseases 0.000 description 1
- 206010012689 Diabetic retinopathy Diseases 0.000 description 1
- 239000004338 Dichlorodifluoromethane Substances 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 208000002251 Dissecting Aneurysm Diseases 0.000 description 1
- 102000015554 Dopamine receptor Human genes 0.000 description 1
- 108050004812 Dopamine receptor Proteins 0.000 description 1
- 201000010374 Down Syndrome Diseases 0.000 description 1
- 241001269524 Dura Species 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 201000009273 Endometriosis Diseases 0.000 description 1
- 108010042407 Endonucleases Proteins 0.000 description 1
- 108010067770 Endopeptidase K Proteins 0.000 description 1
- 208000037487 Endotoxemia Diseases 0.000 description 1
- 206010014824 Endotoxic shock Diseases 0.000 description 1
- 101710146739 Enterotoxin Proteins 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241001131785 Escherichia coli HB101 Species 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 206010073306 Exposure to radiation Diseases 0.000 description 1
- 239000001263 FEMA 3042 Substances 0.000 description 1
- 208000004248 Familial Primary Pulmonary Hypertension Diseases 0.000 description 1
- 208000002633 Febrile Neutropenia Diseases 0.000 description 1
- 206010016654 Fibrosis Diseases 0.000 description 1
- 229920001917 Ficoll Polymers 0.000 description 1
- 208000024412 Friedreich ataxia Diseases 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- 206010017533 Fungal infection Diseases 0.000 description 1
- 206010058872 Fungal sepsis Diseases 0.000 description 1
- 201000000628 Gas Gangrene Diseases 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- FHPXTPQBODWBIY-CIUDSAMLSA-N Glu-Ala-Arg Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O FHPXTPQBODWBIY-CIUDSAMLSA-N 0.000 description 1
- AVZHGSCDKIQZPQ-CIUDSAMLSA-N Glu-Arg-Ala Chemical compound C[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CCC(O)=O)C(O)=O AVZHGSCDKIQZPQ-CIUDSAMLSA-N 0.000 description 1
- PAQUJCSYVIBPLC-AVGNSLFASA-N Glu-Asp-Phe Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 PAQUJCSYVIBPLC-AVGNSLFASA-N 0.000 description 1
- MIWJDJAMMKHUAR-ZVZYQTTQSA-N Glu-Trp-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)NC(=O)[C@H](CCC(=O)O)N MIWJDJAMMKHUAR-ZVZYQTTQSA-N 0.000 description 1
- LURCIJSJAKFCRO-QWRGUYRKSA-N Gly-Asn-Tyr Chemical compound [H]NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O LURCIJSJAKFCRO-QWRGUYRKSA-N 0.000 description 1
- IWAXHBCACVWNHT-BQBZGAKWSA-N Gly-Asp-Arg Chemical compound NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCCN=C(N)N IWAXHBCACVWNHT-BQBZGAKWSA-N 0.000 description 1
- UEGIPZAXNBYCCP-NKWVEPMBSA-N Gly-Cys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CS)NC(=O)CN)C(=O)O UEGIPZAXNBYCCP-NKWVEPMBSA-N 0.000 description 1
- WNZOCXUOGVYYBJ-CDMKHQONSA-N Gly-Phe-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)CN)O WNZOCXUOGVYYBJ-CDMKHQONSA-N 0.000 description 1
- NSVOVKWEKGEOQB-LURJTMIESA-N Gly-Pro-Gly Chemical compound NCC(=O)N1CCC[C@H]1C(=O)NCC(O)=O NSVOVKWEKGEOQB-LURJTMIESA-N 0.000 description 1
- FKYQEVBRZSFAMJ-QWRGUYRKSA-N Gly-Ser-Tyr Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 FKYQEVBRZSFAMJ-QWRGUYRKSA-N 0.000 description 1
- NVTPVQLIZCOJFK-FOHZUACHSA-N Gly-Thr-Asp Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O NVTPVQLIZCOJFK-FOHZUACHSA-N 0.000 description 1
- BNMRSWQOHIQTFL-JSGCOSHPSA-N Gly-Val-Phe Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 BNMRSWQOHIQTFL-JSGCOSHPSA-N 0.000 description 1
- 208000009329 Graft vs Host Disease Diseases 0.000 description 1
- 206010018691 Granuloma Diseases 0.000 description 1
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 1
- 208000003807 Graves Disease Diseases 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 241000989913 Gunnera petaloidea Species 0.000 description 1
- 208000031886 HIV Infections Diseases 0.000 description 1
- 208000037357 HIV infectious disease Diseases 0.000 description 1
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 1
- 206010019315 Heart transplant rejection Diseases 0.000 description 1
- 101710121697 Heat-stable enterotoxin Proteins 0.000 description 1
- 208000032759 Hemolytic-Uremic Syndrome Diseases 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 206010019755 Hepatitis chronic active Diseases 0.000 description 1
- 208000002972 Hepatolenticular Degeneration Diseases 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- 208000002291 Histiocytic Sarcoma Diseases 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000690301 Homo sapiens Aldo-keto reductase family 1 member C4 Proteins 0.000 description 1
- 101001116548 Homo sapiens Protein CBFA2T1 Proteins 0.000 description 1
- 101000801228 Homo sapiens Tumor necrosis factor receptor superfamily member 1A Proteins 0.000 description 1
- 108010000521 Human Growth Hormone Proteins 0.000 description 1
- 102000002265 Human Growth Hormone Human genes 0.000 description 1
- 239000000854 Human Growth Hormone Substances 0.000 description 1
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 208000023105 Huntington disease Diseases 0.000 description 1
- 206010020584 Hypercalcaemia of malignancy Diseases 0.000 description 1
- 208000000269 Hyperkinesis Diseases 0.000 description 1
- 206010020772 Hypertension Diseases 0.000 description 1
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 description 1
- 108700002232 Immediate-Early Genes Proteins 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 1
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 1
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 1
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 1
- 208000004575 Infectious Arthritis Diseases 0.000 description 1
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
- 206010022004 Influenza like illness Diseases 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 206010022491 Insulin resistant diabetes Diseases 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 206010022941 Iridocyclitis Diseases 0.000 description 1
- 208000032382 Ischaemic stroke Diseases 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 208000011200 Kawasaki disease Diseases 0.000 description 1
- 206010023439 Kidney transplant rejection Diseases 0.000 description 1
- 241000588748 Klebsiella Species 0.000 description 1
- 208000006264 Korsakoff syndrome Diseases 0.000 description 1
- LKDRXBCSQODPBY-AMVSKUEXSA-N L-(-)-Sorbose Chemical compound OCC1(O)OC[C@H](O)[C@@H](O)[C@@H]1O LKDRXBCSQODPBY-AMVSKUEXSA-N 0.000 description 1
- UGTHTQWIQKEDEH-BQBZGAKWSA-N L-alanyl-L-prolylglycine zwitterion Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O UGTHTQWIQKEDEH-BQBZGAKWSA-N 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 241000589248 Legionella Species 0.000 description 1
- 208000007764 Legionnaires' Disease Diseases 0.000 description 1
- 208000004554 Leishmaniasis Diseases 0.000 description 1
- 206010024229 Leprosy Diseases 0.000 description 1
- HQUXQAMSWFIRET-AVGNSLFASA-N Leu-Glu-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN HQUXQAMSWFIRET-AVGNSLFASA-N 0.000 description 1
- IEWBEPKLKUXQBU-VOAKCMCISA-N Leu-Leu-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O IEWBEPKLKUXQBU-VOAKCMCISA-N 0.000 description 1
- IRMLZWSRWSGTOP-CIUDSAMLSA-N Leu-Ser-Ala Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O IRMLZWSRWSGTOP-CIUDSAMLSA-N 0.000 description 1
- KIZIOFNVSOSKJI-CIUDSAMLSA-N Leu-Ser-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)N KIZIOFNVSOSKJI-CIUDSAMLSA-N 0.000 description 1
- SBANPBVRHYIMRR-GARJFASQSA-N Leu-Ser-Pro Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CO)C(=O)N1CCC[C@@H]1C(=O)O)N SBANPBVRHYIMRR-GARJFASQSA-N 0.000 description 1
- SBANPBVRHYIMRR-UHFFFAOYSA-N Leu-Ser-Pro Natural products CC(C)CC(N)C(=O)NC(CO)C(=O)N1CCCC1C(O)=O SBANPBVRHYIMRR-UHFFFAOYSA-N 0.000 description 1
- 208000009829 Lewy Body Disease Diseases 0.000 description 1
- 206010024558 Lip oedema Diseases 0.000 description 1
- 208000007021 Lipedema Diseases 0.000 description 1
- 206010024715 Liver transplant rejection Diseases 0.000 description 1
- 208000019693 Lung disease Diseases 0.000 description 1
- 206010051604 Lung transplant rejection Diseases 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- 208000035809 Lymphohistiocytosis Diseases 0.000 description 1
- HGNRJCINZYHNOU-LURJTMIESA-N Lys-Gly Chemical compound NCCCC[C@H](N)C(=O)NCC(O)=O HGNRJCINZYHNOU-LURJTMIESA-N 0.000 description 1
- GQZMPWBZQALKJO-UWVGGRQHSA-N Lys-Gly-Arg Chemical compound [H]N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O GQZMPWBZQALKJO-UWVGGRQHSA-N 0.000 description 1
- GQFDWEDHOQRNLC-QWRGUYRKSA-N Lys-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN GQFDWEDHOQRNLC-QWRGUYRKSA-N 0.000 description 1
- WZVSHTFTCYOFPL-GARJFASQSA-N Lys-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CCCCN)N)C(=O)O WZVSHTFTCYOFPL-GARJFASQSA-N 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 1
- 229920002774 Maltodextrin Polymers 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 201000009906 Meningitis Diseases 0.000 description 1
- 206010027201 Meningitis aseptic Diseases 0.000 description 1
- 206010058858 Meningococcal bacteraemia Diseases 0.000 description 1
- FVKRQMQQFGBXHV-QXEWZRGKSA-N Met-Asp-Val Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O FVKRQMQQFGBXHV-QXEWZRGKSA-N 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical group CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 208000019695 Migraine disease Diseases 0.000 description 1
- 108020005196 Mitochondrial DNA Proteins 0.000 description 1
- 208000003250 Mixed connective tissue disease Diseases 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 101100278853 Mus musculus Dhfr gene Proteins 0.000 description 1
- 241000545499 Mycobacterium avium-intracellulare Species 0.000 description 1
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 1
- 208000031888 Mycoses Diseases 0.000 description 1
- 201000002481 Myositis Diseases 0.000 description 1
- KWIUHFFTVRNATP-UHFFFAOYSA-O N,N,N-trimethylglycinium Chemical compound C[N+](C)(C)CC(O)=O KWIUHFFTVRNATP-UHFFFAOYSA-O 0.000 description 1
- 108010079364 N-glycylalanine Proteins 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 208000002454 Nasopharyngeal Carcinoma Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 241001045988 Neogene Species 0.000 description 1
- IOVCWXUNBOPUCH-UHFFFAOYSA-M Nitrite anion Chemical compound [O-]N=O IOVCWXUNBOPUCH-UHFFFAOYSA-M 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 208000003435 Optic Neuritis Diseases 0.000 description 1
- 208000001132 Osteoporosis Diseases 0.000 description 1
- 238000009004 PCR Kit Methods 0.000 description 1
- 206010053869 POEMS syndrome Diseases 0.000 description 1
- 241000282577 Pan troglodytes Species 0.000 description 1
- 206010049169 Pancreas transplant rejection Diseases 0.000 description 1
- 206010033645 Pancreatitis Diseases 0.000 description 1
- 206010033647 Pancreatitis acute Diseases 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 206010033799 Paralysis Diseases 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- 229920002230 Pectic acid Polymers 0.000 description 1
- 208000029082 Pelvic Inflammatory Disease Diseases 0.000 description 1
- 241000721454 Pemphigus Species 0.000 description 1
- LRBQNJMCXXYXIU-PPKXGCFTSA-N Penta-digallate-beta-D-glucose Natural products OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@@H]2[C@H]([C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-PPKXGCFTSA-N 0.000 description 1
- BYPFEZZEUUWMEJ-UHFFFAOYSA-N Pentoxifylline Chemical compound O=C1N(CCCCC(=O)C)C(=O)N(C)C2=C1N(C)C=N2 BYPFEZZEUUWMEJ-UHFFFAOYSA-N 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 208000025584 Pericardial disease Diseases 0.000 description 1
- 208000005764 Peripheral Arterial Disease Diseases 0.000 description 1
- 208000018262 Peripheral vascular disease Diseases 0.000 description 1
- 208000031845 Pernicious anaemia Diseases 0.000 description 1
- 241000286209 Phasianidae Species 0.000 description 1
- BPCLGWHVPVTTFM-QWRGUYRKSA-N Phe-Ser-Gly Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)NCC(O)=O BPCLGWHVPVTTFM-QWRGUYRKSA-N 0.000 description 1
- MCIXMYKSPQUMJG-SRVKXCTJSA-N Phe-Ser-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O MCIXMYKSPQUMJG-SRVKXCTJSA-N 0.000 description 1
- KLYYKKGCPOGDPE-OEAJRASXSA-N Phe-Thr-Leu Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O KLYYKKGCPOGDPE-OEAJRASXSA-N 0.000 description 1
- BPIMVBKDLSBKIJ-FCLVOEFKSA-N Phe-Thr-Phe Chemical compound C([C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 BPIMVBKDLSBKIJ-FCLVOEFKSA-N 0.000 description 1
- 102000011755 Phosphoglycerate Kinase Human genes 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- 108010003541 Platelet Activating Factor Proteins 0.000 description 1
- 241000606999 Plesiomonas shigelloides Species 0.000 description 1
- 208000005384 Pneumocystis Pneumonia Diseases 0.000 description 1
- 206010073755 Pneumocystis jirovecii pneumonia Diseases 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 108010020346 Polyglutamic Acid Proteins 0.000 description 1
- 229920001273 Polyhydroxy acid Polymers 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 229920001219 Polysorbate 40 Polymers 0.000 description 1
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 1
- VXCHGLYSIOOZIS-GUBZILKMSA-N Pro-Ala-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1 VXCHGLYSIOOZIS-GUBZILKMSA-N 0.000 description 1
