WO2019164930A1 - Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use - Google Patents

Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use Download PDF

Info

Publication number
WO2019164930A1
WO2019164930A1 PCT/US2019/018751 US2019018751W WO2019164930A1 WO 2019164930 A1 WO2019164930 A1 WO 2019164930A1 US 2019018751 W US2019018751 W US 2019018751W WO 2019164930 A1 WO2019164930 A1 WO 2019164930A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
chain variable
variable domain
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/018751
Other languages
English (en)
French (fr)
Inventor
Gregory P. CHANG
Ann F. CHEUNG
Asya Grinberg
Dhruv Kam SETHI
William Haney
Bianka Prinz
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Dragonfly Therapeutics Inc
Original Assignee
Dragonfly Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to MX2020008684A priority Critical patent/MX2020008684A/es
Priority to KR1020207026680A priority patent/KR102832460B1/ko
Priority to AU2019225741A priority patent/AU2019225741A1/en
Priority to PE2020001249A priority patent/PE20210110A1/es
Priority to CA3091424A priority patent/CA3091424A1/en
Priority to EA202091977A priority patent/EA202091977A1/ru
Priority to US16/971,104 priority patent/US12215157B2/en
Priority to MYPI2020004294A priority patent/MY208785A/en
Priority to EP19757000.5A priority patent/EP3755721A4/en
Priority to SG11202007945UA priority patent/SG11202007945UA/en
Priority to JP2020566544A priority patent/JP7353576B2/ja
Priority to CN201980026077.7A priority patent/CN112119093A/zh
Application filed by Dragonfly Therapeutics Inc filed Critical Dragonfly Therapeutics Inc
Priority to BR112020016939-0A priority patent/BR112020016939A2/pt
Publication of WO2019164930A1 publication Critical patent/WO2019164930A1/en
Priority to IL276778A priority patent/IL276778A/en
Anticipated expiration legal-status Critical
Priority to US17/736,031 priority patent/US20220380459A1/en
Priority to JP2023141006A priority patent/JP2023164908A/ja
Priority to US18/912,306 priority patent/US20250154261A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/283Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2851Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the lectin superfamily, e.g. CD23, CD72
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/522CH1 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77Internalization into the cell
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the invention relates to multi-specific binding proteins that bind to CD33 (Siglec- 3), and exhibit high potency and maximum lysis of target cells compared to anti-CD33 monoclonal antibodies.
  • Some of the most frequently diagnosed cancers in adults include prostate cancer, breast cancer, and lung cancer. Hematological malignancies, though less frequent than solid cancers, have low survival rates. Current treatment options for these cancers are not effective for all patients and/or can have substantial adverse side effects. Other types of cancer also remain challenging to treat using existing therapeutic options.
  • T cells are major effectors of the adaptive immune system that attack foreign cells as well as host cells that present mutant or mis-expressed peptides.
  • Cells targeted by T cells may be virally-infected, such that they express foreign proteins, or malignant, where they might express mutant proteins.
  • T cells recognize target cells via their T cell receptor (TCR) engaging intracellular peptides presented by major histocompatibility complex proteins on target cells.
  • TCR T cell receptor
  • Bi-specific T cell engagers link antigen binding site(s) of tumor-associated antigens to antigen binding site(s) of components of the TCR complex to redirect T cell activity towards desired target cells independent of native peptide-MHC recognition.
  • Blincyto is an FDA-approved T cell engager that targets CD 19 on malignant B cells.
  • T cells can also be engineered to express chimeric antigen receptors (CAR) that endow it with target recognition capabilities of its CAR.
  • CARs contain antigen binding site(s) to tumor associated antigens linked to T cell activation domains.
  • CAR-T cells can also be employed to target malignant cells, and some have been FDA-approved for use against B cell malignancies.
  • Antibodies that bind to certain tumor-associated antigens and to certain immune cells have been described in the literature. See, e.g, WO 2016/134371 and WO 2015/095412. Antibody-drug conjugates or immunocytokines using antigen binding sites targeting tumor associated antigens to deliver toxic agents or immune-modulatory cytokines to specific target cells.
  • NK cells Natural killer cells are a component of the innate immune system and make up approximately 15% of circulating lymphocytes. NK cells infiltrate virtually all tissues and were originally characterized by their ability to kill tumor cells effectively without the need for prior sensitization. Activated NK cells kill target cells by means similar to cytotoxic T cells - i.e., via cytolytic granules that contain perforin and granzymes as well as via death receptor pathways. Activated NK cells also secrete inflammatory cytokines such as IFN- gamma and chemokines that promote the recruitment of other leukocytes to the target tissue.
  • cytotoxic T cells i.e., via cytolytic granules that contain perforin and granzymes as well as via death receptor pathways.
  • Activated NK cells also secrete inflammatory cytokines such as IFN- gamma and chemokines that promote the recruitment of other leukocytes to the target tissue.
  • NK cells respond to signals through a variety of activating and inhibitory receptors on their surface. For example, when NK cells encounter healthy self-cells, their activity is inhibited through activation of the killer-cell immunoglobulin-like receptors (KIRs). Alternatively, when NK cells encounter foreign cells or cancer cells, they are activated via their activating receptors (e.g, NKG2D, NCRs, DNAM1). NK cells are also activated by the constant region of some immunoglobulins through CD 16 receptors on their surface. The overall sensitivity of NK cells to activation depends on the sum of stimulatory and inhibitory signals. [0010] CD33 is a member of the sialic acid-binding immunoglobulin-like lectins.
  • CD33 As a transmembrane receptor mainly expressed on cells of myeloid lineage, CD33 modulates inflammatory and immune responses through a dampening effect on tyrosine kinase-driven signaling pathways. For example, CD33 was shown to constitutively suppress the production of pro-inflammatory cytokines such as IL- 1 b, TNF-a, and IL-8 by human monocytes.
  • pro-inflammatory cytokines such as IL- 1 b, TNF-a, and IL-8 by human monocytes.
  • CD33 is associated with hematopoietic cancers. It is broadly expressed in blasts of nearly all acute myeloid leukemia (AML). Furthermore, hematopoietic cancer stem and/or progenitor cells are found to be CD33 + , implying that CD33-directed therapy could potentially eradicate malignant stem and/or progenitor cells in such cases while sparing normal hematopoietic stem cells. In addition to its expression in AML, CD33 is found on other myeloid neoplasms (e.g, myelodysplastic syndromes and myeloproliferative neoplasms) and on subsets of B-cell and T-cell acute lymphoblastic leukemias
  • myeloid neoplasms e.g, myelodysplastic syndromes and myeloproliferative neoplasms
  • ALL /lymphoblastic lymphomas. This expression pattern has led to the use of CD33- directed therapeutics in patients with malignancies including AML, myelodysplastic syndromes, chronic myelomonocytic leukemia, myeloid blast crisis of chronic myeloid leukemia, and ALLs.
  • the invention provides multi-specific binding proteins that bind to CD33 on a cancer cell and to the NKG2D receptor and CD 16 receptor on natural killer cells.
  • Such proteins can engage more than one kind of NK activating receptor, and may block the binding of natural ligands to NKG2D.
  • the proteins can agonize NK cells in humans, and in other species such as rodents and cynomolgus monkeys. Various aspects and embodiments of the invention are described in further detail below.
  • the present invention provides a protein that includes a human CD33 antigen -binding site including a heavy chain variable domain, which includes an amino acid sequence at least 90% (e.g ., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
  • 296, 298, 300, or 302 further comprises a second antigen binding site same or different from the antigen-binding site that binds to human CD33.
  • the present invention provides an antigen-binding site in a protein (e.g., a multi-specific binding protein) that binds to CD33 on a cancer cell, and the NKG2D receptor and CD16 receptor on natural killer cells to activate the natural killer cell.
  • a protein e.g., a multi-specific binding protein
  • the binding protein e.g ., a multi-specific binding protein
  • Binding of the protein including an antigen-binding site that binds to CD33, and to NKG2D receptor and CD 16 receptor on natural killer cell enhances the activity of the natural killer cell toward destruction of a cancer cell.
  • Binding of the protein including an antigen -binding site that binds to CD33 (e.g., a multi-specific binding protein) on a cancer cell brings the cancer cell into proximity to the natural killer cell, which facilitates direct and indirect destruction of the cancer cell by the natural killer cell. Further description of exemplary multi-specific binding proteins is provided below.
  • the first component of the multi-specific binding proteins of the present disclosure binds to CD33 -expressing cells, which can include but are not limited to AML, myelodysplastic syndromes, chronic myelomonocytic leukemia, myeloid blast crisis of chronic myeloid leukemia, and ALLs.
  • the second component of the multi-specific binding proteins of the present disclosure binds to NKG2D receptor-expressing cells, which can include but are not limited to NK cells, gd T cells and CD8 + ab T cells.
  • NKG2D receptor-expressing cells can include but are not limited to NK cells, gd T cells and CD8 + ab T cells.
  • the multi-specific binding proteins may block natural ligands, such as ULBP6 and MICA, from binding to NKG2D and activating NKG2D receptors.
  • the NKG2D antigen binding site can include, for example:
  • a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:8l and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 82 [ADI-29379];
  • a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:83 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 84 [ADI-29463];
  • a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:85 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 86 [ADI-27744]; (4) a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:87 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:88 [
  • a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 191 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:88 [A49MI]; or
  • a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:89 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 90 [ADI-29378]
  • the third component for the multi-specific binding proteins of the present disclosure binds to cells expressing CD 16, an Fc receptor on the surface of leukocytes including natural killer cells, macrophages, neutrophils, eosinophils, mast cells, and follicular dendritic cells.
  • any of the foregoing isolated antibodies has a K D of 1 nM or lower, 5 nM or lower, or 12 nM or lower for extracellular domain of human CD33, as measured by surface plasmon resonance (SPR) (e.g, using the Biacore method described in Example 1 infra ) or by bio-layer interferometry (BLI) (e.g, using the Octet method described in Example 1 infra), and/or binds CD33 from a body fluid, tissue, and/or cell of a subject.
  • SPR surface plasmon resonance
  • BLI bio-layer interferometry
  • any of the foregoing isolated antibodies has a K d (i.e., off-rate, also called K 0ff ) equal to or lower than 1 c 10 5 , 1 c 10 4 , 1 c 10 3 , 5 c 10 3 , 0.01, 0.02, or 0.05 l/s, as measured by SPR (e.g, using the Biacore method described in Example 1 infra) or by BLI (e.g, using the Octet method described in Example 1 infra).
  • K d i.e., off-rate, also called K 0ff
  • Some proteins of the present disclosure bind to NKG2D with a K D of 10 nM or weaker affinity.
  • the invention provides one or more isolated nucleic acids comprising sequences encoding an immunoglobulin heavy chain and/or immunoglobulin light chain variable region of any one of the foregoing antibodies.
  • the invention provides one or more expression vectors that express the immunoglobulin heavy chain and/or immunoglobulin light chain variable region of any one of the foregoing antibodies.
  • the invention provides host cells comprising one or more of the foregoing expression vectors and/or isolated nucleic acids.
  • Formulations including any of the proteins that include a CD33-binding domain described herein and methods of enhancing tumor cell death using these proteins and/or formulations are also provided.
  • the invention provides a method of treating a cancer, for example, a CD33 -associated cancer, in a subject.
  • the method comprises administering to the subject an effective amount of a protein containing any CD33-binding domain described herein, for example, a multi-specific protein containing a CD33binding domain, an NKG2D- binding domain and a CD 16-binding domain, to treat the cancer in the subject.
  • the invention provides a method of inhibiting cancer growth, for example, the growth of a CD33 -associated cancer, in a subject.
  • the method comprises exposing the subject to an effective amount of an antibody comprising any CD33-binding domain described herein, for example, a multi-specific protein containing an CD33 -binding domain, an NKG2D-binding domain and a CD 16-binding domain, to inhibit cancer growth in the subject.
  • Another aspect of the invention provides a method of treating cancer in a patient.
  • the method comprises administering to a patient in need thereof a therapeutically effective amount of the multi-specific binding protein described herein.
  • Exemplary cancers for treatment using the multi-specific binding proteins include, for example, wherein the cancer is selected from the group consisting of AML, myelodysplastic syndromes, chronic myelomonocytic leukemia, myeloid blast crisis of chronic myeloid leukemia, and ALLs.
  • Another aspect of the invention provides a protein comprising:
  • a second antigen-binding site comprising a single-chain variable fragment (scFv) that binds CD33 comprising a heavy chain variable domain and a light chain variable domain;
  • scFv is linked to the antibody Fc domain or a portion thereof sufficient to bind CD 16, or the third antigen-binding site that binds CD 16, via a hinge comprising Ala-Ser or Gly-Ala-Ser.
  • the scFv is linked to the antibody Fc domain.
  • the heavy chain variable domain of the scFv forms a disulfide bridge with the light chain variable domain of the scFv.
  • the disulfide bridge is formed between C44 from the heavy chain variable domain and Cl 00 from the light chain variable domain.
  • the scFv is linked to the antibody Fc domain, wherein the light chain variable domain of the scFv is positioned at the N-terminus of the heavy chain variable domain of the scFv, and is linked to the heavy chain variable domain of the scFv via a flexible linker (GlyGlyGlyGlySer)4 ((G4S)4), and the Fab is linked to the antibody Fc domain.
  • the present invention provides a protein as disclosed herein, wherein the heavy chain variable domain of the scFv is linked to the light chain variable domain of the scFv via a flexible linker.
  • the flexible linker comprises (GlyGlyGlyGlySer)4 ((G4S)4).
  • the present invention provides a protein as disclosed herein, wherein the heavy chain variable domain of the scFv is positioned at the N-terminus or the C-terminus of the light chain variable domain of the scFv. In certain embodiments, the light chain variable domain of the scFv is positioned at the N-terminus of the heavy chain variable domain of the scFv.
  • the present invention provides a protein as disclosed herein, wherein the Fab fragment is linked to the antibody Fc domain or a portion thereof sufficient to bind CD 16 or the third antigen-binding site that binds CD 16.
  • the heavy chain portion of the Fab fragment comprises a heavy chain variable domain and a CH1 domain, and wherein the heavy chain variable domain is linked to the CH1 domain.
  • the Fab fragment is linked to the antibody Fc domain.
  • the first antigen-binding site that binds NKG2D comprises a heavy chain variable domain comprising complementarity-determining region 1 (CDR1), complementarity-determining region 2 (CDR2), and complementarity-determining region 3 (CDR3) sequences represented by the amino acid sequences of SEQ ID NOs:93, 94, and 95, respectively; and a light chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs:96, 97, and 98, respectively.
  • CDR1 complementarity-determining region 1
  • CDR2 complementarity-determining region 2
  • CDR3 complementarity-determining region 3
  • the first antigen-binding site that binds NKG2D comprises a heavy chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs:99, 100, and 101, respectively; and a light chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: l02, 103, and 104, respectively.
  • the first antigen-binding site that binds NKG2D comprises a heavy chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: l05, 106, and 107, respectively; and a light chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 108, 109, and 110, respectively.
  • the first antigen-binding site that binds NKG2D comprises a heavy chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 192, 112, and 193, respectively; and a light chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 114, 115, and 116, respectively.
  • the first antigen-binding site that binds NKG2D comprises a heavy chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 192, 112, and 195, respectively; and a light chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 114, 115, and 116, respectively.
  • the first antigen-binding site that binds NKG2D comprises a heavy chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 117, 118, and 119, respectively; and a light chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: 120, 121, and 122, respectively.
  • the first antigen-binding site that binds NKG2D comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:8l and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:82.
  • a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:82.
  • the first antigen-binding site that binds NKG2D comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:83 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:84.
  • the first antigen-binding site that binds NKG2D comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%,
  • the first antigen-binding site that binds NKG2D comprises a heavy chain variable domain comprising an amino acid sequence at least 90% ( e.g ., 91%, 92%, 93%,
  • the first antigen-binding site that binds NKG2D comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%,
  • the first antigen-binding site that binds NKG2D comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%,
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: l8l, 46, and 182, respectively; and a light chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs:48, 49, and 50, respectively.
  • a heavy chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: l8l, 46, and 182, respectively
  • a light chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs:48, 49, and 50, respectively.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs: l83, 34, and 184, respectively; and a light chain variable domain comprising CDR1, CDR2, and CDR3 sequences represented by the amino acid sequences of SEQ ID NOs:36, 185, and 38, respectively.
  • the second antigen -binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:9 and a light chain variable domain comprising an amino acid sequence at least 90%
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:5 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:6.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g ., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: l and a light chain variable domain comprising an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:2.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 3 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:4.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:7 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:8.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 11 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 12.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 13 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 14.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 15 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 16.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 17 and a light chain variable domain comprising an amino acid sequence at least 90% ( e.g ., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 18.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 19 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:20.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:266 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:267.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:268 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:269.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:270 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:27l.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:272 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:273.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:274 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:275.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:276 and a light chain variable domain comprising an amino acid sequence at least 90% ( e.g ., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:277.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:278 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:279.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:280 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:28l .
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:282 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:283.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:284 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:285.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:286 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:287.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:288 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:289.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g ., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:290 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:29l .
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:292 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:293.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:294 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:295.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:296 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:297.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:298 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:299.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:300 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:30l .
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 302 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 303.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:4l8 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:4l9.
  • the second antigen-binding site that binds CD33 comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:420 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:42l.
  • the present invention provides a protein disclosed herein comprising a sequence selected from SEQ ID NO:l88, SEQ ID NO: l98, SEQ ID NO:206, SEQ ID NO:207, SEQ ID NO:208, SEQ ID NO:209, SEQ ID NO:2lO, SEQ ID NO:2l 1, SEQ ID NO:2l2, SEQ ID NO:2l3, SEQ ID NO:2l4, SEQ ID NO:2l5, SEQ ID NO:2l6, SEQ ID NO:2l7, SEQ ID NO:2l8, SEQ ID NO:2l9, SEQ ID NO:220, SEQ ID NO:22l, SEQ ID NO:222, SEQ ID NO:223, SEQ ID NO:447, SEQ ID NO:448, SEQ ID NO:449, SEQ ID NO:450, SEQ ID NO:45l, SEQ ID NO:452, SEQ ID NO:453, SEQ ID NO:454, SEQ ID NO:455, SEQ ID NO:451, SEQ ID NO:
  • the present invention provides a multi-specific binding protein disclosed herein comprising an scFv linked to an antibody Fc domain, wherein the scFv linked to the antibody Fc domain is represented by a sequence selected from SEQ ID NO: 187, SEQ ID NO: 197, SEQ ID NO:224, SEQ ID NO:225, SEQ ID NO:226, SEQ ID NO: 187, SEQ ID NO: 197, SEQ ID NO:224, SEQ ID NO:225, SEQ ID NO:226, SEQ ID NO: 187, SEQ ID NO: 197, SEQ ID NO:224, SEQ ID NO:225, SEQ ID NO:226, SEQ ID NO: 187, SEQ ID NO: 197, SEQ ID NO:224, SEQ ID NO:225, SEQ ID NO:226, SEQ ID NO: 187, SEQ ID NO: 197, SEQ ID NO:224, SEQ ID NO:225, SEQ ID NO:226, SEQ ID NO: 187, SEQ ID NO: 197
  • the present invention provides a protein disclosed herein comprising a sequence selected from SEQ ID NO:l89, SEQ ID NO: l96, SEQ ID NO:244, and SEQ ID NO:245.
  • the present invention provides a protein disclosed herein comprising a sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to an amino acid sequence selected from SEQ ID NO: 188, SEQ ID NO: 198, SEQ ID NO:206, SEQ ID NO:207, SEQ ID NO:208, SEQ ID NO:209, SEQ ID NO:2lO, SEQ ID NO:2l 1, SEQ ID NO:2l2, SEQ ID NO:2l3, SEQ ID NO:2l4, SEQ ID NO:2l5, SEQ ID NO:2l6, SEQ ID NO:2l7, SEQ ID NO:2l8, SEQ ID NO:2l9, SEQ ID NO:220, SEQ ID NO:22l, SEQ ID NO:222, SEQ ID NO:223, SEQ ID NO:447, SEQ ID NO:448, SEQ ID NO:449, SEQ ID NO: 188, SEQ
  • the present invention provides a protein disclosed herein comprising a sequence at least 99% identical to an amino acid sequence selected from SEQ ID NO: 188, SEQ ID NO: 198, SEQ ID NO:206, SEQ ID NO:207, SEQ ID NO:208, SEQ ID NO:209, SEQ ID NO:2lO, SEQ ID NO:2l 1, SEQ ID NO:2l2, SEQ ID NO:2l3, SEQ ID NO:2l4,
  • SEQ ID NO:2l5 SEQ ID NO:2l6, SEQ ID NO:2l7, SEQ ID NO:2l8, SEQ ID NO:2l9,
  • SEQ ID NO:453 SEQ ID NO:454, SEQ ID NO:455, SEQ ID NO:456, SEQ ID NO:457,
  • SEQ ID NO:458 SEQ ID NO:459, SEQ ID NO:460, SEQ ID NO:46l, SEQ ID NO:462,
  • the present invention provides a protein disclosed herein comprising a sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to an amino acid sequence selected from SEQ ID NO: 187, SEQ ID NO: 197, SEQ ID NO:224, SEQ ID NO:225, SEQ ID NO:226, SEQ ID NO:227, SEQ ID NO:228, SEQ ID NO:229, SEQ ID NO:230, SEQ ID NO:23 l, SEQ ID NO:232, SEQ ID NO:233, SEQ ID NO:234, SEQ ID NO:235, SEQ ID NO:236, SEQ ID NO:237, SEQ ID NO:238, SEQ ID NO:239, SEQ ID NO:240, SEQ ID NO:24l, SEQ ID NO:242, and SEQ ID NO:243.
  • the present invention provides a protein disclosed herein comprising a sequence at least 95% identical to an amino acid sequence selected from SEQ ID NO: 187, SEQ ID NO: 197, SEQ ID NO:224, SEQ ID NO:225, SEQ ID NO:226, SEQ ID NO:227, SEQ ID NO:228, SEQ ID NO:229, SEQ ID NO:230, SEQ ID NO:23 l, SEQ ID NO:232, SEQ ID NO:233, SEQ ID NO:234, SEQ ID NO:235, SEQ ID NO:236, SEQ ID NO:237, SEQ ID NO:238, SEQ ID NO:239, SEQ ID NO:240, SEQ ID NO:24l, SEQ ID NO:242, and SEQ ID NO:243.
  • the present invention provides a protein disclosed herein comprising a sequence at least 99% identical to an amino acid sequence selected from SEQ ID NO: 187, SEQ ID NO: 197, SEQ ID NO:224, SEQ ID NO:250, SEQ ID NO
  • Another aspect of the present invention provides a formulation comprising a protein as disclosed herein, and a pharmaceutically acceptable carrier.
  • Another aspect of the present invention provides a method of treating a CD33- expressing cancer, the method comprising administering a therapeutically effective amount of a protein or formulation thereof disclosed herein to a subject in need thereof.
  • the cancer is selected from the group consisting of acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), acute lymphoblastic leukemia (ALL), myeloproliferative neoplasms (MPNs), lymphoma, non-Hodgkin lymphomas, and classical Hodgkin lymphoma.
  • AML acute myeloid leukemia
  • MDS myelodysplastic syndrome
  • ALL acute lymphoblastic leukemia
  • MPNs myeloproliferative neoplasms
  • lymphoma lymphoma
  • non-Hodgkin lymphomas non-Hodgkin lymphomas
  • classical Hodgkin lymphoma classical Hodgkin lymphoma
  • undifferentiated acute myeloblastic leukemia acute myeloblastic leukemia with minimal maturation, acute myeloblastic leukemia with maturation, acute promyelocytic leukemia (APL), acute myelomonocytic leukemia, acute myelomonocytic leukemia with eosinophilia, acute monocytic leukemia, acute erythroid leukemia, acute megakaryoblastic leukemia (AMKL), acute basophilic leukemia, acute panmyelosis with fibrosis, and blastic
  • APL acute myelomonocytic leukemia
  • ALM acute megakaryoblastic leukemia
  • acute basophilic leukemia acute panmyelosis with fibrosis
  • blastic leukemia acute myeloblastic leukemia with minimal maturation
  • acute myeloblastic leukemia with maturation acute promyelocytic leukemia
  • APL acute myelomonoc
  • the AML is characterized by expression of CLL-l on the AML leukemia stem cells (LSCs).
  • LSCs further express a membrane marker selected from CD34, CD38, CD123, TIM3, CD25, CD32, and CD96.
  • the AML is a minimal residual disease (MRD).
  • MRD minimal residual disease
  • the MRD is characterized by the presence or absence of a mutation selected from FLT3-ITD ((Fms-like tyrosine kinase 3)-intemal tandem duplications (LTD)), NPM1 (Nucleophosmin 1), DNMT3A (DNA methyltransferase gene DNMT3A), and IDH (Isocitrate dehydrogenase 1 and 2 (IDH1 and IDH2)).
  • FLT3-ITD (Fms-like tyrosine kinase 3)-intemal tandem duplications (LTD)
  • NPM1 Nucleophosmin 1
  • DNMT3A DNA methyltransferase gene DNMT3A
  • IDH Isocitrate dehydrogenase 1 and 2 (IDH1 and IDH2)
  • the MDS is selected from MDS with multilineage dysplasia (MDS-MLD), MDS with single lineage dysplasia (MDS-SLD), MDS with ring sideroblasts (MDS-RS), MDS with excess blasts (MDS-EB), MDS with isolated del(5q), and MDS, unclassified (MDS-U).
  • MDS-MLD MDS with multilineage dysplasia
  • MDS-SLD MDS with single lineage dysplasia
  • MDS-RS MDS with ring sideroblasts
  • MDS-EB MDS with excess blasts
  • MDS-U MDS with isolated del(5q)
  • MDS-U unclassified
  • the MDS is a primary MDS or a secondary MDS.
  • the ALL is selected from B-cell acute lymphoblastic leukemia (B-ALL) and T-cell acute lymphoblastic leukemia (T-ALL).
  • B-ALL B-cell acute lymphoblastic leukemia
  • T-ALL T-cell acute lymphoblastic leukemia
  • the MPN is selected from polycythaemia vera, essential thrombocythemia (ET), and myelofibrosis.
  • the non-Hodgkin lymphoma is selected from B-cell lymphoma and T-cell lymphoma.
  • the lymphoma is selected from chronic lymphocytic leukemia (CLL), lymphoblastic lymphoma (LPL), diffuse large B-cell lymphoma (DLBCL), Burkitt lymphoma (BL), primary mediastinal large B-cell lymphoma (PMBL), follicular lymphoma, mantle cell lymphoma, hairy cell leukemia, plasma cell myeloma (PCM) or multiple myeloma (MM), mature T/NK neoplasms, and histiocytic neoplasms.
  • CLL chronic lymphocytic leukemia
  • LPL lymphoblastic lymphoma
  • DLBCL diffuse large B-cell lymphoma
  • BL Burkitt lymphoma
  • PMBL primary mediastinal large B-cell lymphoma
  • follicular lymphoma mantle cell lymphoma
  • hairy cell leukemia plasma cell myeloma (PCM) or
  • FIG. 1 shows a structural representation of the extracellular domain of human CD33 extracellular domain (ECD).
  • CD33 ECD contains two prominent domains: distal V domain and membrane proximal C domain. Ligand binding interface is located on the V domain. Function of the C domain is unknown.
  • ECD of CD33 is heavily glycosylated, with 2 N-linked glycosylation sites located in the V domain and 3 N-linked glycosylation sites located in the C domain.
  • ECD of human CD33 contains several SNPs, with most prominent mutation R69G that is found in 42% patients. SNP R69G is in the V domain.
  • FIG. 2 shows an alignment of the primary sequences of full length human and cyno CD33 (SEQ ID NO:598 and SEQ ID NO:599, respectively). V domain is underlined in blue, C domain is underlined in green. Difference in sequences are framed in red.
  • FIGs. 3A-3K show SPR profiles of Fab fragments from CD33 monoclonal antibodies binding to human CD33 ECD measured by Biacore at 37 °C. Each Fab fragment includes a CD33-binding clone described herein.
  • FIG. 3A is a Biacore profile of ADI-10159;
  • FIG. 3B is a Biacore profile of ADI-10177;
  • FIG. 3C is a Biacore profile of ADI-l 1776;
  • FIG. 3D is a Biacore profile of ADI-l 1801;
  • FIG. 3E is a Biacore profile of ADI-l 1807;
  • FIG. 3F is a Biacore profile of ADI-l 1809;
  • FIG. 3A is a Biacore profile of ADI-10159;
  • FIG. 3B is a Biacore profile of ADI-10177;
  • FIG. 3C is a Biacore profile of ADI-l 1776;
  • FIG. 3D is a Bia
  • 3G is a Biacore profile of ADI-l 1815;
  • FIG. 3H is a Biacore profile of ADI-l 1819;
  • FIG. 31 is a Biacore profile of ADI-l 1830;
  • FIG. 3J is a Biacore profile of ADI-l 1835; and
  • FIG. 3K is a Biacore profile of Fab fragment from
  • FIGs. 4A-4H show SPR profiles of Fab fragments from CD33 monoclonal antibodies binding to cyno CD33 ECD measured by Biacore at 37 °C. Each Fab fragment includes a CD33-binding clone described herein.
  • FIG. 4A is a Biacore profile of ADI-10159;
  • FIG. 4B is a Biacore profile of ADI-10177;
  • FIG. 4C is a Biacore profile of ADI-l 1776;
  • FIG. 4D is a Biacore profile of ADI-l 1807;
  • FIG. 4E is a Biacore profile of ADI-l 1809;
  • FIG. 4F is a Biacore profile of ADI-l 1819;
  • FIG. 4A is a Biacore profile of ADI-10159;
  • FIG. 4B is a Biacore profile of ADI-10177;
  • FIG. 4C is a Biacore profile of ADI-l 1776;
  • FIG. 4D is
  • FIGs. 5A-5T show SPR profiles of FABs from CD33 monoclonal antibodies binding to V domain and C domain of human CD33 measured at 37 °C. Each Fab fragment includes a CD33-binding clone described herein.
  • FIGs. 5A-5J represent binding to the V- domain; panels K-T represent binding to the C domain.
  • FIGs. 5A and 5K are Biacore profiles of ADI-10159;
  • FIGs. 5B and 5L are Biacore profiles of ADI-10177;
  • FIGs. 5C and 5M are Biacore profiles of ADI-l 1776; FIGs.
  • 5D and 5N are Biacore profiles of ADI-l 1801;
  • FIGs. 5E and 50 are Biacore profiles of ADI-l 1807;
  • FIGs. 5F and 5P are Biacore profiles of ADI-l 1809;
  • FIGs. 5G and 5Q are Biacore profiles of ADI-l 1815;
  • FIGs. 5H and 5R are Biacore profiles of ADI-l 1819;
  • FIGs. 51 and 5S are Biacore profiles of ADI-l 1830; and
  • FIGs. 5J and 5T are Biacore profiles of ADI-l 1835.
  • FIGs. 6A-6D show SPR profiles of an Fab that comprises ADI-l 1815 binding to different domains of human CD33 and human CD33 having an R69G point mutation.
  • FIG. 6A Fab binding to human CD33 ECD
  • FIG. 6B Fab binding to V domain
  • FIG. 6C Fab binding to C domain
  • FIG. 6D Fab binding to human CD33 having R69G.
  • FIGs. 7A-7D show SPR profiles of a Fab that comprises ADI-l 1801 binding to different domains of human CD33 and human CD33 having an R69G point mutation.
  • FIG. 7A human CD33 ECD
  • FIG. 7B V domain
  • FIG. 7C C domain
  • FIG. 7D human CD33 having R69G.
  • FIG. 8 are bar graphs showing binding of monoclonal antibodies comprising
  • CD33-binding clones to CD33 expressed on Molm-l3 human AML cells CD33 antibody Lintuzumab was also tested, and mean fluorescence intensity (MFI) was plotted. Five of the six antibodies show higher binding signal to CD33 compared to Lintuzumab.
