US20180237534A1 - Antibodies against ox40 and uses thereof - Google Patents
Antibodies against ox40 and uses thereof Download PDFInfo
- Publication number
- US20180237534A1 US20180237534A1 US15/577,375 US201615577375A US2018237534A1 US 20180237534 A1 US20180237534 A1 US 20180237534A1 US 201615577375 A US201615577375 A US 201615577375A US 2018237534 A1 US2018237534 A1 US 2018237534A1
- Authority
- US
- United States
- Prior art keywords
- seq
- antibody
- nos
- cdr2
- antibodies
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- OXGJOWITIYBOLN-UHFFFAOYSA-N C.CC(=O)C(C(C)C)C(C)C.CC(C)C(C(N)=O)C(C)C Chemical compound C.CC(=O)C(C(C)C)C(C)C.CC(C)C(C(N)=O)C(C)C OXGJOWITIYBOLN-UHFFFAOYSA-N 0.000 description 1
- BJIPDQKTGBDRSJ-UHFFFAOYSA-N C=C1C=CC(=N)C=C1.CC(=O)O.CN.CNC(=O)OCC1=CC=C(N)C=C1.CNC(=O)OCC1=CC=C(NC(=O)C(C)C)C=C1 Chemical compound C=C1C=CC(=N)C=C1.CC(=O)O.CN.CNC(=O)OCC1=CC=C(N)C=C1.CNC(=O)OCC1=CC=C(NC(=O)C(C)C)C=C1 BJIPDQKTGBDRSJ-UHFFFAOYSA-N 0.000 description 1
- OKIITRCTWNWQQO-UHFFFAOYSA-N CC(C)C(N)C(C)C.CC(C)C(NC(=N)CCCS)C(C)C.CC(C)C(NC(=N)CCCSC1CC(=O)N(C)C1=O)C(C)C.CN1C(=O)C=CC1=O.N=C1CCCS1 Chemical compound CC(C)C(N)C(C)C.CC(C)C(NC(=N)CCCS)C(C)C.CC(C)C(NC(=N)CCCSC1CC(=O)N(C)C1=O)C(C)C.CN1C(=O)C=CC1=O.N=C1CCCS1 OKIITRCTWNWQQO-UHFFFAOYSA-N 0.000 description 1
- ZCFKPYAICNDDIP-UHFFFAOYSA-N CC1CC2=C(C#CC3=CC=CC=C31)C=CC=C2.CC1CC2=C(C=CC=C2)C2=C(N=NN2C)C2=CC=CC=C21.CN=[N+]=[N-] Chemical compound CC1CC2=C(C#CC3=CC=CC=C31)C=CC=C2.CC1CC2=C(C=CC=C2)C2=C(N=NN2C)C2=CC=CC=C21.CN=[N+]=[N-] ZCFKPYAICNDDIP-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3023—Lung
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3038—Kidney, bladder
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3069—Reproductive system, e.g. ovaria, uterus, testes, prostate
-
- G01N33/574—
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70503—Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
- G01N2333/70514—CD4
Definitions
- OX40 (TNFRSF4), also known as ACT35, IMD16, TXGP1L, and CD134, is a 50-kD type I transmembrane glycoprotein in the TNFSFR family of costimulatory receptors expressed on activated CD4+ T cells.
- OX40-expressing activated T cells are found in tumor infiltrating lymphocytes.
- OX40 and its ligand, OX40-L play a crucial role in inducing and maintaining T-cell responses. Recent studies have demonstrated the utility of enhancing anti-tumor T cell function to fight cancer, with key components of an effective response including the activation of CD4+ T cells and promoting survival signals through memory and effector T cells.
- novel agents that modulate T cell responses such as those that target OX40, as well as therapies (e.g., combination therapies) that use such agents, would be therapeutically beneficial.
- antibodies such as human monoclonal antibodies, that specifically bind OX40 and have desirable functional properties. These properties include high affinity binding to human OX40 and cynomolgus OX40 and the ability to stimulate antigen-specific T cell responses, e.g., in tumor-bearing subjects. Also provided herein are methods of detecting OX40 in a sample.
- antibodies, or antigen-binding portions thereof which specifically bind to OX40 and exhibit at least one of the following properties:
- the anti-OX40 antibodies, or antigen binding portions thereof, described herein stimulate an anti-tumor immune response, for example, an antigen-specific T cell response.
- the antibodies, or antigen binding portions thereof increase cytokine production (e.g., IL-2 and/or IFN- ⁇ ) in OX40-expressing T cells and/or increase T cell proliferation.
- the antibodies bind to the C1q component of human complement.
- the antibodies induce NK cell-mediated lysis of activated CD4+ T cells.
- the antibody promotes macrophage-mediated phagocytosis of OX40 expressing cells.
- the antibody inhibits regulatory T cell-mediated suppression of CD4+ T cell proliferation.
- isolated monoclonal antibodies, or antigen binding portions thereof which specifically bind to OX40 and comprise the three variable heavy chain CDRs and the three variable light chain CDRs that are in the variable heavy chain and variable light chain pairs selected from: SEQ ID NOs: 318 and 94; SEQ ID NOs: 17 and 18; 28 and 29; 28 and 30; 37 and 38; 48 and 49; 48 and 50; 57 and 58; 65 and 66; 73 and 74; 84 and 85; 84 and 86; 93 and 94.