- NMELOOXSGDRBRU-YUMQZZPRSA-N Pro-Glu-Gly Chemical compound OC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H]1CCCN1 NMELOOXSGDRBRU-YUMQZZPRSA-N 0.000 description 1
- DIDLUFMLRUJLFB-FKBYEOEOSA-N Pro-Trp-Tyr Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CC2=CNC3=CC=CC=C32)C(=O)N[C@@H](CC4=CC=C(C=C4)O)C(=O)O DIDLUFMLRUJLFB-FKBYEOEOSA-N 0.000 description 1
- 238000012356 Product development Methods 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 108010001267 Protein Subunits Proteins 0.000 description 1
- 102000002067 Protein Subunits Human genes 0.000 description 1
- 208000032225 Proximal spinal muscular atrophy type 1 Diseases 0.000 description 1
- 208000033526 Proximal spinal muscular atrophy type 3 Diseases 0.000 description 1
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- 208000004186 Pulmonary Heart Disease Diseases 0.000 description 1
- 206010064911 Pulmonary arterial hypertension Diseases 0.000 description 1
- 108020005067 RNA Splice Sites Proteins 0.000 description 1
- 239000013614 RNA sample Substances 0.000 description 1
- 239000012979 RPMI medium Substances 0.000 description 1
- 208000003782 Raynaud disease Diseases 0.000 description 1
- 208000005587 Refsum Disease Diseases 0.000 description 1
- 208000033626 Renal failure acute Diseases 0.000 description 1
- 201000003099 Renovascular Hypertension Diseases 0.000 description 1
- 208000013616 Respiratory Distress Syndrome Diseases 0.000 description 1
- 206010038748 Restrictive cardiomyopathy Diseases 0.000 description 1
- 206010039094 Rhinitis perennial Diseases 0.000 description 1
- 101710141795 Ribonuclease inhibitor Proteins 0.000 description 1
- 229940122208 Ribonuclease inhibitor Drugs 0.000 description 1
- 102100037968 Ribonuclease inhibitor Human genes 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 238000011579 SCID mouse model Methods 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 241001354013 Salmonella enterica subsp. enterica serovar Enteritidis Species 0.000 description 1
- 241000293871 Salmonella enterica subsp. enterica serovar Typhi Species 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 206010039710 Scleroderma Diseases 0.000 description 1
- 206010039966 Senile dementia Diseases 0.000 description 1
- 108091081021 Sense strand Proteins 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 206010053879 Sepsis syndrome Diseases 0.000 description 1
- BTKUIVBNGBFTTP-WHFBIAKZSA-N Ser-Ala-Gly Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(O)=O BTKUIVBNGBFTTP-WHFBIAKZSA-N 0.000 description 1
- RZEQTVHJZCIUBT-WDSKDSINSA-N Ser-Arg Chemical compound OC[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=N RZEQTVHJZCIUBT-WDSKDSINSA-N 0.000 description 1
- QEDMOZUJTGEIBF-FXQIFTODSA-N Ser-Arg-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(O)=O QEDMOZUJTGEIBF-FXQIFTODSA-N 0.000 description 1
- OBXVZEAMXFSGPU-FXQIFTODSA-N Ser-Asn-Arg Chemical compound C(C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CO)N)CN=C(N)N OBXVZEAMXFSGPU-FXQIFTODSA-N 0.000 description 1
- UIGMAMGZOJVTDN-WHFBIAKZSA-N Ser-Gly-Ser Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O UIGMAMGZOJVTDN-WHFBIAKZSA-N 0.000 description 1
- QYSFWUIXDFJUDW-DCAQKATOSA-N Ser-Leu-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O QYSFWUIXDFJUDW-DCAQKATOSA-N 0.000 description 1
- UGTZYIPOBYXWRW-SRVKXCTJSA-N Ser-Phe-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O UGTZYIPOBYXWRW-SRVKXCTJSA-N 0.000 description 1
- ADJDNJCSPNFFPI-FXQIFTODSA-N Ser-Pro-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CO ADJDNJCSPNFFPI-FXQIFTODSA-N 0.000 description 1
- BMKNXTJLHFIAAH-CIUDSAMLSA-N Ser-Ser-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O BMKNXTJLHFIAAH-CIUDSAMLSA-N 0.000 description 1
- DKGRNFUXVTYRAS-UBHSHLNASA-N Ser-Ser-Trp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O DKGRNFUXVTYRAS-UBHSHLNASA-N 0.000 description 1
- QNBVFKZSSRYNFX-CUJWVEQBSA-N Ser-Thr-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CO)N)O QNBVFKZSSRYNFX-CUJWVEQBSA-N 0.000 description 1
- GSCVDSBEYVGMJQ-SRVKXCTJSA-N Ser-Tyr-Asp Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CO)N)O GSCVDSBEYVGMJQ-SRVKXCTJSA-N 0.000 description 1
- JGUWRQWULDWNCM-FXQIFTODSA-N Ser-Val-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O JGUWRQWULDWNCM-FXQIFTODSA-N 0.000 description 1
- 206010062164 Seronegative arthritis Diseases 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 208000009714 Severe Dengue Diseases 0.000 description 1
- 108010079723 Shiga Toxin Proteins 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- 241000607766 Shigella boydii Species 0.000 description 1
- 241000607764 Shigella dysenteriae Species 0.000 description 1
- 241000607762 Shigella flexneri Species 0.000 description 1
- 241000607760 Shigella sonnei Species 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 244000061456 Solanum tuberosum Species 0.000 description 1
- 235000002595 Solanum tuberosum Nutrition 0.000 description 1
- 239000004147 Sorbitan trioleate Substances 0.000 description 1
- PRXRUNOAOLTIEF-ADSICKODSA-N Sorbitan trioleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCC\C=C/CCCCCCCC)[C@H]1OC[C@H](O)[C@H]1OC(=O)CCCCCCC\C=C/CCCCCCCC PRXRUNOAOLTIEF-ADSICKODSA-N 0.000 description 1
- 208000010112 Spinocerebellar Degenerations Diseases 0.000 description 1
- 101100289792 Squirrel monkey polyomavirus large T gene Proteins 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 241000193996 Streptococcus pyogenes Species 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- 208000037065 Subacute sclerosing leukoencephalitis Diseases 0.000 description 1
- 206010042297 Subacute sclerosing panencephalitis Diseases 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Chemical class OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 208000004732 Systemic Vasculitis Diseases 0.000 description 1
- 101150104425 T4 gene Proteins 0.000 description 1
- 241000188156 Tamu Species 0.000 description 1
- 206010043189 Telangiectasia Diseases 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- UWHCKJMYHZGTIT-UHFFFAOYSA-N Tetraethylene glycol, Natural products OCCOCCOCCOCCO UWHCKJMYHZGTIT-UHFFFAOYSA-N 0.000 description 1
- 101001099217 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) Triosephosphate isomerase Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 206010043540 Thromboangiitis obliterans Diseases 0.000 description 1
- 206010043561 Thrombocytopenic purpura Diseases 0.000 description 1
- 206010044248 Toxic shock syndrome Diseases 0.000 description 1
- 231100000650 Toxic shock syndrome Toxicity 0.000 description 1
- 206010070863 Toxicity to various agents Diseases 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 206010044688 Trisomy 21 Diseases 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- XGFGVFMXDXALEV-XIRDDKMYSA-N Trp-Leu-Asn Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)N XGFGVFMXDXALEV-XIRDDKMYSA-N 0.000 description 1
- MBLJBGZWLHTJBH-SZMVWBNQSA-N Trp-Val-Arg Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O)=CNC2=C1 MBLJBGZWLHTJBH-SZMVWBNQSA-N 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 206010054094 Tumour necrosis Diseases 0.000 description 1
- 206010053614 Type III immune complex mediated reaction Diseases 0.000 description 1
- GAYLGYUVTDMLKC-UWJYBYFXSA-N Tyr-Asp-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 GAYLGYUVTDMLKC-UWJYBYFXSA-N 0.000 description 1
- DWAMXBFJNZIHMC-KBPBESRZSA-N Tyr-Leu-Gly Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O DWAMXBFJNZIHMC-KBPBESRZSA-N 0.000 description 1
- RMRFSFXLFWWAJZ-HJOGWXRNSA-N Tyr-Tyr-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 RMRFSFXLFWWAJZ-HJOGWXRNSA-N 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 208000007814 Unstable Angina Diseases 0.000 description 1
- 206010048709 Urosepsis Diseases 0.000 description 1
- 208000024780 Urticaria Diseases 0.000 description 1
- 206010046851 Uveitis Diseases 0.000 description 1
- UEOOXDLMQZBPFR-ZKWXMUAHSA-N Val-Ala-Asn Chemical compound C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](C(C)C)N UEOOXDLMQZBPFR-ZKWXMUAHSA-N 0.000 description 1
- REJBPZVUHYNMEN-LSJOCFKGSA-N Val-Ala-His Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](C(C)C)N REJBPZVUHYNMEN-LSJOCFKGSA-N 0.000 description 1
- VMRFIKXKOFNMHW-GUBZILKMSA-N Val-Arg-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CO)C(=O)O)N VMRFIKXKOFNMHW-GUBZILKMSA-N 0.000 description 1
- YODDULVCGFQRFZ-ZKWXMUAHSA-N Val-Asp-Ser Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O YODDULVCGFQRFZ-ZKWXMUAHSA-N 0.000 description 1
- SYSWVVCYSXBVJG-RHYQMDGZSA-N Val-Leu-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C(C)C)N)O SYSWVVCYSXBVJG-RHYQMDGZSA-N 0.000 description 1
- PGBMPFKFKXYROZ-UFYCRDLUSA-N Val-Tyr-Phe Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)O)N PGBMPFKFKXYROZ-UFYCRDLUSA-N 0.000 description 1
- 206010046996 Varicose vein Diseases 0.000 description 1
- 206010047249 Venous thrombosis Diseases 0.000 description 1
- 206010047642 Vitiligo Diseases 0.000 description 1
- 201000008485 Wernicke-Korsakoff syndrome Diseases 0.000 description 1
- 208000018839 Wilson disease Diseases 0.000 description 1
- HMNZFMSWFCAGGW-XPWSMXQVSA-N [3-[hydroxy(2-hydroxyethoxy)phosphoryl]oxy-2-[(e)-octadec-9-enoyl]oxypropyl] (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCC(COP(O)(=O)OCCO)OC(=O)CCCCCCC\C=C\CCCCCCCC HMNZFMSWFCAGGW-XPWSMXQVSA-N 0.000 description 1
- 101150063325 ab gene Proteins 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- 231100000230 acceptable toxicity Toxicity 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 201000011040 acute kidney failure Diseases 0.000 description 1
- 201000003229 acute pancreatitis Diseases 0.000 description 1
- 208000012998 acute renal failure Diseases 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 208000030597 adult Refsum disease Diseases 0.000 description 1
- 208000011341 adult acute respiratory distress syndrome Diseases 0.000 description 1
- 201000000028 adult respiratory distress syndrome Diseases 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 238000012867 alanine scanning Methods 0.000 description 1
- 108010076324 alanyl-glycyl-glycine Proteins 0.000 description 1
- 108010069020 alanyl-prolyl-glycine Proteins 0.000 description 1
- 108010086434 alanyl-seryl-glycine Proteins 0.000 description 1
- 108010005233 alanylglutamic acid Proteins 0.000 description 1
- NDAUXUAQIAJITI-UHFFFAOYSA-N albuterol Chemical compound CC(C)(C)NCC(O)C1=CC=C(O)C(CO)=C1 NDAUXUAQIAJITI-UHFFFAOYSA-N 0.000 description 1
- 150000001299 aldehydes Chemical group 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 208000002205 allergic conjunctivitis Diseases 0.000 description 1
- 208000002029 allergic contact dermatitis Diseases 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- 230000000735 allogeneic effect Effects 0.000 description 1
- 231100000360 alopecia Toxicity 0.000 description 1
- 208000006682 alpha 1-Antitrypsin Deficiency Diseases 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 1
- 208000007502 anemia Diseases 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 210000002226 anterior horn cell Anatomy 0.000 description 1
- 201000004612 anterior uveitis Diseases 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000002924 anti-infective effect Effects 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 229960005475 antiinfective agent Drugs 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 239000002216 antistatic agent Substances 0.000 description 1
- 210000000709 aorta Anatomy 0.000 description 1
- 210000000702 aorta abdominal Anatomy 0.000 description 1
- 206010002895 aortic dissection Diseases 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 239000008346 aqueous phase Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 229940114078 arachidonate Drugs 0.000 description 1
- 108010069926 arginyl-glycyl-serine Proteins 0.000 description 1
- 108010068380 arginylarginine Proteins 0.000 description 1
- 208000037849 arterial hypertension Diseases 0.000 description 1
- 208000011775 arteriosclerosis disease Diseases 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 108010077245 asparaginyl-proline Proteins 0.000 description 1
- IAOZJIPTCAWIRG-QWRGUYRKSA-N aspartame Chemical compound OC(=O)C[C@H](N)C(=O)N[C@H](C(=O)OC)CC1=CC=CC=C1 IAOZJIPTCAWIRG-QWRGUYRKSA-N 0.000 description 1
- 239000000605 aspartame Substances 0.000 description 1
- 235000010357 aspartame Nutrition 0.000 description 1
- 229960003438 aspartame Drugs 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 208000024998 atopic conjunctivitis Diseases 0.000 description 1
- 206010003668 atrial tachycardia Diseases 0.000 description 1
- 229960001799 aurothioglucose Drugs 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- IVRMZWNICZWHMI-UHFFFAOYSA-N azide group Chemical group [N-]=[N+]=[N-] IVRMZWNICZWHMI-UHFFFAOYSA-N 0.000 description 1
- 239000000688 bacterial toxin Substances 0.000 description 1
- 229910052788 barium Inorganic materials 0.000 description 1
- DSAJWYNOEDNPEQ-UHFFFAOYSA-N barium atom Chemical compound [Ba] DSAJWYNOEDNPEQ-UHFFFAOYSA-N 0.000 description 1
- 210000004227 basal ganglia Anatomy 0.000 description 1
- 229940116224 behenate Drugs 0.000 description 1
- UKMSUNONTOPOIO-UHFFFAOYSA-M behenate Chemical compound CCCCCCCCCCCCCCCCCCCCCC([O-])=O UKMSUNONTOPOIO-UHFFFAOYSA-M 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 229960003237 betaine Drugs 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 238000001815 biotherapy Methods 0.000 description 1