  • FIG. 9 are bar graphs showing internalization of CD33 antibodies on Molm-l3 cells after 24 hours. All the CD33 antibodies showed similar internalization after 24 hours. Lintuzumab showed slightly higher internalization compare to other anti-CD33 antibodies.
  • FIGs. 10A-10B show binding of CD33 -targeting TriNKETs to human NKG2D expressed on EL4-hNKG2D and KHYG-l cells.
  • FIG. 10A shows binding of CD33 -targeting TriNKETs to human NKG2D recombinantly expressed on EL4 cells.
  • FIG. 10B shows binding of CD33 -targeting TriNKETs to human NKG2D expressed on KHYG-l cells.
  • signal fold-over-background (FOB) was similar on both EL4-hNKG2D cells and KHYG-l cells, and the rank of binding was also maintain on both cell lines.
  • FIG. 11 shows binding of CD33-targeting TriNKETs to CD33 expressed on human AML Molm-l3 cells.
  • Four different CD33-binding clones were used with five NKG2D-binding clones to make a total of 20 different TriNKETs.
  • NKG2D-binding domains TriNKET do not affect the binding of CD33-binding clones to CD33.
  • FIG. 12 is a graph showing that rested human NK cells are activated by CD33- targeting TriNKETs in co-culture with CD33 -expressing THP-l AML cells.
  • FIG. 13 is a bar graph showing that CD33 TriNKETs induce rested NK cell mediated killing of Molm-l3 AML cells.
  • FIG. 14 is a bar graph showing that CD33 TriNKETs induce activated NK cell mediated killing of THP-l cells.
  • FIG. 15A are line graphs showing that TriNKETs mediate KHYG-l killing of Molm-l3 AML cells.
  • FIG. 15B are line graphs showing that TriNKETs mediate rested human NK cell killing of Molm-l3 human AML cells.
  • FIG. 16 are line graphs showing that TriNKETs mediate KHYG-l killing of EOL-l AML cells.
  • FIG. 17A are line graphs showing that TriNKETs mediate KHYG-l killing of THP-l cells.
  • FIG. 17B are line graphs showing that TriNKETs mediate rested human NK cell killing of THP-l human AML cells.
  • FIG. 18 is a representation of a multispecific binding protein that contains an NKG2D-binding domain (right arm), a CD33-binding domain (left arm), and an Fc domain or a portion thereof that binds to CD 16.
  • FIG. 19 is a representation of a multispecific binding protein that includes a NKG2D-binding domain or a CD33 -binding domain, either one of which can be in a scFv format, and an Fc domain or a portion thereof that binds to CD 16.
  • FIG. 20 is a representation of a TriNKET in the Triomab form, which is a trifunctional, bispecific antibody that maintains an IgG-like shape.
  • This chimera consists of two half antibodies, each with one light and one heavy chain, that originate from two parental antibodies.
  • FIG. 21 is a representation of a TriNKET in the KiH Common Light Chain (LC) form, which involves the knobs-into-holes (KIHs) technology.
  • KiH is a heterodimer containing 2 Fabs binding to target 1 and 2, and an Fc stabilized by heterodimerization mutations.
  • TriNKET in the KiH format may be an heterodimeric construct with 2 Fabs binding to target 1 and target 2, containing two different heavy chains and a common light chain that pairs with both heavy chains.
  • FIG. 22 is a representation of a TriNKET in the dual-variable domain
  • DVD-IgTM immunoglobulin
  • DVD-IgTM is a homodimeric construct where variable domain targeting antigen 2 is fused to the N terminus of variable domain of Fab targeting antigen 1 Construct contains normal Fc.
  • FIG. 23 is a representation of a TriNKET in the Orthogonal Fab interface (Ortho- Fab) form, which is an heterodimeric construct that contains 2 Fabs binding to target 1 and target 2 fused to Fc. LC-HC pairing is ensured by orthogonal interface. Heterodimerization is ensured by mutations in the Fc.
  • FIG. 24 is a representation of a TrinKET in the 2-in-l Ig format.
  • FIG. 25 is a representation of a TriNKET in the ES form, which is an
  • heterodimeric construct containing two different Fabs binding to target 1 and target 2 fused to the Fc. Heterodimerization is ensured by electrostatic steering mutations in the Fc.
  • FIG. 26 is a representation of a TriNKET in the Fab Arm Exchange form:
  • Fab Arm Exchange form (cFae) is a heterodimer containing 2 Fabs binding to target 1 and 2, and an Fc stabilized by heterodimerization mutations.
  • FIG. 27 is a representation of a TriNKET in the SEED Body form, which is an heterodimer containing two Fabs binding to target 1 and 2, and an Fc stabilized by
  • FIG. 28 is a representation of a TriNKET in the LuZ-Y form, in which leucine zipper is used to induce heterodimerization of two different HCs.
  • LuZ-Y form is a heterodimer containing two different scFabs binding to target 1 and 2, fused to Fc.
  • FIG. 29 is a representation of a TriNKET in the Cov-X-Body form.
  • FIGs. 30A-30B represent TriNKETs in the kl-Body forms, which are an heterodimeric constructs with two different Fabs fused to Fc stabilized by heterodimerization mutations: Fabl targeting antigen 1 contains kappa LC, while second Fab targeting antigen 2 contains lambda LC.
  • FIG. 30A is an exemplary representation of one form of a kl-Body;
  • FIG. 30B is an exemplary representation of another kl-Body.
  • FIG. 31 is an Oasc-Fab heterodimeric construct that includes Fab binding to target 1 and scFab binding to target 2 fused to Fc. Heterodimerization is ensured by mutations in the Fc.
  • FIG. 32 is a DuetMab, which is an heterodimeric construct containing two different Fabs binding to antigens 1 and 2, and Fc stabilized by heterodimerization mutations.
  • Fab 1 and 2 contain differential S-S bridges that ensure correct light chain (LC) and heavy chain (HC) pairing.
  • FIG. 33 is a CrossmAb, which is an heterodimeric construct with two different Fabs binding to targets 1 and 2 fused to Fc stabilized by heterodimerization.
  • CL and CH1 domains and VH and VL domains are switched, e.g CH1 is fused in-line with VL, while CL is fused in-line with VH.
  • FIG. 34 is a Fit-Ig, which is a homodimeric constructs where Fab binding to antigen 2 is fused to the N terminus of HC of Fab that binds to antigen 1.
  • the construct contains wild-type Fc.
  • FIG. 35 is a graph showing binding of A49-F3’-TriNKET-I07 and I07-F405L mAb to cell surface human NKG2D expressed on EL4 cells.
  • FIGs. 36A-36B are graphs showing binding of A49-F3’-TriNKET-I07 and 107- F405L mAb to CD33 + human AML cell lines Mv4-l 1 (FIG. 36A) and Molm-l3 (FIG. 36B).
  • FIGs. 37A-37B are graphs showing internalization of A49-F3’-TriNKET-I07 and I07-F405L mAb after incubation with EOL-l cells (FIG. 37A) and Molm-l3 cells (FIG.
  • FIGs. 38A-38D are graphs showing specific lysis of Molm-l3 (FIG. 38A), EOL-l (FIG. 38B), and THEM (FIGs. 38C and 38D) human AML cells by rested human NK cells in the presence of A49-F3’-TriNKET-I07 and anti-CD33 monoclonal antibodies.
  • FIG. 39 is a series of flow cytograms showing the expression level of CD3, CD8, NKG2D, and CD 16 on isolated primary CD8 + T cells.
  • FIGs. 40A-40B are graphs showing specific lysis of Molm-l3 cells by isolated primary CD8 + T cells in the presence of A49-F3’-TriNKET-I07, A49-F3’-TriNKET-H76, a non-target TriNKET, or I07-F405L mAb (denoted as 107 in the figures).
  • the primary CD8 + T cells in FIG. 40A were isolated from PBMCs of donor 1, and the primary CD8 + T cells in FIG. 40B were isolated from PBMCs of donor 2.
  • the dotted lines indicate specific lysis of Molm-l3 cells by CD8 + T cells in the absence of TriNKET or antibody.
  • FIGs. 41A-41E are histograms showing the binding of A49-F3’-TriNKET-I07 to NK cells (FIG. 41A), CD8 + T cells (FIG. 41B), CD4 + T cells (FIG. 41C), B cells (FIG. 41D), and monocytes (FIG. 41E) in human whole blood.
  • the dotted lines without fill represent binding of A49-F3’-TriNKET-I07 to the cells; the solid lines with fill represent binding of human IgGl isotype control to the cells.
  • FIGs. 42A-42B are graphs showing CD33 expression on monocytes.
  • FIG. 42 A shows CD33 expression on monocytes from four healthy donors (dark gray) and Molm-l3 (light grey). The bottom five rows are signals from the cell samples stained with an anti- CD33 antibody; the top five rows are signals from the same samples stained with an isotype antibody.
  • FIG. 42B shows CD33 expression on monocytes from the same donor before (light grey) and after (dark grey) negative selection for monocytes.
  • FIGs. 43A-43B are graphs showing long-term cytotoxicity of NK cells against Molm-l3 AML cells and human primary monocytes in the presence of A49-F3’-TriNKET- 107. Proliferation of the target cells are plotted against the time of co-culture with NK cells in the presence of A49-F3’ -TriNKET -107 or PMA + ionomycin.
  • FIG. 43A represents the results from an experiment using NK cells from one donor
  • FIG. 43B represents the results from another experiment using NK cells from a different donor.
  • FIG. 44 illustrates a trispecific antibody (TriNKET) that contains a CD33-binding scFv, a NKG2D-targeting Fab, and a heterodimerized antibody constant domain that binds CD 16.
  • the antibody format is referred to herein as F3’ -TriNKET.
  • the invention provides multi-specific binding proteins that bind a CD33 on a cancer cell and the NKG2D receptor and CD 16 receptor on natural killer cells to activate the natural killer cell, pharmaceutical compositions comprising such multi-specific binding proteins, and therapeutic methods using such multi -specific proteins and pharmaceutical compositions, including for the treatment of cancer.
  • multi-specific binding proteins that bind a CD33 on a cancer cell and the NKG2D receptor and CD 16 receptor on natural killer cells to activate the natural killer cell
  • pharmaceutical compositions comprising such multi-specific binding proteins
  • therapeutic methods using such multi -specific proteins and pharmaceutical compositions including for the treatment of cancer.
  • the invention provides a multi-specific binding protein comprising an antigen binding site that binds an epitope on an extracellular domain of human CD33 and/or Cynomolgus/Rhesus (cyno) CD33.
  • the present invention provides an antigen binding site that recognizes and binds one or more conformational epitopes on the extracellular domain of human CD33 and/or Cynomolgus/Rhesus (cyno) CD33.
  • the present invention provides an antigen binding site that recognizes and binds one or more conformational epitopes on the extracellular domain of human CD33 but does not recognize and/or bind one or more conformational epitopes on the extracellular domain of cyno CD33.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33.
  • the present invention provides an antigen binding site that binds to wild-type human CD33 but not the R69G allele of human CD33.
  • the present invention provides an antigen binding site that binds to an epitope on human CD33 that includes R69.
  • the present invention provides an antigen binding site that binds to the S128N allele of human CD33. In one aspect, the present invention provides an antigen binding site that binds to wild-type human CD33 but not the S128N allele of human CD33. In one aspect, the present invention provides an antigen binding site that binds to an epitope on human CD33 that includes S128. In one aspect, the present invention provides an antigen binding site including a heavy chain variable domain, which binds to the extracellular domain in human CD33 and/or cyno CD33, irrespective of the glycosylation profile of the targeted CD33.
  • the present invention provides a multi-specific binding protein comprising an antigen binding site, which binds to the extracellular domain in human CD33 and/or cyno CD33, such that the epitopes are unique compared to the epitopes targeted by one or more known anti-CD33 antibodies in the art.
  • the present invention provides an antigen binding site, which binds to the extracellular domain in human CD33 and/or cyno CD33, and shows human or Cynomolgus/Rhesus (cyno) CD33 cross reactivity and high affinity binding to the target CD33.
  • the term "antigen -binding site” refers to the part of the immunoglobulin molecule that participates in antigen binding.
  • the antigen binding site is formed by amino acid residues of the N-terminal variable ("V") regions of the heavy ("H") and light (“L”) chains.
  • V N-terminal variable
  • H heavy
  • L light
  • Three highly divergent stretches within the V regions of the heavy and light chains are referred to as “hypervariable regions" which are interposed between more conserved flanking stretches known as “framework regions,” or "FR.”
  • FR refers to amino acid sequences which are naturally found between and adjacent to hypervariable regions in immunoglobulins.
  • the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen binding surface.
  • the antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as "complementarity-determining regions," or "CDRs.”
  • CDRs complementarity-determining regions
  • the antigen-binding site is formed by a single antibody chain providing a“single domain antibody.”
  • Antigen-binding sites can exist in an intact antibody, in an antigen-binding fragment of an antibody that retains the antigen binding surface, or in a recombinant polypeptide such as an scFv, using a peptide linker to connect the heavy chain variable domain to the light chain variable domain in a single polypeptide. All the amino acid positions in heavy or light chain variable regions disclosed herein are numbered according to Kabat number
  • the CDRs of an antigen-binding site can be determined by the methods described in Kabat et al., J. Biol. Chem. 252, 6609-6616 (1977) and Kabat et al., Sequences of protein of immunological interest. (1991), Chothia et al., J. Mol. Biol. 196:901-917 (1987), and MacCallum et al., J. Mol. Biol. 262:732-745 (1996).
  • the CDRs determined under these definitions typically include overlapping or subsets of amino acid residues when compared against each other.
  • the term“CDR” is a CDR as defined by
  • CDR is a CDR as defined by Kabat et al., J. Biol. Chem. 252, 6609- 6616 (1977) and Kabat et al., Sequences of protein of immunological interest. (1991).
  • heavy chain CDRs and light chain CDRs of an antibody are defined using different conventions.
  • the heavy chain CDRs are defined according to MacCallum ⁇ supra), and the light CDRs are defined according to Kabat ⁇ supra).
  • CDRH1, CDRH2 and CDRH3 denote the heavy chain CDRs
  • CDRL1, CDRL2 and CDRL3 denote the light chain CDRs.
  • the terms“subject” and“patient” refer to an organism to be treated by the methods and compositions described herein. Such organisms preferably include, but are not limited to, mammals ⁇ e.g, murines, simians, equines, bovines, porcines, canines, felines, and the like), and more preferably include humans.
  • the term“effective amount” refers to the amount of a compound ⁇ e.g, a compound of the present invention) sufficient to effect beneficial or desired results.
  • an effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route.
  • the term“treating” includes any effect, e.g, lessening, reducing, modulating, ameliorating or eliminating, that results in the improvement of the condition, disease, disorder, and the like, or ameliorating a symptom thereof.
  • the term“pharmaceutical composition” refers to the combination of an active agent with a carrier, inert or active, making the composition especially suitable for diagnostic or therapeutic use in vivo or ex vivo.
  • the term“pharmaceutically acceptable carrier” refers to any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, emulsions ( e.g ., such as an oil/water or water/oil emulsions), and various types of wetting agents.
  • the compositions also can include stabilizers and preservatives.
  • stabilizers and adjuvants see e.g., Martin, Remington's Pharmaceutical Sciences,
  • the term“pharmaceutically acceptable salt” refers to any pharmaceutically acceptable salt (e.g, acid or base) of a compound of the present invention which, upon administration to a subject, is capable of providing a compound of this invention or an active metabolite or residue thereof.
  • “salts” of the compounds of the present invention may be derived from inorganic or organic acids and bases.
  • Exemplary acids include, but are not limited to, hydrochloric, hydrobromic, sulfuric, nitric, perchloric, fumaric, maleic, phosphoric, glycolic, lactic, salicylic, succinic, toluene-p- sulfonic, tartaric, acetic, citric, methanesulfonic, ethanesulfonic, formic, benzoic, malonic, naphthalene-2-sulfonic, benzenesulfonic acid, and the like.
  • Other acids such as oxalic, while not in themselves pharmaceutically acceptable, may be employed in the preparation of salts useful as intermediates in obtaining the compounds of the invention and their
  • Exemplary bases include, but are not limited to, alkali metal (e.g, sodium) hydroxides, alkaline earth metal (e.g, magnesium) hydroxides, ammonia, and compounds of formula NW 4 + , wherein W is Ci -4 alkyl, and the like.
  • alkali metal e.g, sodium
  • alkaline earth metal e.g, magnesium
  • W is Ci -4 alkyl
  • Exemplary salts include, but are not limited to: acetate, adipate, alginate, aspartate, benzoate, benzenesulfonate, bisulfate, butyrate, citrate, camphorate,
  • salts include anions of the compounds of the present invention compounded with a suitable cation such as Na + , NH 4 + , and NW + (wherein W is a C M alkyl group), and the like.
  • a suitable cation such as Na + , NH 4 + , and NW + (wherein W is a C M alkyl group), and the like.
  • salts of the compounds of the present invention are contemplated as being pharmaceutically acceptable.
  • salts of acids and bases that are non-pharmaceutically acceptable may also find use, for example, in the preparation or purification of a pharmaceutically acceptable compound.
  • compositions are described as having, including, or comprising specific components, or where processes and methods are described as having, including, or comprising specific steps, it is contemplated that, additionally, there are compositions of the present invention that consist essentially of, or consist of, the recited components, and that there are processes and methods according to the present invention that consist essentially of, or consist of, the recited processing steps.
  • compositions specifying a percentage are by weight unless otherwise specified. Further, if a variable is not accompanied by a definition, then the previous definition of the variable controls.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 1, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:2.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: l, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:2l, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:22, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:23.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: l, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:434, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:22, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:435.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:2, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:24, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:25, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:26.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:3, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:4.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:3.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:3, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:27, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 28, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:29.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:3, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 181, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:28, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:436.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:4, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 30, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:31, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:32.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:5, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 6.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 5, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:33, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:34, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:35.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:5, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 183, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:34, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 184.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 6, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 36, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:37, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:38.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:6, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:36, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 185, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:38.
  • the antigen-binding site comprises an amino acid sequence at least 90% (e.g, at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 188. In certain embodiments, the antigen-binding site comprises an amino acid sequence at least 95% identical to SEQ ID NO: 188. In certain embodiments, the antigen binding site comprises an amino acid sequence at least 99% identical to SEQ ID NO: 188. In certain embodiments, the antigen-binding site comprises the amino acid sequence of SEQ ID NO: l88.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 7, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:8.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:7.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:7 includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:39, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:40, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:4l.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 7, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:437, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:40, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:438.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 8, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:42, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:43, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:44.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 9, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 10.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:9, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:45, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:46, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:47.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:9, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 181, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:46, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 182.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 10, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:48, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:49, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:50.
  • the antigen-binding site comprises an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 198. In certain embodiments, the antigen-binding site comprises an amino acid sequence at least 95% identical to SEQ ID NO: 198. In certain embodiments, the antigen-binding site comprises an amino acid sequence at least 99% identical to SEQ ID NO: 198. In certain embodiments, the antigen-binding site comprises the amino acid sequence of SEQ ID NO: 198.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 11, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%,
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 11, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 181, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 52, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:439.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 12, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 54, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:55, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:56.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 13, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%,
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 13, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:57, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 58, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 59.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 13, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:440, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 58, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:44l .
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 14, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 60, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:6l, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:62.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 15, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%,
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 15, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:63, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 64, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 65.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: l5, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:442, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 64, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:443.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 16, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 66, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:67, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:68.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 17, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%,
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 17, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 181, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:70, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:444.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 18, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 72, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:73, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:74.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 19, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%,
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 19, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:445, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:76, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:446.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:20, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:78, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:79, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:80.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:266, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:267.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:267.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:266, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:304, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:305, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 306.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:266, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 528, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:305, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 529.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:267, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:307, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:308, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 309.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:268, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:269.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:269.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:268, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:310, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 311, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:312.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:268, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:530, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:311, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:53 l.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:269, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:313, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 314, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:3 l5.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:270, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:27l.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:27l.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:270, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:316, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 317, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:318.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:270, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:532, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:317, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:533.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:27l, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:319, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:320, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:32l.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:272, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:273.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:273.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:272, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:322, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:323, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:324.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:272, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:534, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:323, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:535.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:273, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:325, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:326, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:327.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:274, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:275.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:275.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:274, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:328, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:329, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:330.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:274, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:536, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:329, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:537.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:275, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:331, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:332, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:333.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:276, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:277.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:277.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:276, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:334, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:335, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:336.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:276, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:538, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:335, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:539.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:277, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:337, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:338, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:339.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:278, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:279.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:279.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:278, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:340, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:34l, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:342.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:278, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 540, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:34l, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 541.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:279, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:343, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:344, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:345.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:280, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:28l.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:28l.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:280, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:346, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:347, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:348.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:280, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 542, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:347, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 543.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:28l, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:349, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:350, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:35l.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:282, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:283.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:283.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:282, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:352, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:353, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 354.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:282, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 544, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:353, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 545.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:283, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:355, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:356, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:357.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:284, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:285.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:284.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:284, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:358, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:359, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 360.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:284, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 546, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:359, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:547.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:285, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:36l, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 362, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 363.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:286, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:287.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:287.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:286, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:364, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 365, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 366.