- monoclonal antibodies or antigen binding portions thereof, which bind to OX40 and comprise:
- isolated monoclonal antibodies, or antigen binding portions thereof which bind to OX40 and comprise heavy and light chain variable region sequences at least 85% identical, for example, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical, to the amino acid sequences selected from the group consisting of: SEQ ID NOs: 318 and 94; 17 and 18; 28 and 29; 28 and 30; 37 and 38; 48 and 49; 48 and 50; 57 and 58; 65 and 66; 73 and 74; 84 and 85; 84 and 86; 93 and 94.
- isolated monoclonal antibodies, or antigen binding portions thereof which bind to OX40 and comprise heavy chain and light chain sequences at least 80%, 85%, 90%, 95%, 96%, 97%, 98% 99%, or 100% identical to the amino acid sequences selected from the group consisting of: SEQ ID NOs: 124 and 116; 95 and 96; 97 and 98; 99 and 100; 101 and 102; 103 and 104; 105 and 106; 107 and 108; 109 and 110; 111 and 112; 113 and 114; 115 and 116; 117 and 118; 119 and 120; 121 and 122; 123 and 116; 124 and 116; and 125 and 116.
- the isolated monoclonal antibodies, or antigen binding portions thereof (a) bind to the same epitope on OX40 as 3F4, 14B6-1, 14B6-2, 23H3, 18E9, 8B11, 20B3, or 20C1, or binds to the same epitope on OX40 as 6E1-1, 6E1-2, 14A2-1 or 14A2-2, and (b) inhibit binding of 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and/or 20C1 to OX40 on activated T cells by at least 50%, 60%, 70%, 80% or 90% as measured by, e.g., FACS.
- the anti-OX40 antibodies, or antigen binding portions thereof bind within the regions DVVSSKPCKPCTWCNLR (SEQ ID NO: 178) or DSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGK (SEQ ID NO: 179) of mature extracellular portion of human OX40 (SEQ ID NO: 2).
- the anti-OX40 antibodies, or antigen binding portions thereof, described herein bind to both human and cynomolgus OX40.
- the anti-OX40 antibodies, or antigen binding portions thereof, described herein do not bind to mouse and/or rat OX40.
- the anti-OX40 antibodies, or antigen-binding portions thereof are IgG1, IgG2, IgG3, or IgG4 antibodies, or variants thereof.
- methionine residues in the CDR regions of the anti-OX40 antibodies, or antigen-binding portions thereof are substituted for amino acid residues that do not undergo oxidation.
- the anti-OX40 antibodies, or antigen-binding portions thereof are human or humanized antibodies.
- the anti-OX40 antibodies comprise an Fc having enhanced binding to an activating Fc ⁇ R.
- the heavy chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 124 and 125, or a heavy chain that differs therefrom in at most 10 amino acids or is at least 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence of SEQ ID NOs: 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 124 and 125.
- the light chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, and 122, or a light chain that differs therefrom in at most 10 amino acids or is at least 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence of SEQ ID NOs: 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, and 122.
- the anti-OX40 antibodies, or antigen-binding portions thereof are not immunogenic.
- the anti-OX40 antibodies, or antigen-binding portions thereof lack an amino acid sequence that undergoes isomerization.
- the amino acid sequence Asp-Gly is present in the heavy and/or light chain CDR sequences of the antibody, the sequence is substituted with an amino acid sequence that does not undergo isomerization.
- the antibody comprises the heavy chain variable region CDR2 sequence set forth in SEQ ID NO: 76, but wherein the Asp or Gly in the Asp-Gly sequence (LISY DG SRKHYADSVKG; SEQ ID NO: 76) is replaced with an amino acid sequence that does not undergo isomerization, for example, an Asp-Ser or a Ser-Gly sequence.
- the antibody comprises the heavy chain variable region CDR2 sequence set forth in SEQ ID NO: 88, but wherein the Asp or Gly in the Asp-Gly sequence (AIDT DG GTFYADSVRG; SEQ ID NO: 88) is replaced with an amino acid sequence that does not undergo isomerization, for example, a Ser-Gly, an Asp-Ala, or a Ser-Thr sequence.
- antibodies which bind to OX40 comprising an amino acid selected from the group consisting of SEQ ID NOs: 282-296.
- the antibodies comprise a heavy chain consisting of an amino acid sequence selected from the group consisting of SEQ ID NOs: 282-296.
- bispecific molecules comprising an anti-OX40 antibody linked to a molecule having a second binding specificity.
- nucleic acids encoding the heavy and/or light chain variable regions of the anti-OX40 antibodies, or antigen binding portions thereof, expression vectors comprising the nucleic acid molecules, and cells transformed with the expression vectors.
- immunoconjugates comprising the anti-OX40 antibodies described herein, linked to an agent.
- compositions comprising anti-OX40 antibodies, or antigen binding portions thereof, and a carrier.
- kits comprising the anti-OX40 antibodies, or antigen binding portions thereof, and instructions for use.
- the kits further comprise an anti-CTLA4 antibody, anti-PD-1, or anti-PD-L1 antibody.
- a method of preparing the anti-OX40 antibodies comprising expressing an anti-OX40 antibody in a cell and isolating the antibody from the cell.
- a method of stimulating an antigen-specific T cell response comprising contacting the T cell with an anti-OX40 antibody, or antigen binding portion thereof, such that an antigen-specific T cell response is stimulated.
- a method of activating or co-stimulating a T cell comprising contacting a cell, e.g., an effector T cell, with an anti-OX40 antibody, or antigen binding portion thereof, and CD3, wherein the effector T cell is activated or co-stimulated.