- 229910052797 bismuth Inorganic materials 0.000 description 1
- JCXGWMGPZLAOME-UHFFFAOYSA-N bismuth atom Chemical compound [Bi] JCXGWMGPZLAOME-UHFFFAOYSA-N 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 230000024279 bone resorption Effects 0.000 description 1
- 108010006025 bovine growth hormone Proteins 0.000 description 1
- 230000003139 buffering effect Effects 0.000 description 1
- 210000004375 bundle of his Anatomy 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical class O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 230000001612 cachectic effect Effects 0.000 description 1
- 229910052793 cadmium Inorganic materials 0.000 description 1
- BDOSMKKIYDKNTQ-UHFFFAOYSA-N cadmium atom Chemical compound [Cd] BDOSMKKIYDKNTQ-UHFFFAOYSA-N 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- CJZGTCYPCWQAJB-UHFFFAOYSA-L calcium stearate Chemical compound [Ca+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CJZGTCYPCWQAJB-UHFFFAOYSA-L 0.000 description 1
- 239000008116 calcium stearate Substances 0.000 description 1
- 235000013539 calcium stearate Nutrition 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- FAKRSMQSSFJEIM-RQJHMYQMSA-N captopril Chemical compound SC[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O FAKRSMQSSFJEIM-RQJHMYQMSA-N 0.000 description 1
- 229960000830 captopril Drugs 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- PFKFTWBEEFSNDU-UHFFFAOYSA-N carbonyldiimidazole Chemical compound C1=CN=CN1C(=O)N1C=CN=C1 PFKFTWBEEFSNDU-UHFFFAOYSA-N 0.000 description 1
- 125000002057 carboxymethyl group Chemical group [H]OC(=O)C([H])([H])[*] 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 229940082638 cardiac stimulant phosphodiesterase inhibitors Drugs 0.000 description 1
- 230000002612 cardiopulmonary effect Effects 0.000 description 1
- 210000000748 cardiovascular system Anatomy 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 238000000423 cell based assay Methods 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 210000001638 cerebellum Anatomy 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 230000000739 chaotic effect Effects 0.000 description 1
- 238000002144 chemical decomposition reaction Methods 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- KYKAJFCTULSVSH-UHFFFAOYSA-N chloro(fluoro)methane Chemical compound F[C]Cl KYKAJFCTULSVSH-UHFFFAOYSA-N 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 description 1
- 230000007882 cirrhosis Effects 0.000 description 1
- 208000019425 cirrhosis of liver Diseases 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 229910017052 cobalt Inorganic materials 0.000 description 1
- 239000010941 cobalt Substances 0.000 description 1
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 201000010989 colorectal carcinoma Diseases 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 208000010247 contact dermatitis Diseases 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 239000010949 copper Substances 0.000 description 1
- 208000029078 coronary artery disease Diseases 0.000 description 1
- 230000001054 cortical effect Effects 0.000 description 1
- 230000002594 corticospinal effect Effects 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 238000002425 crystallisation Methods 0.000 description 1
- 230000008025 crystallization Effects 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 229940097362 cyclodextrins Drugs 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000000593 degrading effect Effects 0.000 description 1
- 238000002716 delivery method Methods 0.000 description 1
- 208000017004 dementia pugilistica Diseases 0.000 description 1
- 230000003210 demyelinating effect Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 201000002950 dengue hemorrhagic fever Diseases 0.000 description 1
- 238000000151 deposition Methods 0.000 description 1
- 229940096516 dextrates Drugs 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- PXBRQCKWGAHEHS-UHFFFAOYSA-N dichlorodifluoromethane Chemical compound FC(F)(Cl)Cl PXBRQCKWGAHEHS-UHFFFAOYSA-N 0.000 description 1
- 235000019404 dichlorodifluoromethane Nutrition 0.000 description 1
- OZRNSSUDZOLUSN-LBPRGKRZSA-N dihydrofolic acid Chemical compound N=1C=2C(=O)NC(N)=NC=2NCC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OZRNSSUDZOLUSN-LBPRGKRZSA-N 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 201000011304 dilated cardiomyopathy 1A Diseases 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- UKMSUNONTOPOIO-UHFFFAOYSA-N docosanoic acid Chemical compound CCCCCCCCCCCCCCCCCCCCCC(O)=O UKMSUNONTOPOIO-UHFFFAOYSA-N 0.000 description 1
- POULHZVOKOAJMA-UHFFFAOYSA-M dodecanoate Chemical compound CCCCCCCCCCCC([O-])=O POULHZVOKOAJMA-UHFFFAOYSA-M 0.000 description 1
- POULHZVOKOAJMA-UHFFFAOYSA-N dodecanoic acid Chemical compound CCCCCCCCCCCC(O)=O POULHZVOKOAJMA-UHFFFAOYSA-N 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 229940112141 dry powder inhaler Drugs 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 206010014599 encephalitis Diseases 0.000 description 1
- 201000002491 encephalomyelitis Diseases 0.000 description 1
- 206010014665 endocarditis Diseases 0.000 description 1
- 230000007515 enzymatic degradation Effects 0.000 description 1
- 238000009585 enzyme analysis Methods 0.000 description 1
- 208000001606 epiglottitis Diseases 0.000 description 1
- 230000003628 erosive effect Effects 0.000 description 1
- 201000011384 erythromelalgia Diseases 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- HQPMKSGTIOYHJT-UHFFFAOYSA-N ethane-1,2-diol;propane-1,2-diol Chemical compound OCCO.CC(O)CO HQPMKSGTIOYHJT-UHFFFAOYSA-N 0.000 description 1
- 238000012869 ethanol precipitation Methods 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- DEFVIWRASFVYLL-UHFFFAOYSA-N ethylene glycol bis(2-aminoethyl)tetraacetic acid Chemical compound OC(=O)CN(CC(O)=O)CCOCCOCCN(CC(O)=O)CC(O)=O DEFVIWRASFVYLL-UHFFFAOYSA-N 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 208000021045 exocrine pancreatic carcinoma Diseases 0.000 description 1
- 239000002095 exotoxin Substances 0.000 description 1
- 231100000776 exotoxin Toxicity 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 239000010685 fatty oil Substances 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 201000008825 fibrosarcoma of bone Diseases 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 229960005051 fluostigmine Drugs 0.000 description 1
- 239000012595 freezing medium Substances 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- LRBQNJMCXXYXIU-QWKBTXIPSA-N gallotannic acid Chemical compound OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@H]2[C@@H]([C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-QWKBTXIPSA-N 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 108060003196 globin Proteins 0.000 description 1
- 239000000174 gluconic acid Chemical class 0.000 description 1
- 235000012208 gluconic acid Nutrition 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 102000005396 glutamine synthetase Human genes 0.000 description 1
- 108020002326 glutamine synthetase Proteins 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 102000035122 glycosylated proteins Human genes 0.000 description 1
- 108091005608 glycosylated proteins Proteins 0.000 description 1
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 1
- 108010089804 glycyl-threonine Proteins 0.000 description 1
- 208000024908 graft versus host disease Diseases 0.000 description 1
- ZJYYHGLJYGJLLN-UHFFFAOYSA-N guanidinium thiocyanate Chemical compound SC#N.NC(N)=N ZJYYHGLJYGJLLN-UHFFFAOYSA-N 0.000 description 1
- 238000001631 haemodialysis Methods 0.000 description 1
- 201000009277 hairy cell leukemia Diseases 0.000 description 1
- 125000001475 halogen functional group Chemical group 0.000 description 1
- 208000024348 heart neoplasm Diseases 0.000 description 1
- 208000018578 heart valve disease Diseases 0.000 description 1
- 201000011066 hemangioma Diseases 0.000 description 1
- 230000000322 hemodialysis Effects 0.000 description 1
- 230000002949 hemolytic effect Effects 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 125000005842 heteroatom Chemical group 0.000 description 1
- 150000004687 hexahydrates Chemical class 0.000 description 1
- 102000054751 human RUNX1T1 Human genes 0.000 description 1
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 1
- 208000008750 humoral hypercalcemia of malignancy Diseases 0.000 description 1
- BHEPBYXIRTUNPN-UHFFFAOYSA-N hydridophosphorus(.) (triplet) Chemical group [PH] BHEPBYXIRTUNPN-UHFFFAOYSA-N 0.000 description 1
- 229930195733 hydrocarbon Natural products 0.000 description 1
- 150000002430 hydrocarbons Chemical class 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 230000003483 hypokinetic effect Effects 0.000 description 1
- 230000004179 hypothalamic–pituitary–adrenal axis Effects 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 229940102223 injectable solution Drugs 0.000 description 1
- 229940102213 injectable suspension Drugs 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- CDAISMWEOUEBRE-GPIVLXJGSA-N inositol Chemical compound O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H]1O CDAISMWEOUEBRE-GPIVLXJGSA-N 0.000 description 1
- 229960000367 inositol Drugs 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 201000004332 intermediate coronary syndrome Diseases 0.000 description 1
- 208000036971 interstitial lung disease 2 Diseases 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000000185 intracerebroventricular administration Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 230000005865 ionizing radiation Effects 0.000 description 1
- 208000012947 ischemia reperfusion injury Diseases 0.000 description 1
- 230000000302 ischemic effect Effects 0.000 description 1
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 1
- 238000010902 jet-milling Methods 0.000 description 1
- 201000004815 juvenile spinal muscular atrophy Diseases 0.000 description 1
- 229940043355 kinase inhibitor Drugs 0.000 description 1
- 239000000832 lactitol Substances 0.000 description 1
- 235000010448 lactitol Nutrition 0.000 description 1
- VQHSOMBJVWLPSR-JVCRWLNRSA-N lactitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-JVCRWLNRSA-N 0.000 description 1
- 229960003451 lactitol Drugs 0.000 description 1
- 229940070765 laurate Drugs 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 231100000225 lethality Toxicity 0.000 description 1
- 108010044311 leucyl-glycyl-glycine Proteins 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 210000004558 lewy body Anatomy 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 108010064235 lysylglycine Proteins 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- UEGPKNKPLBYCNK-UHFFFAOYSA-L magnesium acetate Chemical compound [Mg+2].CC([O-])=O.CC([O-])=O UEGPKNKPLBYCNK-UHFFFAOYSA-L 0.000 description 1
- 239000011654 magnesium acetate Substances 0.000 description 1
- 235000011285 magnesium acetate Nutrition 0.000 description 1
- 229940069446 magnesium acetate Drugs 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 229960002337 magnesium chloride Drugs 0.000 description 1
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 1
- 235000019341 magnesium sulphate Nutrition 0.000 description 1
- 229940091250 magnesium supplement Drugs 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 206010025482 malaise Diseases 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- FPYJFEHAWHCUMM-UHFFFAOYSA-N maleic anhydride Chemical compound O=C1OC(=O)C=C1 FPYJFEHAWHCUMM-UHFFFAOYSA-N 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 201000006812 malignant histiocytosis Diseases 0.000 description 1
- 229960001855 mannitol Drugs 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- QWIZNVHXZXRPDR-WSCXOGSTSA-N melezitose Chemical compound O([C@@]1(O[C@@H]([C@H]([C@@H]1O[C@@H]1[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O)O)CO)CO)[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O QWIZNVHXZXRPDR-WSCXOGSTSA-N 0.000 description 1
- 208000022089 meningococcemia Diseases 0.000 description 1
- 230000037323 metabolic rate Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 239000003475 metalloproteinase inhibitor Substances 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 206010027599 migraine Diseases 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 108091064355 mitochondrial RNA Proteins 0.000 description 1
- 230000002438 mitochondrial effect Effects 0.000 description 1
- 239000003226 mitogen Substances 0.000 description 1
- 239000002829 mitogen activated protein kinase inhibitor Substances 0.000 description 1
- 239000011812 mixed powder Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 150000002763 monocarboxylic acids Chemical class 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 230000003232 mucoadhesive effect Effects 0.000 description 1
- 208000001725 mucocutaneous lymph node syndrome Diseases 0.000 description 1
- 201000000585 muscular atrophy Diseases 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- 208000025113 myeloid leukemia Diseases 0.000 description 1
- 230000002107 myocardial effect Effects 0.000 description 1
- 229940105132 myristate Drugs 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 150000002790 naphthalenes Chemical class 0.000 description 1
- 201000011216 nasopharynx carcinoma Diseases 0.000 description 1
- 229920005615 natural polymer Polymers 0.000 description 1