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:286, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 548, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:365, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 549.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:287, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:367, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 368, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 369.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:289.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:289.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:370, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:37l, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 372.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:550, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:37l, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 551.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:289, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:373, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:374, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 375.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:290, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:29l.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:29l.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:290, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:376, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:377, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:378.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:290, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 552, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:377, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:553.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:29l, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:379, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 380, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:38l.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:292, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:293.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:293.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:292, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:382, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:383, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:384.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:292, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 554, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:383, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:555.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:293, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:385, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:386, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:387.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:294, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:295.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:294.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:294, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:388, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 389, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 390.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:294, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:556, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:389, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:557.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:295, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:39l, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 392, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 393.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:296, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:297.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:297.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:296, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:394, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 395, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:396.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:296, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO: 558, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:395, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:559.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:297, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:397, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO: 398, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO: 399.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:298, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:299.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:299.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:298, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:400, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:40l, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:402.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:298, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:560, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:40l, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:56l.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:299, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:403, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:404, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:405.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 300, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:30l.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:30l.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:300, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:406, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:407, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:408.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:300, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:562, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:407, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:563.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:30l, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:409, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:4lO, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:4l 1.
  • the present invention provides an antigen-binding site that includes an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 302, and an antibody light chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 303.
  • an antibody heavy chain variable domain that includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 303.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 302, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:4l2, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:4l3, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:4l4.
  • an antigen-binding site that includes an antibody heavy chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 302, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:564, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:4l3, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:565.
  • an antigen-binding site that includes an antibody light chain variable domain with an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:303, includes a CDR1 sequence represented by the amino acid sequence of SEQ ID NO:4l5, a CDR2 sequence represented by the amino acid sequence of SEQ ID NO:4l6, and a CDR3 sequence represented by the amino acid sequence of SEQ ID NO:4l7.
  • immunoglobulin heavy chain variable region sequences and/or light chain variable region sequences that together bind CD33 may contain amino acid alterations (e.g, at least 1, 2, 3, 4, 5, or 10 amino acid substitutions, deletions, or additions) in the framework regions of the heavy and/or light chain variable regions without affecting their ability to bind to CD33 significantly.
  • Table 1 lists peptide sequences of heavy chain variable domains and light chain variable domains that, in combination (either as a Fab fragment or a single-chain variable fragment (scFv)), can bind to CD33. Unless indicated otherwise, the CDR sequences provided in Table 1 are determined under Rabat. The CD33-binding domains can vary in their binding affinity to CD33. Table 1 also lists scFv forms of the CD33-binding heavy and light chain variable domains.
  • the exemplary nucleic acid sequences listed in Table 1 are predicted possible nucleic acid sequences that the listed corresponding peptide sequences originated from, and were generated using EMBL-EBFs Protein Sequence Back-translation program.
  • An antigen binding site that binds an epitope on an extracellular domain of human CD33 and/or Cynomolgus/Rhesus (cyno) CD33
  • the invention provides an antigen binding site including a heavy chain variable domain that binds an epitope on an extracellular domain of human CD33 and/or Cynomolgus/Rhesus (cyno) CD33.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33 and Cynomolgus/Rhesus (cyno) CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: l .
  • the heavy chain variable domain includes amino acid sequences FTFSSYGMS [SEQ ID NO:2 l] as the first complementarity-determining region 1 (“CDR1”), NIKQDGSEKYYVDSVKG [SEQ ID NO:22] as the second CDR (“CDR2”), and AREGGP YYD S S G YF V Y Y GMD V [SEQ ID NO:23] as the third CDR (“CDR3”) of SEQ ID NO: l .
  • the heavy chain variable domain includes amino acid sequences SYGMS [SEQ ID NO:434] as the first complementarity-determining region 1 (“CDR1”), NIKQDGSEKYYVDSVKG [SEQ ID NO:22] as the second CDR (“CDR2”), and EGGP Y YD S SGYF VYY GMD V [SEQ ID NO:435] as the third CDR (“CDR3”) of SEQ ID NO: l .
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 1 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO: 1 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • RASQSISSWLA SEQ ID NO:24
  • DASSLES SEQ ID NO:25
  • QQYESFPT SEQ ID NO:26
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33 and Cynomolgus/Rhesus (cyno) CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:3.
  • the heavy chain variable domain incorporates amino acid sequences FTFSSYWMS [SEQ ID NO:27] as CDR1, NIKQDGSEKYYVDSVKG [SEQ ID NO:28] as CDR2, and ARPLNAGELDV [SEQ ID NO:29] as CDR3 of SEQ ID NO:3.
  • the heavy chain variable domain incorporates amino acid sequences SYWMS [SEQ ID NO: 181] as CDR1,
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:3, is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • RASQSISSWLA SEQ ID NO:30
  • EASSLES SEQ ID NO:31
  • QQLESYPLT SEQ ID NO:32
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33 and Cynomolgus/Rhesus (cyno) CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:5.
  • the heavy chain variable domain incorporates amino acid sequences FTFSKYTMS [SEQ ID NO:33] as CDR1, AIVGSGESTYFADSVKG [SEQ ID NO:34] as CDR2, and
  • the heavy chain variable domain incorporates amino acid sequences KYTMS [SEQ ID NO: 183] as CDR1, AIVGSGESTYFADSVKG [SEQ ID NO:34] as CDR2, and EGGP YYD S S GYF V Y Y GMD V [SEQ ID NO: 184] as CDR3 of SEQ ID NO:5.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:5 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • RASQSISSWLA SEQ ID NO:36
  • KASSLES SEQ ID NO:37
  • KASSLE SEQ ID NO: 185
  • QQYDDLPT SEQ ID NO:38
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:7.
  • the heavy chain variable domain incorporates amino acid sequences YTFSDYYMH [SEQ ID NO:39] as CDR1, MINPSWGSTSYAQKFQG [SEQ ID NO:40] as CDR2, and
  • the heavy chain variable domain incorporates amino acid sequences DYYMH [SEQ ID NO:437] as CDR1, AIVGSGESTYFADSVKG [SEQ ID NO:34] as CDR2, and EA ADGF V GERYFDL [SEQ ID NO:438] as CDR3 of SEQ ID NO:7.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:7 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33 and Cynomolgus/Rhesus (cyno) CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:9.
  • the heavy chain variable domain incorporates amino acid sequences FTFGSYWMS [SEQ ID NO:45] as CDR1, TIKQDGSEKSYVDSVKG [SEQ ID NO:46] as CDR2, and ARPLNAGELDV [SEQ ID NO:47] as CDR3 of SEQ ID NO:9.
  • the heavy chain variable domain incorporates amino acid sequences SYWMS [SEQ ID NO: 181] as CDR1,
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 9 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO: 9 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 10, which includes amino acid sequences RASQSISSWLA [SEQ ID NO:48] as CDR1, EASSLES [SEQ ID NO:49] as CDR2, and QQSQSYPPIT [SEQ ID NO:50] as CDR3 of SEQ ID NO: 10.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33 and Cynomolgus/Rhesus (cyno) CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: 11.
  • the heavy chain variable domain incorporates amino acid sequences FTFPSYWMS [SEQ ID NO:51] as CDR1, TIKRDGSEKGYVDSVKG [SEQ ID NO:52] as CDR2, and ARPLNAGELD V [SEQ ID NO:53] as CDR3 of SEQ ID NO: 11.
  • the heavy chain variable domain incorporates amino acid sequences SYWMS [SEQ ID NO: 181] as CDR1
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 11 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO: 11 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 12, which includes amino acid sequences RASQSISSWLA [SEQ ID NO:54] as CDR1, EASSLES [SEQ ID NO:55] as CDR2, and QQSQSYPPIT [SEQ ID NO:56] as CDR3 of SEQ ID NO: 12.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: l3.
  • the heavy chain variable domain incorporates amino acid sequences YTFGTYYMH [SEQ ID NO:57] as CDR1, IINPSRGSTVYAQKFQG [SEQ ID NO:58] as CDR2, and ARGAGYDDEDMDV [SEQ ID NO:59] as CDR3 of SEQ ID NO: 13.
  • the heavy chain variable domain incorporates amino acid sequences TYYMH [SEQ ID NO:440] as CDR1, TIKRDGSEKGYVD S VKG [SEQ ID NO:52] as CDR2, and GAGYDDEDMDV [SEQ ID NO:44l] as CDR3 of SEQ ID NO: 13.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 13 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence
  • an antibody heavy chain variable domain at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 13 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 14, which includes amino acid sequences RASQGIDSWLA [SEQ ID NO:60] as CDR1, AASSLQS [SEQ ID NO:6l] as CDR2, and Q
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33 and Cynomolgus/Rhesus (cyno) CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: l 5.
  • the heavy chain variable domain incorporates amino acid sequences FTFSSYAMS [SEQ ID NO:63] as CDR1, SISSSSEGIYYADSVKG [SEQ ID NO:64] as CDR2, and
  • the heavy chain variable domain incorporates amino acid sequences SYAMS [SEQ ID NO:442] as CDR1, SISSSSEGIYYADSVKG [SEQ ID NO:64] as CDR2, and EGGP Y YD S S GYF V Y Y GMD V [SEQ ID NO:443] as CDR3 of SEQ ID NO: 15.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 15 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence DIQMT Q SP S TL S A S V GDRVTIT CR
  • ASN SIS S WL AW Y QQKPGK APKLLI YE AS S TK S GV PSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYDDLPTFGGGTKVEIK [SEQ ID
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO: 15 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 16, which includes amino acid sequences RASNSISSWLA [SEQ ID NO:66] as CDR1, EASSTKS [SEQ ID NO:67] as CDR2, and QQYDDLPT [SEQ ID NO:68] as CDR3 of SEQ ID NO: 16.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33 and Cynomolgus/Rhesus (cyno) CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: 17.
  • the heavy chain variable domain incorporates amino acid sequences FTFSSYWMS [SEQ ID NO: 69] as CDR1, NINTDGSEVYYVDSVKG [SEQ ID NO:70] as CDR2, and
  • the heavy chain variable domain incorporates amino acid sequences SYWMS [SEQ ID NO: 181] as CDR1, NINTDGSEVYYVDSVKG [SEQ ID NO:70] as CDR2, and D VGPGIAYQGHFD Y [SEQ ID NO:444] as CDR3 of SEQ ID NO: 17.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 17 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO: 17 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 18, which includes amino acid sequences RASQVIYSYLN [SEQ ID NO:72] as CDR1, AASSLKS [SEQ ID NO:73] as CDR2, and QQVYDTPLT [SEQ ID NO:74] as CDR3 of SEQ ID NO: 18.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33 and Cynomolgus/Rhesus (cyno) CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: 19.
  • the heavy chain variable domain incorporates amino acid sequences GSISSTDYYWG [SEQ ID NO:75] as CDR1, SIGYSGTYYNPSLKS [SEQ ID NO:76] as CDR2, and ARETAHDVHGMDV [SEQ ID NO:77] as CDR3 of SEQ ID NO: 19.
  • the heavy chain variable domain incorporates amino acid sequences STDYYWG [SEQ ID NO:445] as CDR1, SIGYSGTYYNPSLKS [SEQ ID NO:76] as CDR2, and ETAHDVHGMDV [SEQ ID NO:445] as CDR1, SIGYSGTYYNPSLKS [SEQ ID NO:76] as CDR2, and ETAHDVHGMDV [SEQ ID NO:
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., at least 91%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 19 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:20 which includes amino acid sequences RASHS VY S YL A [SEQ ID NO:78] as CDR1, DASNRAT [SEQ ID NO:79] as CDR2, and QQYDNLPT [SEQ ID NO:80] as CDR3 of SEQ ID NO:20.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:266.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:266.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 304 as CDR1, SEQ ID NO:305 as CDR2, and SEQ ID NO:306 as CDR3 of SEQ ID NO:266. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 528 as CDR1, SEQ ID NO:305 as CDR2, and SEQ ID NO:529 as CDR3 of SEQ ID NO:266.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:266 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:267.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO: 266 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:267, which includes amino acid sequences SEQ ID NO:307 as CDR1, SEQ ID NO:308 as CDR2, and SEQ ID NO:309 as CDR3 of SEQ ID NO:267.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:268.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:268.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:3 lO as CDR1, SEQ ID NO:311 as CDR2, and SEQ ID NO:312 as CDR3 of SEQ ID NO:268. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:530 as CDR1, SEQ ID NO:311 as CDR2, and SEQ ID NO:531 as CDR3 of SEQ ID NO:268.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:268 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:269.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:268 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:269, which includes amino acid sequences SEQ ID NO:3 l3 as CDR1, SEQ ID NO:3 l4 as CDR2, and SEQ ID NO:315 as CDR3 of SEQ ID NO:269.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:270.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:270.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:3 l6 as CDR1, SEQ ID NO:3 l7 as CDR2, and SEQ ID NO:3 l8 as CDR3 of SEQ ID NO:270. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:532 as CDR1, SEQ ID NO:3 l7 as CDR2, and SEQ ID NO:533 as CDR3 of SEQ ID NO: 270.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:270 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:27l.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:270 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:27l, which includes amino acid sequences SEQ ID NO:3 l9 as CDR1, SEQ ID NO:320 as CDR2, and SEQ ID NO:32l as CDR3 of SEQ ID NO:27l .
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:272.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:272.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:322 as CDR1, SEQ ID NO:323 as CDR2, and SEQ ID NO:324 as CDR3 of SEQ ID NO:272.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:534 as CDR1, SEQ ID NO:323 as CDR2, and SEQ ID NO:535 as CDR3 of SEQ ID NO:272.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:272 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:273.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:272 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:273, which includes amino acid sequences SEQ ID NO:325 as CDR1, SEQ ID NO:326 as CDR2, and SEQ ID NO:327 as CDR3 of SEQ ID NO:273.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:274.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:274.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:328 as CDR1, SEQ ID NO:329 as CDR2, and SEQ ID NO:330 as CDR3 of SEQ ID NO:274.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:536 as CDR1, SEQ ID NO:329 as CDR2, and SEQ ID NO:537 as CDR3 of SEQ ID NO:274.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:274 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:275.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:274 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:275, which includes amino acid sequences SEQ ID NO:33 l as CDR1, SEQ ID NO:332 as CDR2, and SEQ ID NO:333 as CDR3 of SEQ ID NO:275.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:276.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:276.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:334 as CDR1, SEQ ID NO:335 as CDR2, and SEQ ID NO:336 as CDR3 of SEQ ID NO:276. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:538 as CDR1, SEQ ID NO:335 as CDR2, and SEQ ID NO:539 as CDR3 of SEQ ID NO:276.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:276 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:277.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:276 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:277, which includes amino acid sequences SEQ ID NO:337 as CDR1, SEQ ID NO:338 as CDR2, and SEQ ID NO:339 as CDR3 of SEQ ID NO:277.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:278.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:278.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:340 as CDR1, SEQ ID NO:34l as CDR2, and SEQ ID NO:342 as CDR3 of SEQ ID NO:278.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 540 as CDR1, SEQ ID NO:34l as CDR2, and SEQ ID NO:54l as CDR3 of SEQ ID NO:278.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:278 is combined with a light chain variable domain to form an antigen -binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:279 which includes amino acid sequences SEQ ID NO:343 as CDR1, SEQ ID NO:344 as CDR2, and SEQ ID NO:345 as CDR3 of SEQ ID NO:279.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:280.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:280.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:346 as CDR1, SEQ ID NO:347 as CDR2, and SEQ ID NO:348 as CDR3 of SEQ ID NO:280.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 542 as CDR1, SEQ ID NO:347 as CDR2, and SEQ ID NO:543 as CDR3 of SEQ ID NO:280.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:280 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:28l.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:280 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:28l, which includes amino acid sequences SEQ ID NO:349 as CDR1, SEQ ID NO:350 as CDR2, and SEQ ID NO:35l as CDR3 of SEQ ID NO:28l.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:282.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:282.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 352 as CDR1, SEQ ID NO:353 as CDR2, and SEQ ID NO:354 as CDR3 of SEQ ID NO:282.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 544 as CDR1, SEQ ID NO:353 as CDR2, and SEQ ID NO:545 as CDR3 of SEQ ID NO:282.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:282 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:283.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:282 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:283, which includes amino acid sequences SEQ ID NO:355 as CDR1, SEQ ID NO:356 as CDR2, and SEQ ID NO:357 as CDR3 of SEQ ID NO:283.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:284.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:284.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:358 as CDR1, SEQ ID NO:359 as CDR2, and SEQ ID NO:360 as CDR3 of SEQ ID NO:284.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 546 as CDR1, SEQ ID NO:359 as CDR2, and SEQ ID NO:360 as CDR3 of SEQ ID NO:547.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:284 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:285.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:284 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:285, which includes amino acid sequences SEQ ID NO:36l as CDR1, SEQ ID NO:362 as CDR2, and SEQ ID NO:363 as CDR3 of SEQ ID NO:285.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:286.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:286.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 364 as CDR1, SEQ ID NO:365 as CDR2, and SEQ ID NO:366 as CDR3 of SEQ ID NO:286.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 548 as CDR1, SEQ ID NO:365 as CDR2, and SEQ ID NO:549 as CDR3 of SEQ ID NO:286.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:286 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:287.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:286 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:287, which includes amino acid sequences SEQ ID NO:367 as CDR1, SEQ ID NO:368 as CDR2, and SEQ ID NO:369 as CDR3 of SEQ ID NO:287.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:288.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:370 as CDR1, SEQ ID NO:37l as CDR2, and SEQ ID NO:372 as CDR3 of SEQ ID NO:288. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:550 as CDR1, SEQ ID NO:37l as CDR2, and SEQ ID NO:55l as CDR3 of SEQ ID NO:288.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:289.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:288 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:289, which includes amino acid sequences SEQ ID NO:373 as CDR1, SEQ ID NO:374 as CDR2, and SEQ ID NO:375 as CDR3 of SEQ ID NO:289.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:290.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:290.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:376 as CDR1, SEQ ID NO:377 as CDR2, and SEQ ID NO:378 as CDR3 of SEQ ID NO:290.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:552 as CDR1, SEQ ID NO:377 as CDR2, and SEQ ID NO:553 as CDR3 of SEQ ID NO:290.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:290 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:29l.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:290 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:29l, which includes amino acid sequences SEQ ID NO:379 as CDR1, SEQ ID NO:380 as CDR2, and SEQ ID NO:38l as CDR3 of SEQ ID NO:29l.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:292.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:292.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 382 as CDR1, SEQ ID NO:383 as CDR2, and SEQ ID NO:384 as CDR3 of SEQ ID NO:292.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 554 as CDR1, SEQ ID NO:383 as CDR2, and SEQ ID NO:555 as CDR3 of SEQ ID NO:292.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:292 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:292 can be paired with an antibody light chain variable domain at least 90%
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:293.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:292 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:293, which includes amino acid sequences SEQ ID NO:385 as CDR1, SEQ ID NO:386 as CDR2, and SEQ ID NO:387 as CDR3 of SEQ ID NO:293.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:294.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:294.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:388 as CDR1, SEQ ID NO:389 as CDR2, and SEQ ID NO:390 as CDR3 of SEQ ID NO:294.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:556 as CDR1, SEQ ID NO:389 as CDR2, and SEQ ID NO:557 as CDR3 of SEQ ID NO:294.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:294 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:295.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:294 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:295, which includes amino acid sequences SEQ ID NO:39l as CDR1, SEQ ID NO:392 as CDR2, and SEQ ID NO:393 as CDR3 of SEQ ID NO:295.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:296.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:296.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 394 as CDR1, SEQ ID NO:395 as CDR2, and SEQ ID NO:396 as CDR3 of SEQ ID NO:296. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 558 as CDR1, SEQ ID NO:395 as CDR2, and SEQ ID NO:559 as CDR3 of SEQ ID NO:296.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:296 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:297.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:296 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:297, which includes amino acid sequences SEQ ID NO:397 as CDR1, SEQ ID NO:398 as CDR2, and SEQ ID NO:399 as CDR3 of SEQ ID NO:297.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33 and Cynomolgus/Rhesus (cyno) CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:298. In some embodiments, the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:298.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:400 as CDR1, SEQ ID NO:40l as CDR2, and SEQ ID NO:402 as CDR3 of SEQ ID NO:298. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:560 as CDR1, SEQ ID NO:40l as CDR2, and SEQ ID NO:56l as CDR3 of SEQ ID NO:298.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:298 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • SEQ ID NO:299 which includes amino acid sequences SEQ ID NO:403 as CDR1, SEQ ID NO:404 as CDR2, and SEQ ID NO:405 as CDR3 of SEQ ID NO:299.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:300.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:300.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:406 as CDR1, SEQ ID NO:407 as CDR2, and SEQ ID NO:408 as CDR3 of SEQ ID NO:300.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:562 as CDR1, SEQ ID NO:407 as CDR2, and SEQ ID NO:563 as CDR3 of SEQ ID NO:300.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:300 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:30l.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO: 300 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:30l, which includes amino acid sequences SEQ ID NO:409 as CDR1, SEQ ID NO:4lO as CDR2, and SEQ ID NO:4l 1 as CDR3 of SEQ ID NO:30l.
  • the present invention provides an antigen binding site that binds an epitope on an extracellular domain of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:302.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:302.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:4l2 as CDR1, SEQ ID NO:4l3 as CDR2, and SEQ ID NO:4l4 as CDR3 of SEQ ID NO:302. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:564 as CDR1, SEQ ID NO:4l3 as CDR2, and SEQ ID NO:565 as CDR3 of SEQ ID NO:302.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:302 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 303.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO: 302 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:303, which includes amino acid sequences SEQ ID NO:4l5 as CDR1, SEQ ID NO:4l6 as CDR2, and SEQ ID NO:4l7 as CDR3 of SEQ ID NO:303.
  • An antigen binding site that recognizes and binds a conformational epitope on an extracellular domain of the human CD33 and/or the Cynomolgus/Rhesus (cyno) CD33
  • the present invention provides an antigen binding site including a heavy chain variable domain that recognizes and binds one or more conformational epitopes on the extracellular domain of the human CD33 and/or the Cynomolgus/Rhesus (cyno)
  • the present invention provides an antigen binding site that recognizes and binds a conformational epitope partially located in the V domain of human CD33 extracellular domain; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g ., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:3.
  • the heavy chain variable domain incorporates amino acid sequences FTFSSYWMS [SEQ ID NO:27] as CDR1, NIKQDGSEKYYVDSVKG [SEQ ID NO:28] as CDR2, and ARPLNAGELDV [SEQ ID NO:29] as CDR3 of SEQ ID NO:3.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:3 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • amino acid sequence of SEQ ID NO: 3 can be paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence
  • an antibody heavy chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 3 can be paired with an antibody light chain variable domain at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:4, which includes amino acid sequences RASQSISSWLA
  • the present invention provides an antigen binding site that recognizes and binds a conformational epitope partially located in the V domain of the human CD33 extracellular domain; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: 11.
  • the heavy chain variable domain incorporates amino acid sequences FTFPSYWMS [SEQ ID NO:51] as CDR1, TIKRDGSEKGYVDSVKG [SEQ ID NO:52] as CDR2, and ARPLNAGELD V [SEQ ID NO:53] as CDR3 of SEQ ID NO: 11.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 11 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO: 11 can be paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 12, which includes amino acid sequences
  • the present invention provides an antigen binding site that recognizes and binds a conformational epitope partially located in the V domain of the human CD33 extracellular domain; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: l 5.
  • the heavy chain variable domain incorporates amino acid sequences FTFSSYAMS [SEQ ID NO:63] as CDR1, SISSSSEGIYYADSVKG [SEQ ID NO:64] as CDR2, and
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 15 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO: 15 can be paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 16, which includes amino acid sequences
  • the present invention provides an antigen binding site that recognizes and binds a conformational epitope partially located in the V domain of the human CD33 extracellular domain; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:270.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:270.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:3 l6 as CDR1, SEQ ID NO:3 l7 as CDR2, and SEQ ID NO:3 l8 as CDR3 of SEQ ID NO:270. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:532 as CDR1, SEQ ID NO:3 l7 as CDR2, and SEQ ID NO:533 as CDR3 of SEQ ID NO:270.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:270 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:27l.
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO:270 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:27l, which includes amino acid sequences SEQ ID NO:3 l9 as CDR1, SEQ ID NO:320 as CDR2, and SEQ ID NO:32l as CDR3 of SEQ ID NO:27l.
  • the present invention provides an antigen binding site that recognizes and binds a conformational epitope partially located in the V domain of the human CD33 extracellular domain; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:272.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:272.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:322 as CDR1, SEQ ID NO:323 as CDR2, and SEQ ID NO:324 as CDR3 of SEQ ID NO:272. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:534 as CDR1, SEQ ID NO:323 as CDR2, and SEQ ID NO:535 as CDR3 of SEQ ID NO:272.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:272 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:273.
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO:272 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:273, which includes amino acid sequences SEQ ID NO:325 as CDR1, SEQ ID NO:326 as CDR2, and SEQ ID NO:327 as CDR3 of SEQ ID NO:273.