- a method of increasing IL-2 and/or IFN- ⁇ production in and/or proliferation of a T cell comprising contacting the T cell with an effective amount of an anti-OX40 antibody, or antigen binding portion thereof.
- a method of increasing IL-2 and/or IFN- ⁇ production in T cells in a subject comprising administering an effective amount of an anti-OX40 antibody, or antigen binding portion thereof, bispecific molecule or conjugate comprising the anti-OX40 antibody, or composition comprising the anti-OX40 antibody, to increase IL-2 and/or IFN- ⁇ production from the T cells.
- a method of reducing or depleting the number of T regulatory cells in a tumor of a subject in need thereof comprising administering an effective amount of an anti-OX40 antibody, or antigen binding portion thereof, bispecific molecule or conjugate wherein the antibody, or antigen binding portion thereof, has effector or enhanced effector function, to reduce the number of T regulatory cells in the tumor.
- a method of stimulating an immune response in a subject comprising administering an effective amount of an anti-OX40 antibody, or antigen binding portion thereof, bispecific molecule or conjugate to the subject such that an immune response in the subject is stimulated.
- the subject has a tumor and an immune response against the tumor is stimulated.
- a method of inhibiting the growth of tumor cells in a subject comprising administering to the subject an anti-OX40 antibody, or antigen binding portion thereof, bispecific molecule or conjugate such that growth of the tumor is inhibited in the subject.
- a method of treating cancer e.g., by immunotherapy, comprising administering to a subject in need thereof a therapeutically effective amount an anti-OX40 antibody, or antigen binding portion thereof, bispecific molecule or conjugate comprising the anti-OX40 antibody, or composition comprising the anti-OX40 antibody, to treat the cancer.
- the cancer is selected from the group consisting of: bladder cancer, breast cancer, uterine/cervical cancer, ovarian cancer, prostate cancer, testicular cancer, esophageal cancer, gastrointestinal cancer, pancreatic cancer, colorectal cancer, colon cancer, kidney cancer, head and neck cancer, lung cancer, stomach cancer, germ cell cancer, bone cancer, liver cancer, thyroid cancer, skin cancer, neoplasm of the central nervous system, lymphoma, leukemia, myeloma, sarcoma, and virus-related cancer.
- the cancer is a metastatic cancer, refractory cancer, or recurrent cancer.
- the methods described herein further comprise administering one or more additional therapeutics with an anti-OX40 antibody, for example, an anti-PD1 antibody, a LAG-3 antibody, a CTLA-4 antibody, and/or a PD-L1 antibody.
- an anti-OX40 antibody for example, an anti-PD1 antibody, a LAG-3 antibody, a CTLA-4 antibody, and/or a PD-L1 antibody.
- a method of detecting the presence of OX40 in a sample comprising contacting the sample with an anti-OX40 antibody, or an antigen binding portion thereof, under conditions that allow for formation of a complex between the antibody, or antigen binding portion thereof, and OX40, and detecting the formation of a complex.
- anti-OX40 antibodies described herein for treating cancer, stimulating an immune response in a subject, stimulating an antigen-specific T cell response, activating or co-stimulating a T cell, increasing the production of cytokines, such as IL-2 and/or IFN- ⁇ , in and/or proliferation of a T cell, reducing or depleting the number of T regulatory cells in a tumor, and/or inhibiting the growth of tumor cells.
- cytokines such as IL-2 and/or IFN- ⁇
- a method of treating a solid tumor in a human subject comprising administering to the subject an effective amount of an anti-OX40 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 318, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 94, wherein the method comprises at least one administration cycle, wherein the cycle is a period of two weeks, wherein for each of the at least one cycles, one dose of the anti-OX40 antibody is administered at a dose of 1 mg/kg body weight; a fixed dose of 20, 40, 80, 160, or 320 mg; a dose of about 1 mg/kg body weight; or a fixed dose of about 20, 40, 80, 160, or 320 mg.
- the method comprises further administering an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 301, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 302, wherein the method comprises at least one administration cycle, wherein the cycle is a period of two, three, or four weeks, wherein for each of the at least one cycles, one dose of the anti-OX40 antibody is administered at a dose of 1 mg/kg body weight; a fixed dose of 20, 40, 80, 160, or 320 mg; a dose of about 1 mg/kg body weight; or a fixed dose of about 20, 40, 80, 160, or 320 mg, and one dose of the anti-PD-1 antibody is administered at a dose of 240, 360, or 480 mg or a dose of about 240, 360, or 480 mg.
- the method comprises further administering an anti-CTLA-4 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 309, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 310, wherein the method comprises at least one administration cycle, wherein the cycle is a period of three weeks, wherein for each of the at least one cycles, one dose of the anti-OX40 antibody is administered at a dose of 1 mg/kg body weight; a fixed dose of 20, 40, 80, 160, or 320 mg; a dose of about 1 mg/kg body weight; or a fixed dose of about 20, 40, 80, 160, or 320 mg, and one dose of the anti-CTLA-4 antibody is administered at a dose of 1 mg/kg or a dose of about 1 mg/kg,
- the anti-OX40 antibody is administered together with the anti-CTLA-4 antibody for at least one cycle, followed by anti-OX40 antibody monotherapy for at least one cycle.
- the treatment consists of 8 cycles.
- the anti-OX40 antibody is administered together with the anti-CTLA-4 antibody for the first 4 cycles, followed by anti-OX40 antibody monotherapy for the last 4 cycles.
- the anti-OX40 antibody comprises heavy and light chain sequences set forth in SEQ ID NOs: 124 and 116, respectively.