- 101150091879 neo gene Proteins 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 201000008383 nephritis Diseases 0.000 description 1
- 208000009928 nephrosis Diseases 0.000 description 1
- 231100001027 nephrosis Toxicity 0.000 description 1
- 230000004770 neurodegeneration Effects 0.000 description 1
- 208000015122 neurodegenerative disease Diseases 0.000 description 1
- 230000002644 neurohormonal effect Effects 0.000 description 1
- 201000001119 neuropathy Diseases 0.000 description 1
- 230000007823 neuropathy Effects 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- 239000002687 nonaqueous vehicle Substances 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 238000010899 nucleation Methods 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 229940049964 oleate Drugs 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 239000011022 opal Substances 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 150000002892 organic cations Chemical class 0.000 description 1
- 229920000620 organic polymer Polymers 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- 239000007800 oxidant agent Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 239000003002 pH adjusting agent Substances 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 210000002741 palatine tonsil Anatomy 0.000 description 1
- 208000021090 palsy Diseases 0.000 description 1
- WLJNZVDCPSBLRP-UHFFFAOYSA-N pamoic acid Chemical compound C1=CC=C2C(CC=3C4=CC=CC=C4C=C(C=3O)C(=O)O)=C(O)C(C(O)=O)=CC2=C1 WLJNZVDCPSBLRP-UHFFFAOYSA-N 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 208000012111 paraneoplastic syndrome Diseases 0.000 description 1
- 230000003071 parasitic effect Effects 0.000 description 1
- 230000000849 parathyroid Effects 0.000 description 1
- 230000001314 paroxysmal effect Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000001814 pectin Substances 0.000 description 1
- 229920001277 pectin Polymers 0.000 description 1
- 235000010987 pectin Nutrition 0.000 description 1
- 229960001476 pentoxifylline Drugs 0.000 description 1
- 239000002304 perfume Substances 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 208000033808 peripheral neuropathy Diseases 0.000 description 1
- 206010034674 peritonitis Diseases 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 229940127557 pharmaceutical product Drugs 0.000 description 1
- 239000008180 pharmaceutical surfactant Substances 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- ORMNNUPLFAPCFD-DVLYDCSHSA-M phenethicillin potassium Chemical compound [K+].N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C([O-])=O)=O)C(=O)C(C)OC1=CC=CC=C1 ORMNNUPLFAPCFD-DVLYDCSHSA-M 0.000 description 1
- 229960005323 phenoxyethanol Drugs 0.000 description 1
- 229940080469 phosphocellulose Drugs 0.000 description 1
- 239000002571 phosphodiesterase inhibitor Substances 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- PTMHPRAIXMAOOB-UHFFFAOYSA-L phosphoramidate Chemical compound NP([O-])([O-])=O PTMHPRAIXMAOOB-UHFFFAOYSA-L 0.000 description 1
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 1
- 238000005222 photoaffinity labeling Methods 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 229940068196 placebo Drugs 0.000 description 1
- 239000000902 placebo Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 201000000317 pneumocystosis Diseases 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229940116406 poloxamer 184 Drugs 0.000 description 1
- 229940044519 poloxamer 188 Drugs 0.000 description 1
- 229920001993 poloxamer 188 Polymers 0.000 description 1
- 229920000724 poly(L-arginine) polymer Polymers 0.000 description 1
- 229920001308 poly(aminoacid) Polymers 0.000 description 1
- 229920002627 poly(phosphazenes) Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 108010011110 polyarginine Proteins 0.000 description 1
- 108010064470 polyaspartate Proteins 0.000 description 1
- 239000010318 polygalacturonic acid Substances 0.000 description 1
- 229920002643 polyglutamic acid Polymers 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 229920002503 polyoxyethylene-polyoxypropylene Polymers 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 150000007519 polyprotic acids Polymers 0.000 description 1
- 229940068965 polysorbates Drugs 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229940124606 potential therapeutic agent Drugs 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 201000011461 pre-eclampsia Diseases 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 150000003141 primary amines Chemical class 0.000 description 1
- 201000008312 primary pulmonary hypertension Diseases 0.000 description 1
- 239000002987 primer (paints) Substances 0.000 description 1
- 230000002947 procoagulating effect Effects 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 108010053725 prolylvaline Proteins 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 239000012264 purified product Substances 0.000 description 1
- 239000003379 purinergic P1 receptor agonist Substances 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 239000000376 reactant Substances 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 208000037803 restenosis Diseases 0.000 description 1
- 238000011268 retreatment Methods 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 239000003161 ribonuclease inhibitor Substances 0.000 description 1
- 238000002702 ribosome display Methods 0.000 description 1
- HJORMJIFDVBMOB-UHFFFAOYSA-N rolipram Chemical compound COC1=CC=C(C2CC(=O)NC2)C=C1OC1CCCC1 HJORMJIFDVBMOB-UHFFFAOYSA-N 0.000 description 1
- 229950005741 rolipram Drugs 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 238000013341 scale-up Methods 0.000 description 1
- CDAISMWEOUEBRE-UHFFFAOYSA-N scyllo-inosotol Natural products OC1C(O)C(O)C(O)C(O)C1O CDAISMWEOUEBRE-UHFFFAOYSA-N 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 201000001223 septic arthritis Diseases 0.000 description 1
- 206010040400 serum sickness Diseases 0.000 description 1
- 239000004017 serum-free culture medium Substances 0.000 description 1
- 108010007375 seryl-seryl-seryl-arginine Proteins 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 229940007046 shigella dysenteriae Drugs 0.000 description 1
- 229940115939 shigella sonnei Drugs 0.000 description 1
- 208000007056 sickle cell anemia Diseases 0.000 description 1
- 229920000260 silastic Polymers 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 230000000392 somatic effect Effects 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 235000019337 sorbitan trioleate Nutrition 0.000 description 1
- 229960000391 sorbitan trioleate Drugs 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 239000008347 soybean phospholipid Substances 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 238000001694 spray drying Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 239000008174 sterile solution Substances 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 239000002438 stress hormone Substances 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- KZNICNPSHKQLFF-UHFFFAOYSA-N succinimide Chemical class O=C1CCC(=O)N1 KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 206010042772 syncope Diseases 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 208000006379 syphilis Diseases 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 229920002258 tannic acid Polymers 0.000 description 1
- 229940033123 tannic acid Drugs 0.000 description 1
- 235000015523 tannic acid Nutrition 0.000 description 1
- 208000009056 telangiectasis Diseases 0.000 description 1
- 229960003676 tenidap Drugs 0.000 description 1
- LXIKEPCNDFVJKC-QXMHVHEDSA-N tenidap Chemical compound C12=CC(Cl)=CC=C2N(C(=O)N)C(=O)\C1=C(/O)C1=CC=CS1 LXIKEPCNDFVJKC-QXMHVHEDSA-N 0.000 description 1
- JDMUZPCDCYZTJA-UHFFFAOYSA-N tert-butyl 2,2-diaminoheptanoate Chemical compound CCCCCC(N)(N)C(=O)OC(C)(C)C JDMUZPCDCYZTJA-UHFFFAOYSA-N 0.000 description 1
- AOCSUUGBCMTKJH-UHFFFAOYSA-N tert-butyl n-(2-aminoethyl)carbamate Chemical compound CC(C)(C)OC(=O)NCCN AOCSUUGBCMTKJH-UHFFFAOYSA-N 0.000 description 1
- CWXZMNMLGZGDSW-UHFFFAOYSA-N tetracontanoic acid Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC(O)=O CWXZMNMLGZGDSW-UHFFFAOYSA-N 0.000 description 1
- 150000004044 tetrasaccharides Chemical class 0.000 description 1
- WROMPOXWARCANT-UHFFFAOYSA-N tfa trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.OC(=O)C(F)(F)F WROMPOXWARCANT-UHFFFAOYSA-N 0.000 description 1
- 229960003433 thalidomide Drugs 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 206010043554 thrombocytopenia Diseases 0.000 description 1
- 230000002537 thrombolytic effect Effects 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 206010043778 thyroiditis Diseases 0.000 description 1
- 208000037816 tissue injury Diseases 0.000 description 1
- AOBORMOPSGHCAX-DGHZZKTQSA-N tocofersolan Chemical compound OCCOC(=O)CCC(=O)OC1=C(C)C(C)=C2O[C@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C AOBORMOPSGHCAX-DGHZZKTQSA-N 0.000 description 1
- 229960000984 tocofersolan Drugs 0.000 description 1
- 125000005490 tosylate group Chemical group 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 229940108519 trasylol Drugs 0.000 description 1
- 230000008733 trauma Effects 0.000 description 1
- VHOCUJPBKOZGJD-UHFFFAOYSA-N triacontanoic acid Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC(O)=O VHOCUJPBKOZGJD-UHFFFAOYSA-N 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- CYRMSUTZVYGINF-UHFFFAOYSA-N trichlorofluoromethane Chemical compound FC(Cl)(Cl)Cl CYRMSUTZVYGINF-UHFFFAOYSA-N 0.000 description 1
- 229940029284 trichlorofluoromethane Drugs 0.000 description 1
- 150000004043 trisaccharides Chemical class 0.000 description 1
- 229940073585 tromethamine hydrochloride Drugs 0.000 description 1
- 239000002753 trypsin inhibitor Substances 0.000 description 1
- 108010080629 tryptophan-leucine Proteins 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 229910052721 tungsten Inorganic materials 0.000 description 1
- 208000025883 type III hypersensitivity disease Diseases 0.000 description 1
- 230000005951 type IV hypersensitivity Effects 0.000 description 1
- 208000027930 type IV hypersensitivity disease Diseases 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 108010003137 tyrosyltyrosine Proteins 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 208000009852 uremia Diseases 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 108010073969 valyllysine Proteins 0.000 description 1
- 208000027185 varicose disease Diseases 0.000 description 1
- 238000007879 vasectomy Methods 0.000 description 1
- 229940099259 vaseline Drugs 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 239000002435 venom Substances 0.000 description 1
- 231100000611 venom Toxicity 0.000 description 1
- 210000001048 venom Anatomy 0.000 description 1
- 208000037997 venous disease Diseases 0.000 description 1
- 229940070384 ventolin Drugs 0.000 description 1
- 208000003663 ventricular fibrillation Diseases 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 108010027345 wheylin-1 peptide Proteins 0.000 description 1
- 229940075420 xanthine Drugs 0.000 description 1
- 229910052727 yttrium Inorganic materials 0.000 description 1
- 150000003751 zinc Chemical class 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/241—Tumor Necrosis Factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A90/00—Technologies having an indirect contribution to adaptation to climate change
- Y02A90/10—Information and communication technologies [ICT] supporting adaptation to climate change, e.g. for weather forecasting or climate simulation
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Immunology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Rheumatology (AREA)
- Pain & Pain Management (AREA)
- Virology (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Tropical Medicine & Parasitology (AREA)
- Hematology (AREA)
- Heart & Thoracic Surgery (AREA)
- Cardiology (AREA)
- Transplantation (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Physical Education & Sports Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Claims (5)
1. Antistof der er specifikt for tumornekrosefaktor-alfa (TNFa) med tre tungkæde CDR'er og tre letkæde CDR'er eller et antigen-bindende fragment deraf, hvor de tre tungkæde CDR'er har aminosyresekvensen af: CDRH1: SYAMH; CDRH2: FMSYDGSNKKYADSVKG; CDRH3: DRGIAAGGNYYYYGMDV; og de tre letkæde CDR'er har aminosyresekvensen af: CDRL1: RASQSVYSYLA; CDRL2: DASNRAT; CDRL3: QQRSNWPPFT; til anvendelse i behandling af juvenil rheumatoid arthritis.
2. Antistoffet eller det antigen-bindende fragment ifølge krav 1 til anvendelse ifølge krav 1, hvor antistoffet er humant.
3. Antistoffet ifølge krav 1 eller krav 2 til anvendelse ifølge det krav, hvor: tungkæden omfatter aminosyresekvensen: QVQLVESGGGVVQPGRSLRLSCAASGFIFSSYAMHWVRQAPGKGL EWVAFMSYDGSNKKYADSVKGRFTISRDNSKNTLYLQMNSLRAED TAVYYCARDRGIAAGGNYYYYGMDVWGQGTTVTVSS; og letkæden omfatter aminosyresekvensen: EIVLTQSPATLSLSPGERATLSCRASQSVYSYLAWYQQKPGQAPRLL IYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWP PFTFGPGTKVDIK; og antistoffet er IgGlK.
4. Sammensætning omfattende antistoffet ifølge kravene 1-3 og en farmaceutisk acceptabel bærer eller fortyndingsmiddel, til anvendelse i behandling af juvenil rheumatoid arthritis.