  • the present invention provides an antigen binding site that recognizes and binds a conformational epitope partially located in the V domain of the human CD33 extracellular domain; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:280.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:346 as CDR1, SEQ ID NO:347 as CDR2, and SEQ ID NO:348 as CDR3 of SEQ ID NO:280.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:542 as CDR1, SEQ ID NO:347 as CDR2, and SEQ ID NO:543 as CDR3 of SEQ ID NO:280.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:280 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:28l.
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO:280 can be paired with an antibody light chain variable domain at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:28l, which includes amino acid sequences SEQ ID NO:349 as CDR1, SEQ ID NO:350 as CDR2, and SEQ ID NO:35 l as CDR3 of SEQ ID NO:28l .
  • An antigen binding site that recognizes and binds a conformational epitope on an extracellular domain of the human CD33 but not a conformational epitope on an extracellular domain of the Cynomolgus/Rhesus (cyno) CD33
  • the present invention provides an antigen binding site that recognizes and binds one or more conformational epitopes on the extracellular domain of the human CD33 but does not recognize and/or bind one or more conformational epitopes on the extracellular domain of the cyno CD33.
  • the present invention provides an antigen binding site that recognizes and binds one or more conformational epitopes on the extracellular domain of the human CD33 but does not recognize and/or bind one or more conformational epitopes on the extracellular domain of the cyno CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:7.
  • the heavy chain variable domain incorporates amino acid sequences YTFSDYYMH [SEQ ID NO: 39] as CDR1, MINPSWGSTSYAQKFQG [SEQ ID NO:40] as CDR2, and
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 7 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 7 can be paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence DIVMTQSPLSLPVTPGEPASISCRSSQSLLYSNGYNYLDWYLQKPGQSPQLLIYLGSN RASGVPDRF SGSGSGTDFTLKISRVEAED VGVYY CMQD VALPITF GGGTKVEIK [SEQ ID NO: 8]
  • an antibody heavy chain variable domain at least 90% e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • the present invention provides an antigen binding site that recognizes and binds one or more conformational epitopes on the extracellular domain of the human CD33 but does not recognize and/or bind one or more conformational epitopes on the extracellular domain of the cyno CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: 13.
  • the heavy chain variable domain incorporates amino acid sequences YTFGTYYMH [SEQ ID NO:57] as CDR1, IINPSRGSTVYAQKFQG [SEQ ID NO:58] as CDR2, and ARGAGYDDEDMDV [SEQ ID NO:59] as CDR3 of SEQ ID NO: 13.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 13 is combined with a light chain variable domain to form an antigen -binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO: 13 can be paired with an antibody light chain variable domain at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 14, which includes amino acid sequences
  • an antibody binding site that includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • an antibody binding site that includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 13, and is paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence
  • an antibody binding site that includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 13, and is paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 14, which includes amino acid sequences
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% ( e.g ., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: l .
  • the heavy chain variable domain includes amino acid sequences FTFSSYGMS [SEQ ID NO:2l] as the first complementarity-determining region 1 (“CDR1”), NIKQDGSEKYYVDSVKG [SEQ ID NO:22] as the second CDR (“CDR2”), and AREGGP YYD S S GYF V YY GMD V [SEQ ID NO:23] as the third CDR (“CDR3”) of SEQ ID NO: l.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 1 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: l can be paired with an antibody light chain variable domain at least 90%
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33 ; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:3.
  • the heavy chain variable domain incorporates amino acid sequences FTFSSYWMS [SEQ ID NO:27] as CDR1, NIKQDGSEKYYVDSVKG [SEQ ID NO:28] as CDR2, and ARPLNAGELDV [SEQ ID NO:29] as CDR3 of SEQ ID NO:3.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:3 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • amino acid sequence of SEQ ID NO: 3 can be paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence
  • an antibody heavy chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:3 can be paired with an antibody light chain variable domain at least 90%
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:5.
  • the heavy chain variable domain incorporates amino acid sequences FTFSKYTMS [SEQ ID NO:33] as CDR1, AIVGSGESTYFADSVKG [SEQ ID NO:34] as CDR2, and
  • the heavy chain variable domain incorporates amino acid sequences KYTMS [SEQ ID NO: 183] as CDR1, AIVGSGESTYFADSVKG [SEQ ID NO:34] as CDR2, and EGGP YYD S S GYF V Y Y GMD V [SEQ ID NO: 184] as CDR3 of SEQ ID NO:5.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 5 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 5 can be paired with an antibody light chain variable domain at least 90%
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:9.
  • the heavy chain variable domain incorporates amino acid sequences FTFGSYWMS [SEQ ID NO:45] as CDR1, TIKQDGSEKSYVDSVKG [SEQ ID NO:46] as CDR2, and ARPLNAGELDV [SEQ ID NO:47] as CDR3 of SEQ ID NO:9.
  • the heavy chain variable domain incorporates amino acid sequences SYWMS [SEQ ID NO: 181] as CDR1,
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:9 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO: 9 can be paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO: 9 can be paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 10, which includes amino acid sequences
  • RASQSISSWLA SEQ ID NO:48
  • EASSLES SEQ ID NO:49
  • QQSQSYPPIT SEQ ID NO:50
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: 11.
  • the heavy chain variable domain incorporates amino acid sequences FTFPSYWMS [SEQ ID NO:5 l] as CDR1, TIKRDGSEKGYVDSVKG [SEQ ID NO:52] as CDR2, and ARPLNAGELDV [SEQ ID NO:53] as CDR3 of SEQ ID NO: 11.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 11 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO: 11 can be paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 12, which includes amino acid sequences
  • RASQSISSWLA SEQ ID NO:54] as CDR1
  • EASSLES SEQ ID NO:55
  • QQSQSYPPIT SEQ ID NO:56
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: 13.
  • the heavy chain variable domain incorporates amino acid sequences YTFGTYYMH [SEQ ID NO:57] as CDR1, IINPSRGSTVYAQKFQG [SEQ ID NO:58] as CDR2, and ARGAGYDDEDMDV [SEQ ID NO:59] as CDR3 of SEQ ID NO: 13.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 13 is combined with a light chain variable domain to form an antigen -binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO: 13 can be paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 14, which includes amino acid sequences
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33 ; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: l 5.
  • the heavy chain variable domain incorporates amino acid sequences FTFSSYAMS [SEQ ID NO:63] as CDR1, SISSSSEGIYYADSVKG [SEQ ID NO:64] as CDR2, and
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 15 is combined with a light chain variable domain to form an antigen -binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO: 15 can be paired with an antibody light chain variable domain at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 91%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 16, which includes amino acid sequences
  • RASNSISSWLA SEQ ID NO:66
  • EASSTKS SEQ ID NO:67
  • QQYDDLPT SEQ ID NO:68
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33 ; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: 17.
  • the heavy chain variable domain incorporates amino acid sequences FTFSSYWMS [SEQ ID NO:69] as CDR1, NINTDGSEVYYVDSVKG [SEQ ID NO:70] as CDR2, and
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 17 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 17 can be paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 18, which includes amino acid sequences
  • RASQVIYSYLN as CDR1
  • a AS SLK S as CDR2
  • QQVYDTPLT as CDR3 of SEQ ID NO: 18.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33 ; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO: 19.
  • the heavy chain variable domain incorporates amino acid sequences GSISSTDYYWG [SEQ ID NO:75] as CDR1, SIGYSGTYYNPSLKS [SEQ ID NO:76] as CDR2, and ARETAHDVHGMDV [SEQ ID NO:77] as CDR3 of SEQ ID NO: 19.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 19 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90%
  • amino acid sequence of SEQ ID NO: 19 can be paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:20, which includes amino acid sequences
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:266.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:304 as CDR1, SEQ ID NO:305 as CDR2, and SEQ ID NO:306 as CDR3 of SEQ ID NO:266.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:528 as CDR1, SEQ ID NO:305 as CDR2, and SEQ ID NO:529 as CDR3 of SEQ ID NO:266.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:266 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:267.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:266 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:267, which includes amino acid sequences SEQ ID NO:307 as CDR1, SEQ ID NO:308 as CDR2, and SEQ ID NO:309 as CDR3 of SEQ ID NO:267.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:268.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:3lO as CDR1, SEQ ID NO:3 l l as CDR2, and SEQ ID NO:3 l2 as CDR3 of SEQ ID NO:268.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:530 as CDR1, SEQ ID NO:311 as CDR2, and SEQ ID NO:531 as CDR3 of SEQ ID NO:268.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:268 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:269.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:268 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:269, which includes amino acid sequences SEQ ID NO:3 l3 as CDR1, SEQ ID NO:3 l4 as CDR2, and SEQ ID NO:315 as CDR3 of SEQ ID NO:269.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:270.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:3l6 as CDR1, SEQ ID NO:3 l7 as CDR2, and SEQ ID NO:3 l8 as CDR3 of SEQ ID NO:270.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:532 as CDR1, SEQ ID NO:3 l7 as CDR2, and SEQ ID NO:533 as CDR3 of SEQ ID NO:270.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:270 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:27l.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:270 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:27l, which includes amino acid sequences SEQ ID NO:3 l9 as CDR1, SEQ ID NO:320 as CDR2, and SEQ ID NO:32l as CDR3 of SEQ ID NO:27l.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:272.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:322 as CDR1, SEQ ID NO:323 as CDR2, and SEQ ID NO:324 as CDR3 of SEQ ID NO:272.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:534 as CDR1, SEQ ID NO:323 as CDR2, and SEQ ID NO:535 as CDR3 of SEQ ID NO:272.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:272 is combined with a light chain variable domain to form an anti gen -binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:273.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:272 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:273, which includes amino acid sequences SEQ ID NO:325 as CDR1, SEQ ID NO:326 as CDR2, and SEQ ID NO:327 as CDR3 of SEQ ID NO:273.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:274.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:328 as CDR1, SEQ ID NO:329 as CDR2, and SEQ ID NO:330 as CDR3 of SEQ ID NO:274.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:536 as CDR1, SEQ ID NO:329 as CDR2, and SEQ ID NO:537 as CDR3 of SEQ ID NO:274.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:274 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:275.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:274 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:275, which includes amino acid sequences SEQ ID NO:33 l as CDR1, SEQ ID NO:332 as CDR2, and SEQ ID NO:333 as CDR3 of SEQ ID NO:275.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:276.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:334 as CDR1, SEQ ID NO:335 as CDR2, and SEQ ID NO:336 as CDR3 of SEQ ID NO:276.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:538 as CDR1, SEQ ID NO:335 as CDR2, and SEQ ID NO:539 as CDR3 of SEQ ID NO:276.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:276 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:277.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:276 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:277, which includes amino acid sequences SEQ ID NO:337 as CDR1, SEQ ID NO:338 as CDR2, and SEQ ID NO:339 as CDR3 of SEQ ID NO:277.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:278.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:340 as CDR1, SEQ ID NO:34l as CDR2, and SEQ ID NO:342 as CDR3 of SEQ ID NO:278.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 540 as CDR1, SEQ ID NO:34l as CDR2, and SEQ ID NO:54l as CDR3 of SEQ ID NO:278.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:278 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:279.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:278 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:279, which includes amino acid sequences SEQ ID NO:343 as CDR1, SEQ ID NO:344 as CDR2, and SEQ ID NO:345 as CDR3 of SEQ ID NO:279.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:280.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:346 as CDR1, SEQ ID NO:347 as CDR2, and SEQ ID NO:348 as CDR3 of SEQ ID NO:280.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 542 as CDR1, SEQ ID NO:347 as CDR2, and SEQ ID NO:543 as CDR3 of SEQ ID NO:280.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:280 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:28l.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:280 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:28l, which includes amino acid sequences SEQ ID NO:349 as CDR1, SEQ ID NO:350 as CDR2, and SEQ ID NO:35l as CDR3 of SEQ ID NO:28l.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:282.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:352 as CDR1, SEQ ID NO:353 as CDR2, and SEQ ID NO:354 as CDR3 of SEQ ID NO:282.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:544 as CDR1, SEQ ID NO:353 as CDR2, and SEQ ID NO:545 as CDR3 of SEQ ID NO:282.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:282 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:283.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:282 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:283, which includes amino acid sequences SEQ ID NO:355 as CDR1, SEQ ID NO:356 as CDR2, and SEQ ID NO:357 as CDR3 of SEQ ID NO:283.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:284.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:358 as CDR1, SEQ ID NO:359 as CDR2, and SEQ ID NO:360 as CDR3 of SEQ ID NO:284.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 546 as CDR1, SEQ ID NO:359 as CDR2, and SEQ ID NO:360 as CDR3 of SEQ ID NO:547.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:284 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:285 which includes amino acid sequences SEQ ID NO:36l as CDR1, SEQ ID NO:362 as CDR2, and SEQ ID NO:363 as CDR3 of SEQ ID NO:285.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:286.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:364 as CDR1, SEQ ID NO:365 as CDR2, and SEQ ID NO:366 as CDR3 of SEQ ID NO:286.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 548 as CDR1, SEQ ID NO:365 as CDR2, and SEQ ID NO:549 as CDR3 of SEQ ID NO:286.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:286 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:287.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:286 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:287, which includes amino acid sequences SEQ ID NO:367 as CDR1, SEQ ID NO:368 as CDR2, and SEQ ID NO:369 as CDR3 of SEQ ID NO:287.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:292.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:382 as CDR1, SEQ ID NO:383 as CDR2, and SEQ ID NO:384 as CDR3 of SEQ ID NO:292.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 554 as CDR1, SEQ ID NO:383 as CDR2, and SEQ ID NO:555 as CDR3 of SEQ ID NO:292.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:292 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:293.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:292 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:293, which includes amino acid sequences SEQ ID NO:385 as CDR1, SEQ ID NO:386 as CDR2, and SEQ ID NO:387 as CDR3 of SEQ ID NO:293.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:294.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:388 as CDR1, SEQ ID NO:389 as CDR2, and SEQ ID NO:390 as CDR3 of SEQ ID NO:294.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:556 as CDR1, SEQ ID NO:389 as CDR2, and SEQ ID NO:557 as CDR3 of SEQ ID NO:294.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:294 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:295.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:294 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:295, which includes amino acid sequences SEQ ID NO:39l as CDR1, SEQ ID NO:392 as CDR2, and SEQ ID NO:393 as CDR3 of SEQ ID NO:295.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:296.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:394 as CDR1, SEQ ID NO:395 as CDR2, and SEQ ID NO:396 as CDR3 of SEQ ID NO:296.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 558 as CDR1, SEQ ID NO:395 as CDR2, and SEQ ID NO:559 as CDR3 of SEQ ID NO:296.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:296 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:297.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:296 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:297, which includes amino acid sequences SEQ ID NO:397 as CDR1, SEQ ID NO:398 as CDR2, and SEQ ID NO:399 as CDR3 of SEQ ID NO:297.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:298.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:400 as CDR1, SEQ ID NO:40l as CDR2, and SEQ ID NO:402 as CDR3 of SEQ ID NO:298.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:560 as CDR1, SEQ ID NO:40l as CDR2, and SEQ ID NO:56l as CDR3 of SEQ ID NO:298.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:298 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:299.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:298 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:299, which includes amino acid sequences SEQ ID NO:403 as CDR1, SEQ ID NO:404 as CDR2, and SEQ ID NO:405 as CDR3 of SEQ ID NO:299.
  • the present invention provides an antigen binding site that binds to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:302.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:4l2 as CDR1, SEQ ID NO:4l3 as CDR2, and SEQ ID NO:4l4 as CDR3 of SEQ ID NO:302.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:564 as CDR1, SEQ ID NO:4l3 as CDR2, and SEQ ID NO:565 as CDR3 of SEQ ID NO:302.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 302 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:303 which includes amino acid sequences SEQ ID NO:4l5 as CDR1, SEQ ID NO:4l6 as CDR2, and SEQ ID NO :417 as CDR3 of SEQ ID NO: 303.
  • the present invention provides an antigen binding site including a heavy chain variable domain that binds wild-type human CD33, but not the R69G allele of human CD33.
  • the present invention provides an antigen binding site that does not bind to the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of Q VQLVQ SGAEVKKPGAS VKV SCKASGYTF SD YYMHWVRQ APGQGLEWMGMINPS WGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAREAADGFVGERYF DLWGRGTLVTVSS [SEQ ID NO:7]
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:7.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 7 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90 %(e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 7 can be paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence
  • an antibody heavy chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 7 can be paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 8, which includes amino acid sequences
  • the present invention provides an antigen binding site that binds to wild-type human CD33 but not the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:288.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:370 as CDR1, SEQ ID NO:37l as CDR2, and SEQ ID NO:372 as CDR3 of SEQ ID NO:288. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:550 as CDR1, SEQ ID NO:37l as CDR2, and SEQ ID NO:55l as CDR3 of SEQ ID NO:288.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:289 which includes amino acid sequences SEQ ID NO:373 as CDR1, SEQ ID NO:374 as CDR2, and SEQ ID NO:375 as CDR3 of SEQ ID NO:289.
  • the present invention provides an antigen binding site that binds to wild-type human CD33 but not the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:290.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:290.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:376 as CDR1, SEQ ID NO:377 as CDR2, and SEQ ID NO:378 as CDR3 of SEQ ID NO:290. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:552 as CDR1, SEQ ID NO:377 as CDR2, and SEQ ID NO:553 as CDR3 of SEQ ID NO:290.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:290 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:29l which includes amino acid sequences SEQ ID NO:379 as CDR1, SEQ ID NO:380 as CDR2, and SEQ ID NO:38l as CDR3 of SEQ ID NO:29l.
  • the present invention provides an antigen binding site that binds to wild-type human CD33 but not the R69G allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:300.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:300.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:406 as CDR1, SEQ ID NO:407 as CDR2, and SEQ ID NO:408 as CDR3 of SEQ ID NO:300. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:562 as CDR1, SEQ ID NO:407 as CDR2, and SEQ ID NO:563 as CDR3 of SEQ ID NO:300.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:300 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:30l which includes amino acid sequences SEQ ID NO:409 as CDR1, SEQ ID NO:4lO as CDR2, and SEQ ID NO:4l l as CDR3 of SEQ ID NO:30l.
  • the present invention provides an antigen binding site including a heavy chain variable domain that binds to a unique epitope on human CD33 that includes R69.
  • the present invention provides an antigen binding site that binds to a unique epitope on human CD33 that includes R69; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of Q VQLVQ SGAEVKKPGAS VKV SCKASGYTF SD YYMHWVRQ APGQGLEWMGMINPS WGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAREAADGFVGERYF DLWGRGTLVTVSS [SEQ ID NO:7]
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:7. In some embodiments, the heavy chain variable domain incorporates amino acid sequences YTFSDYYMH [SEQ ID NO:39] as CDR1,
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 7 is combined with a light chain variable domain to form an antigen -binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 7 can be paired with an antibody light chain variable domain at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 8, which includes amino acid sequences
  • the present invention provides an antigen binding site that binds to a unique epitope on human CD33 that includes R69; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:288.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:370 as CDR1, SEQ ID NO:37l as CDR2, and SEQ ID NO:372 as CDR3 of SEQ ID NO:288. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:550 as CDR1, SEQ ID NO:37l as CDR2, and SEQ ID NO:55l as CDR3 of SEQ ID NO:288.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:289.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:288 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:289, which includes amino acid sequences SEQ ID NO:373 as CDR1, SEQ ID NO:374 as CDR2, and SEQ ID NO:375 as CDR3 of SEQ ID NO:289.
  • the present invention provides an antigen binding site that binds to a unique epitope on human CD33 that includes R69; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:290.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:290.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:376 as CDR1, SEQ ID NO:377 as CDR2, and SEQ ID NO:378 as CDR3 of SEQ ID NO:290.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:552 as CDR1, SEQ ID NO:377 as CDR2, and SEQ ID NO:553 as CDR3 of SEQ ID NO:290.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:290 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:29l.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:290 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:29l, which includes amino acid sequences SEQ ID NO:379 as CDR1, SEQ ID NO:380 as CDR2, and SEQ ID NO:38l as CDR3 of SEQ ID NO:29l.
  • the present invention provides an antigen binding site that binds to a unique epitope on human CD33 that includes R69; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:300.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:300.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:406 as CDR1, SEQ ID NO:407 as CDR2, and SEQ ID NO:408 as CDR3 of SEQ ID NO:300.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:562 as CDR1, SEQ ID NO:407 as CDR2, and SEQ ID NO:563 as CDR3 of SEQ ID NO:300.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:300 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:30l.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO: 300 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:30l, which includes amino acid sequences SEQ ID NO:409 as CDR1, SEQ ID NO:4lO as CDR2, and SEQ ID NO:4l 1 as CDR3 of SEQ ID NO:30l.
  • the present invention provides an antigen binding site that binds to the S128N allele of human CD33.
  • the present invention provides an antigen binding site that binds to the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% ( e.g ., at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:268.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:3lO as CDR1, SEQ ID NO:3 l l as CDR2, and SEQ ID NO:3 l2 as CDR3 of SEQ ID NO:268.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:530 as CDR1, SEQ ID NO:311 as CDR2, and SEQ ID NO:531 as CDR3 of SEQ ID NO:268.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:268 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:269.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:268 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:269, which includes amino acid sequences SEQ ID NO:3 l3 as CDR1, SEQ ID NO:3 l4 as CDR2, and SEQ ID NO:315 as CDR3 of SEQ ID NO:269.
  • the present invention provides an antigen binding site that binds to the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:274.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:328 as CDR1, SEQ ID NO:329 as CDR2, and SEQ ID NO:330 as CDR3 of SEQ ID NO:274.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:536 as CDR1, SEQ ID NO:329 as CDR2, and SEQ ID NO:537 as CDR3 of SEQ ID NO:274.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:274 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:275.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:274 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:275, which includes amino acid sequences SEQ ID NO:33 l as CDR1, SEQ ID NO:332 as CDR2, and SEQ ID NO:333 as CDR3 of SEQ ID NO:275.
  • the present invention provides an antigen binding site that binds to the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:276.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:334 as CDR1, SEQ ID NO:335 as CDR2, and SEQ ID NO:336 as CDR3 of SEQ ID NO:276.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:538 as CDR1, SEQ ID NO:335 as CDR2, and SEQ ID NO:539 as CDR3 of SEQ ID NO:276.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:276 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:277.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:276 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:277, which includes amino acid sequences SEQ ID NO:337 as CDR1, SEQ ID NO:338 as CDR2, and SEQ ID NO:339 as CDR3 of SEQ ID NO:277.
  • the present invention provides an antigen binding site that binds to the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:292.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:382 as CDR1, SEQ ID NO:383 as CDR2, and SEQ ID NO:384 as CDR3 of SEQ ID NO:292.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 554 as CDR1, SEQ ID NO:383 as CDR2, and SEQ ID NO:555 as CDR3 of SEQ ID NO:292.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:292 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:293.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:292 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:293, which includes amino acid sequences SEQ ID NO:385 as CDR1, SEQ ID NO:386 as CDR2, and SEQ ID NO:387 as CDR3 of SEQ ID NO:293.
  • the present invention provides an antigen binding site that binds to the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:294.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:388 as CDR1, SEQ ID NO:389 as CDR2, and SEQ ID NO:390 as CDR3 of SEQ ID NO:294.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:556 as CDR1, SEQ ID NO:389 as CDR2, and SEQ ID NO:557 as CDR3 of SEQ ID NO:294.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:294 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:295.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:294 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:295, which includes amino acid sequences SEQ ID NO:39l as CDR1, SEQ ID NO:392 as CDR2, and SEQ ID NO:393 as CDR3 of SEQ ID NO:295.
  • the present invention provides an antigen binding site that binds to the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:296.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:394 as CDR1, SEQ ID NO:395 as CDR2, and SEQ ID NO:396 as CDR3 of SEQ ID NO:296.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 558 as CDR1, SEQ ID NO:395 as CDR2, and SEQ ID NO:559 as CDR3 of SEQ ID NO:296.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:296 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:297.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:296 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:297, which includes amino acid sequences SEQ ID NO:397 as CDR1, SEQ ID NO:398 as CDR2, and SEQ ID NO:399 as CDR3 of SEQ ID NO:297.
  • the present invention provides an antigen binding site that binds to the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:298.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:400 as CDR1, SEQ ID NO:40l as CDR2, and SEQ ID NO:402 as CDR3 of SEQ ID NO:298.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:560 as CDR1, SEQ ID NO:40l as CDR2, and SEQ ID NO:56l as CDR3 of SEQ ID NO:298.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:298 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:299.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:298 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:299, which includes amino acid sequences SEQ ID NO:403 as CDR1, SEQ ID NO:404 as CDR2, and SEQ ID NO:405 as CDR3 of SEQ ID NO:299.
  • the present invention provides an antigen binding site that binds to the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:290.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:376 as CDR1, SEQ ID NO:377 as CDR2, and SEQ ID NO:378 as CDR3 of SEQ ID NO:290.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:552 as CDR1, SEQ ID NO:377 as CDR2, and SEQ ID NO:553 as CDR3 of SEQ ID NO:290.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:290 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:29l.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:290 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:29l, which includes amino acid sequences SEQ ID NO:379 as CDR1, SEQ ID NO:380 as CDR2, and SEQ ID NO:38l as CDR3 of SEQ ID NO:29l.
  • the present invention provides an antigen binding site that binds to the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% ( e.g ., at least 91%, 92%,
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:300.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:406 as CDR1, SEQ ID NO:407 as CDR2, and SEQ ID NO:408 as CDR3 of SEQ ID NO:300.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:562 as CDR1, SEQ ID NO:407 as CDR2, and SEQ ID NO:563 as CDR3 of SEQ ID NO:300.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:300 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:30l.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO: 300 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:30l, which includes amino acid sequences SEQ ID NO:409 as CDR1, SEQ ID NO:4lO as CDR2, and SEQ ID NO:4l 1 as CDR3 of SEQ ID NO:30l.
  • the present invention provides an antigen binding site including a heavy chain variable domain that binds to wild-type human CD33 but not the S128N allele of human CD33.
  • the present invention provides an antigen binding site that binds to wild-type human CD33 but not the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:302.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:302.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:4l2 as CDR1, SEQ ID NO:4l3 as CDR2, and SEQ ID NO:4l4 as CDR3 of SEQ ID NO:302. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:564 as CDR1, SEQ ID NO:4l3 as CDR2, and SEQ ID NO:565 as CDR3 of SEQ ID NO:302.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:302 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:303 which includes amino acid sequences SEQ ID NO:4l5 as CDR1, SEQ ID NO:4l6 as CDR2, and SEQ ID NO:4l7 as CDR3 of SEQ ID NO:303.
  • the present invention provides an antigen binding site that binds to wild-type human CD33 but not the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:266.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:266.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 304 as CDR1, SEQ ID NO:305 as CDR2, and SEQ ID NO:306 as CDR3 of SEQ ID NO:266. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:528 as CDR1, SEQ ID NO:305 as CDR2, and SEQ ID NO:529 as CDR3 of SEQ ID NO:266.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:266 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:267 which includes amino acid sequences SEQ ID NO:307 as CDR1, SEQ ID NO:308 as CDR2, and SEQ ID NO:309 as CDR3 of SEQ ID NO:267.
  • the present invention provides an antigen binding site that binds to wild-type human CD33 but not the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:270.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:270.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:3 l6 as CDR1, SEQ ID NO:3 l7 as CDR2, and SEQ ID NO:3 l8 as CDR3 of SEQ ID NO: 270. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:532 as CDR1, SEQ ID NO:3 l7 as CDR2, and SEQ ID NO:533 as CDR3 of SEQ ID NO:270.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:270 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:27l which includes amino acid sequences SEQ ID NO:3 l9 as CDR1, SEQ ID NO:320 as CDR2, and SEQ ID NO:32l as CDR3 of SEQ ID NO:27l.