- the anti-OX40 antibody, or anti-OX40 antibody and anti-PD-1 or anti-CTLA-4 antibody are formulated for intravenous administration.
- the anti-OX40 and anti-PD-1 or anti-CTLA-4 antibody are formulated together.
- the anti-OX40 and anti-PD-1 or anti-CTLA-4 antibody are formulated separately.
- the treatment consists of 8 cycles.
- the anti-OX40 antibody, or anti-OX40 antibody and anti-PD-1 or anti-CTLA-4 antibody are administered on Day 1 of each cycle.
- the anti-OX40 antibody is administered prior to administration of the anti-PD-1 or anti-CTLA-4 antibody. In one embodiment, the anti-OX40 antibody is administered within about 30 minutes prior to administration of the anti-PD-1 or anti-CTLA-4 antibody. In other embodiments, the anti-OX40 antibody is administered after administration of the anti-PD-1 or anti-CTLA-4 antibody. In yet other embodiments, the anti-OX40 antibody is administered concurrently with the anti-PD-1 or anti-CTLA-4 antibody.
- the treatment produces at least one therapeutic effect chosen from a reduction in size of a tumor, reduction in number of metastatic lesions over time, complete response, partial response, and stable disease.
- the tumor is associated with a cancer selected from the group consisting of: cervical cancer, bladder cancer, colorectal cancer, and ovarian cancer.
- FIG. 1A shows the nucleotide sequence (SEQ ID NO: 126) and amino acid sequence (SEQ ID NO: 17) of the heavy chain variable region of the 3F4 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 11), CDR2 (SEQ ID NO: 12) and CDR3 (SEQ ID NO: 13) regions are delineated and the V, D and J germline derivations are indicated.
- FIG. 1B shows the nucleotide sequence (SEQ ID NO: 127) and amino acid sequence (SEQ ID NO: 18) of the kappa light chain variable region of the 3F4 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 14), CDR2 (SEQ ID NO: 15) and CDR3 (SEQ ID NO: 16) regions are delineated and the V and J germline derivations are indicated.
- FIG. 2C shows the nucleotide sequence (SEQ ID NO: 130) and amino acid sequence (SEQ ID NO: 30) of the kappa light chain variable region of the 14B6-2 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 26), CDR2 (SEQ ID NO: 27) and CDR3 (SEQ ID NO: 28) regions are delineated and the V and J germline derivations are indicated.
- FIG. 3B shows the nucleotide sequence (SEQ ID NO: 132) and amino acid sequence (SEQ ID NO: 38) of the kappa light chain variable region of the 23H3 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 34), CDR2 (SEQ ID NO: 35) and CDR3 (SEQ ID NO: 36) regions are delineated and the V and J germline derivations are indicated.
- FIG. 4A shows the nucleotide sequence (SEQ ID NO: 133) and amino acid sequence (SEQ ID NO: 48) of the heavy chain variable region of the 6E1 (6E1-1 and 6E1-2) human monoclonal antibody.
- the CDR1 (SEQ ID NO: 39), CDR2 (SEQ ID NO: 40) and CDR3 (SEQ ID NO: 41) regions are delineated and the V, D and J germline derivations are indicated.
- FIG. 4B shows the nucleotide sequence (SEQ ID NO: 134) and amino acid sequence (SEQ ID NO: 49) of the kappa light chain variable region of the 6E1-1 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 42), CDR2 (SEQ ID NO: 43) and CDR3 (SEQ ID NO: 44) regions are delineated and the V and J germline derivations are indicated.
- FIG. 4C shows the nucleotide sequence (SEQ ID NO: 135) and amino acid sequence (SEQ ID NO: 50) of the kappa light chain variable region of the 6E1-2 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 45), CDR2 (SEQ ID NO: 46) and CDR3 (SEQ ID NO: 47) regions are delineated and the V and J germline derivations are indicated.
- FIG. 5A shows the nucleotide sequence (SEQ ID NO: 136) and amino acid sequence (SEQ ID NO: 57) of the heavy chain variable region of the 18E9 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 51), CDR2 (SEQ ID NO: 52) and CDR3 (SEQ ID NO: 53) regions are delineated and the V, D and J germline derivations are indicated.
- FIG. 5B shows the nucleotide sequence (SEQ ID NO: 137) and amino acid sequence (SEQ ID NO: 58) of the kappa light chain variable region of the 18E9 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 54), CDR2 (SEQ ID NO: 55) and CDR3 (SEQ ID NO: 56) regions are delineated and the V and J germline derivations are indicated.
- FIG. 6A shows the nucleotide sequence (SEQ ID NO: 138) and amino acid sequence (SEQ ID NO: 65) of the heavy chain variable region of the 8B11 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 59), CDR2 (SEQ ID NO: 60) and CDR3 (SEQ ID NO: 61) regions are delineated and the V, D and J germline derivations are indicated.
- FIG. 6B shows the nucleotide sequence (SEQ ID NO: 139) and amino acid sequence (SEQ ID NO: 66) of the kappa light chain variable region of the 8B11 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 62), CDR2 (SEQ ID NO: 63) and CDR3 (SEQ ID NO: 64) regions are delineated and the V and J germline derivations are indicated.
- FIG. 7A shows the nucleotide sequence (SEQ ID NO: 140) and amino acid sequence (SEQ ID NO: 73) of the heavy chain variable region of the 20B3 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 67), CDR2 (SEQ ID NO: 68) and CDR3 (SEQ ID NO: 69) regions are delineated and the V, D and J germline derivations are indicated.