5. Sammensætning omfattende antistoffet ifølge kravene 1-3 til anvendelse i behandling af juvenil rheumatoid arthritis, yderligere omfattende mindst én valgt fra en TNF antagonist, et antirheumatika, et muskelafslappende middel, et narkotika, et ikke-steroid anti-inflammatorisk lægemiddel (NSAID), et smertestillende middel, et bedøvelsesmiddel, et beroligende middel, et lokalbedøvende middel, en neuromuskulær blokker, et antimikrobielt middel, et antipsoriasis middel, et kortikosteroid, et anabolsk steroid, et diabetes-relateret middel, et mineral, et næringsmiddel, et thyroidmiddel, et vitamin, et calciumrelateret hormon, et middel mod diarré, et hostemedicin, et antiemetikum, et middel mod mavesår, et afføringsmiddel, en antikoagulant, en erythropieitin, et filgrastim, et sargramostim, et immuniseringsmiddel, et immunoglobulin, et immunosuppressiv, et væksthormon, et hormonerstatningslægemiddel, en østrogenreceptormodulator, et mydriatikum, et cykloplegisk middel, et alkyleringsmiddel, en antimetabolit, en mitosehæmmer, et radiofarmaceutisk middel, et antidepressiv, et middel mod mani, et antipsykotisk middel, et angstdæmpende middel, et sovemiddel, et sympatomimetikum, et opkvikkende middel, donepezil, tacrin, en astmamedicin, en beta-agonist, et steroid til inhalering, en leukotrien-hæmmer, methylxanthin, et cromolyn, en epinephrin eller analog, domase-alfa, en cytokin og en cytokinantagonist.
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US22336000P | 2000-08-07 | 2000-08-07 | |
US23682600P | 2000-09-29 | 2000-09-29 | |
US09/920,137 US7250165B2 (en) | 2000-08-07 | 2001-08-01 | Anti-TNF antibodies, compositions, methods and uses |
EP10184630.1A EP2330129B1 (en) | 2000-08-07 | 2001-08-07 | Anti-tnf antibodies, compositions, methods and uses |
Publications (1)
Publication Number | Publication Date |
---|---|
DK3118318T3 true DK3118318T3 (da) | 2019-02-18 |
Family
ID=40673117
Family Applications (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
DK09013122.8T DK2159230T3 (da) | 2000-08-07 | 2001-08-07 | Anti-TNF-antistoffer, sammensætninger, fremgangsmåder og anvendelser |
DK16179183.5T DK3118318T3 (da) | 2000-08-07 | 2001-08-07 | Anti-tnf-antistoffer, sammensætninger, fremgangsmåder og anvendelser |
DK10184630.1T DK2330129T3 (da) | 2000-08-07 | 2001-08-07 | Anti-tnf-antistoffer, sammensætninger, fremgangsmåder og anvendelser |
DK01957489T DK1309691T3 (da) | 2000-08-07 | 2001-08-07 | Anti-TNF-antistoffer, sammensætninger, fremgangsmåder og anvendelser |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
DK09013122.8T DK2159230T3 (da) | 2000-08-07 | 2001-08-07 | Anti-TNF-antistoffer, sammensætninger, fremgangsmåder og anvendelser |
Family Applications After (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
DK10184630.1T DK2330129T3 (da) | 2000-08-07 | 2001-08-07 | Anti-tnf-antistoffer, sammensætninger, fremgangsmåder og anvendelser |
DK01957489T DK1309691T3 (da) | 2000-08-07 | 2001-08-07 | Anti-TNF-antistoffer, sammensætninger, fremgangsmåder og anvendelser |
Country Status (33)
Country | Link |
---|---|
US (3) | US7250165B2 (da) |
EP (4) | EP1309691B1 (da) |
JP (7) | JP4748920B2 (da) |
KR (1) | KR100883078B1 (da) |
CN (2) | CN1468308B (da) |
AT (1) | ATE446367T1 (da) |
AU (2) | AU2001279227B2 (da) |
BE (1) | BE2010C014I2 (da) |
BR (1) | BRPI0113110C8 (da) |
CA (1) | CA2419205C (da) |
CY (7) | CY1109618T1 (da) |
DE (2) | DE60140259D1 (da) |
DK (4) | DK2159230T3 (da) |
EA (2) | EA007005B1 (da) |
ES (4) | ES2331602T3 (da) |
FR (1) | FR10C0014I2 (da) |
HK (2) | HK1052948B (da) |
HR (1) | HRP20030089B1 (da) |
HU (2) | HU229523B1 (da) |
IL (3) | IL154327A0 (da) |
LT (5) | LT2330129T (da) |
LU (3) | LU91663I2 (da) |
ME (1) | ME00314B (da) |
MX (1) | MXPA03001231A (da) |
MY (2) | MY157288A (da) |
NO (3) | NO333378B1 (da) |
NZ (2) | NZ562811A (da) |
PL (1) | PL206833B1 (da) |
PT (4) | PT2159230E (da) |
RS (1) | RS50858B (da) |
SI (4) | SI3118318T1 (da) |
UA (1) | UA81743C2 (da) |
WO (1) | WO2002012502A2 (da) |
Families Citing this family (161)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6090382A (en) * | 1996-02-09 | 2000-07-18 | Basf Aktiengesellschaft | Human antibodies that bind human TNFα |
BRPI9715219B8 (pt) | 1996-02-09 | 2015-07-07 | Abbvie Biotechnology Ltd | Vetor recombinante de expressão, e célula hospedeira procariótica. |
US7163681B2 (en) * | 2000-08-07 | 2007-01-16 | Centocor, Inc. | Anti-integrin antibodies, compositions, methods and uses |
US6709655B2 (en) | 2001-02-28 | 2004-03-23 | Instituto Bioclon, S.A. De C.V. | Pharmaceutical composition of F(ab1)2 antibody fragments and a process for the preparation thereof |
CA2868614A1 (en) | 2001-06-08 | 2002-12-08 | Abbott Laboratories (Bermuda) Ltd. | Methods of administering anti-tnf.alpha. antibodies |
TWI327597B (en) | 2001-08-01 | 2010-07-21 | Centocor Inc | Anti-tnf antibodies, compositions, methods and uses |
ES2346517T3 (es) * | 2001-11-12 | 2010-10-18 | Merck Patent Gmbh | Anticuerpo modificado anti-tnf alfa. |
EP1585477A4 (en) * | 2001-11-30 | 2007-06-27 | Centocor Inc | ANTI-TNF ANTIBODIES, COMPOSITIONS, METHODS AND USES |
US20040009172A1 (en) * | 2002-04-26 | 2004-01-15 | Steven Fischkoff | Use of anti-TNFalpha antibodies and another drug |
CN1678634A (zh) * | 2002-06-28 | 2005-10-05 | 多曼蒂斯有限公司 | 免疫球蛋白单个变体抗原结合区及其特异性构建体 |
CA2491669A1 (en) | 2002-07-04 | 2004-01-15 | Oncomab Gmbh | Neoplasm specific antibodies and uses thereof |
KR20150043568A (ko) * | 2002-07-19 | 2015-04-22 | 애브비 바이오테크놀로지 리미티드 | TNFα 관련 질환의 치료 |
US20040033228A1 (en) | 2002-08-16 | 2004-02-19 | Hans-Juergen Krause | Formulation of human antibodies for treating TNF-alpha associated disorders |
MY150740A (en) | 2002-10-24 | 2014-02-28 | Abbvie Biotechnology Ltd | Low dose methods for treating disorders in which tnf? activity is detrimental |
US9320792B2 (en) | 2002-11-08 | 2016-04-26 | Ablynx N.V. | Pulmonary administration of immunoglobulin single variable domains and constructs thereof |
US20060034845A1 (en) | 2002-11-08 | 2006-02-16 | Karen Silence | Single domain antibodies directed against tumor necrosis factor alpha and uses therefor |
CA2505326A1 (en) | 2002-11-08 | 2004-05-21 | Ablynx N.V. | Camelidae antibodies against immunoglobulin e and use thereof for the treatment of allergic disorders |
US7335759B2 (en) * | 2002-12-02 | 2008-02-26 | Universidad Nacional Autónoma de Méxica (UNAM) | Recombinant immunogens for the generation of antivenoms to the venom of scorpions of the genus Centruroides |
US7101978B2 (en) | 2003-01-08 | 2006-09-05 | Applied Molecular Evolution | TNF-α binding molecules |
DE10311248A1 (de) | 2003-03-14 | 2004-09-30 | Müller-Hermelink, Hans Konrad, Prof. Dr. | Humaner monoklonaler Antikörper |
WO2005009464A1 (en) * | 2003-07-25 | 2005-02-03 | Lopez De Silanes Juan | Administration of anti-cytokine f(ab')2 antibody fragments |
EP1660533A4 (en) * | 2003-09-12 | 2009-10-21 | Univ California | SPECIFIC MONOCLONAL ANTIBODIES MADE FROM PROTEINS OF DIFFERENT SEQUENCES FOR HIGHLY MOLECULAR AGGREGATIVE INTERMEDIATE PRODUCTS OF AMYLOIDS |
CN1328379C (zh) * | 2003-11-13 | 2007-07-25 | 中国人民解放军第四军医大学 | 高亲和力抗肿瘤坏死因子单克隆抗体的可变区基因 |
DE10353175A1 (de) | 2003-11-14 | 2005-06-16 | Müller-Hermelink, Hans Konrad, Prof. Dr. | Humaner monoklonaler Antikörper mit fettsenkender Wirkung |
EP1531162A1 (en) * | 2003-11-14 | 2005-05-18 | Heinz Vollmers | Adenocarcinoma specific antibody SAM-6, and uses thereof |
US7435799B2 (en) | 2004-01-08 | 2008-10-14 | Applied Molecular Evolution | TNF-α binding molecules |
RS51908B (en) * | 2004-02-06 | 2012-02-29 | University Of Massachusetts | CLOSTRIDIUM DIFFICILE TOXIN ANTIBODIES AND THEIR USES |
TWI556829B (zh) | 2004-04-09 | 2016-11-11 | 艾伯維生物技術有限責任公司 | 用於治療TNFα相關失調症之多重可變劑量療法 |
GB0414054D0 (en) | 2004-06-23 | 2004-07-28 | Owen Mumford Ltd | Improvements relating to automatic injection devices |
US20070160606A1 (en) * | 2004-09-30 | 2007-07-12 | Heavner George A | Treating renal cell carcinoma with an anti-TNF human antibody or fragment |
WO2006041970A2 (en) * | 2004-10-08 | 2006-04-20 | Abbott Biotechnology Ltd. | Treatment of respiratory syncytial virus (rsv) infection |
GB0425972D0 (en) * | 2004-11-25 | 2004-12-29 | Celltech R&D Ltd | Biological products |
ES2440777T3 (es) | 2004-12-21 | 2014-01-30 | Janssen Biotech, Inc. | Vectores basados en anticuerpo anti-il-12, células huéspedes y métodos de producción y usos |
US7381802B2 (en) * | 2005-04-15 | 2008-06-03 | Universidad Nacional Autónoma De México (UNAM) | Human antibodies that specifically recognize the toxin Cn2 from Centruroides noxius scorpion venom |
TWI399384B (zh) | 2005-05-16 | 2013-06-21 | Abbott Biotech Ltd | TNFα抑制劑於治療侵蝕型多發性關節炎之用途 |
US20070041905A1 (en) | 2005-08-19 | 2007-02-22 | Hoffman Rebecca S | Method of treating depression using a TNF-alpha antibody |
BRPI0616600A2 (pt) | 2005-08-31 | 2011-06-28 | Centocor Inc | linhagens de célula hospedeira para produção de região constante de anticorpo com função efetora aumentada |
SG169361A1 (en) | 2005-11-01 | 2011-03-30 | Abbott Biotech Ltd | Methods and compositions for diagnosing ankylosing spondylitis using biomarkers |
WO2007117490A2 (en) | 2006-04-05 | 2007-10-18 | Abbott Biotechnology Ltd. | Antibody purification |
US9624295B2 (en) | 2006-04-10 | 2017-04-18 | Abbvie Biotechnology Ltd. | Uses and compositions for treatment of psoriatic arthritis |
US20090317399A1 (en) * | 2006-04-10 | 2009-12-24 | Pollack Paul F | Uses and compositions for treatment of CROHN'S disease |
EP2012586A4 (en) | 2006-04-10 | 2010-08-18 | Abbott Biotech Ltd | USES AND COMPOSITIONS FOR THE TREATMENT OF ANKYLOSANTE SPONDYLARTHRITIS |
EP2010214A4 (en) * | 2006-04-10 | 2010-06-16 | Abbott Biotech Ltd | USES AND COMPOSITIONS FOR THE TREATMENT OF RHEUMATOID ARTHRITIS |
US20080118496A1 (en) * | 2006-04-10 | 2008-05-22 | Medich John R | Uses and compositions for treatment of juvenile rheumatoid arthritis |
EP2010213A4 (en) * | 2006-04-10 | 2010-08-11 | Abbott Biotech Ltd | USE AND COMPOSITIONS FOR THE TREATMENT OF JUVENIL RHEUMATOID ARTHRITIS |
CA2564435A1 (en) | 2006-04-10 | 2007-10-10 | Abbott Biotechnology Ltd. | Methods for monitoring and treating intestinal disorders |
EP2708242A3 (en) | 2006-04-10 | 2014-03-26 | Abbott Biotechnology Ltd | Uses and compositions for treatment of ankylosing spondylitis |
US9605064B2 (en) | 2006-04-10 | 2017-03-28 | Abbvie Biotechnology Ltd | Methods and compositions for treatment of skin disorders |
US20080131374A1 (en) * | 2006-04-19 | 2008-06-05 | Medich John R | Uses and compositions for treatment of rheumatoid arthritis |
US20100021451A1 (en) | 2006-06-08 | 2010-01-28 | Wong Robert L | Uses and compositions for treatment of ankylosing spondylitis |
MX2008016335A (es) | 2006-06-30 | 2009-01-21 | Abbott Biotech Ltd | Dispositivo automatico de inyeccion. |
US8911964B2 (en) | 2006-09-13 | 2014-12-16 | Abbvie Inc. | Fed-batch method of making human anti-TNF-alpha antibody |
SG10201510384UA (en) | 2006-09-13 | 2016-01-28 | Abbvie Inc | Cell culture improvements |
NZ613356A (en) * | 2006-10-27 | 2015-02-27 | Abbvie Biotechnology Ltd | Crystalline anti-htnfalpha antibodies |
US20090022727A1 (en) * | 2007-01-26 | 2009-01-22 | Alza Corp. | Injectable, nonaqueous suspension with high concentration of therapeutic agent |
JP2010523695A (ja) * | 2007-04-11 | 2010-07-15 | アルコン リサーチ, リミテッド | アレルギー性鼻炎およびアレルギー性結膜炎を処置するためのTNFαのインヒビターおよび抗ヒスタミン薬の使用 |
EP2679995A1 (en) | 2007-05-31 | 2014-01-01 | AbbVie Inc. | Biomarkers predictive of the responsiveness to TNF-alfa inhibitors in autoimmune disorders |
WO2008154543A2 (en) | 2007-06-11 | 2008-12-18 | Abbott Biotechnology Ltd. | Methods for treating juvenile idiopathic arthritis |
WO2009011782A2 (en) * | 2007-07-13 | 2009-01-22 | Abbott Biotechnology Ltd. | METHODS AND COMPOSITIONS FOR PULMONARY ADMINISTRATION OF A TNFa INHIBITOR |
CN101980722A (zh) | 2007-08-08 | 2011-02-23 | 雅培制药有限公司 | 结晶抗体的组合物和方法 |
US8883146B2 (en) | 2007-11-30 | 2014-11-11 | Abbvie Inc. | Protein formulations and methods of making same |
CA2707483A1 (en) * | 2007-11-30 | 2009-06-11 | Wolfgang Fraunhofer | Protein formulations and methods of making same |
JP6078217B2 (ja) | 2008-01-15 | 2017-02-08 | アッヴィ・ドイチュラント・ゲー・エム・ベー・ハー・ウント・コー・カー・ゲー | 粉末化されたタンパク質組成物及びその作製方法 |
CA2717905A1 (en) * | 2008-03-24 | 2009-10-01 | Abbott Biotechnology Ltd. | Methods and compositions for treating bone loss |
US11969501B2 (en) | 2008-04-21 | 2024-04-30 | Dompé Farmaceutici S.P.A. | Auris formulations for treating otic diseases and conditions |
KR20130097813A (ko) | 2008-04-21 | 2013-09-03 | 오토노미, 인코포레이티드 | 귀 질환 및 병태를 치료하기 위한 귀 조제물 |
WO2009154995A2 (en) * | 2008-05-27 | 2009-12-23 | Kyowa Hakko Kirin Co., Ltd. | Interleukin 10 receptor (il-10r) antibodies and methods of use |
RU2652907C2 (ru) * | 2008-06-25 | 2018-05-03 | ИЭсБиЭйТЕК, ЭН АЛЬКОН БАЙОМЕДИКАЛ РИСЕРЧ ЮНИТ ЭлЭлСи | Гуманизация антител кролика с использованием универсального каркаса антитела |
JP5856480B2 (ja) | 2008-06-25 | 2016-02-09 | エスバテック − ア ノバルティスカンパニー エルエルシー | 汎用性抗体フレームワークを用いたイエウサギ抗体のヒト化 |
AU2009274229B2 (en) | 2008-07-21 | 2013-08-22 | Otonomy, Inc. | Controlled-release otic structure modulating and innate immune system modulating compositions and methods for the treatment of otic disorders |
US8784870B2 (en) * | 2008-07-21 | 2014-07-22 | Otonomy, Inc. | Controlled release compositions for modulating free-radical induced damage and methods of use thereof |
EP2384367A4 (en) | 2008-12-30 | 2013-07-10 | Janssen Biotech Inc | SERUM MARKERS TO PREDICT THE CLINICAL RESPONSE TO ANTI-TNF ANTIBODIES IN PATIENTS WITH MORBUS BECHTEREW |
US8636704B2 (en) | 2009-04-29 | 2014-01-28 | Abbvie Biotechnology Ltd | Automatic injection device |
KR20120038406A (ko) * | 2009-05-04 | 2012-04-23 | 애보트 바이오테크놀로지 리미티드 | 인간 항?TNF?α 항체의 안정한 고 단백질 농도 제형 |