  • the present invention provides an antigen binding site that binds to wild-type human CD33 but not the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:272.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:272.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:322 as CDR1, SEQ ID NO:323 as CDR2, and SEQ ID NO:324 as CDR3 of SEQ ID NO:272. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:534 as CDR1, SEQ ID NO:323 as CDR2, and SEQ ID NO:535 as CDR3 of SEQ ID NO:272.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:272 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:273 which includes amino acid sequences SEQ ID NO:325 as CDR1, SEQ ID NO:326 as CDR2, and SEQ ID NO:327 as CDR3 of SEQ ID NO:273.
  • the present invention provides an antigen binding site that binds to wild-type human CD33 but not the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:278.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:278.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:340 as CDR1, SEQ ID NO:34l as CDR2, and SEQ ID NO:342 as CDR3 of SEQ ID NO:278. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:540 as CDR1, SEQ ID NO:34l as CDR2, and SEQ ID NO:54l as CDR3 of SEQ ID NO:278.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:278 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:279 which includes amino acid sequences SEQ ID NO:343 as CDR1, SEQ ID NO:344 as CDR2, and SEQ ID NO:345 as CDR3 of SEQ ID NO:279.
  • the present invention provides an antigen binding site that binds to wild-type human CD33 but not the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:280.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:280.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:346 as CDR1, SEQ ID NO:347 as CDR2, and SEQ ID NO:348 as CDR3 of SEQ ID NO:280. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:542 as CDR1, SEQ ID NO:347 as CDR2, and SEQ ID NO:543 as CDR3 of SEQ ID NO:280.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:280 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:28l which includes amino acid sequences SEQ ID NO:349 as CDR1, SEQ ID NO:350 as CDR2, and SEQ ID NO:35l as CDR3 of SEQ ID NO:28l.
  • the present invention provides an antigen binding site that binds to wild-type human CD33 but not the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:282.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:282.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 352 as CDR1, SEQ ID NO:353 as CDR2, and SEQ ID NO:354 as CDR3 of SEQ ID NO:282. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:544 as CDR1, SEQ ID NO:353 as CDR2, and SEQ ID NO:545 as CDR3 of SEQ ID NO:282.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:282 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:283 which includes amino acid sequences SEQ ID NO:355 as CDR1, SEQ ID NO:356 as CDR2, and SEQ ID NO:357 as CDR3 of SEQ ID NO:283.
  • the present invention provides an antigen binding site that binds to wild-type human CD33 but not the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:284.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:284.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:358 as CDR1, SEQ ID NO:359 as CDR2, and SEQ ID NO:360 as CDR3 of SEQ ID NO:284. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:546 as CDR1, SEQ ID NO:359 as CDR2, and SEQ ID NO:360 as CDR3 of SEQ ID NO:547.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:284 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:285 which includes amino acid sequences SEQ ID NO:36l as CDR1, SEQ ID NO:362 as CDR2, and SEQ ID NO:363 as CDR3 of SEQ ID NO:285.
  • the present invention provides an antigen binding site that binds to wild-type human CD33 but not the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:286.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:286.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 364 as CDR1, SEQ ID NO:365 as CDR2, and SEQ ID NO:366 as CDR3 of SEQ ID NO:286. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:548 as CDR1, SEQ ID NO:365 as CDR2, and SEQ ID NO:549 as CDR3 of SEQ ID NO:286.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:286 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:287 which includes amino acid sequences SEQ ID NO:367 as CDR1, SEQ ID NO:368 as CDR2, and SEQ ID NO:369 as CDR3 of SEQ ID NO:287.
  • the present invention provides an antigen binding site that binds to wild-type human CD33 but not the S128N allele of human CD33; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:288.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:370 as CDR1, SEQ ID NO:37l as CDR2, and SEQ ID NO:372 as CDR3 of SEQ ID NO:288. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:550 as CDR1, SEQ ID NO:37l as CDR2, and SEQ ID NO:55l as CDR3 of SEQ ID NO:288.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:289 which includes amino acid sequences SEQ ID NO:373 as CDR1, SEQ ID NO:374 as CDR2, and SEQ ID NO:375 as CDR3 of SEQ ID NO:289.
  • the present invention provides an antigen binding site including a heavy chain variable domain that binds to a unique epitope on human CD33 that includes S128.
  • the present invention provides an antigen binding site that binds to a unique epitope on human CD33 that includes S128; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 302.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:302.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:4l2 as CDR1, SEQ ID NO:4l3 as CDR2, and SEQ ID NO:4l4 as CDR3 of SEQ ID NO:302. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:564 as CDR1, SEQ ID NO:4l3 as CDR2, and SEQ ID NO:565 as CDR3 of SEQ ID NO:302.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:302 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • amino acid sequence of SEQ ID NO:303 which includes amino acid sequences SEQ ID NO:4l5 as CDR1, SEQ ID NO:4l6 as CDR2, and SEQ ID NO:4l7 as CDR3 of SEQ ID NO:303.
  • the present invention provides an antigen binding site that binds to a unique epitope on human CD33 that includes S128; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:266.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:266.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:304 as CDR1, SEQ ID NO:305 as CDR2, and SEQ ID NO:306 as CDR3 of SEQ ID NO:266. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 528 as CDR1, SEQ ID NO:305 as CDR2, and SEQ ID NO:529 as CDR3 of SEQ ID NO:266.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:266 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:267.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:266 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:267, which includes amino acid sequences SEQ ID NO:307 as CDR1, SEQ ID NO:308 as CDR2, and SEQ ID NO:309 as CDR3 of SEQ ID NO:267.
  • the present invention provides an antigen binding site that binds to a unique epitope on human CD33 that includes S128; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:270.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:270.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:3 l6 as CDR1, SEQ ID NO:3 l7 as CDR2, and SEQ ID NO:3 l8 as CDR3 of SEQ ID NO:270. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:532 as CDR1, SEQ ID NO:3 l7 as CDR2, and SEQ ID NO:533 as CDR3 of SEQ ID NO:270.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:270 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:27l.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:270 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:27l, which includes amino acid sequences SEQ ID NO:3 l9 as CDR1, SEQ ID NO:320 as CDR2, and SEQ ID NO:32l as CDR3 of SEQ ID NO:27l.
  • the present invention provides an antigen binding site that binds to a unique epitope on human CD33 that includes S128; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:272.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:272.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:322 as CDR1, SEQ ID NO:323 as CDR2, and SEQ ID NO:324 as CDR3 of SEQ ID NO:272. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:534 as CDR1, SEQ ID NO:323 as CDR2, and SEQ ID NO:535 as CDR3 of SEQ ID NO:272.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:272 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:273.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:272 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:273, which includes amino acid sequences SEQ ID NO:325 as CDR1, SEQ ID NO:326 as CDR2, and SEQ ID NO:327 as CDR3 of SEQ ID NO:273.
  • the present invention provides an antigen binding site that binds to a unique epitope on human CD33 that includes S128; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:278.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:278.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:340 as CDR1, SEQ ID NO:34l as CDR2, and SEQ ID NO:342 as CDR3 of SEQ ID NO:278. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 540 as CDR1, SEQ ID NO:34l as CDR2, and SEQ ID NO:54l as CDR3 of SEQ ID NO:278.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:278 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:279.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:278 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:279, which includes amino acid sequences SEQ ID NO:343 as CDR1, SEQ ID NO:344 as CDR2, and SEQ ID NO:345 as CDR3 of SEQ ID NO:279.
  • the present invention provides an antigen binding site that binds to a unique epitope on human CD33 that includes S128; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:280.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:280.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:346 as CDR1, SEQ ID NO:347 as CDR2, and SEQ ID NO:348 as CDR3 of SEQ ID NO:280. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 542 as CDR1, SEQ ID NO:347 as CDR2, and SEQ ID NO:543 as CDR3 of SEQ ID NO:280.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:280 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:28l.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:280 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:28l, which includes amino acid sequences SEQ ID NO:349 as CDR1, SEQ ID NO:350 as CDR2, and SEQ ID NO:35l as CDR3 of SEQ ID NO:28l.
  • the present invention provides an antigen binding site that binds to a unique epitope on human CD33 that includes S128; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:282.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:282.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:352 as CDR1, SEQ ID NO:353 as CDR2, and SEQ ID NO:354 as CDR3 of SEQ ID NO:282. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 544 as CDR1, SEQ ID NO:353 as CDR2, and SEQ ID NO:545 as CDR3 of SEQ ID NO:282.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:282 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:283.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:282 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:283, which includes amino acid sequences SEQ ID NO:355 as CDR1, SEQ ID NO:356 as CDR2, and SEQ ID NO:357 as CDR3 of SEQ ID NO:283.
  • the present invention provides an antigen binding site that binds to a unique epitope on human CD33 that includes S128; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:284.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:284.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:358 as CDR1, SEQ ID NO:359 as CDR2, and SEQ ID NO:360 as CDR3 of SEQ ID NO:284.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 546 as CDR1, SEQ ID NO:359 as CDR2, and SEQ ID NO:360 as CDR3 of SEQ ID NO:547.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:284 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:284 can be paired with an antibody light chain variable domain at least 90%
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:285.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:284 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:285, which includes amino acid sequences SEQ ID NO:36l as CDR1, SEQ ID NO:362 as CDR2, and SEQ ID NO:363 as CDR3 of SEQ ID NO:285.
  • the present invention provides an antigen binding site that binds to a unique epitope on human CD33 that includes S128; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:286.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:286.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 364 as CDR1, SEQ ID NO:365 as CDR2, and SEQ ID NO:366 as CDR3 of SEQ ID NO:286. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 548 as CDR1, SEQ ID NO:365 as CDR2, and SEQ ID NO:549 as CDR3 of SEQ ID NO:286.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:286 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:287.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:286 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:287, which includes amino acid sequences SEQ ID NO:367 as CDR1, SEQ ID NO:368 as CDR2, and SEQ ID NO:369 as CDR3 of SEQ ID NO:287.
  • the present invention provides an antigen binding site that binds to a unique epitope on human CD33 that includes S128; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:288.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:370 as CDR1, SEQ ID NO:37l as CDR2, and SEQ ID NO:372 as CDR3 of SEQ ID NO:288. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:550 as CDR1, SEQ ID NO:37l as CDR2, and SEQ ID NO:55l as CDR3 of SEQ ID NO:288.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%,
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:289.
  • an antibody heavy chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • amino acid sequence of SEQ ID NO:288 can be paired with an antibody light chain variable domain at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:289, which includes amino acid sequences SEQ ID NO:373 as CDR1, SEQ ID NO:374 as CDR2, and SEQ ID NO:375 as CDR3 of SEQ ID NO:289.
  • An antigen binding site binds to the V domain of human CD33 in a glycosylation sensidve manner
  • the present invention provides an antigen binding site including a heavy chain variable domain that binds to the V domain of human CD33 in a glycosylation sensitive manner, e.g, binds to the V domain of CD33 only when the V domain is deglycosylated.
  • the present invention provides an antigen binding site that binds an epitope in the V domain of human CD33 only when the V domain is deglycosylated; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:278.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:278.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:340 as CDR1, SEQ ID NO:34l as CDR2, and SEQ ID NO:342 as CDR3 of SEQ ID NO:278. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:540 as CDR1, SEQ ID NO:34l as CDR2, and SEQ ID NO:54l as CDR3 of SEQ ID NO:278.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:278 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • SEQ ID NO:279 which includes amino acid sequences SEQ ID NO:343 as CDR1, SEQ ID NO:344 as CDR2, and SEQ ID NO:345 as CDR3 of SEQ ID NO:279.
  • the present invention provides an antigen binding site that binds an epitope in the V domain of human CD33 only when the V domain is deglycosylated; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:282.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:282.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:352 as CDR1, SEQ ID NO:353 as CDR2, and SEQ ID NO:354 as CDR3 of SEQ ID NO:282. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:544 as CDR1, SEQ ID NO:353 as CDR2, and SEQ ID NO:545 as CDR3 of SEQ ID NO:282.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:282 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g., at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • identical to the amino acid sequence of SEQ ID NO:282 can be paired with an antibody light chain variable domain at least 90%
  • SEQ ID NO:283 which includes amino acid sequences SEQ ID NO:355 as CDR1, SEQ ID NO:356 as CDR2, and SEQ ID NO:357 as CDR3 of SEQ ID NO:283.
  • the present invention provides an antigen binding site that binds an epitope in the V domain of human CD33 only when the V domain is deglycosylated; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:284.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:284.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:358 as CDR1, SEQ ID NO:359 as CDR2, and SEQ ID NO:360 as CDR3 of SEQ ID NO:284. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:546 as CDR1, SEQ ID NO:359 as CDR2, and SEQ ID NO:360 as CDR3 of SEQ ID NO:547.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:284 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • SEQ ID NO:285 (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:285, which includes amino acid sequences SEQ ID NO:36l as CDR1, SEQ ID NO: 362 as CDR2, and SEQ ID NO: 363 as CDR3 of SEQ ID NO:285.
  • the present invention provides an antigen binding site that binds an epitope in the V domain of human CD33 only when the V domain is deglycosylated; the antigen binding site includes a heavy chain variable domain including an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288.
  • the antibody heavy chain variable domain is at least 95% identical to SEQ ID NO:288.
  • the heavy chain variable domain incorporates amino acid sequences SEQ ID NO: 370 as CDR1, SEQ ID NO:37l as CDR2, and SEQ ID NO: 372 as CDR3 of SEQ ID NO:288. In some embodiments, the heavy chain variable domain incorporates amino acid sequences SEQ ID NO:550 as CDR1, SEQ ID NO:37l as CDR2, and SEQ ID NO:55l as CDR3 of SEQ ID NO:288.
  • the antibody heavy chain variable domain which includes an amino acid sequence at least 90% (e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO:288 is combined with a light chain variable domain to form an antigen-binding site capable of binding to CD33.
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody light chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • an antibody heavy chain variable domain at least 90% e.g, at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%
  • SEQ ID NO:289 which includes amino acid sequences SEQ ID NO: 373 as CDR1, SEQ ID NO: 374 as CDR2, and SEQ ID NO: 375 as CDR3 of SEQ ID NO:289.
  • An antigen binding site that binds to the extracellular domain in human CD33 and/or cyno CD33, irrespective of the glycosylation profile of the targeted CD33
  • the present invention provides an antigen binding site including a heavy chain variable domain which includes an amino acid sequence at least 90% (e.g ., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, or 302, which binds to the amino acid sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, or 302, which binds to the amino acid sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 29
  • the present invention provides an antigen binding site including a heavy chain variable domain that binds to the extracellular domain in human CD33 and/or cyno CD33, such that the epitopes are unique compared to the epitopes targeted by one or more known anti-CD33 antibodies in the art.
  • the present invention provides an antigen binding site including a heavy chain variable domain that binds to the extracellular domain in human CD33 and/or cyno CD33, which shows human or Cynomolgus/Rhesus (cyno) CD33 cross reactivity and high affinity binding to the target CD33.
  • the present invention provides a protein that includes a human CD33 antigen -binding site including a heavy chain variable domain, which includes an amino acid sequence at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to the amino acid sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11,
  • 296, 298, 300, or 302 further comprises a second antigen binding site same or different from the antigen-binding site that binds to human CD33.
  • the amino acid sequence of the constant region is at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a human antibody constant region, such as an human IgGl constant region, an IgG2 constant region, IgG3 constant region, or IgG4 constant region.
  • the amino acid sequence of the constant region is at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to an antibody constant region from another mammal, such as rabbit, dog, cat, mouse, or horse.
  • One or more mutations can be incorporated into the constant region as compared to human IgGl constant region, for example at Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366,
  • exemplary substitutions include, for example, Q347E, Q347R, Y349S, Y349K, Y349T, Y349D, Y349E, Y349C, T350V, L351K, L351D, L351Y, S354C, E356K, E357Q, E357L, E357W, K360E, K360W, Q362E, S364K, S364E, S364H, S364D, T366V, T366I, T366L, T366M, T366K, T366W, T366S, L368E, L368A, L368D, K370S, N390D, N390E, K392L, K392M,
  • mutations that can be incorporated into the CH1 of a human IgGl constant region may be at amino acid V125, F126, P127, T135, T139, A140, F170, P171, and/or V173.
  • mutations that can be incorporated into the CK of a human IgGl constant region may be at amino acid E123, Fl 16, S176, V163,
  • the present invention provides an antigen-binding site in a protein (e.g, a multi-specific binding protein) that binds to CD33 on a cancer cell, and the NKG2D receptor and CD 16 receptor on natural killer cells to activate the natural killer cell.
  • a protein e.g, a multi-specific binding protein
  • the term“antibody” encompasses proteins (e.g, multi-specific binding proteins) that comprise one or more antigen-binding sites (e.g, an antigen-binding site that binds CD33), and is not limited to single-specific antibodies.
  • the protein (e.g ., multi-specific binding protein) or antibody is a trispecific antibody, also called Trispecific NK cell Engagement Therapy (TriNKET).
  • the protein (e.g., a multi-specific binding protein) is useful in the pharmaceutical compositions and therapeutic methods described herein. Binding of the protein including an antigen-binding site that binds to CD33, and to NKG2D receptor and CD 16 receptor on natural killer cell enhances the activity of the natural killer cell toward destruction of a cancer cell. Binding of the protein including an antigen-binding site that binds to CD33 (e.g, a multi-specific binding protein) on a cancer cell brings the cancer cell into proximity to the natural killer cell, which facilitates direct and indirect destruction of the cancer cell by the natural killer cell. Further description of exemplary multi-specific binding proteins is provided below.
  • the first component of the multi specific binding proteins binds to CD33 -expressing cells, which can include but are not limited to AML, myelodysplastic syndromes, chronic myelomonocytic leukemia, myeloid blast crisis of chronic myeloid leukemia, and ALLs.
  • the second component of the multi-specific binding proteins binds to NKG2D receptor-expressing cells, which can include but are not limited to NK cells, gd T cells and CD8 + ab T cells.
  • NKG2D receptor-expressing cells which can include but are not limited to NK cells, gd T cells and CD8 + ab T cells.
  • the multi-specific binding proteins may block natural ligands, such as EILBP6 and MICA, from binding to NKG2D and activating NKG2D receptors.
  • the third component for the multi-specific binding proteins binds to cells expressing CD16, an Fc receptor on the surface of leukocytes including natural killer cells, macrophages, neutrophils, eosinophils, mast cells, and follicular dendritic cells.
  • Another aspect of the present invention provides a protein comprising an antigen binding site that binds NKG2D, the antigen-binding site comprising a heavy chain variable domain comprising:
  • CDR1 comprising the amino acid sequence of SYSMN [SEQ ID NO: 192];
  • CDR2 comprising the amino acid sequence of SISSSSSYIYYADSVKG [SEQ ID NO: 112];
  • CDR3 comprising the amino acid sequence of GAPXGAAAGWFDP [SEQ ID NO:527], wherein X is A, V, L, I, P, F, W, G, S, T, C, N, Q, or Y; and
  • a light chain variable domain comprising:
  • CDR1 comprising the amino acid sequence of RASQGISSWLA [SEQ ID NO: 1]
  • CDR2 comprising the amino acid sequence of AASSLQS [SEQ ID NO:l 15]
  • CDR3 comprising the amino acid sequence of QQGVSFPRT [SEQ ID NO:l 16]
  • X is A, V, L, I, P, F, or W. In certain embodiments, X is V, L, or I.
  • the amino acid sequence of CDR3 in the heavy chain variable domain comprises the sequence of SEQ ID NO: 123. In certain embodiments, the amino acid sequence of CDR3 in the heavy chain variable domain comprises the sequence of SEQ ID NO: 195, SEQ ID NO:588, SEQ ID NO:59l, SEQ ID NO:594, or SEQ ID NO:597.
  • the antigen-binding site comprises a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to the amino acid sequence of SEQ ID NO: 191; and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to the amino acid sequence of SEQ ID NO:8l.
  • the antigen-binding site comprises a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 191; and a light chain variable domain comprising the amino acid sequence of SEQ ID NO:8l.
  • the antigen-binding site that binds NKG2D is in the form of an Fab fragment. In certain embodiments, the antigen-binding site that binds NKG2D is in the form of an scFv.
  • the present invention provides a protein comprising (a) a first antigen-binding site comprising an Fab fragment that binds NKG2D as disclosed herein; (b) a second antigen-binding site comprising a single-chain variable fragment (scFv) that binds a tumor associated antigen (e.g, CD33); and (c) an antibody Fc domain or a portion thereof sufficient to bind CD 16, or a third antigen-binding site that binds CD 16.
  • a protein comprising (a) a first antigen-binding site comprising an Fab fragment that binds NKG2D as disclosed herein; (b) a second antigen-binding site comprising a single-chain variable fragment (scFv) that binds a tumor associated antigen (e.g, CD33); and (c) an antibody Fc domain or a portion thereof sufficient to bind CD 16, or a third antigen-binding site that binds CD 16.
  • scFv single-chain variable fragment
  • the multi-specific binding proteins described herein can take various formats.
  • one format is a heterodimeric, multi-specific antibody which includes a first immunoglobulin heavy chain, a first immunoglobulin light chain, a second immunoglobulin heavy chain and a second immunoglobulin light chain.
  • the first immunoglobulin heavy chain includes a first Fc (hinge-CH2-CH3) domain, a first heavy chain variable domain and optionally a first CH1 heavy chain domain.
  • the first immunoglobulin light chain includes a first light chain variable domain and a first light chain constant domain.
  • the immunoglobulin light chain together with the first immunoglobulin heavy chain, forms an antigen-binding site that binds CD33.
  • the second immunoglobulin heavy chain comprises a second Fc (hinge-CH2-CH3) domain, a second heavy chain variable domain and optionally a second CH1 heavy chain domain.
  • the second immunoglobulin light chain includes a second light chain variable domain and a second light chain constant domain.
  • the second immunoglobulin light chain, together with the second immunoglobulin heavy chain forms an antigen-binding site that binds NKG2D.
  • the first Fc domain and second Fc domain together are able to bind to CD 16.
  • Another exemplary format involves a heterodimeric, multi-specific antibody which includes a first immunoglobulin heavy chain, a second immunoglobulin heavy chain and an immunoglobulin light chain.
  • the first immunoglobulin heavy chain includes a first Fc (hinge-CH2-CH3) domain fused via either a linker or an antibody hinge to a single-chain variable fragment (scFv) composed of a heavy variable domain and light chain variable domain which pair and bind CD33 or NKG2D.
  • the second immunoglobulin heavy chain includes a second Fc (hinge-CH2-CH3) domain, a second heavy chain variable domain and optionally a CH1 heavy chain domain.
  • the immunoglobulin light chain includes a light chain variable domain and a constant light chain domain.
  • the second immunoglobulin heavy chain pairs with the immunoglobulin light chain and binds to NKG2D or CD33.
  • the first Fc domain and the second Fc domain together are able to bind to CD 16.
  • One or more additional binding motifs may be fused to the C-terminus of the constant region CH3 domain, optionally via a linker sequence.
  • the antigen-binding site could be a single-chain or disulfide-stabilized variable region (scFv) or could form a tetravalent or trivalent molecule.
  • the multi-specific binding protein is in the Triomab form, which is a trifunctional, bispecific antibody that maintains an IgG-like shape.
  • This chimera consists of two half antibodies, each with one light and one heavy chain, that originate from two parental antibodies.
  • the multi-specific binding protein is the KiH Common Light Chain (LC) form, which involves the knobs-into-holes (KIHs) technology.
  • the KIH involves engineering C H 3 domains to create either a“knob” or a“hole” in each heavy chain to promote heterodimerization.
  • the concept behind the“Knobs-into-Holes (KiH)” Fc technology was to introduce a“knob” in one CH3 domain (CH3 A) by substitution of a small residue with a bulky one (e.g ., T366WC H3A in EU numbering).
  • a complementary“hole” surface was created on the other CH3 domain (CH3B) by replacing the closest neighboring residues to the knob with smaller ones (e.g.,
  • T366S/L368A/Y407VC H3B The“hole” mutation was optimized by structured-guided phage library screening (Atwell S, Ridgway JB, Wells JA, Carter P., Stable heterodimers from remodeling the domain interface of a homodimer using a phage display library, J. Mol. Biol. (1997) 270(l):26-35).
  • X-ray crystal structures of KiH Fc variants (Elliott JM, Ultsch M, Lee J, Tong R, Takeda K, Spiess C, et al. , Antiparallel conformation of knob and hole aglycosylated half-antibody homodimers is mediated by a CH2-CH3 hydrophobic
  • the multi-specific binding protein is in the dual-variable domain immunoglobulin (DVD-IgTM) form, which combines the target binding domains of two monoclonal antibodies via flexible naturally occurring linkers, and yields a tetravalent IgG - like molecule.
  • DVD-IgTM dual-variable domain immunoglobulin
  • the multi-specific binding protein is in the Orthogonal Fab interface (Ortho-Fab) form.
  • Ortho-Fab IgG approach Lewis SM, Wu X, Pustilnik A, Sereno A, Huang F, Rick HL, et al ., Generation of bispecific IgG antibodies by structure- based design of an orthogonal Fab interface. Nat. Biotechnol. (2014) 32(2): 191-8
  • structure- based regional design introduces complementary mutations at the LC and HCVH-CHI interface in only one Fab, without any changes being made to the other Fab.
  • the multi-specific binding protein is in the 2-in-l Ig format. In some embodiments, the multi-specific binding protein is in the ES form, which is a heterodimeric construct containing two different Fabs binding to targets 1 and target 2 fused to the Fc. Heterodimerization is ensured by electrostatic steering mutations in the Fc.
  • the multi-specific binding protein is in the kl-Body form, which is an heterodimeric constructs with two different Fabs fused to Fc stabilized by heterodimerization mutations: Fabl targeting antigen 1 contains kappa LC, while second Fab targeting antigen 2 contains lambda LC.
  • FIG. 30A is an exemplary representation of one form of a kl-Body;
  • FIG. 30B is an exemplary representation of another kl-Body.
  • the multi-specific binding protein is in Fab Arm Exchange form (antibodies that exchange Fab arms by swapping a heavy chain and attached light chain (half-molecule) with a heavy -light chain pair from another molecule, which results in bispecific antibodies).
  • the multi-specific binding protein is in the SEED Body form.
  • SEED strand-exchange engineered domain
  • the SEED design allows efficient generation of AG/GA heterodimers, while disfavoring homodimerization of AG and GA SEED CH3 domains.
  • the multi-specific binding protein is in the LuZ-Y form, in which a leucine zipper is used to induce heterodimerization of two different HCs.
  • the multi-specific binding protein is in the Cov-X-Body form.
  • CovX-Bodies two different peptides are joined together using a branched azetidinone linker and fused to the scaffold antibody under mild conditions in a site-specific manner. Whereas the pharmacophores are responsible for functional activities, the antibody scaffold imparts long half-life and Ig-like distribution. The pharmacophores can be chemically optimized or replaced with other pharmacophores to generate optimized or unique bispecific antibodies. (Doppalapudi VR et al. , PNAS (2010), l07(52);22611-22616).
  • the multi-specific binding protein is in an Oasc-Fab heterodimeric form that includes Fab binding to target 1, and scFab binding to target 2 fused to Fc. Heterodimerization is ensured by mutations in the Fc.
  • the multi-specific binding protein is in a DuetMab form, which is an heterodimeric construct containing two different Fabs binding to antigens 1 and 2, and Fc stabilized by heterodimerization mutations.
  • Fab 1 and 2 contain differential S-S bridges that ensure correct LC and HC pairing.
  • the multi-specific binding protein is in a CrossmAb form, which is an heterodimeric construct with two different Fabs binding to targets 1 and 2, fused to Fc stabilized by heterodimerization.
  • CL and CH1 domains and VH and VL domains are switched, e.g. , CH1 is fused in-line with VL, while CL is fused in-line with VH.
  • the multi-specific binding protein is in a Fit-Ig form, which is a homodimeric constructs where Fab binding to antigen 2 is fused to the N terminus of HC of Fab that binds to antigen 1.
  • the construct contains wild-type Fc.
  • the third component for the multi-specific binding proteins is an antibody constant region.
  • each of the two immunoglobulin heavy chains of the antibody constant region includes a constant region with an amino acid sequence at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to human IgGl constant region.
  • the amino acid sequence of one polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl constant region at one or more positions selected from the group consisting of Q347, Y349, L351, S354, E356, E357, K360, Q362, S364, T366, L368, K370, K392, T394, D399, S400, D401, F405, Y407, K409, T411 and K439; and the amino acid sequence of the other polypeptide chain of the antibody constant region differs from the amino acid sequence of an IgGl constant region at one or more positions selected from the group consisting of Q347, Y349, L351, S354, E356, E357, S364, T366, L368, K370, N390, K392, T394, D399, D401, F405, Y407, K409, T411 and K439.
  • the NKG2D-antigen binding site comprises:
  • a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:8l and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a SEQ ID NO: 82 [ADI-29379];
  • a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:83 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a SEQ ID NO: 84 [ADI-29463];
  • a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:85 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a SEQ ID NO: 86 [ADI-27744];
  • a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:87 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a SEQ ID NO:88 [ADI-27749]; (5) a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 191 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a SEQ ID
  • a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO:89 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a SEQ ID NO: 90 [ADI-29378]
  • the NKG2D-antigen binding site comprises:
  • a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 124 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a SEQ ID NO: 125 [ADI-27705];
  • a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 129 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a SEQ ID NO: 130 [ADI-27724];
  • a heavy chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to SEQ ID NO: 131 and a light chain variable domain comprising an amino acid sequence at least 90% (e.g, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to a SEQ ID NO: 132 [ADI-27740];