- FIG. 7B shows the nucleotide sequence (SEQ ID NO: 141) and amino acid sequence (SEQ ID NO: 74) of the kappa light chain variable region of the 20B3 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 70), CDR2 (SEQ ID NO: 71) and CDR3 (SEQ ID NO: 72) regions are delineated and the V and J germline derivations are indicated.
- FIG. 8A shows the nucleotide sequence (SEQ ID NO: 142) and amino acid sequence (SEQ ID NO: 84) of the heavy chain variable region of the 14A2 (14A2-1 and 14A2-2) human monoclonal antibody.
- the CDR1 (SEQ ID NO: 75), CDR2 (SEQ ID NO: 76) and CDR3 (SEQ ID NO: 77) regions are delineated and the V, D and J germline derivations are indicated.
- FIG. 8B shows the nucleotide sequence (SEQ ID NO: 143) and amino acid sequence (SEQ ID NO: 85) of the kappa light chain variable region of the 14A2-1 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 78), CDR2 (SEQ ID NO: 79) and CDR3 (SEQ ID NO: 80) regions are delineated and the V and J germline derivations are indicated.
- FIG. 8C shows the nucleotide sequence (SEQ ID NO: 144) and amino acid sequence (SEQ ID NO: 86) of the kappa light chain variable region of the 14A2-2 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 81), CDR2 (SEQ ID NO: 82) and CDR3 (SEQ ID NO: 83) regions are delineated and the V and J germline derivations are indicated.
- FIG. 9A shows the nucleotide sequence (SEQ ID NO: 145) and amino acid sequence (SEQ ID NO: 93) of the heavy chain variable region of the 20C1 human monoclonal antibody.
- the CDR1 (SEQ ID NO: 87), CDR2 (SEQ ID NO: 88) and CDR3 (SEQ ID NO: 89) regions are delineated and the V, D and J germline derivations are indicated.
- FIG. 10A shows the nucleotide sequence (SEQ ID NO: 176) and amino acid sequence (SEQ ID NO: 124) of the heavy chain of the OX40.21 human monoclonal antibody.
- the nucleotide sequence (SEQ ID NO: 168) and amino acid sequence (SEQ ID NO: 116) of the light chain is shown in FIG. 10B .
- FIGS. 11A-11D show binding curves and EC 50 s (in nM) of various anti-OX40 antibodies for activated human T cells, with hIgG1 and secondary antibodies serving as controls, as assessed by FACS.
- FIGS. 13A-13C show binding curves and K D s of the anti-OX40 antibody, OX40.21, for activated human T cells, HEK293 cells overexpressing human OX40, and CHO cells overexpressing cynomolgus monkey OX40, as assessed by Scatchard analysis.
- FIG. 14A shows immunohistological staining of various acetone-fixed frozen human tissue sections with the anti-OX40 antibodies OX40.8, OX40.6, and OX40.16. Images show representative staining at an antibody concentration of 1 ⁇ g/ml for hyperplasic tonsil and 5 ⁇ g/ml for other tissues, with the exception of OX40.16 at 10 ⁇ g/ml in the endocardium and valves.
- OX40.8 While all three antibodies positively stained a small subset of lymphocytes in the tonsil, OX40.8 also stained myofilament-like structures in the heart and OX40.6 stained the cardiac muscles, endothelium/subendothelium matrix in small arteries in the tonsil, and endocardium and valves in the heart.
- GC germinal center
- MZ mantle zone.
- FIG. 14B shows immunostaining of various acetone-fixed frozen human tissue sections with the anti-OX40 antibody OX40.21 (a variant of OX40.16). Images show representative staining at an antibody concentration of 5 ⁇ g/ml. The antibody positively stained a small subset of lymphocytes in the tonsil and thymus. The positive cells in the tonsil were distributed in the germinal center, mantle zone, and inter-follicular region, while the positive cells in the thymus were primarily localized in the medulla. No specific staining was observed in the heart, liver, kidney, and lung. GC, germinal center; Me, medulla; MZ, mantle zone.
- FIGS. 15B and 15C shows immunohistological staining for CD3, FoxP3, and OX40 on adjacent FFPE sections from colorectal carcinoma (CRC) and head and neck squamous cell carcinoma (HNSCC) samples.
- FIG. 15B is a low power view, showing that both OX40+ and FoxP3+ TILs are a small fraction of CD3+ TILs and primarily distributed in tumor stroma.
- FIG. 15C is a higher power view showing potential partial co-localization of OX40+ and FoxP3+ (Treg) TILs in CRC.
- FIG. 16 shows the ability of various anti-OX40 antibodies to inhibit the binding of OX40 ligand (OX40-L) to human OX40-transfected 293 cells (“hOX40-293 cells”), with hIgG1 as the control.
- FIG. 17 summarizes the OX40-L blocking relationships between various anti-OX40 antibodies.
- FIG. 18 shows the ability of various anti-OX40 antibodies to inhibit the binding of the anti-OX40 antibody clone L106 to hOX40-293 cells, as assessed by FACS, with PE-labeled L106 only, PE-labeled mIgG1, and unstained cells as controls.
- FIGS. 19A-19C show the ability of various anti-OX40 antibodies to inhibit the binding of allophycocyanin (APC)-conjugated OX40.1 antibody to hOX40-293 ( FIGS. 19A and 19B ) or hOX40-HT1080 cells ( FIG. 19C ), as assessed by FACS. hIgG1 and/or hIgG4 were used as controls.