BRPI1010639A2 (pt) * | 2009-05-13 | 2016-03-15 | Protein Delivery Solutions Llc | sistema farmacêutico para distribuição transmembrana |
AU2010300421B2 (en) * | 2009-10-01 | 2014-01-23 | Alcon Research, Ltd. | Olopatadine compositions and uses thereof |
WO2011056590A1 (en) * | 2009-10-26 | 2011-05-12 | Prometheus Laboratories Inc. | Assays for the detection of anti-tnf drugs and autoantibodies |
UY32979A (es) * | 2009-10-28 | 2011-02-28 | Abbott Lab | Inmunoglobulinas con dominio variable dual y usos de las mismas |
ES2617281T3 (es) | 2009-10-28 | 2017-06-16 | Janssen Biotech, Inc. | Anticuerpos anti-glp-1r y sus usos |
EP2513144A1 (en) | 2009-12-16 | 2012-10-24 | Philip Bosch | Methods of treating interstitial cystitis |
CL2010000019A1 (es) * | 2010-01-11 | 2010-06-11 | Univ Chile | Anticuerpo monoclonal contra el tnf humano y sus fragmentos, secuencias nucleotidicas que lo codifican, vector de expresion y celulas que las contienen, composiciones y kit que comprenden el anticuerpo, uso de los mismos y metodo para su obtencion. |
MX2012008985A (es) | 2010-02-02 | 2012-09-07 | Abbott Biotech Ltd | Metodos y composiciones para predecir la capacidad de respuesta al tratamiento con el inhibidor de tnf-alfa. |
WO2011095174A1 (en) | 2010-02-08 | 2011-08-11 | Aarhus Universitet | Human herpes virus 6 and 7 u20 polypeptide and polynucleotides for use as a medicament or diagnosticum |
CN102167741B (zh) * | 2010-02-25 | 2014-05-14 | 上海百迈博制药有限公司 | 一种全人源抗TNF-α单克隆抗体、其制备方法及用途 |
US20110223208A1 (en) * | 2010-03-09 | 2011-09-15 | Beth Hill | Non-Aqueous High Concentration Reduced Viscosity Suspension Formulations |
US9072668B2 (en) | 2010-03-09 | 2015-07-07 | Janssen Biotech, Inc. | Non-aqueous high concentration reduced viscosity suspension formulations of antibodies |
JP5809242B2 (ja) | 2010-04-21 | 2015-11-10 | アッヴィ バイオテクノロジー リミテッド | 治療薬の制御送達のための装着型自動注入装置 |
WO2011146727A1 (en) | 2010-05-19 | 2011-11-24 | Philip Bosch | Methods of treating interstitial cystitis |
WO2011153477A2 (en) | 2010-06-03 | 2011-12-08 | Abbott Biotechnology Ltd. | Uses and compositions for treatment of hidradenitis suppurativa (hs) |
TW201206473A (en) | 2010-08-03 | 2012-02-16 | Abbott Lab | Dual variable domain immunoglobulins and uses thereof |
TWI606840B (zh) * | 2010-11-11 | 2017-12-01 | 艾伯維生物技術有限責任公司 | 具有增進高濃度之抗-TNFα抗體之液體調配物 |
EP2490024A1 (en) | 2010-12-22 | 2012-08-22 | Proteomika, S.L. | Method to optimize the treatment of patients with biological drugs |
EP2471554A1 (en) | 2010-12-28 | 2012-07-04 | Hexal AG | Pharmaceutical formulation comprising a biopharmaceutical drug |
JP6478214B2 (ja) | 2011-01-24 | 2019-03-06 | アッヴィ バイオテクノロジー リミテッド | オーバーモールド把持面を有する自動注射器 |
CN102675460B (zh) * | 2011-02-28 | 2015-08-19 | 珠海市丽珠单抗生物技术有限公司 | 抗肿瘤坏死因子α的人源化抗体 |
AU2012231178B2 (en) | 2011-03-18 | 2015-11-05 | Abbvie Inc. | Systems, devices and methods for assembling automatic injection devices and sub-assemblies thereof |
CN105413022A (zh) | 2011-03-29 | 2016-03-23 | 艾伯维公司 | 自动注射装置中的改进的护罩展开 |
CN107096098A (zh) | 2011-04-21 | 2017-08-29 | 艾伯维公司 | 可佩戴式自动注射装置 |
EP2702077A2 (en) | 2011-04-27 | 2014-03-05 | AbbVie Inc. | Methods for controlling the galactosylation profile of recombinantly-expressed proteins |
US9067990B2 (en) | 2013-03-14 | 2015-06-30 | Abbvie, Inc. | Protein purification using displacement chromatography |
WO2013158273A1 (en) | 2012-04-20 | 2013-10-24 | Abbvie Inc. | Methods to modulate c-terminal lysine variant distribution |
US9150645B2 (en) | 2012-04-20 | 2015-10-06 | Abbvie, Inc. | Cell culture methods to reduce acidic species |
US9249182B2 (en) | 2012-05-24 | 2016-02-02 | Abbvie, Inc. | Purification of antibodies using hydrophobic interaction chromatography |
US9206390B2 (en) | 2012-09-02 | 2015-12-08 | Abbvie, Inc. | Methods to control protein heterogeneity |
US9512214B2 (en) | 2012-09-02 | 2016-12-06 | Abbvie, Inc. | Methods to control protein heterogeneity |
HUE049282T2 (hu) | 2012-09-07 | 2020-09-28 | Coherus Biosciences Inc | Adalimumab stabil vizes formulációi |
ES2621285T3 (es) * | 2012-09-19 | 2017-07-03 | Abbvie Biotherapeutics Inc. | Métodos para identificar anticuerpos con inmunogenicidad reducida |
TW201811825A (zh) | 2012-11-01 | 2018-04-01 | 美商艾伯維有限公司 | 抗-vegf/dll4雙重可變區域免疫球蛋白及其用途 |
AU2014224174B2 (en) * | 2013-03-06 | 2018-08-30 | Hadasit Medical Research Services And Development Ltd. | Use of plant cells expressing a TNFalpha polypeptide inhibitor in therapy |
JP6454650B2 (ja) * | 2013-03-06 | 2019-01-23 | プロタリクス リミテッド | TNFαポリペプチド阻害剤を発現する植物細胞及び薬学的に許容される担体を含む医薬組成物 |
CA2905010A1 (en) | 2013-03-12 | 2014-09-18 | Abbvie Inc. | Human antibodies that bind human tnf-alpha and methods of preparing the same |
WO2014151878A2 (en) | 2013-03-14 | 2014-09-25 | Abbvie Inc. | Methods for modulating protein glycosylation profiles of recombinant protein therapeutics using monosaccharides and oligosacharides |
US9017687B1 (en) | 2013-10-18 | 2015-04-28 | Abbvie, Inc. | Low acidic species compositions and methods for producing and using the same using displacement chromatography |
WO2014159579A1 (en) | 2013-03-14 | 2014-10-02 | Abbvie Inc. | MUTATED ANTI-TNFα ANTIBODIES AND METHODS OF THEIR USE |
CA2907140A1 (en) | 2013-03-15 | 2014-09-25 | Janssen Biotech, Inc. | Manufacturing methods to control c-terminal lysine, galactose and sialic acid content in recombinant proteins |
TW201512219A (zh) | 2013-03-15 | 2015-04-01 | Abbvie Inc | 針對IL-1β及/或IL-17之雙特異性結合蛋白 |
US9603775B2 (en) | 2013-04-24 | 2017-03-28 | Corning Incorporated | Delamination resistant pharmaceutical glass containers containing active pharmaceutical ingredients |
EP3052640A2 (en) | 2013-10-04 | 2016-08-10 | AbbVie Inc. | Use of metal ions for modulation of protein glycosylation profiles of recombinant proteins |
US8946395B1 (en) | 2013-10-18 | 2015-02-03 | Abbvie Inc. | Purification of proteins using hydrophobic interaction chromatography |
US9085618B2 (en) | 2013-10-18 | 2015-07-21 | Abbvie, Inc. | Low acidic species compositions and methods for producing and using the same |
US9181337B2 (en) | 2013-10-18 | 2015-11-10 | Abbvie, Inc. | Modulated lysine variant species compositions and methods for producing and using the same |
WO2015073884A2 (en) | 2013-11-15 | 2015-05-21 | Abbvie, Inc. | Glycoengineered binding protein compositions |
JPWO2015083765A1 (ja) * | 2013-12-04 | 2017-03-16 | 国立大学法人大阪大学 | 生物学的製剤による関節リウマチの治療効果を予測判定する方法 |
US9962363B2 (en) | 2014-02-10 | 2018-05-08 | Patara Pharma, LLC | Mast cell stabilizers treatment for systemic disorders |
AU2015213681B2 (en) | 2014-02-10 | 2020-03-12 | Respivant Sciences Gmbh | Mast cell stabilizers for lung disease treatment |
WO2015198320A1 (en) | 2014-06-24 | 2015-12-30 | Insight Biopharmaceuticals Ltd. | Methods of purifying antibodies |
UA123624C2 (uk) | 2014-09-03 | 2021-05-05 | Бьорінґер Інґельхайм Інтернаціональ Ґмбх | Сполука, специфічна до іл-23а та фнп-альфа, та її застосування |
US10000551B2 (en) | 2014-09-11 | 2018-06-19 | Protalix Ltd. | Chimeric polypeptides, polynucleotides encoding same, cells expressing same and methods of producing same |
WO2016094881A2 (en) | 2014-12-11 | 2016-06-16 | Abbvie Inc. | Lrp-8 binding proteins |
AU2016239948B2 (en) | 2015-03-31 | 2022-03-17 | Sorriso Pharmaceuticals, Inc. | Polypeptides |
TW201710286A (zh) | 2015-06-15 | 2017-03-16 | 艾伯維有限公司 | 抗vegf、pdgf及/或其受體之結合蛋白 |
US10238625B2 (en) | 2015-08-07 | 2019-03-26 | Respivant Sciences Gmbh | Methods for the treatment of mast cell related disorders with mast cell stabilizers |
WO2017027402A1 (en) | 2015-08-07 | 2017-02-16 | Patara Pharma, LLC | Methods for the treatment of systemic disorders treatable with mast cell stabilizers, including mast cell related disorders |
US11229702B1 (en) | 2015-10-28 | 2022-01-25 | Coherus Biosciences, Inc. | High concentration formulations of adalimumab |
GB201522394D0 (en) | 2015-12-18 | 2016-02-03 | Ucb Biopharma Sprl | Antibodies |
US20170218092A1 (en) * | 2016-01-28 | 2017-08-03 | Janssen Biotech, Inc. | Bispecific Anti-TNF-Alpha/IL17A Antibodies and Anti-TNF-Alpha Antibodies and Methods of Their Use |
US10465003B2 (en) | 2016-02-05 | 2019-11-05 | Janssen Biotech, Inc. | Anti-TNF antibodies, compositions, methods and use for the treatment or prevention of type 1 diabetes |
JP2019513737A (ja) | 2016-04-08 | 2019-05-30 | ギリアード サイエンシーズ, インコーポレイテッド | がん、炎症性疾患および自己免疫疾患を処置するための組成物および方法 |
US11071782B2 (en) | 2016-04-20 | 2021-07-27 | Coherus Biosciences, Inc. | Method of filling a container with no headspace |
US10858422B2 (en) | 2016-05-31 | 2020-12-08 | Abcentra, Llc | Methods for treating systemic lupus erythematosus with an anti-apolipoprotein B antibody |
JP7033789B2 (ja) | 2016-06-29 | 2022-03-11 | オトノミー,インク. | トリグリセリド耳用製剤とその使用 |
JP2019528320A (ja) | 2016-08-31 | 2019-10-10 | レシュピファント サイエンシス ゲゼルシャフト ミット ベシュレンクター ハフトゥングRespivant Sciences Gmbh | 特発性肺線維症による慢性咳の治療のためのクロモリン組成物 |
WO2018060453A1 (en) | 2016-09-30 | 2018-04-05 | Vhsquared Limited | Compositions |
WO2018067341A1 (en) | 2016-10-07 | 2018-04-12 | Patara Pharma, LLC | Cromolyn compositions for treatment of pulmonary fibrosis |
JOP20190162A1 (ar) | 2016-12-30 | 2019-06-27 | Biocad Joint Stock Co | تركيبة صيدلانية مائية من جسم مضاد لـ tnf? أحادي النسيلة معاود الارتباط الجيني |
EP3573658A4 (en) | 2017-01-30 | 2021-07-21 | Janssen Biotech, Inc. | ANTI-TNF ANTIBODIES, COMPOSITIONS, AND METHODS FOR TREATMENT OF ACTIVE PSORIATIC ARTHRITIS |
MX2019009377A (es) | 2017-02-07 | 2019-12-11 | Janssen Biotech Inc | Anticuerpos anti-tnf, composiciones y metodos para el tratamiento de la espondilitis anquilosante activa. |
WO2019232081A1 (en) * | 2018-05-29 | 2019-12-05 | Abcentra, Llc | Compositions and methods for treatment of rheumatoid arthritis and accelerated atherosclerosis |
MA54750A (fr) | 2019-01-15 | 2021-11-24 | Janssen Biotech Inc | Compositions d'anticorps anti-tnf et procédés pour le traitement de l'arthrite idiopathique juvénile |
EP3938391A1 (en) * | 2019-03-14 | 2022-01-19 | Janssen Biotech, Inc. | Methods for producing anti-tnf antibody compositions |
JP2022534020A (ja) | 2019-05-23 | 2022-07-27 | ヤンセン バイオテツク,インコーポレーテツド | Il-23及びtnfアルファに対する抗体の併用療法による炎症性腸疾患の治療方法 |
AU2020289070A1 (en) | 2019-06-03 | 2022-02-03 | Janssen Biotech, Inc. | Anti-TNF antibody compositions, and methods for the treatment of Psoriatic Arthritis |
CA3144566A1 (en) | 2019-06-21 | 2020-12-24 | Sorriso Pharmaceuticals, Inc. | Polypeptides |
WO2020254827A1 (en) | 2019-06-21 | 2020-12-24 | Vhsquared Limited | Polypeptides |
WO2021028752A1 (en) | 2019-08-15 | 2021-02-18 | Janssen Biotech, Inc. | Anti-tfn antibodies for treating type i diabetes |
CN111153994B (zh) * | 2019-12-31 | 2021-10-15 | 武汉班科生物技术股份有限公司 | 人肿瘤坏死因子的人源单克隆抗体 |
AU2022276189A1 (en) | 2021-05-20 | 2024-01-18 | Janssen Biotech, Inc. | Method of treating inflammatory bowel disease with a combination therapy of antibodies to il-23 and tnf alpha |
WO2023154799A1 (en) | 2022-02-14 | 2023-08-17 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Combination immunotherapy for treating cancer |
WO2024054934A1 (en) | 2022-09-07 | 2024-03-14 | Mdx Management Llc | Shp-1 inhibitors for treating cancer |
WO2024097804A1 (en) | 2022-11-02 | 2024-05-10 | Mdx Management Llc | Combination of a tyrosine kinase inhibitor and a pro-inflammatory agent for treating cancer |
WO2024184281A1 (en) * | 2023-03-03 | 2024-09-12 | Alvotech Hf | Liquid formulations comprising golimumab and poloxamer 188 |
Family Cites Families (190)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
US4309989A (en) | 1976-02-09 | 1982-01-12 | The Curators Of The University Of Missouri | Topical application of medication by ultrasound with coupling agent |
FR2374910A1 (fr) | 1976-10-23 | 1978-07-21 | Choay Sa | Preparation a base d'heparine, comprenant des liposomes, procede pour l'obtenir et medicaments contenant de telles preparations |
FR2413974A1 (fr) | 1978-01-06 | 1979-08-03 | David Bernard | Sechoir pour feuilles imprimees par serigraphie |
US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
US4822776A (en) * | 1981-09-08 | 1989-04-18 | The Rockefeller University | Lipoprotein lipase suppression by endotoxin-induced mediator (shock assay) |
US4603106A (en) * | 1982-02-22 | 1986-07-29 | The Rockefeller University | Lipoprotein lipase suppression by endotoxin-induced mediator (shock assay) |
US5700466A (en) * | 1981-09-08 | 1997-12-23 | The Rockefeller University | Method of ameliorating or preventing septic shock using a monoclonal antibody specific to cachectin/tumor necrosis factor |
US4656134A (en) | 1982-01-11 | 1987-04-07 | Board Of Trustees Of Leland Stanford Jr. University | Gene amplification in eukaryotic cells |
US5149636A (en) | 1982-03-15 | 1992-09-22 | Trustees Of Columbia University In The City Of New York | Method for introducing cloned, amplifiable genes into eucaryotic cells and for producing proteinaceous products |
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
US4965188A (en) | 1986-08-22 | 1990-10-23 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme |
US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
DE229046T1 (de) | 1985-03-30 | 1987-12-17 | Marc Genf/Geneve Ballivet | Verfahren zum erhalten von dns, rns, peptiden, polypeptiden oder proteinen durch dns-rekombinant-verfahren. |
US6492107B1 (en) | 1986-11-20 | 2002-12-10 | Stuart Kauffman | Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique |
SE448277B (sv) | 1985-04-12 | 1987-02-09 | Draco Ab | Indikeringsanordning vid en doseringsanordning for lekemedel |