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)
PCT/US2019/018751 2018-02-20 2019-02-20 Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use Ceased WO2019164930A1 (en)

Priority Applications (17)

Application Number Priority Date Filing Date Title
JP2020566544A JP7353576B2 (ja) 2018-02-20 2019-02-20 Cd33、nkg2d、及びcd16に結合する多重特異性結合タンパク質、ならびにその使用方法
AU2019225741A AU2019225741A1 (en) 2018-02-20 2019-02-20 Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use
PE2020001249A PE20210110A1 (es) 2018-02-20 2019-02-20 Proteinas de union multiespecificas que se unen a cd33, nkg2d y cd16 y metodos de uso
CA3091424A CA3091424A1 (en) 2018-02-20 2019-02-20 Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use
EA202091977A EA202091977A1 (ru) 2018-05-28 2019-02-20 Мультиспецифические связывающие белки, которые связывают cd33, nkg2d и cd16, и способы применения
US16/971,104 US12215157B2 (en) 2018-02-20 2019-02-20 Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use
MYPI2020004294A MY208785A (en) 2018-02-20 2019-02-20 Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use
EP19757000.5A EP3755721A4 (en) 2018-02-20 2019-02-20 MULTI-SPECIFIC BINDING PROTEINS THAT BIND CD33, NKG2D AND CD16, AND METHODS OF USE
SG11202007945UA SG11202007945UA (en) 2018-02-20 2019-02-20 Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use
MX2020008684A MX2020008684A (es) 2018-02-20 2019-02-20 Proteinas de union multiespecificas que se unen a cd33, nkg2d y cd16 y metodos de uso.
KR1020207026680A KR102832460B1 (ko) 2018-02-20 2019-02-20 Cd33, nkg2d, 및 cd16에 결합하는 다중-특이적 결합 단백질, 및 이의 사용 방법
CN201980026077.7A CN112119093A (zh) 2018-02-20 2019-02-20 结合cd33、nkg2d和cd16的多特异性结合蛋白和使用方法
BR112020016939-0A BR112020016939A2 (pt) 2018-02-20 2019-02-20 Proteínas de ligação multiespecíficas que se ligam a cd33, nkg2d, e cd16 e métodos de uso
IL276778A IL276778A (en) 2018-02-20 2020-08-18 Multispecific binding proteins that bind cd33, nkg2d, and cd16 and methods for their use
US17/736,031 US20220380459A1 (en) 2018-02-20 2022-05-03 Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use
JP2023141006A JP2023164908A (ja) 2018-02-20 2023-08-31 Cd33、nkg2d、及びcd16に結合する多重特異性結合タンパク質、ならびにその使用方法
US18/912,306 US20250154261A1 (en) 2018-02-20 2024-10-10 Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201862632756P 2018-02-20 2018-02-20
US62/632,756 2018-02-20
US201862677137P 2018-05-28 2018-05-28
US62/677,137 2018-05-28

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US16/971,104 A-371-Of-International US12215157B2 (en) 2018-02-20 2019-02-20 Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use
US17/736,031 Continuation US20220380459A1 (en) 2018-02-20 2022-05-03 Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use
US18/912,306 Division US20250154261A1 (en) 2018-02-20 2024-10-10 Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use

Publications (1)

Publication Number Publication Date
WO2019164930A1 true WO2019164930A1 (en) 2019-08-29

Family

ID=67688572

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/018751 Ceased WO2019164930A1 (en) 2018-02-20 2019-02-20 Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use

Country Status (16)

Country Link
US (3) US12215157B2 (https=)
EP (1) EP3755721A4 (https=)
JP (2) JP7353576B2 (https=)
KR (1) KR102832460B1 (https=)
CN (1) CN112119093A (https=)
AU (1) AU2019225741A1 (https=)
BR (1) BR112020016939A2 (https=)
CA (1) CA3091424A1 (https=)
CL (3) CL2020002144A1 (https=)
IL (1) IL276778A (https=)
MX (1) MX2020008684A (https=)
MY (1) MY208785A (https=)
PE (1) PE20210110A1 (https=)
SG (1) SG11202007945UA (https=)
TW (1) TW201942134A (https=)
WO (1) WO2019164930A1 (https=)

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021098851A1 (en) * 2019-11-20 2021-05-27 Eucure (Beijing) Biopharma Co., Ltd Anti-ctla4/ox40 bispecific antibodies and uses thereof
EP3802581A4 (en) * 2018-05-28 2022-04-13 Dragonfly Therapeutics, Inc. MULTISPECIFIC BINDING PROTEINS AND IMPROVEMENTS THERETO
WO2022234003A1 (en) 2021-05-07 2022-11-10 Avacta Life Sciences Limited Cd33 binding polypeptides with stefin a protein
JP2023508942A (ja) * 2020-05-06 2023-03-06 ドラゴンフライ セラピューティクス, インコーポレイテッド Nkg2d、cd16及びclec12aに結合するタンパク質
WO2023057946A1 (en) 2021-10-07 2023-04-13 Avacta Life Sciences Limited Serum half-life extended pd-l1 binding polypeptides
WO2023057567A1 (en) 2021-10-07 2023-04-13 Avacta Life Sciences Limited Pd-l1 binding affimers
JP2023525695A (ja) * 2020-05-04 2023-06-19 イミュノライゾン リミテッド 前駆体三重特異性抗体構築物及びその使用方法
US11939384B1 (en) 2018-02-08 2024-03-26 Dragonfly Therapeutics, Inc. Antibody variable domains targeting the NKG2D receptor
EP4045538A4 (en) * 2019-10-15 2024-11-06 Dragonfly Therapeutics, Inc. PROTEINS BINDING TO NKG2D, CD16 AND FLT3
US12215157B2 (en) 2018-02-20 2025-02-04 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use
US12275791B2 (en) 2018-08-08 2025-04-15 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use
US12378318B2 (en) 2018-08-08 2025-08-05 Dragonfly Therapeutics, Inc. Proteins binding NKG2D, CD16 and a tumor-associated antigen
US12377144B2 (en) 2021-03-03 2025-08-05 Dragonfly Therapeutics, Inc. Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen
US12384851B2 (en) 2018-08-08 2025-08-12 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind BCMA, NKG2D and CD16, and methods of use
US12384847B2 (en) 2018-02-08 2025-08-12 Dragonfly Therapeutics, Inc. Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen
EP4377354A4 (en) * 2021-07-30 2026-01-21 Nanjing Legend Biotech Co Ltd Anti-CD33 antibodies and their uses

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2018219887B2 (en) 2017-02-08 2024-08-15 Dragonfly Therapeutics, LLC Multi-specific binding proteins for activation of natural killer cells and therapeutic uses thereof to treat cancer
CN110944661A (zh) 2017-02-20 2020-03-31 蜻蜓疗法股份有限公司 结合her2、nkg2d和cd16的蛋白质
TW202110873A (zh) 2019-04-30 2021-03-16 美商聖堤生物科技股份有限公司 嵌合受體及其使用方法
BR112022023697A2 (pt) * 2020-05-21 2022-12-20 Merus Nv Métodos e meios para a produção de moléculas semelhantes a ig
CN117482246B (zh) * 2022-12-30 2024-10-15 英百瑞(杭州)生物医药有限公司 抗cd33/cll1双特异性抗体-自然杀伤细胞偶联物及其用途
WO2024238769A2 (en) * 2023-05-16 2024-11-21 The Regents Of The University Of California Inhibitory chimeric antigen receptors that reduce car-t cell "on-target, off-tumor" toxicity

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20120058906A1 (en) * 2008-11-07 2012-03-08 Vaughn Smider Combinatorial antibody libraries and uses thereof
WO2016109774A1 (en) * 2015-01-02 2016-07-07 Dyax Corp. Bispecific antibodies against plasma kallikrein and factor xii
US20170114141A1 (en) * 2015-10-02 2017-04-27 Hoffmann-La Roche Inc. Bispecific antibodies specific for a costimulatory tnf receptor
US20170368169A1 (en) * 2016-03-21 2017-12-28 Elstar Therapeutics, Inc. Multispecific and multifunctional molecules and uses thereof