- FIGS. 19D-19G show the ability of various anti-OX40 antibodies to inhibit the binding of biotin-conjugated OX40.4 or OX40.5 antibody to hOX40-293 cells. hIgG1 and streptavidin-APC were used as controls.
- FIG. 19H summarize the epitope bins in relation to OX40.1 based on results shown in FIGS. 19A-19C .
- FIG. 19I summarizes the epitope bins in relation to OX40.5 or OX40.4 based on results shown in FIGS. 19D-19G .
- FIG. 20A shows that OX40.21 binds only to non-reduced human OX40, regardless of the presence of N-linked sugars.
- FIGS. 20B and 20C show two N-glycopeptides that were identified by peptide mapping after deglycosylation: 60% occupancy for both AspN118 ( FIG. 20B ) and AspN12 ( FIG. 20C ).
- FIG. 20D depicts the regions in OX40 bound by OX40.16, OX40.21, and OX40.8.
- FIG. 20E shows the identification of the peptides recognized by OX40.16, OX40.21, and OX40.8 by LC-MS.
- FIGS. 21A-21D show the effects of various anti-OX40 antibodies on human primary CD4+ T cell proliferation when co-cultured with CHO-CD3-CD32A cells.
- CHO cells only, T cells only, CHO cells co-cultured with T cells only, and hIgG1 were used as controls.
- FIGS. 22A-22D show the effects of various anti-OX40 antibodies on interferon gamma (IFN- ⁇ ) secretion from human primary CD4+ T cells co-cultured with CHO-CD3-CD32A cells.
- IFN- ⁇ interferon gamma
- FIGS. 23A-23F show the effects of various anti-OX40 antibodies on the stimulation of IL-2 secretion from primary T cells in cultures of staphylococcus enterotoxin B (SEB)-activated human peripheral blood mononuclear cells (PBMCs), which were isolated from different donors.
- SEB staphylococcus enterotoxin B
- PBMCs peripheral blood mononuclear cells
- FIG. 24 shows the effects of various anti-OX40 antibodies on NK92 cell induced lysis of activated CD4+ cells.
- FIGS. 25A and 25B show the effects of various anti-OX40 antibodies on primary NK cell-mediated lysis of activated CD4+ T cells isolated from two donors by NK:target cell ratios.
- FIG. 26 shows the effects of various anti-OX40 antibodies on the phagocytosis of hOX40-293 cells by primary human macrophages.
- FIG. 27 shows the level of binding of the human complement C1q component to OX40.21. IgG1 and IgG1.1 (effectorless) were used as controls.
- FIGS. 28A-28C show that OX40 is expressed in tumor infiltrating lymphocytes, with a pattern generally limited to CD4+ cells with minimal expression on CD8+ cells.
- FIG. 28D shows that OX40 is expressed by CD4+ T cells and regulatory T cells in mouse Sa1N tumors.
- FIG. 28E shows that OX40 is expressed by CD4+ T cells, CD8+ T cells, and regulatory T cells in mouse MC38 tumors.
- FIG. 29 shows the ability of various anti-OX40 antibodies to reverse regulatory T (Treg) cell-mediated suppression of human CD4+ T cells.
- Treg reverse regulatory T
- anti-OX40 antibodies increased the proliferation of T responder (Tresp) cells compared to the IgG1 isotype control.
- FIGS. 30A and 30B show the clearance of intravenously administered OX40.6 antibody from monkeys. Two of the monkeys showed accelerated clearance, which correlated with the formation of anti-drug antibodies.
- FIG. 31 is a graph depicting T-cell proliferation results for percentage antigenicity for various anti-OX40 antibodies, as well as quality control samples QC-1, QC-2, and QC-3.
- FIGS. 32A-32C show the effects of different isotypes of the chimeric OX86 antibody (an antibody having the rat variable regions of OX86 and mouse constant region that does not block the interaction between OX40 and OX40-L, i.e., a non-blocking antibody) on anti-tumor activity measured by changes in tumor volumes in individual mice treated with these isotypes (mIgG1 and mIgG2 isotypes) in a MC38 colon adenocarcinoma model: ( FIG. 32A ) control mouse IgG1 antibody (“control”), ( FIG. 32B ) OX86 mIgG1 antibody (“OX-40 mIgG1”), ( FIG. 32C ) OX86 mIgG2 antibody (“OX-40 mIgG2a).
- control control
- FIG. 32B OX86 mIgG1 antibody
- OX-40 mIgG1 OX-40 mIgG2a
- FIGS. 33A-33C show the effects of different isotypes (mIgG1 and mIgG2a) of the OX86 antibody on the number of CD4+ regulatory T cells in tumors and the periphery, and on cell numbers in the spleen.
- FIGS. 34A-34C show the effects of chimeric OX86 antibodies with a human IgG1 on anti-tumor activity measured by changes in tumor volumes in individual mice treated with the indicated antibodies in the MC38 colon adenocarcinoma model:
- FIG. 34A human IgG1 isotype control (“Isotype”)
- FIG. 34B OX86-hIgG1 chimeric antibody (“OX86-hG1”)
- FIG. 34C OX86-hIgG1-S267E antibody (“OX86-hG1-S267E”).
- the S267E substitution in hIgG1 increases its effector function by increasing binding to FcRs (CD32A and CD32B).
- OX86-hIgG1 exhibited potent anti-tumor activity.
- FIGS. 35A-35D show the effects of chimeric OX86 hIgG1 antibody on regulatory T cell depletion.
- FIGS. 36A-36E show the effects of a blocking (i.e., blocks the interaction between OX40 and OX40 ligand) hamster anti-mouse OX40 antibody (8E5) at different dosages on anti-tumor activity by changes in tumor volumes in individual mice treated with the indicated antibodies in the subcutaneous mouse CT-26 tumor model.