US4766067A (en) | 1985-05-31 | 1988-08-23 | President And Fellows Of Harvard College | Gene amplification |
GB8517895D0 (en) | 1985-07-16 | 1985-08-21 | Technology Licence Co Ltd | Monoclonal antibodies |
EP0613006A1 (en) | 1985-08-16 | 1994-08-31 | The Rockefeller University | Antibodies to cachectin and immunoassays |
US4870163A (en) | 1985-08-29 | 1989-09-26 | New York Blood Center, Inc. | Preparation of pure human tumor necrosis factor and hybridomas producing monoclonal antibodies to human tumor necrosis factor |
US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
US5576195A (en) | 1985-11-01 | 1996-11-19 | Xoma Corporation | Vectors with pectate lyase signal sequence |
US5618920A (en) | 1985-11-01 | 1997-04-08 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
DE3600905A1 (de) | 1986-01-15 | 1987-07-16 | Ant Nachrichtentech | Verfahren zum dekodieren von binaersignalen sowie viterbi-dekoder und anwendungen |
GB8601597D0 (en) | 1986-01-23 | 1986-02-26 | Wilson R H | Nucleotide sequences |
US4800159A (en) | 1986-02-07 | 1989-01-24 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences |
SE453566B (sv) | 1986-03-07 | 1988-02-15 | Draco Ab | Anordning vid pulverinhalatorer |
US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
US4767402A (en) | 1986-07-08 | 1988-08-30 | Massachusetts Institute Of Technology | Ultrasound enhancement of transdermal drug delivery |
IL79740A0 (en) | 1986-08-17 | 1986-11-30 | Yeda Res & Dev | Hepatitis vaccine |
WO1988001213A1 (en) | 1986-08-18 | 1988-02-25 | Clinical Technologies Associates, Inc. | Delivery systems for pharmacological agents |
US4889818A (en) | 1986-08-22 | 1989-12-26 | Cetus Corporation | Purified thermostable enzyme |
US4704692A (en) | 1986-09-02 | 1987-11-03 | Ladner Robert C | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
DE3631229A1 (de) | 1986-09-13 | 1988-03-24 | Basf Ag | Monoklonale antikoerper gegen humanen tumornekrosefaktor (tnf) und deren verwendung |
US4795699A (en) | 1987-01-14 | 1989-01-03 | President And Fellows Of Harvard College | T7 DNA polymerase |
US4921794A (en) | 1987-01-14 | 1990-05-01 | President And Fellows Of Harvard College | T7 DNA polymerase |
EP0832981A1 (en) | 1987-02-17 | 1998-04-01 | Pharming B.V. | DNA sequences to target proteins to the mammary gland for efficient secretion |
DE3852304T3 (de) | 1987-03-02 | 1999-07-01 | Enzon Labs Inc., Piscataway, N.J. | Organismus als Träger für "Single Chain Antibody Domain (SCAD)". |
EP0288088B1 (en) | 1987-04-24 | 1994-03-09 | Teijin Limited | Detection of tumor necrosis factor; monoclonal antibody and kit |
US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
CA1341235C (en) | 1987-07-24 | 2001-05-22 | Randy R. Robinson | Modular assembly of antibody genes, antibodies prepared thereby and use |
US4939666A (en) | 1987-09-02 | 1990-07-03 | Genex Corporation | Incremental macromolecule construction methods |
IL83878A (en) | 1987-09-13 | 1995-07-31 | Yeda Res & Dev | Soluble protein corresponding to tnf inhibitory protein its preparation and pharmaceutical compositions containing it |
DE3850542T2 (de) | 1987-09-23 | 1994-11-24 | Bristol Myers Squibb Co | Antikörper-Heterokonjugate zur Töting von HIV-infizierten Zellen. |
JP2980626B2 (ja) | 1988-01-11 | 1999-11-22 | ゾーマ・コーポレーション | ペクチン酸リアーゼのシグナル配列を含む新規プラスミドベクター |
US6010902A (en) | 1988-04-04 | 2000-01-04 | Bristol-Meyers Squibb Company | Antibody heteroconjugates and bispecific antibodies for use in regulation of lymphocyte activity |
US4956288A (en) | 1988-04-22 | 1990-09-11 | Biogen, Inc. | Method for producing cells containing stably integrated foreign DNA at a high copy number, the cells produced by this method, and the use of these cells to produce the polypeptides coded for by the foreign DNA |
US5770198A (en) | 1988-05-18 | 1998-06-23 | The Research Foundation Of The State Of New York | Platelet-specific chimeric 7E3 immunoglobulin |
US5130238A (en) | 1988-06-24 | 1992-07-14 | Cangene Corporation | Enhanced nucleic acid amplification process |
DE3823804A1 (de) | 1988-07-14 | 1990-01-18 | Basf Ag | Neutralisation der in vitro und in vivo toxischen eigenschaften von tnf-(alpha) durch monoklonale antikoerper und den davon abgeleiteten fragmenten |
NZ229922A (en) | 1988-07-18 | 1992-04-28 | Chiron Corp | Monoclonal antibodies specifically binding cachectin (tumor necrosis factor) and compositions |
US5601819A (en) | 1988-08-11 | 1997-02-11 | The General Hospital Corporation | Bispecific antibodies for selective immune regulation and for selective immune cell binding |
US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
IL94039A (en) | 1989-08-06 | 2006-09-05 | Yeda Res & Dev | Antibodies to tbp - 1 and their use |
US5066584A (en) | 1988-09-23 | 1991-11-19 | Cetus Corporation | Methods for generating single stranded dna by the polymerase chain reaction |
US5091310A (en) | 1988-09-23 | 1992-02-25 | Cetus Corporation | Structure-independent dna amplification by the polymerase chain reaction |
US5142033A (en) | 1988-09-23 | 1992-08-25 | Hoffmann-La Roche Inc. | Structure-independent DNA amplification by the polymerase chain reaction |
GB8823869D0 (en) | 1988-10-12 | 1988-11-16 | Medical Res Council | Production of antibodies |
US4987893A (en) | 1988-10-12 | 1991-01-29 | Rochal Industries, Inc. | Conformable bandage and coating material |
WO1990005144A1 (en) | 1988-11-11 | 1990-05-17 | Medical Research Council | Single domain ligands, receptors comprising said ligands, methods for their production, and use of said ligands and receptors |
US5342613A (en) * | 1988-12-27 | 1994-08-30 | Health Research Inc. | Pharmaceutical compositions and use thereof in the treatment of psoriasis |
US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US4994370A (en) | 1989-01-03 | 1991-02-19 | The United States Of America As Represented By The Department Of Health And Human Services | DNA amplification technique |
PT92900A (pt) | 1989-01-24 | 1990-07-31 | Sistema de vectores de expressao para a producao de anticorpos monoclonais quimericos | |
US5225538A (en) | 1989-02-23 | 1993-07-06 | Genentech, Inc. | Lymphocyte homing receptor/immunoglobulin fusion proteins |
US5116964A (en) | 1989-02-23 | 1992-05-26 | Genentech, Inc. | Hybrid immunoglobulins |
US5266491A (en) | 1989-03-14 | 1993-11-30 | Mochida Pharmaceutical Co., Ltd. | DNA fragment and expression plasmid containing the DNA fragment |
DE3909708A1 (de) | 1989-03-23 | 1990-09-27 | Boehringer Mannheim Gmbh | Verfahren zur herstellung bispezifischer antikoerper |
ATE289350T1 (de) | 1989-04-21 | 2005-03-15 | Amgen Inc | Tnf-rezeptor, tnf bindende proteine und dafür kodierende dnas |
CA2016841C (en) | 1989-05-16 | 1999-09-21 | William D. Huse | A method for producing polymers having a preselected activity |
CA2016842A1 (en) | 1989-05-16 | 1990-11-16 | Richard A. Lerner | Method for tapping the immunological repertoire |
AU652539B2 (en) | 1989-05-16 | 1994-09-01 | Medical Research Council | Co-expression of heteromeric receptors |
CA2017025C (en) | 1989-05-18 | 2008-07-22 | David Wallach | Tumor necrosis factor binding protein ii, its purification and antibodies thereto |
WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
JP3443119B2 (ja) | 1989-08-07 | 2003-09-02 | ペプテック リミテッド | 腫瘍壊死因子結合リガンド |
KR0185192B1 (ko) | 1989-10-05 | 1999-04-01 | 제임스 더블유. 데이비 | 신규의 유전자 및 폴리펩티드의 무세포 합성 및 분리 |
ES2080098T3 (es) | 1989-12-13 | 1996-02-01 | Yeda Res & Dev | Expresion de la proteina de union i al factor de necrosis tumoral tbp-i recombinante. |
GB8928874D0 (en) | 1989-12-21 | 1990-02-28 | Celltech Ltd | Humanised antibodies |
US5580575A (en) | 1989-12-22 | 1996-12-03 | Imarx Pharmaceutical Corp. | Therapeutic drug delivery systems |
DE69133566T2 (de) | 1990-01-12 | 2007-12-06 | Amgen Fremont Inc. | Bildung von xenogenen Antikörpern |
TW212184B (da) | 1990-04-02 | 1993-09-01 | Takeda Pharm Industry Co Ltd | |
US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
AU8081491A (en) | 1990-06-01 | 1991-12-31 | Cetus Corporation | Compositions and methods for identifying biologically active molecules |
US5723286A (en) | 1990-06-20 | 1998-03-03 | Affymax Technologies N.V. | Peptide library and screening systems |
KR0149181B1 (ko) | 1990-06-29 | 1998-08-17 | 데이비드 알, 맥지 | 형질전환된 미생물에 의한 멜라닌의 제조방법 |
US5580734A (en) | 1990-07-13 | 1996-12-03 | Transkaryotic Therapies, Inc. | Method of producing a physical map contigous DNA sequences |
EP0542810A1 (en) | 1990-08-02 | 1993-05-26 | B.R. Centre Limited | Methods for the production of proteins with a desired function |
WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US6300129B1 (en) | 1990-08-29 | 2001-10-09 | Genpharm International | Transgenic non-human animals for producing heterologous antibodies |
EP0814159B1 (en) | 1990-08-29 | 2005-07-27 | GenPharm International, Inc. | Transgenic mice capable of producing heterologous antibodies |
US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
WO1992005258A1 (en) | 1990-09-20 | 1992-04-02 | La Trobe University | Gene encoding barley enzyme |
GB9022648D0 (en) | 1990-10-18 | 1990-11-28 | Charing Cross Sunley Research | Polypeptide and its use |
EP0557300B1 (en) | 1990-10-29 | 1997-11-19 | Chiron Corporation | Bispecific antibodies, method of production, and uses thereof |
US5958413A (en) * | 1990-11-01 | 1999-09-28 | Celltech Limited | Use of antibodies to TNF or fragments derived thereof and xanthine derivatives for combination therapy and compositions therefor |
DE69129154T2 (de) | 1990-12-03 | 1998-08-20 | Genentech, Inc., South San Francisco, Calif. | Verfahren zur anreicherung von proteinvarianten mit geänderten bindungseigenschaften |
US5582996A (en) | 1990-12-04 | 1996-12-10 | The Wistar Institute Of Anatomy & Biology | Bifunctional antibodies and method of preparing same |
GB9109645D0 (en) | 1991-05-03 | 1991-06-26 | Celltech Ltd | Recombinant antibodies |
DK0567566T4 (da) | 1991-01-18 | 2007-10-22 | Amgen Inc | Fremgangsmåder til behandling af tumornekrosefaktor-medierede sygdomme |
JPH06508022A (ja) | 1991-02-21 | 1994-09-14 | ギリアド サイエンシズ,インコーポレイテッド | 生体分子に特異的なアプタマーおよび生産方法 |
US5404871A (en) | 1991-03-05 | 1995-04-11 | Aradigm | Delivery of aerosol medications for inspiration |
JP3693671B2 (ja) | 1991-03-15 | 2005-09-07 | アムゲン インコーポレーテッド | ポリペプチドのpeg化 |
US5656272A (en) * | 1991-03-18 | 1997-08-12 | New York University Medical Center | Methods of treating TNF-α-mediated Crohn's disease using chimeric anti-TNF antibodies |
US5698195A (en) * | 1991-03-18 | 1997-12-16 | New York University Medical Center | Methods of treating rheumatoid arthritis using chimeric anti-TNF antibodies |
DE07012625T1 (de) | 1991-03-18 | 2010-01-21 | New York University | Monoklonale und chimäre Antikörper gegen humanen Tumornekrosefaktor |
US6284471B1 (en) * | 1991-03-18 | 2001-09-04 | New York University Medical Center | Anti-TNFa antibodies and assays employing anti-TNFa antibodies |
US6277969B1 (en) * | 1991-03-18 | 2001-08-21 | New York University | Anti-TNF antibodies and peptides of human tumor necrosis factor |
US5919452A (en) * | 1991-03-18 | 1999-07-06 | New York University | Methods of treating TNFα-mediated disease using chimeric anti-TNF antibodies |
JP3672306B2 (ja) | 1991-04-10 | 2005-07-20 | ザ スクリップス リサーチ インスティテュート | ファージミドを使用するヘテロ二量体受容体ライブラリー |
WO1992020373A1 (en) | 1991-05-14 | 1992-11-26 | Repligen Corporation | Heteroconjugate antibodies for treatment of hiv infection |
DE4118120A1 (de) | 1991-06-03 | 1992-12-10 | Behringwerke Ag | Tetravalente bispezifische rezeptoren, ihre herstellung und verwendung |
US5637481A (en) | 1993-02-01 | 1997-06-10 | Bristol-Myers Squibb Company | Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell |
NL9101124A (nl) | 1991-06-28 | 1993-01-18 | Stork Brabant Bv | Rotatiezeefdrukmachine. |
ES2141108T3 (es) | 1991-07-02 | 2000-03-16 | Inhale Inc | Metodo y dispositivo para proporcionar medicamentos en aerosol. |
IE922437A1 (en) * | 1991-07-25 | 1993-01-27 | Idec Pharma Corp | Recombinant antibodies for human therapy |
SK285046B6 (sk) | 1991-07-25 | 2006-05-04 | Idec Pharmaceuticals Corporation | Chimérna protilátka, ktorá sa špecificky viaže na ľudský antigén, farmaceutický prostriedok s jej obsahom, spôsob jej výroby a použitie |
EP0525570A3 (en) | 1991-07-31 | 1993-10-06 | Miles Inc. | Anti-idiotypic antibodies that mimic tnf |
DE4125898C2 (de) | 1991-08-05 | 1994-02-03 | Hirschmann Richard Gmbh Co | Fahrzeugantenne in Form einer Schlitzantenne |
IL99120A0 (en) | 1991-08-07 | 1992-07-15 | Yeda Res & Dev | Multimers of the soluble forms of tnf receptors,their preparation and pharmaceutical compositions containing them |
US5270170A (en) | 1991-10-16 | 1993-12-14 | Affymax Technologies N.V. | Peptide library and screening method |
WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
US5641670A (en) | 1991-11-05 | 1997-06-24 | Transkaryotic Therapies, Inc. | Protein production and protein delivery |
US5733761A (en) | 1991-11-05 | 1998-03-31 | Transkaryotic Therapies, Inc. | Protein production and protein delivery |
US5932448A (en) | 1991-11-29 | 1999-08-03 | Protein Design Labs., Inc. | Bispecific antibody heterodimers |
ATE408012T1 (de) | 1991-12-02 | 2008-09-15 | Medical Res Council | Herstellung von autoantikörpern auf phagenoberflächen ausgehend von antikörpersegmentbibliotheken |
DE69233204T2 (de) | 1991-12-13 | 2004-07-15 | Xoma Corp., Berkeley | Verfahren und materialien zur herstellung von modifizierten variablen antikörperdomänen und ihre therapeutische verwendung |