Family Cites Families (297)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0366707A1 (en) 1987-05-06 1990-05-09 OOSTERWIJK, Egbert Monoclonal antibodies to renal cell carcinoma
EP0415929A1 (en) 1988-01-15 1991-03-13 Centocor, Inc. Heteroligating antibodies and therapeutic uses thereof
WO1992008802A1 (en) 1990-10-29 1992-05-29 Cetus Oncology Corporation Bispecific antibodies, method of production, and uses thereof
US6036955A (en) 1992-03-05 2000-03-14 The Scripps Research Institute Kits and methods for the specific coagulation of vasculature
US5965132A (en) 1992-03-05 1999-10-12 Board Of Regents, The University Of Texas System Methods and compositions for targeting the vasculature of solid tumors
US5776427A (en) 1992-03-05 1998-07-07 Board Of Regents, The University Of Texas System Methods for targeting the vasculature of solid tumors
PT627940E (pt) 1992-03-05 2003-07-31 Univ Texas Utilizacao de imunoconjugados para o diagnostico e/ou terapia de tumores vascularizados
US7381803B1 (en) 1992-03-27 2008-06-03 Pdl Biopharma, Inc. Humanized antibodies against CD3
US6129914A (en) 1992-03-27 2000-10-10 Protein Design Labs, Inc. Bispecific antibody effective to treat B-cell lymphoma and cell line
US5622701A (en) 1994-06-14 1997-04-22 Protein Design Labs, Inc. Cross-reacting monoclonal antibodies specific for E- and P-selectin
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
EP0871673B1 (en) 1995-05-03 2006-04-05 Bioenhancementsments Ltd. Bispecific antibodies in which the binding capability is reversibly inhibited by a photocleavable moiety
DE19531346A1 (de) 1995-08-25 1997-02-27 Gsf Forschungszentrum Umwelt Arzneimittel zur Immuntherapie, enthaltend Antikörper, die spezifisch das MHCII-Antigen eines zu behandelnden Patienten erkennen
US7951917B1 (en) 1997-05-02 2011-05-31 Genentech, Inc. Method for making multispecific antibodies having heteromultimeric and common components
US7112324B1 (en) 1998-04-21 2006-09-26 Micromet Ag CD 19×CD3 specific polypeptides and uses thereof
US6572856B1 (en) 1998-09-10 2003-06-03 The University Of Virginia Patent Foundation Methods for the prevention and treatment of cancer using anti-C3b(i) antibodies
DE69936927T2 (de) 1998-10-21 2008-05-15 Altor Bioscience Corp., Miramar Polyspezifische bindemoleküle und deren verwendung
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US20040038339A1 (en) 2000-03-24 2004-02-26 Peter Kufer Multifunctional polypeptides comprising a binding site to an epitope of the nkg2d receptor complex
CA2409991A1 (en) 2000-05-24 2001-11-29 Imclone Systems Incorporated Bispecific immunoglobulin-like antigen binding proteins and method of production
US20040115198A1 (en) 2001-02-28 2004-06-17 Fred Hutchinson Cancer Research Center Activation of lymphocyte populations expressing NKG2D using anti-NKG2D antibodies and ligand derivatives
US20030095965A1 (en) 2001-05-02 2003-05-22 Katrien Van Beneden Antibodies to Ly49E and CD94/NKG2 receptors
US20020193569A1 (en) 2001-06-04 2002-12-19 Idec Pharmaceuticals Corporation Bispecific fusion protein and method of use for enhancing effector cell killing of target cells
DE10156482A1 (de) 2001-11-12 2003-05-28 Gundram Jung Bispezifisches Antikörper-Molekül
NZ542784A (en) 2002-08-19 2008-07-31 Astrazeneca Ab Antibodies directed to monocyte chemo-attractant protein-1 (MCP-1) and uses thereof
US7820166B2 (en) 2002-10-11 2010-10-26 Micromet Ag Potent T cell modulating molecules
DE10261223A1 (de) 2002-12-20 2004-07-08 MedInnova Gesellschaft für medizinische Innovationen aus akademischer Forschung mbH Steigerung der Immunantwort durch Substanzen, welche die Funktion von Natürlichen Killerzellen beeinflussen
US20060235201A1 (en) 2003-02-06 2006-10-19 Roman Kischel Enduring T cell response
US7666417B2 (en) 2003-04-22 2010-02-23 Fred Hutchinson Cancer Research Center Methods and compositions for treating autoimmune diseases or conditions
DK1629011T3 (da) 2003-05-31 2010-05-03 Micromet Ag Humane anti-humane-DC3-bindingsmolekyler
JP2008501621A (ja) 2003-05-31 2008-01-24 マイクロメット アクツィエン ゲゼルシャフト B細胞関連疾患を処置するための二重特異性抗cd3、抗cd19抗体構築物を含む薬学的組成物
HRP20120845T1 (hr) 2003-07-02 2012-11-30 Innate Pharma Protutijela za pan-kir2dl nk-receptor i njihova uporaba u dijagnostici i lijeäśenju
HRP20170342T1 (hr) 2003-07-24 2017-05-19 Innate Pharma S.A. Metode i sastavi za povećanje učinkovitosti terapijskih protutijela koristeći tvari koje potenciraju nk stanice
HN2004000285A (es) 2003-08-04 2006-04-27 Pfizer Prod Inc ANTICUERPOS DIRIGIDOS A c-MET
MXPA06004035A (es) 2003-10-16 2006-08-31 Micromet Ag Aglutinantes cd3 de-inmunizados multi-especificos.
US7235641B2 (en) 2003-12-22 2007-06-26 Micromet Ag Bispecific antibodies
US20110020273A1 (en) 2005-04-06 2011-01-27 Ibc Pharmaceuticals, Inc. Bispecific Immunocytokine Dock-and-Lock (DNL) Complexes and Therapeutic Use Thereof
EP1716178B1 (en) 2004-02-16 2010-08-11 Micromet AG Less immunogenic binding molecules
CA2564246A1 (en) 2004-04-30 2005-11-10 Innate Pharma Compositions and methods for treating immunoproliferatifs disorders such as nk-type ldgl
AU2005263555B2 (en) 2004-07-16 2011-01-27 Amgen Research (Munich) Gmbh Expression-enhanced polypeptides
DK1771482T3 (da) 2004-07-22 2014-10-20 Genentech Inc HER2-antistofsammensætning
JP2008514685A (ja) 2004-10-01 2008-05-08 メディジーン リミテッド 治療剤に連結した、非天然型ジスルフィド鎖間結合を含有するt細胞レセプター
DOP2006000029A (es) 2005-02-07 2006-08-15 Genentech Inc Antibody variants and uses thereof. (variantes de un anticuerpo y usos de las mismas)
US9284375B2 (en) 2005-04-15 2016-03-15 Macrogenics, Inc. Covalent diabodies and uses thereof
ES2971647T3 (es) 2005-04-15 2024-06-06 Macrogenics Inc Diacuerpos covalentes y usos de los mismos
WO2007002905A1 (en) 2005-06-29 2007-01-04 University Of Miami Antibody-immune cell ligand fusion protein for cancer therapy
WO2007022520A2 (en) 2005-08-19 2007-02-22 Cerus Corporation Antibody-mediated enhancement of immune response
PE20071101A1 (es) 2005-08-31 2007-12-21 Amgen Inc Polipeptidos y anticuerpos
EP1940881B1 (en) 2005-10-11 2016-11-30 Amgen Research (Munich) GmbH Compositions comprising cross-species-specific antibodies and uses thereof
CN101300272B (zh) 2005-10-14 2013-09-18 依奈特制药公司 用于治疗增生性病症的组合物和方法
US20080299137A1 (en) 2005-10-28 2008-12-04 Novo Nordisk A/S Fusion Proteins That Bind Effector Lymphocytes And Target Cells
JP2009514537A (ja) 2005-11-03 2009-04-09 ジェネンテック・インコーポレーテッド 治療的抗her2抗体融合ポリペプチド
WO2007055926A1 (en) 2005-11-03 2007-05-18 Fred Hutchinson Cancer Research Center Negative immunomodulation of immune responses by nkg2d-positive cd4+ cells
HRP20150175T1 (en) 2005-12-16 2015-03-27 Amgen Research (Munich) Gmbh Means and methods for the treatment of tumorous diseases
EP1820513A1 (en) 2006-02-15 2007-08-22 Trion Pharma Gmbh Destruction of tumor cells expressing low to medium levels of tumor associated target antigens by trifunctional bispecific antibodies
NZ573646A (en) 2006-06-12 2012-04-27 Wyeth Llc Single-chain multivalent binding proteins with effector function
GB0614780D0 (en) 2006-07-25 2006-09-06 Ucb Sa Biological products
EP2450377A1 (en) 2006-09-07 2012-05-09 Crucell Holland B.V. Human binding molecules capable of neutralizing influenza virus H5N1 and uses thereof
EP1900752A1 (en) 2006-09-15 2008-03-19 DOMPE' pha.r.ma s.p.a. Human anti-folate receptor alpha antibodies and antibody fragments for the radioimmunotherapy of ovarian carcinoma
CN101269760B (zh) 2007-03-23 2011-11-16 海德堡印刷机械股份公司 收纸滚筒及双面印刷机
EP2158318A2 (en) 2007-05-14 2010-03-03 Biogen Idec MA, Inc. Single-chain fc (scfc) regions, binding polypeptides comprising same, and methods related thereto
EP2014680A1 (en) 2007-07-10 2009-01-14 Friedrich-Alexander-Universität Erlangen-Nürnberg Recombinant, single-chain, trivalent tri-specific or bi-specific antibody derivatives
JP2010534469A (ja) 2007-07-25 2010-11-11 アストラゼネカ アクチボラグ Kdr指向性標的化結合物質およびその使用
JP2010536341A (ja) 2007-08-15 2010-12-02 アムニクス, インコーポレイテッド 生物学的に活性なポリペプチドの特性を改変するための組成物および方法
JOP20080381B1 (ar) 2007-08-23 2023-03-28 Amgen Inc بروتينات مرتبطة بمولدات مضادات تتفاعل مع بروبروتين كونفيرتاز سيتيليزين ككسين من النوع 9 (pcsk9)
EP3124497B1 (en) 2007-09-14 2020-04-15 Adimab, LLC Rationally designed, synthetic antibody libraries and uses therefor
AU2008337517B2 (en) 2007-12-14 2014-06-26 Novo Nordisk A/S Antibodies against human NKG2D and uses thereof
JP6157046B2 (ja) 2008-01-07 2017-07-05 アムジェン インコーポレイテッド 静電的ステアリング(electrostaticsteering)効果を用いた抗体Fcヘテロ二量体分子を作製するための方法
JP2011509687A (ja) 2008-01-22 2011-03-31 バイオジェン・アイデック・エムエイ・インコーポレイテッド Ron抗体およびその使用
AR071891A1 (es) 2008-05-30 2010-07-21 Imclone Llc Anticuerpos humanos anti-flt3 (receptor tirosina cinasa 3 tipo fms humano)
TW201006485A (en) 2008-06-03 2010-02-16 Abbott Lab Dual variable domain immunoglobulins and uses thereof
US8067339B2 (en) 2008-07-09 2011-11-29 Merck Sharp & Dohme Corp. Surface display of whole antibodies in eukaryotes
WO2010017103A2 (en) 2008-08-04 2010-02-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Servic Fully human anti-human nkg2d monoclonal antibodies
US10865233B2 (en) 2008-12-18 2020-12-15 Dana-Farber Cancer Institute, Inc. NKG2D-fc for immunotherapy
DK2786762T3 (da) 2008-12-19 2019-05-06 Macrogenics Inc Kovalente diabodies og anvendelser deraf
MX2011010166A (es) 2009-04-07 2011-10-11 Roche Glycart Ag Anticuerpos biespecificos anti-erbb-3/anti-c-met.
WO2010132697A2 (en) 2009-05-13 2010-11-18 Genzyme Corporation Methods and compositions for treatment
WO2010144295A1 (en) 2009-06-09 2010-12-16 University Of Miami Aptamer-targeted costimulatory ligand aptamer
GB0909904D0 (en) 2009-06-09 2009-07-22 Affitech As Product
WO2011003780A1 (en) 2009-07-06 2011-01-13 F. Hoffmann-La Roche Ag Bi-specific digoxigenin binding antibodies
UY32808A (es) 2009-07-29 2011-02-28 Abbott Lab Inmunoglobulinas como dominio variable dual y usos de las mismas
WO2011028952A1 (en) 2009-09-02 2011-03-10 Xencor, Inc. Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens
WO2011030851A1 (ja) 2009-09-11 2011-03-17 タカラバイオ株式会社 ナチュラルキラー細胞の製造方法
DE102009045006A1 (de) 2009-09-25 2011-04-14 Technische Universität Dresden Anti-CD33 Antikörper und ihre Anwendung zum Immunotargeting bei der Behandlung von CD33-assoziierten Erkrankungen
RS54655B2 (sr) 2009-10-27 2021-04-29 Amgen Res Munich Gmbh Dozni režim za primenu cd19xcd3 bispecifičnog antitela
WO2011057124A1 (en) 2009-11-06 2011-05-12 Transtarget, Inc. Polyclonal bispecific antibody compositions and method of use
EP2332994A1 (en) 2009-12-09 2011-06-15 Friedrich-Alexander-Universität Erlangen-Nürnberg Trispecific therapeutics against acute myeloid leukaemia
US20120288507A1 (en) 2009-12-18 2012-11-15 Amgen Inc. Wise binding agents and epitopes
DK2516468T3 (en) 2009-12-23 2016-05-23 Synimmune Gmbh ANTI-FLT3 ANTIBODIES AND METHODS FOR USING THESE
US8796420B2 (en) 2009-12-31 2014-08-05 Avidbiotics Corp. Non-natural MIC proteins
US8658765B2 (en) 2009-12-31 2014-02-25 Avidbiotics Corp. Non-natural MIC proteins
WO2011085178A1 (en) 2010-01-11 2011-07-14 Trustees Of Dartmouth College Monomeric bi-specific fusion protein
PH12012501751A1 (en) 2010-03-04 2012-11-12 Macrogenics Inc Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof
EP2542256B1 (en) 2010-03-04 2019-05-22 MacroGenics, Inc. Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof
TWI653333B (zh) 2010-04-01 2019-03-11 安進研究(慕尼黑)有限責任公司 跨物種專一性之PSMAxCD3雙專一性單鏈抗體
HRP20241208T1 (hr) 2010-04-20 2024-11-22 Genmab A/S Heterodimerni proteini koji sadrže fc fragment protutijela i postupci za njihovu proizvodnju
KR101860963B1 (ko) 2010-04-23 2018-05-24 제넨테크, 인크. 이종다량체 단백질의 생산
US9527926B2 (en) 2010-05-14 2016-12-27 Rinat Neuroscience Corp. Heterodimeric proteins and methods for producing and purifying them
EP3323830B1 (en) 2010-06-19 2023-08-23 Memorial Sloan-Kettering Cancer Center Anti-gd2 antibodies
UY33492A (es) 2010-07-09 2012-01-31 Abbott Lab Inmunoglobulinas con dominio variable dual y usos de las mismas
DE102010039018B4 (de) 2010-08-06 2013-02-28 Technische Universität Dresden Anti-La Antikörper und ihre Anwendung zum Immunotargeting
JP2013537416A (ja) 2010-08-13 2013-10-03 メディミューン リミテッド 変異型Fc領域を含むモノマーポリペプチド及び使用方法
CN103068846B9 (zh) 2010-08-24 2016-09-28 弗·哈夫曼-拉罗切有限公司 包含二硫键稳定性Fv片段的双特异性抗体
TWI560199B (en) 2010-08-31 2016-12-01 Sanofi Sa Peptide or peptide complex binding to α2 integrin and methods and uses involving the same
WO2012032080A1 (en) 2010-09-07 2012-03-15 F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H Stabilised human fc
CN103328511B (zh) 2010-09-10 2016-01-20 埃派斯进有限公司 抗-IL-1β抗体及其使用方法
UA112062C2 (uk) 2010-10-04 2016-07-25 Бьорінгер Інгельхайм Інтернаціональ Гмбх Cd33-зв'язувальний агент
UY33707A (es) 2010-11-04 2012-05-31 Abbott Lab Inmunoglobulinas con dominio variable dual y usos de las mismas
ES2758994T3 (es) 2010-11-05 2020-05-07 Zymeworks Inc Diseño anticuerpo heterodimérico estable con mutaciones en el dominio Fc
TWI452136B (zh) 2010-11-17 2014-09-11 中外製藥股份有限公司 A multiple specific antigen-binding molecule that replaces the function of Factor VIII in blood coagulation
UY33826A (es) 2010-12-22 2012-07-31 Abbott Lab Proteínas de unión con dominios trivariables y sus usos
MX352889B (es) 2011-02-25 2017-12-13 Chugai Pharmaceutical Co Ltd Anticuerpo de fc especifico para fcyriib.
EP2686345B1 (en) 2011-03-16 2018-04-25 Amgen Inc. Fc variants
BR112013023918A2 (pt) 2011-03-25 2016-12-13 Glenmark Pharmaceuticals Sa imunoglobulina hetero-dimérica ou fragmento hetero-dimérico da mesma, método para produzir uma imunoglobulina hetero-dimérica ou fragmento hetero-dimérico da mesma, método para construir uma interface proteína-proteína de um domínio de uma proteína de múltiplos domínios e uso de um domínio doador de um primeiro e de um segundo membro de uma super-família de imunoglobulina de ocorrência natural
WO2012158818A2 (en) 2011-05-16 2012-11-22 Fabion Pharmaceuticals, Inc. Multi-specific fab fusion proteins and methods of use
BR112013029892A2 (pt) 2011-05-21 2016-12-20 Macrogenics Inc polipeptídeo, molécula de ligação a antígeno, diacorpo e uso de uma porção polipeptídica de uma proteína de ligação a soro desimunizada
EP2714738B1 (en) 2011-05-24 2018-10-10 Zyngenia, Inc. Multivalent and monovalent multispecific complexes and their uses
US8852599B2 (en) 2011-05-26 2014-10-07 Bristol-Myers Squibb Company Immunoconjugates, compositions for making them, and methods of making and use
US20140234342A1 (en) 2011-06-21 2014-08-21 Innate Pharma Nkp46-mediated nk cell tuning
TWI687439B (zh) 2011-06-30 2020-03-11 中外製藥股份有限公司 異源二聚化多胜肽
DE102011118022B4 (de) 2011-06-30 2018-01-18 Gemoab Monoclonals Gmbh Antikörper gegen das Prostata-spezifische Stammzellenantigen und dessen Verwendung
US8790651B2 (en) 2011-07-21 2014-07-29 Zoetis Llc Interleukin-31 monoclonal antibody
WO2013013700A1 (en) 2011-07-22 2013-01-31 Affimed Therapeutics Ag Multivalent antigen-binding fv molecule
WO2013036799A2 (en) 2011-09-09 2013-03-14 Fred Hutchinson Cancer Research Center Methods and compositions involving nkg2d inhibitors and cancer
JP6322411B2 (ja) 2011-09-30 2018-05-09 中外製薬株式会社 複数の生理活性を有する抗原の消失を促進する抗原結合分子
KR102276528B1 (ko) 2011-09-30 2021-07-12 추가이 세이야쿠 가부시키가이샤 이온 농도 의존성 결합 분자 라이브러리
HUE033245T2 (hu) 2011-12-19 2017-11-28 Synimmune Gmbh Bispecifikus ellenanyag molekula
US10633451B2 (en) 2012-02-03 2020-04-28 Hoffmann-La Roche Inc. Bispecific antibody molecules with antigen-transfected T-cells and their use in medicine
WO2013120012A2 (en) 2012-02-08 2013-08-15 Igm Biosciences Inc. Cdim binding proteins and uses thereof
GB201203442D0 (en) 2012-02-28 2012-04-11 Univ Birmingham Immunotherapeutic molecules and uses
US9029510B2 (en) 2012-03-30 2015-05-12 Sorrento Therapeutics, Inc. Fully human antibodies that bind to VEGFR2 and methods of use thereof
US9248181B2 (en) 2012-04-20 2016-02-02 Merus B.V. Methods and means for the production of Ig-like molecules
US9163090B2 (en) 2012-05-07 2015-10-20 Cellerant Therapeutics, Inc. Antibodies specific for CLL-1
US20130309223A1 (en) 2012-05-18 2013-11-21 Seattle Genetics, Inc. CD33 Antibodies And Use Of Same To Treat Cancer
WO2013180200A1 (ja) 2012-05-30 2013-12-05 中外製薬株式会社 標的組織特異的抗原結合分子
JP6628966B2 (ja) 2012-06-14 2020-01-15 中外製薬株式会社 改変されたFc領域を含む抗原結合分子
CN105050618B (zh) 2012-06-21 2018-11-16 索伦托治疗有限公司 与c-Met结合的抗原结合蛋白
RU2639287C2 (ru) 2012-06-27 2017-12-20 Ф. Хоффманн-Ля Рош Аг Способ отбора и получения высокоселективных и мультиспецифичных нацеливающих групп с заданными свойствами, включающих по меньшей мере две различные связывающие группировки, и их применения
AU2013289883B2 (en) 2012-07-13 2018-11-01 Zymeworks Bc Inc. Bispecific asymmetric heterodimers comprising anti-CD3 constructs
IN2015DN01299A (https=) 2012-07-23 2015-07-03 Zymeworks Inc
US20150203591A1 (en) 2012-08-02 2015-07-23 Regeneron Pharmaceuticals, Inc. Mutivalent antigen-binding proteins
CN104379169A (zh) 2012-08-14 2015-02-25 Ibc药品公司 用于治疗疾病的t-细胞重定向双特异性抗体
HUE042040T2 (hu) 2012-09-27 2019-06-28 Merus Nv Bispecifikus IGG antitestek mint T-sejt kapcsolók
US9562110B2 (en) 2012-11-21 2017-02-07 Wuhan Yzy Biopharma Co., Ltd. Bispecific antibody
JP6385357B2 (ja) 2012-11-27 2018-09-05 アジュ ユニバーシティー インダストリー−アカデミック コーオペレイション ファウンデーションAjou University Industry−Academic Cooperation Foundation 抗体重鎖不変部位の異種二量体、高効率の形成を誘導するch3ドメイン変異体対、その作製方法および用途
KR20200024345A (ko) 2013-01-10 2020-03-06 젠맵 비. 브이 인간 IgG1 Fc 영역 변이체 및 그의 용도
KR102211837B1 (ko) 2013-01-14 2021-02-03 젠코어 인코포레이티드 신규한 이형이량체 단백질
US10968276B2 (en) 2013-03-12 2021-04-06 Xencor, Inc. Optimized anti-CD3 variable regions
WO2014116846A2 (en) 2013-01-23 2014-07-31 Abbvie, Inc. Methods and compositions for modulating an immune response
WO2014122143A1 (en) 2013-02-05 2014-08-14 Engmab Ag Method for the selection of antibodies against bcma
US10047163B2 (en) 2013-02-08 2018-08-14 Abbvie Stemcentrx Llc Multispecific constructs
LT2961771T (lt) 2013-02-26 2020-03-10 Roche Glycart Ag Bispecifinės t ląstelę aktyvinančios antigeną surišančios molekulės, specifinės cd3 ir cea antigenams
SMT202100464T1 (it) 2013-03-14 2021-11-12 Macrogenics Inc Molecole bispecifiche che sono immunoreattive con cellule effettrici immunitarie che esprimono un recettore di attivazione
US10858417B2 (en) 2013-03-15 2020-12-08 Xencor, Inc. Heterodimeric proteins
RU2680267C2 (ru) 2013-03-15 2019-02-19 Мемориал Слоан Кеттеринг Кэнсер Сентер Высокоаффинные антитела к gd2
ES2821753T3 (es) 2013-03-15 2021-04-27 Lilly Co Eli Procedimientos de producción de Fab y de anticuerpos biespecíficos
JP6594855B2 (ja) 2013-03-15 2019-10-23 ゼンコア インコーポレイテッド ヘテロ二量体タンパク質
WO2014165818A2 (en) 2013-04-05 2014-10-09 T Cell Therapeutics, Inc. Compositions and methods for preventing and treating prostate cancer
HK1221908A1 (zh) 2013-04-29 2017-06-16 Adimab, Llc 多特异(polyspecificity)试剂,其制备方法和用途
EP3415534A1 (en) 2013-05-10 2018-12-19 Numab Therapeutics AG Bispecific constructs and their use in the treatment of various diseases
WO2014198748A1 (en) 2013-06-11 2014-12-18 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-her2 single domain antibodies, polypeptides comprising thereof and their use for treating cancer
US9908944B2 (en) 2013-07-15 2018-03-06 Novo Nordisk A/S Antibodies that bind urokinase plasminogen activator
BR112016000853A2 (pt) 2013-07-16 2017-12-12 Genentech Inc métodos para tratar ou retardar, reduzir ou inibir a recidiva ou a progressão do câncer e a progressão de uma doença imune-relacionada em um indivíduo, para aumentar, melhorar ou estimular uma resposta ou função imune em um indivíduo e kit
CN105722859B (zh) 2013-07-25 2021-05-07 西托姆克斯治疗公司 多特异性抗体、多特异性可活化抗体及其使用方法
GB2518221A (en) 2013-09-16 2015-03-18 Sergej Michailovic Kiprijanov Tetravalent antigen-binding protein molecule
RU2671089C2 (ru) 2013-09-16 2018-10-29 Хельмхольтц Центрум Мюнхен - Дойчес Форшунгсцентрум Фюр Гезундхайт Унд Умвельт (Гмбх) Би- или полиспецифические полипептиды, связывающие поверхностные антигены иммунных эффекторных клеток и антигены hbv для лечения инфекций bv и ассоциированных с ними состояний
GB2519786A (en) 2013-10-30 2015-05-06 Sergej Michailovic Kiprijanov Multivalent antigen-binding protein molecules
EP3066130B1 (en) 2013-11-07 2019-05-15 Memorial Sloan-Kettering Cancer Center Anti-wt1/hla bi-specific antibody
DE102013019352A1 (de) 2013-11-13 2015-09-17 Elke Pogge Von Strandmann Tri-spezifische rekombinante Antikörperderivate zur Behandlung von malignen Erkrankungen durch Aktivierung einer NK-Zell-basierten Immunantwort
SG11201604784XA (en) 2013-12-13 2016-07-28 Genentech Inc Anti-cd33 antibodies and immunoconjugates
WO2015095412A1 (en) 2013-12-19 2015-06-25 Zhong Wang Bispecific antibody with two single-domain antigen-binding fragments
EP3083696B1 (en) 2013-12-20 2018-02-14 F.Hoffmann-La Roche Ag Bispecific her2 antibodies and methods of use
CN105849124B (zh) 2013-12-20 2022-04-12 豪夫迈·罗氏有限公司 双重特异性抗体
KR20160122127A (ko) 2013-12-23 2016-10-21 자임워크스 인코포레이티드 C-말단의 경쇄 폴리펩타이드 연장부를 포함하는 항체 및 이의 컨쥬게이트 및 이들의 사용방법
US10519251B2 (en) 2013-12-30 2019-12-31 Epimab Biotherapeutics, Inc. Fabs-in-tandem immunoglobulin and uses thereof
RU2016132863A (ru) 2014-01-15 2018-02-20 Займворкс Инк. БИСПЕЦИФИЧЕСКИЕ CD3 и CD19 АНТИГЕНСВЯЗЫВАЮЩИЕ КОНСТРУКЦИИ
DK3241561T3 (da) 2014-03-05 2025-06-30 Autolus Ltd Konjugeret antistof eller bispecifik t-celle-engager, som selektivt binder enten tcr-beta konstant region 1 (trbc1) eller trbc2
KR20160146747A (ko) 2014-03-31 2016-12-21 제넨테크, 인크. 항혈관신생제 및 ox40 결합 효능제를 포함하는 조합 요법
EP4050026A1 (en) 2014-04-01 2022-08-31 Adimab, LLC Method of obtaining or identifying one or more common light chains for use in preparing a multispecific antibody
UA117289C2 (uk) 2014-04-02 2018-07-10 Ф. Хоффманн-Ля Рош Аг Мультиспецифічне антитіло
PL3560954T3 (pl) 2014-04-03 2021-12-13 Igm Biosciences, Inc. Zmodyfikowany łańcuch J
SG11201608192SA (en) 2014-04-11 2016-10-28 Medimmune Llc Bispecific her2 antibodies
EP2930188A1 (en) 2014-04-13 2015-10-14 Affimed Therapeutics AG Trifunctional antigen-binding molecule
EP2942629A1 (en) 2014-05-08 2015-11-11 Universität Würzburg Predictive markers for successful cancer immunotherapy
EA035419B9 (ru) * 2014-05-29 2020-08-07 Мэкроудженикс, Инк. Триспецифичные связывающие молекулы и способы их применения
GB201409558D0 (en) 2014-05-29 2014-07-16 Ucb Biopharma Sprl Method
WO2015197598A2 (en) 2014-06-27 2015-12-30 Innate Pharma Multispecific antigen binding proteins
WO2015197582A1 (en) 2014-06-27 2015-12-30 Innate Pharma Monomeric multispecific antigen binding proteins
JP6822849B2 (ja) 2014-06-27 2021-01-27 イナート・ファルマ・ソシエテ・アノニムInnate Pharma Pharma S.A. 多重特異的NKp46結合タンパク質
WO2016001810A1 (en) 2014-07-01 2016-01-07 Pfizer Inc. Bispecific heterodimeric diabodies and uses thereof
US9777073B2 (en) 2014-07-21 2017-10-03 Wuhan Yzy Biopharma Co., Ltd. Construction and application of bispecific antibody EpCAM×CD3
CN106999556B (zh) 2014-07-21 2021-07-30 武汉友芝友生物制药有限公司 细胞因子诱导的杀伤细胞的双特异性抗体介导的癌症治疗
TWI719942B (zh) 2014-07-21 2021-03-01 瑞士商諾華公司 使用cd33嵌合抗原受體治療癌症
JP6390239B2 (ja) 2014-07-25 2018-09-19 富士ゼロックス株式会社 情報処理装置、及びプログラム
EP2985294A1 (en) 2014-08-14 2016-02-17 Deutsches Krebsforschungszentrum Recombinant antibody molecule and its use for target cell restricted T cell activation
AU2015301460B2 (en) 2014-08-14 2021-04-08 Novartis Ag Treatment of cancer using GFR alpha-4 chimeric antigen receptor
JO3663B1 (ar) 2014-08-19 2020-08-27 Merck Sharp & Dohme الأجسام المضادة لمضاد lag3 وأجزاء ربط الأنتيجين
RU2017105425A (ru) 2014-08-28 2018-09-28 Академиш Зикенхёйс Лейден Х.О.Д.Н. Люмк Комбинации антитела против cd94/nkg2a и/или cd94/nkg2b и вакцины
EP2990416B1 (en) 2014-08-29 2018-06-20 GEMoaB Monoclonals GmbH Universal chimeric antigen receptor expressing immune cells for targeting of diverse multiple antigens and method of manufacturing the same and use of the same for treatment of cancer, infections and autoimmune disorders
EP3215531A1 (en) 2014-11-03 2017-09-13 Merck Patent GmbH Methods for generating bispecific shark variable antibody domains and use thereof
EP3227332B1 (en) 2014-12-03 2019-11-06 F.Hoffmann-La Roche Ag Multispecific antibodies
CA2963274C (en) 2014-12-05 2024-01-30 Avidbiotics Corp. Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands
WO2016100533A2 (en) 2014-12-17 2016-06-23 Intrexon Corporation Intercalated single-chain variable fragments
MX384198B (es) 2014-12-19 2025-03-14 Chiome Bioscience Inc Proteina de fusion que comprende tres dominios de union a 5t4 y cd3.
CA2973720A1 (en) * 2015-01-14 2016-07-21 Compass Therapeutics Llc Multispecific immunomodulatory antigen-binding constructs
WO2016122701A1 (en) 2015-01-26 2016-08-04 Macrogenics, Inc. Anti-dr5 antibodies and molecules comprising dr5-binding domains thereof
WO2016134371A2 (en) 2015-02-20 2016-08-25 Ohio State Innovation Foundation Bivalent antibody directed against nkg2d and tumor associated antigens
MA41613A (fr) 2015-02-23 2018-01-02 Abbvie Stemcentrx Llc Récepteurs antigéniques chimériques anti-dll3 et procédés d'utilisation desdits récepteurs
WO2016135041A1 (en) 2015-02-26 2016-09-01 INSERM (Institut National de la Santé et de la Recherche Médicale) Fusion proteins and antibodies comprising thereof for promoting apoptosis
US11673957B2 (en) 2015-03-10 2023-06-13 Eureka Therapeutics, Inc. Anti-ROR2 antibodies
WO2016146702A1 (en) 2015-03-16 2016-09-22 Helmholtz Zentrum München - Deutsches Forschungszentrum für Gesundheit und Umwelt (GmbH) Trispecific binding molecules for treating hbv infection and associated conditions
WO2016161390A1 (en) 2015-04-03 2016-10-06 Eureka Therapeutics, Inc. Constructs targeting afp peptide/mhc complexes and uses thereof
RS61907B1 (sr) 2015-04-06 2021-06-30 Subdomain Llc Polipeptidi koji sadrže de novo vezujući domen i njihova primena
SI3280441T1 (sl) 2015-04-07 2022-01-31 Alector Llc Protitelesa anti-sortilin in metoda njihove uporabe
TWI703159B (zh) 2015-04-13 2020-09-01 美商輝瑞股份有限公司 Bcma特異性治療性抗體及其用途
WO2016187220A2 (en) 2015-05-18 2016-11-24 Five Prime Therapeutics, Inc. Anti-ror1 antibodies
EP3095792A1 (en) 2015-05-19 2016-11-23 Klinikum rechts der Isar der Technischen Universität München T cell receptor with specificity for myeloperoxidase peptide and uses thereof
US20180147257A1 (en) 2015-05-22 2018-05-31 The Board Of Trustees Of The Leland Stanford Junior University Btn3a ectodomain proteins and methods of use
MA53355A (fr) 2015-05-29 2022-03-16 Agenus Inc Anticorps anti-ctla-4 et leurs procédés d'utilisation
DK3303396T5 (da) 2015-05-29 2024-10-07 Bristol Myers Squibb Co Antistoffer mod ox40 og anvendelser deraf
AU2016276981B2 (en) 2015-06-12 2022-10-06 Alector Llc Anti-CD33 antibodies and methods of use thereof
HK1252675A1 (zh) 2015-06-12 2019-05-31 Alector Llc 抗cd33抗体及其使用方法
AU2016274989A1 (en) 2015-06-12 2017-11-02 Immunomedics, Inc. Disease therapy with chimeric antigen receptor (car) constructs and t cells (car-t) or nk cells (car-nk) expressing car constructs
AU2016284871B2 (en) 2015-06-23 2022-09-29 Innate Pharma Multispecific NK engager proteins
DK3313876T3 (da) 2015-06-23 2025-04-22 Innate Pharma Multispecifikke antigenbindende proteiner
US10344081B2 (en) 2015-07-06 2019-07-09 Ucb Biopharma Sprl Tau-binding antibodies
EP3322735A4 (en) 2015-07-15 2019-03-13 Zymeworks Inc. ACTIVE CONJUGATED BIS-SPECIFIC ANTIGEN-BONDING CONSTRUCTS
TWI793062B (zh) 2015-07-31 2023-02-21 德商安美基研究(慕尼黑)公司 Dll3及cd3抗體構築體
EP3349792A1 (en) 2015-09-14 2018-07-25 Compass Therapeutics LLC Compositions and methods for treating cancer via antagonism of the cd155/tigit pathway and tgf-
KR101851380B1 (ko) 2015-10-12 2018-04-23 아주대학교산학협력단 효모접합을 이용한 항체 ch3 도메인 이종이중체 돌연변이쌍 제조 방법 및 이에 의하여 제조된 ch3 돌연변이체 쌍
CA3003458A1 (en) 2015-10-29 2017-05-04 Alector Llc Anti-siglec-9 antibodies and methods of use thereof
KR20180083874A (ko) 2015-11-04 2018-07-23 사울 제이. 프라이스맨 Her2를 표적화하는 키메라 항원 수용체
US10815290B2 (en) 2015-11-10 2020-10-27 Fred Hutchinson Cancer Research Center NKG2D decoys
US20180327499A1 (en) 2015-11-13 2018-11-15 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti- nkg2d single domain antibodies and uses thereof
EP3397645B1 (en) 2015-12-28 2026-03-25 Innate Pharma Variable regions for nkp46 binding proteins
WO2017124002A1 (en) 2016-01-13 2017-07-20 Compass Therapeutics Llc Multispecific immunomodulatory antigen-binding constructs
MA55746A (fr) 2016-01-21 2022-03-02 Novartis Ag Molécules multispécifiques ciblant cll-1
WO2017142928A1 (en) 2016-02-17 2017-08-24 Macrogenics, Inc. Ror1-binding molecules, and methods of use thereof
CN109310766A (zh) 2016-02-26 2019-02-05 伊蒙纽斯私人有限公司 多特异性分子
EP3432924A1 (en) 2016-03-23 2019-01-30 Novartis AG Cell secreted minibodies and uses thereof
CA3021634A1 (en) 2016-04-15 2017-10-19 Zymeworks Inc. Multi-specific antigen-binding constructs targeting immunotherapeutics
GEP20227398B (en) 2016-04-15 2022-07-25 Macrogenics Inc Novel b7-h3 binding molecules, antibody drug conjugates thereof and usage thereof
GB201610044D0 (en) 2016-06-08 2016-07-20 Ucb Biopharma Sprl Antibodies
JP7010854B2 (ja) 2016-06-14 2022-01-26 ゼンコア インコーポレイテッド 二重特異性チェックポイント阻害剤抗体
US9567399B1 (en) 2016-06-20 2017-02-14 Kymab Limited Antibodies and immunocytokines
CN105906722B (zh) 2016-06-24 2020-02-07 安徽未名细胞治疗有限公司 一种Her2特异性嵌合抗原受体及其应用
AU2017319519A1 (en) 2016-09-01 2019-04-18 Immunomab, Inc. Bispecific antibodies
US20190225702A1 (en) 2016-10-14 2019-07-25 Harpoon Therapeutics, Inc. Innate immune cell trispecific binding proteins and methods of use
WO2018081648A2 (en) 2016-10-29 2018-05-03 Genentech, Inc. Anti-mic antibidies and methods of use
JP7291396B2 (ja) 2016-11-22 2023-06-15 ティーシーアール2 セラピューティクス インク. 融合タンパク質を用いたtcrの再プログラミングのための組成物及び方法
JOP20190134A1 (ar) 2016-12-23 2019-06-02 Potenza Therapeutics Inc بروتينات رابطة لمولد ضد مضادة لنيوروبيلين وطرق استخدامها
AU2018219887B2 (en) * 2017-02-08 2024-08-15 Dragonfly Therapeutics, LLC Multi-specific binding proteins for activation of natural killer cells and therapeutic uses thereof to treat cancer
WO2018148447A1 (en) 2017-02-08 2018-08-16 Adimab, Llc Antibody heavy chain variable domains targeting the nkg2d receptor
CA3053275A1 (en) 2017-02-10 2018-08-16 Dragonfly Therapeutics, Inc. Proteins binding psma, nkg2d and cd16
CN110461361A (zh) 2017-02-10 2019-11-15 蜻蜓治疗公司 结合bcma、nkg2d和cd16的蛋白
WO2018152547A1 (en) 2017-02-20 2018-08-23 Adimab, Llc Proteins binding cd123, nkg2d and cd16
CN110944661A (zh) * 2017-02-20 2020-03-31 蜻蜓疗法股份有限公司 结合her2、nkg2d和cd16的蛋白质
SG11201907638QA (en) 2017-02-20 2019-09-27 Dragonfly Therapeutics Inc Proteins binding cd33, nkg2d and cd16
BR112019017256A2 (pt) 2017-02-20 2020-04-14 Dragonfly Therapeutics Inc proteínas de ligação gd2, nkg2d e cd16
CA3177692A1 (en) 2017-02-27 2018-08-30 Dragonfly Therapeutics, Inc. Multispecific binding proteins targeting caix, ano1, mesothelin, trop2, or claudin-18.2
US20200179511A1 (en) 2017-04-28 2020-06-11 Novartis Ag Bcma-targeting agent, and combination therapy with a gamma secretase inhibitor
US20200157226A1 (en) 2017-05-23 2020-05-21 Dragonfly Therapeutics, Inc. Proteins binding nkg2d, cd16 and a tumor-associated antigen
IL270803B1 (en) 2017-05-23 2026-02-01 Dragonfly Therapeutics Inc NKG2D, CD16, and tumor-associated antigen binding protein
JP2020521448A (ja) 2017-05-23 2020-07-27 ドラゴンフライ セラピューティクス, インコーポレイテッド Nkg2d、cd16、およびror1またはror2に結合するタンパク質
US20200165344A1 (en) 2017-07-31 2020-05-28 Dragonfly Therapeutics, Inc. Proteins binding nkg2d, cd16 and flt3
BR112019023789A2 (pt) 2017-08-03 2020-07-28 Alector Llc anticorpos anti-cd33 e métodos de uso dos mesmos
EP3668893A4 (en) 2017-08-16 2021-08-04 Dragonfly Therapeutics, Inc. PROTEINS BINDING TO NKG2D, CD16 AND EGFR, HLA-E, CCR4, OR PD-L1
US20200231679A1 (en) 2017-08-23 2020-07-23 Dragonfly Therapeutics, Inc. Proteins binding nkg2d, cd16 and a tumor-associated antigen
SG11202001930QA (en) 2017-09-07 2020-04-29 Dragonfly Therapeutics Inc Proteins binding nkg2d, cd16 and a tumor-associated antigen
EA202090718A1 (ru) 2017-09-14 2020-07-01 Драгонфлай Терапьютикс, Инк. Белки, связывающие nkg2d, cd16 и лектиноподобную молекулу-1 c-типа (cll-1)
BR112020015994A2 (pt) * 2018-02-08 2020-12-15 Dragonfly Therapeutics, Inc. Terapia de combinação do câncer que envolve proteínas de ligação multiespecíficas que ativam células natural killer
CA3237846A1 (en) 2018-02-08 2019-08-15 Dragonfly Therapeutics, Inc. Antibody variable domains targeting the nkg2d receptor
BR112020016944A2 (pt) 2018-02-20 2020-12-15 Dragonfly Therapeutics, Inc. Domínios variáveis de anticorpo que alvejam cd33 e uso dos mesmos
WO2019164930A1 (en) 2018-02-20 2019-08-29 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use
EP3773676A4 (en) 2018-04-03 2022-05-18 Dragonfly Therapeutics, Inc. Proteins binding nkg2d, cd16 and an antigen associated with tumors, mdscs and/or tams
EP3774921A4 (en) 2018-04-03 2022-01-05 Dragonfly Therapeutics, Inc. ANTIBODY VARIABLE DOMAINS AGAINST DLL3 AND USE OF IT
KR20210018275A (ko) 2018-05-07 2021-02-17 드래곤플라이 쎄라퓨틱스, 인크. Nkg2d, cd16 및 종양-연관 항원에 결합하는 단백질
AU2019271263A1 (en) 2018-05-16 2020-12-03 Dragonfly Therapeutics, Inc. Protein binding NKG2D, CD16 and a fibroblast activation protein
EA202091977A1 (ru) * 2018-05-28 2021-02-09 Драгонфлай Терапьютикс, Инк. Мультиспецифические связывающие белки, которые связывают cd33, nkg2d и cd16, и способы применения
EP3833392A4 (en) 2018-08-08 2022-05-18 Dragonfly Therapeutics, Inc. MULTISPECIFIC BINDING PROTEINS FOR BINDING CD33, NKG2D AND CD16 AND METHODS OF USE
JP2021534096A (ja) 2018-08-08 2021-12-09 ドラゴンフライ セラピューティクス, インコーポレイテッド Nkg2d、cd16および腫瘍関連抗原に結合するタンパク質
EA202091888A1 (ru) 2018-08-08 2020-10-23 Драгонфлай Терапьютикс, Инк. Вариабельные домены антител, нацеленные на рецептор nkg2d
KR102835308B1 (ko) 2018-08-08 2025-07-21 드래곤플라이 쎄라퓨틱스, 인크. Nkg2d, cd16 및 종양 관련 항원에 결합하는 단백질
SG11202104136YA (en) 2018-10-23 2021-05-28 Dragonfly Therapeutics Inc Heterodimeric fc-fused proteins
EP3927722A4 (en) 2019-02-18 2022-11-23 Courier Therapeutics, Inc. BISPECIFIC FUSION PROTEIN USING ORTHOPOXVIRUS MAJOR HISTOCOMPATIBILITY COMPLEX (MHC) CLASS L-LIKE PROTEIN (OMCP) AND TUMOR-SPECIFIC BINDING PARTNER
WO2020263830A1 (en) 2019-06-25 2020-12-30 Gilead Sciences, Inc. Flt3l-fc fusion proteins and methods of use
AR119393A1 (es) 2019-07-15 2021-12-15 Hoffmann La Roche Anticuerpos que se unen a nkg2d
AU2020337999A1 (en) 2019-08-30 2022-03-24 Dragonfly Therapeutics, Inc. Pharmaceutical formulations and dosage regimens for multi-specific binding proteins that bind HER2, NKG2D, and CD16 for cancer treatment
MX2022003414A (es) * 2019-09-25 2022-04-18 Fate Therapeutics Inc Celulas efectoras con multiples objetivos y uso de las mismas.
MX2022013112A (es) 2020-04-22 2023-01-16 Dragonfly Therapeutics Inc Fórmulacion, regimen de dosificación y proceso de manufactura de proteínas heterodiméricas fusionadas con fc.
JP7512394B2 (ja) 2020-05-06 2024-07-08 ドラゴンフライ セラピューティクス, インコーポレイテッド Nkg2d、cd16及びclec12aに結合するタンパク質
US20230257467A1 (en) 2020-08-05 2023-08-17 Dragonfly Therapeutics, Inc. Proteins binding nkg2d, cd16 and egfr
EP4301774A4 (en) 2021-03-03 2025-08-13 Dragonfly Therapeutics Inc METHODS OF TREATING CANCER USING MULTI-SPECIFIC BINDING PROTEINS THAT BIND TO NKG2D, CD16, AND A TUMOR-ASSOCIATED ANTIGEN
AR127162A1 (es) 2021-09-29 2023-12-27 Dragonfly Therapeutics Inc Proteínas que se unen a nkg2d, cd16 y baff-r
WO2023107956A1 (en) 2021-12-08 2023-06-15 Dragonfly Therapeutics, Inc. Proteins binding nkg2d, cd16 and 5t4
EP4476263A4 (en) 2022-02-09 2026-01-28 Dragonfly Therapeutics Inc PHARMACEUTICAL FORMULATIONS AND THERAPEUTIC USES OF MULTI-SPECIFIC BINDING PROTEINS THAT BIND TO EGFR, NKG2D AND CD16
US20230416402A1 (en) 2022-03-03 2023-12-28 Dragonfly Therapeutics, Inc. Methods of treating cancer using multi-specific binding proteins that bind nkg2d, cd16, and her2