- FIG. 36A hamster Ig control
- FIG. 36B 8E5 at 10 mg/kg
- FIG. 36C 8E5 at 3 mg/kg
- FIG. 36D 8E5 at 1 mg/kg
- FIG. 36E 8E5 at 0.3 mg/kg.
- FIGS. 37A-37D show the effects of combination therapy with the OX86-rG1 antibody and an anti-PD1 antibody on anti-tumor activity measured by changes in tumor volumes in individual mice treated with the indicated antibodies and combination in the MC38 colon adenocarcinoma model:
- FIG. 37A isotype control
- FIG. 37B anti-PD1 antibody
- FIG. 37C OX86-rG1 (“anti-OX40”)
- FIG. 36D OX86-rG1+anti-PD1 antibody (“anti-OX40+anti-PD1”).
- FIGS. 38A and 38B show the ex vivo recall response to KLH, CD69+ expressing CD4+CD8 ⁇ T cells at Days 22 and 41, respectively. Animals were immunized with KLH on Study Day 1. Data points represent individual animal (males and females) results as a percentage of CD4+CD8 ⁇ T cells. Horizontal bars represent group means.
- FIG. 39 shows antibody binding to anti-his Fab captured Fc ⁇ R-his proteins. Binding responses are plotted as a percentage of the theoretical Rmax assuming a 1:1 mAb:Fc ⁇ R binding stoichiometry. The bars for each antibody are shown in the order provided by the color legends at the bottom of the slide.
- FIG. 40 shows antibody binding to anti-his Fab captured FcgR-his proteins. Binding responses are plotted as a percentage of the theoretical Rmax assuming a 1:1 mAb:Fc ⁇ R binding stoichiometry. The bars for each antibody are shown in the order provided by the color legends at the bottom of the slide.
- FIGS. 41A-41D show the effects of combination therapy with an agonistic anti-OX40 antibody (OX86-rG1) and an anti-CTLA-4 antibody (9D9-mG2b) on anti-tumor activity measured by changes in tumor volumes in individual mice treated with the indicated antibodies and combination in the CT26 colon adenocarcinoma model: ( FIG. 41A ) isotype control, ( FIG. 41B ) anti-CTLA-4 antibody, ( FIG. 41C ) OX86-rG1, ( FIG. 41D ) OX86-rG1+anti-CTLA-4 antibody.
- FIG. 41A isotype control
- FIG. 41B anti-CTLA-4 antibody
- FIG. 41C OX86-rG1
- FIG. 41D OX86-rG1+anti-CTLA-4 antibody.
- FIG. 42 is a schematic of the Phase 1/2a clinical trial protocol.
- FIG. 43 is a schematic of the study visit schedule for the Phase 1/2a clinical trial.
- Described herein are isolated antibodies, particularly monoclonal antibodies, e.g., human monoclonal antibodies, which specifically bind to OX40 and thereby activate downstream OX40 signaling (“agonist anti-OX40 antibodies”).
- the antibodies described herein are characterized by particular functional features and/or comprise particular structural features, such as CDR regions comprising specific amino acid sequences.
- methods of using the antibodies for immune response enhancement alone or in combination with other immunostimulatory agents (e.g., antibodies) and/or cancer therapies. Accordingly, the anti-OX40 antibodies described herein may be used in a treatment in a wide variety of therapeutic applications, including, for example, inhibiting tumor growth and treating viral infections.
- OX40 refers to a receptor that is a member of the TNF-receptor superfamily, which binds to OX40 ligand (OX40-L). OX40 is also referred to as tumor necrosis factor receptor superfamily, member 4 (TNFRSF4), ACT35, IMD16, TXGP1L, and CD134.
- TNFRSF4 tumor necrosis factor receptor superfamily, member 4
- ACT35 tumor necrosis factor receptor superfamily, member 4
- IMD16 e.g., TXGP1L
- CD134 CD134
- OX40 includes any variants or isoforms of OX40 which are naturally expressed by cells. Accordingly, antibodies described herein may cross-react with OX40 from species other than human (e.g., cynomolgus OX40). Alternatively, the antibodies may be specific for human OX40 and may not exhibit any cross-reactivity with other species. OX40 or any variants and isoforms thereof, may either be isolated from cells or
- the amino acid sequence of human OX40 precursor (Accession No. NP_003318.1) is set forth in SEQ ID NO: 1.
- the amino acid sequence of the extracellular domain of mature human OX40 is set forth in SEQ ID NO: 2.
- the amino acid sequence of cynomolgus OX40 is set forth in SEQ ID NO: 3.
- the amino acid sequence of human OX40-L is set forth in SEQ ID NO: 4.
- Programmed Death 1 “Programmed Cell Death 1,” “Protein PD-1,” “PD-1,” PD1,” “PDCD1,” “hPD-1” and “hPD-I,” as used herein, are used interchangeably, and include variants, isoforms, species homologs of human PD-1, and analogs having at least one common epitope with PD-1.
- the complete PD-1 sequence can be found under GenBank Accession No. U64863.
- cytotoxic T lymphocyte-associated antigen-4 “CTLA-4,” “CTLA4,” “CTLA-4 antigen” and “CD152” (see, e.g., Murata (1999) Am. J. Pathol. 155:453-460) are used interchangeably, and include variants, isoforms, species homologs of human CTLA-4, and analogs having at least one common epitope with CTLA-4 (see, e.g., Balzano (1992) Int. J. Cancer Suppl. 7:28-32).