US5667988A (en) | 1992-01-27 | 1997-09-16 | The Scripps Research Institute | Methods for producing antibody libraries using universal or randomized immunoglobulin light chains |
DE4207475A1 (de) | 1992-03-10 | 1993-09-16 | Goldwell Ag | Mittel zum blondieren von menschlichen haaren und verfahren zu dessen herstellung |
US5447851B1 (en) | 1992-04-02 | 1999-07-06 | Univ Texas System Board Of | Dna encoding a chimeric polypeptide comprising the extracellular domain of tnf receptor fused to igg vectors and host cells |
WO1994006498A1 (en) | 1992-09-23 | 1994-03-31 | Fisons Plc | Inhalation device |
AU5322494A (en) | 1992-10-02 | 1994-04-26 | Trustees Of Dartmouth College | Bispecific reagents for redirected targeting of low density lipoprotein |
BR9307270A (pt) | 1992-10-19 | 1999-06-01 | Dura Pharma Inc | Inalador de pó seco |
US5643252A (en) | 1992-10-28 | 1997-07-01 | Venisect, Inc. | Laser perforator |
WO1994012520A1 (en) | 1992-11-20 | 1994-06-09 | Enzon, Inc. | Linker for linked fusion polypeptides |
US5849695A (en) | 1993-01-13 | 1998-12-15 | The Regents Of The University Of California | Parathyroid hormone analogues useful for treatment of osteoporosis and disorders of calcium meatabolism in mammals |
ES2124870T3 (es) | 1993-01-19 | 1999-02-16 | Glaxo Group Ltd | Distribuidor de aerosol y procedimiento de fabricacion. |
PL310327A1 (en) | 1993-02-12 | 1995-12-11 | Univ Leland Stanford Junior | Adjustable transcription of target genes and other biological processes |
EP0614989A1 (en) | 1993-02-17 | 1994-09-14 | MorphoSys AG | A method for in vivo selection of ligand-binding proteins |
US5770428A (en) | 1993-02-17 | 1998-06-23 | Wisconsin Alumni Research Foundation | Chimeric retrovial expression vectors and particles containing a simple retroviral long terminal repeat, BLV or HIV coding regions and cis-acting regulatory sequences, and an RNA translational enhancer with internal ribsome entry site |
US5888511A (en) * | 1993-02-26 | 1999-03-30 | Advanced Biotherapy Concepts, Inc. | Treatment of autoimmune diseases, including AIDS |
DK0614984T4 (da) * | 1993-03-05 | 2010-12-20 | Bayer Healthcare Llc | Humane monoklonale anti-TNF-alfa-antistoffer |
GB9315846D0 (en) | 1993-07-30 | 1993-09-15 | Isis Innovation | Tumour inhibitors |
US5514670A (en) | 1993-08-13 | 1996-05-07 | Pharmos Corporation | Submicron emulsions for delivery of peptides |
US5625825A (en) | 1993-10-21 | 1997-04-29 | Lsi Logic Corporation | Random number generating apparatus for an interface unit of a carrier sense with multiple access and collision detect (CSMA/CD) ethernet data network |
DE4337197C1 (de) | 1993-10-30 | 1994-08-25 | Biotest Pharma Gmbh | Verfahren zur selektiven Herstellung von Hybridomazellinien, die monoklonale Antikörper mit hoher Zytotoxizität gegen humanes CD16-Antigen produzieren, sowie Herstellung bispezifischer monoklonaler Antikörper unter Verwendung derartiger monoklonaler Antikörper und des CD30-HRS-3-Antikörpers zur Therapie menschlicher Tumore |
US5814599A (en) | 1995-08-04 | 1998-09-29 | Massachusetts Insitiute Of Technology | Transdermal delivery of encapsulated drugs |
SE9304060D0 (sv) | 1993-12-06 | 1993-12-06 | Bioinvent Int Ab | Sätt att selektera specifika bakteriofager |
US5827690A (en) | 1993-12-20 | 1998-10-27 | Genzyme Transgenics Corporatiion | Transgenic production of antibodies in milk |
EP0749325B1 (en) | 1994-03-07 | 2002-06-12 | Medarex, Inc. | Bispecific molecules having clinical utilities |
US6190691B1 (en) * | 1994-04-12 | 2001-02-20 | Adolor Corporation | Methods for treating inflammatory conditions |
US5763733A (en) | 1994-10-13 | 1998-06-09 | Enzon, Inc. | Antigen-binding fusion proteins |
US5549551A (en) | 1994-12-22 | 1996-08-27 | Advanced Cardiovascular Systems, Inc. | Adjustable length balloon catheter |
FR2728793A1 (fr) * | 1994-12-28 | 1996-07-05 | Oreal | Utilisation d'un antagoniste d'histamine, d'un antagoniste d'interleukine 1 et/ou d'un antagoniste de tnf-alpha dans une composition cosmetique, pharmaceutique ou dermatologique et composition obtenue |
US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
US6037453A (en) | 1995-03-15 | 2000-03-14 | Genentech, Inc. | Immunoglobulin variants |
US5656730A (en) | 1995-04-07 | 1997-08-12 | Enzon, Inc. | Stabilized monomeric protein compositions |
ATE390933T1 (de) | 1995-04-27 | 2008-04-15 | Amgen Fremont Inc | Aus immunisierten xenomäusen stammende menschliche antikörper gegen il-8 |
AU2466895A (en) | 1995-04-28 | 1996-11-18 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
US5730723A (en) | 1995-10-10 | 1998-03-24 | Visionary Medical Products Corporation, Inc. | Gas pressured needle-less injection device and method |
US6090382A (en) * | 1996-02-09 | 2000-07-18 | Basf Aktiengesellschaft | Human antibodies that bind human TNFα |
GB9526100D0 (en) | 1995-12-20 | 1996-02-21 | Intersurgical Ltd | Nebulizer |
IL125183A0 (en) | 1996-01-03 | 1999-03-12 | Glaxo Group Ltd | Inhalation device |
BRPI9715219B8 (pt) | 1996-02-09 | 2015-07-07 | Abbvie Biotechnology Ltd | Vetor recombinante de expressão, e célula hospedeira procariótica. |
US5714352A (en) | 1996-03-20 | 1998-02-03 | Xenotech Incorporated | Directed switch-mediated DNA recombination |
DE19624387C2 (de) | 1996-06-19 | 1999-08-19 | Hatz Motoren | Kaltstartvorrichtung |
EP0826695B1 (de) | 1996-09-03 | 2001-12-12 | GSF-Forschungszentrum für Umwelt und Gesundheit GmbH | Zerstörung von kontaminierenden Tumorzellen in Stammzelltransplantaten mit bispezifischen Antikörpern |
AU5702298A (en) | 1996-12-03 | 1998-06-29 | Abgenix, Inc. | Transgenic mammals having human Ig loci including plural VH and VK regions nd antibodies produced therefrom |
US5879681A (en) | 1997-02-07 | 1999-03-09 | Emisphere Technolgies Inc. | Compounds and compositions for delivering active agents |
US5921447A (en) | 1997-02-13 | 1999-07-13 | Glaxo Wellcome Inc. | Flow-through metered aerosol dispensing apparatus and method of use thereof |
US6235883B1 (en) | 1997-05-05 | 2001-05-22 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
IL120943A (en) | 1997-05-29 | 2004-03-28 | Univ Ben Gurion | A system for administering drugs through the skin |
AU2003247411A1 (en) | 2002-05-23 | 2003-12-12 | Cognis Corporation | NON-REVERTIBLE Beta-OXIDATION BLOCKED CANDIDA TROPICALIS |
JP5470817B2 (ja) | 2008-03-10 | 2014-04-16 | 日産自動車株式会社 | 電池用電極およびこれを用いた電池、並びにその製造方法 |
JP5155355B2 (ja) | 2010-04-07 | 2013-03-06 | レノボ・シンガポール・プライベート・リミテッド | 無線基地局の自律的な負荷調整が可能な無線端末装置 |
US9619256B1 (en) | 2012-06-27 | 2017-04-11 | EMC IP Holding Company LLC | Multi site and multi tenancy |
JP6136279B2 (ja) | 2013-01-15 | 2017-05-31 | 株式会社ジェイテクト | 転がり軸受装置 |
TWI503850B (zh) | 2013-03-22 | 2015-10-11 | Polytronics Technology Corp | 過電流保護元件 |
TWI510996B (zh) | 2013-10-03 | 2015-12-01 | Acer Inc | 控制觸控面板的方法以及使用該方法的可攜式電腦 |
US9816280B1 (en) | 2016-11-02 | 2017-11-14 | Matthew Reitnauer | Portable floor |
-
2001
- 2001-07-08 UA UA2003021152A patent/UA81743C2/uk unknown
- 2001-08-01 NZ NZ562811A patent/NZ562811A/en not_active IP Right Cessation
- 2001-08-01 US US09/920,137 patent/US7250165B2/en not_active Expired - Lifetime
- 2001-08-07 EA EA200300243A patent/EA007005B1/ru not_active IP Right Cessation
- 2001-08-07 EP EP01957489A patent/EP1309691B1/en not_active Expired - Lifetime
- 2001-08-07 ES ES01957489T patent/ES2331602T3/es not_active Expired - Lifetime
- 2001-08-07 DK DK09013122.8T patent/DK2159230T3/da active
- 2001-08-07 LT LTEP10184630.1T patent/LT2330129T/lt unknown
- 2001-08-07 MY MYPI20013719A patent/MY157288A/en unknown
- 2001-08-07 PT PT90131228T patent/PT2159230E/pt unknown
- 2001-08-07 SI SI200131069T patent/SI3118318T1/sl unknown
- 2001-08-07 SI SI200130948T patent/SI1309691T1/sl unknown
- 2001-08-07 EP EP10184630.1A patent/EP2330129B1/en not_active Expired - Lifetime
- 2001-08-07 DE DE60140259T patent/DE60140259D1/de not_active Expired - Lifetime
- 2001-08-07 DK DK16179183.5T patent/DK3118318T3/da active
- 2001-08-07 CN CN018169600A patent/CN1468308B/zh not_active Expired - Lifetime
- 2001-08-07 PL PL360438A patent/PL206833B1/pl unknown
- 2001-08-07 LT LTEP16179183.5T patent/LT3118318T/lt unknown
- 2001-08-07 ME MEP-2008-484A patent/ME00314B/me unknown
- 2001-08-07 EA EA200600126A patent/EA009288B1/ru not_active IP Right Cessation
- 2001-08-07 NZ NZ524147A patent/NZ524147A/en not_active IP Right Cessation
- 2001-08-07 ES ES09013122.8T patent/ES2527953T3/es not_active Expired - Lifetime
- 2001-08-07 AT AT01957489T patent/ATE446367T1/de active
- 2001-08-07 KR KR1020037001826A patent/KR100883078B1/ko active IP Right Review Request
- 2001-08-07 EP EP09013122.8A patent/EP2159230B1/en not_active Expired - Lifetime
- 2001-08-07 DK DK10184630.1T patent/DK2330129T3/da active
- 2001-08-07 PT PT01957489T patent/PT1309691E/pt unknown
- 2001-08-07 RS YUP-91/03A patent/RS50858B/sr unknown
- 2001-08-07 DE DE122010000010C patent/DE122010000010I1/de active Pending
- 2001-08-07 BR BRPI0113110A patent/BRPI0113110C8/pt active Search and Examination
- 2001-08-07 CA CA2419205A patent/CA2419205C/en not_active Expired - Lifetime
- 2001-08-07 MX MXPA03001231A patent/MXPA03001231A/es active IP Right Grant
- 2001-08-07 PT PT101846301T patent/PT2330129T/pt unknown
- 2001-08-07 ES ES10184630.1T patent/ES2607679T3/es not_active Expired - Lifetime
- 2001-08-07 SI SI200131059A patent/SI2330129T1/sl unknown
- 2001-08-07 SI SI200131036T patent/SI2159230T1/sl unknown
- 2001-08-07 WO PCT/US2001/024785 patent/WO2002012502A2/en active Application Filing
- 2001-08-07 MY MYPI2013001768A patent/MY157289A/en unknown
- 2001-08-07 PT PT16179183T patent/PT3118318T/pt unknown
- 2001-08-07 CN CN201010156291.5A patent/CN101980017B/zh not_active Expired - Lifetime
- 2001-08-07 AU AU2001279227A patent/AU2001279227B2/en active Active
- 2001-08-07 JP JP2002517790A patent/JP4748920B2/ja not_active Expired - Lifetime
- 2001-08-07 ES ES16179183T patent/ES2709335T3/es not_active Expired - Lifetime
- 2001-08-07 HU HU0302376A patent/HU229523B1/hu active Protection Beyond IP Right Term
- 2001-08-07 DK DK01957489T patent/DK1309691T3/da active
- 2001-08-07 IL IL15432701A patent/IL154327A0/xx unknown
- 2001-08-07 AU AU7922701A patent/AU7922701A/xx active Pending
- 2001-08-07 EP EP16179183.5A patent/EP3118318B1/en not_active Expired - Lifetime
-
2003
- 2003-02-06 IL IL154327A patent/IL154327A/en active IP Right Grant
- 2003-02-07 NO NO20030620A patent/NO333378B1/no not_active IP Right Cessation
- 2003-02-07 HR HR20030089A patent/HRP20030089B1/xx not_active IP Right Cessation
- 2003-07-08 HK HK03104875.9A patent/HK1052948B/zh not_active IP Right Cessation
-
2004
- 2004-07-30 US US10/954,900 patent/US7691378B2/en not_active Expired - Lifetime
-
2005
- 2005-07-13 US US11/180,219 patent/US7521206B2/en not_active Expired - Lifetime
-
2008
- 2008-12-11 IL IL195898A patent/IL195898A/en active IP Right Grant
-
2009
- 2009-11-12 CY CY20091101189T patent/CY1109618T1/el unknown
-
2010
- 2010-02-01 LT LTPA2010004C patent/LTPA2010004I1/lt unknown
- 2010-03-02 BE BE2010C014C patent/BE2010C014I2/fr unknown
- 2010-03-12 LU LU91663C patent/LU91663I2/fr unknown
- 2010-03-12 FR FR10C0014C patent/FR10C0014I2/fr active Active
- 2010-04-09 CY CY2010008C patent/CY2010008I2/el unknown
- 2010-07-09 HK HK10106696.2A patent/HK1140494A1/xx not_active IP Right Cessation
-
2011
- 2011-04-12 JP JP2011088687A patent/JP2011188862A/ja not_active Withdrawn
-
2013
- 2013-06-07 NO NO2013012C patent/NO2013012I1/no unknown
-
2014
- 2014-03-17 HU HUS1400015C patent/HUS1400015I1/hu unknown
-
2015
- 2015-01-28 CY CY20151100086T patent/CY1116149T1/el unknown
- 2015-07-03 JP JP2015134150A patent/JP6449113B2/ja not_active Expired - Lifetime
-
2016
- 2016-12-14 CY CY20161101300T patent/CY1118443T1/el unknown
-
2017
- 2017-03-10 LU LU00010C patent/LUC00010I2/en unknown
- 2017-03-16 CY CY2017009C patent/CY2017009I2/el unknown
- 2017-03-20 LT LTPA2017008C patent/LTPA2017008I1/lt unknown
- 2017-08-25 NO NO2017046C patent/NO2017046I1/no unknown
- 2017-09-15 JP JP2017177751A patent/JP6564438B2/ja not_active Expired - Lifetime
-
2018
- 2018-11-08 JP JP2018210798A patent/JP6590428B2/ja not_active Expired - Lifetime
-
2019
- 2019-02-25 CY CY20191100232T patent/CY1121353T1/el unknown
- 2019-05-23 LU LU00121C patent/LUC00121I2/fr unknown
- 2019-05-27 LT LTPA2019013C patent/LTPA2019013I1/lt unknown
- 2019-05-28 CY CY2019029C patent/CY2019029I1/el unknown
- 2019-07-23 JP JP2019135600A patent/JP2019216721A/ja not_active Ceased
-
2020
- 2020-10-21 JP JP2020176492A patent/JP2021036872A/ja active Pending
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9828424B2 (en) | Anti-TNF antibodies, compositions, methods and uses | |
DK3118318T3 (da) | Anti-tnf-antistoffer, sammensætninger, fremgangsmåder og anvendelser | |
AU2001279227A1 (en) | Anti-TNF antibodies, compositions, methods and uses | |
WO2002097048A2 (en) | ANTI-p40 IMMUNOGLOBULIN DERIVED PROTEINS, COMPOSITIONS, METHODS AND USES | |
EP1742968A2 (en) | Il-13 mutein proteins, antibodies, compositions, methods and uses | |
US20030143603A1 (en) | Anti-TNF antibodies, compositions, methods and uses | |
WO2003083061A2 (en) | Anti-tnf antibodies, compositions, methods and uses | |
US8088600B2 (en) | Nucleic acids encoding cynomolgus IL-13 mutein proteins | |
AU2022306144A1 (en) | Manufacturing methods for producing anti-tnf antibody compositions | |
WO2009009782A2 (en) | Cynomolgus il-17 proteins, antibodies, compositions, methods and uses | |
ZA200301856B (en) | Anti-TNF antibodies, compositions, methods and uses. |