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20120058906A1 (en) * 2008-11-07 2012-03-08 Vaughn Smider Combinatorial antibody libraries and uses thereof
WO2016109774A1 (en) * 2015-01-02 2016-07-07 Dyax Corp. Bispecific antibodies against plasma kallikrein and factor xii
US20170114141A1 (en) * 2015-10-02 2017-04-27 Hoffmann-La Roche Inc. Bispecific antibodies specific for a costimulatory tnf receptor
US20170368169A1 (en) * 2016-03-21 2017-12-28 Elstar Therapeutics, Inc. Multispecific and multifunctional molecules and uses thereof

Cited By (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11939384B1 (en) 2018-02-08 2024-03-26 Dragonfly Therapeutics, Inc. Antibody variable domains targeting the NKG2D receptor
US12384847B2 (en) 2018-02-08 2025-08-12 Dragonfly Therapeutics, Inc. Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen
US12264200B2 (en) 2018-02-08 2025-04-01 Dragonfly Therapeutics, Inc. Antibody variable domains targeting the NKG2D receptor
US12129300B2 (en) 2018-02-08 2024-10-29 Dragonfly Therapeutics, Inc. Antibody variable domains targeting the NKG2D receptor
US12215157B2 (en) 2018-02-20 2025-02-04 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use
EP3802581A4 (en) * 2018-05-28 2022-04-13 Dragonfly Therapeutics, Inc. MULTISPECIFIC BINDING PROTEINS AND IMPROVEMENTS THERETO
US12275791B2 (en) 2018-08-08 2025-04-15 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use
US12384851B2 (en) 2018-08-08 2025-08-12 Dragonfly Therapeutics, Inc. Multi-specific binding proteins that bind BCMA, NKG2D and CD16, and methods of use
US12378318B2 (en) 2018-08-08 2025-08-05 Dragonfly Therapeutics, Inc. Proteins binding NKG2D, CD16 and a tumor-associated antigen
EP4045538A4 (en) * 2019-10-15 2024-11-06 Dragonfly Therapeutics, Inc. PROTEINS BINDING TO NKG2D, CD16 AND FLT3
WO2021098851A1 (en) * 2019-11-20 2021-05-27 Eucure (Beijing) Biopharma Co., Ltd Anti-ctla4/ox40 bispecific antibodies and uses thereof
JP2023525695A (ja) * 2020-05-04 2023-06-19 イミュノライゾン リミテッド 前駆体三重特異性抗体構築物及びその使用方法
CN115836088A (zh) * 2020-05-06 2023-03-21 蜻蜓疗法股份有限公司 结合nkg2d、cd16和clec12a的蛋白质
JP2024160215A (ja) * 2020-05-06 2024-11-13 ドラゴンフライ セラピューティクス, インコーポレイテッド Nkg2d、cd16及びclec12aに結合するタンパク質
JP2023508942A (ja) * 2020-05-06 2023-03-06 ドラゴンフライ セラピューティクス, インコーポレイテッド Nkg2d、cd16及びclec12aに結合するタンパク質
JP7512394B2 (ja) 2020-05-06 2024-07-08 ドラゴンフライ セラピューティクス, インコーポレイテッド Nkg2d、cd16及びclec12aに結合するタンパク質
US12377144B2 (en) 2021-03-03 2025-08-05 Dragonfly Therapeutics, Inc. Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen
WO2022234003A1 (en) 2021-05-07 2022-11-10 Avacta Life Sciences Limited Cd33 binding polypeptides with stefin a protein
EP4377354A4 (en) * 2021-07-30 2026-01-21 Nanjing Legend Biotech Co Ltd Anti-CD33 antibodies and their uses
WO2023057946A1 (en) 2021-10-07 2023-04-13 Avacta Life Sciences Limited Serum half-life extended pd-l1 binding polypeptides
WO2023057567A1 (en) 2021-10-07 2023-04-13 Avacta Life Sciences Limited Pd-l1 binding affimers

Also Published As

Publication number Publication date
EP3755721A1 (en) 2020-12-30
CN112119093A (zh) 2020-12-22
MY208785A (en) 2025-05-28
CL2023002108A1 (es) 2024-02-16
CL2020002144A1 (es) 2021-03-26
KR102832460B1 (ko) 2025-07-11
US20220380459A1 (en) 2022-12-01
AU2019225741A1 (en) 2020-09-17
IL276778A (en) 2020-10-29
KR20200132875A (ko) 2020-11-25
US12215157B2 (en) 2025-02-04
US20250154261A1 (en) 2025-05-15
BR112020016939A2 (pt) 2020-12-15
JP2023164908A (ja) 2023-11-14
PE20210110A1 (es) 2021-01-19
JP2021514396A (ja) 2021-06-10
MX2020008684A (es) 2020-12-07
SG11202007945UA (en) 2020-09-29
JP7353576B2 (ja) 2023-10-02
CA3091424A1 (en) 2019-08-29
TW201942134A (zh) 2019-11-01
US20210101976A1 (en) 2021-04-08
CL2024003715A1 (es) 2025-04-04
EP3755721A4 (en) 2021-12-22

Similar Documents

Publication Publication Date Title
US20220380459A1 (en) Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use
JP7539840B2 (ja) Cd33を標的とする抗体可変ドメイン及びその使用
US20240117054A1 (en) Proteins binding nkg2d, cd16 and flt3
US20220025037A1 (en) Antibody variable domains targeting dll3, and use thereof
WO2021076554A1 (en) Antibodies targeting flt3 and use thereof
EP4146704A2 (en) Antibodies targeting clec12a and use thereof
WO2023056243A1 (en) Antibodies targeting baff-r and use thereof
JP2025527967A (ja) タンパク質結合nkg2d、cd16、及びceacam5
EA049630B1 (ru) Мультиспецифические связывающие белки, которые связывают cd33, nkg2d и cd16, и способы применения

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19757000

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3091424

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020566544

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20207026680

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019225741

Country of ref document: AU

Date of ref document: 20190220

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019757000

Country of ref document: EP

Effective date: 20200921

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112020016939

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112020016939

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20200819

WWE Wipo information: entry into national phase

Ref document number: 522441839

Country of ref document: SA

WWE Wipo information: entry into national phase

Ref document number: 522441839

Country of ref document: SA

WWE Wipo information: entry into national phase

Ref document number: 520412668

Country of ref document: SA

WWG Wipo information: grant in national office

Ref document number: 202091977

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 522441839

Country of ref document: SA

WWW Wipo information: withdrawn in national office

Ref document number: 276778

Country of ref document: IL