- a complete sequence of human CTLA-4 is set forth in GenBank Accession No. Ll 5006.
- antibody as used to herein may include whole antibodies and any antigen binding fragments (i.e., “antigen-binding portions”) or single chains thereof.
- An “antibody” refers, in one embodiment, to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as V H ) and a heavy chain constant region.
- V H heavy chain variable region
- the heavy chain constant region is comprised of three domains, CH1, CH2 and CH3.
- each light chain is comprised of a light chain variable region (abbreviated herein as V L ) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- the V H and V L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each V H and V L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (C1q)
- Antibodies typically bind specifically to their cognate antigen with high affinity, reflected by a dissociation constant (K D ) of 10 ⁇ 7 to 10 ⁇ 11 M or less. Any K D greater than about 10 ⁇ 6 M is generally considered to indicate nonspecific binding.
- an antibody that “binds specifically” to an antigen refers to an antibody that binds to the antigen and substantially identical antigens with high affinity, which means having a K D of 10 ⁇ 7 M or less, preferably 10 ⁇ 8 M or less, even more preferably 5 ⁇ 10 ⁇ 9 M or less, and most preferably between 10 ⁇ 8 M and 10 ⁇ 10 M or less, but does not bind with high affinity to unrelated antigens.
- An antigen is “substantially identical” to a given antigen if it exhibits a high degree of sequence identity to the given antigen, for example, if it exhibits at least 80%, at least 90%, preferably at least 95%, more preferably at least 97%, or even more preferably at least 99% sequence identity to the sequence of the given antigen.
- an antibody that binds specifically to human OX40 may cross-react with OX40 from certain non-human primate species (e.g., cynomolgus monkey), but may not cross-react with OX40 from other species (e.g., murine OX40), or with an antigen other than OX40.
- An immunoglobulin may be from any of the commonly known isotypes, including but not limited to IgA, secretory IgA, IgG and IgM.
- the IgG isotype is divided in subclasses in certain species: IgG1, IgG2, IgG3 and IgG4 in humans, and IgG1, IgG2a, IgG2b and IgG3 in mice.
- the anti-OX40 antibodies described herein are of the IgG1 or IgG2 subtype.
- Immunoglobulins, e.g., IgG1 exist in several allotypes, which differ from each other in at most a few amino acids.
- Antibody may include, by way of example, both naturally occurring and non-naturally occurring antibodies; monoclonal and polyclonal antibodies; chimeric and humanized antibodies; human and nonhuman antibodies; wholly synthetic antibodies; and single chain antibodies.
- antigen-binding portion of an antibody refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., human OX40). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- binding fragments encompassed within the term “antigen-binding portion” of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , CL and CH1 domains; (ii) a F(ab′) 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and CH1 domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a V H domain; and (vi) an isolated complementarity determining region (CDR) or (vii) a combination of two or more isolated CDRs which may optionally be joined by a synthetic linker.
- a Fab fragment a monovalent fragment consisting of the V L , V H , CL
- the two domains of the Fv fragment, V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
- single chain Fv single chain Fv
- Such single chain antibodies are also intended to be encompassed within the term “antigen-binding portion” of an antibody.
- bispecific or “bifunctional antibody” is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites.
- Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab′ fragments. See, e.g., Songsivilai & Lachmann, Clin. Exp. Immunol. 79:315-321 (1990); Kostelny et al., J. Immunol. 148, 1547-1553 (1992).
- monoclonal antibody refers to an antibody that displays a single binding specificity and affinity for a particular epitope or a composition of antibodies in which all antibodies display a single binding specificity and affinity for a particular epitope.
- monoclonal antibodies will be derived from a single cell or nucleic acid encoding the antibody, and will be propagated without intentionally introducing any sequence alterations.
- human monoclonal antibody refers to a monoclonal antibody that has variable and optional constant regions derived from human germline immunoglobulin sequences.
- human monoclonal antibodies are produced by a hybridoma, for example, obtained by fusing a B cell obtained from a transgenic or transchromosomal non-human animals (e.g., a transgenic mouse having a genome comprising a human heavy chain transgene and a light chain), to an immortalized cell.
- a transgenic or transchromosomal non-human animals e.g., a transgenic mouse having a genome comprising a human heavy chain transgene and a light chain
- recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences.
- variable and constant regions that utilize particular human germline immunoglobulin sequences are encoded by the germline genes, but include subsequent rearrangements and mutations that occur, for example, during antibody maturation.
- the variable region contains the antigen binding domain, which is encoded by various genes that rearrange to form an antibody specific for a foreign antigen.
- the variable region can be further modified by multiple single amino acid changes (referred to as somatic mutation or hypermutation) to increase the affinity of the antibody to the foreign antigen.
- the constant region will change in further response to an antigen (i.e., isotype switch).
- the rearranged and somatically mutated nucleic acid sequences that encode the light chain and heavy chain immunoglobulin polypeptides in response to an antigen may not be identical to the original germline sequences, but instead will be substantially identical or similar (i.e., have at least 80% identity).
- a “human” antibody refers to an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences.
- the antibodies described herein may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
- the term “human antibody”, as used herein is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- a “humanized” antibody refers to an antibody in which some, most or all of the amino acids outside the CDR domains of a non-human antibody are replaced with corresponding amino acids derived from human immunoglobulins. In one embodiment of a humanized form of an antibody, some, most, or all of the amino acids outside the CDR domains have been replaced with amino acids from human immunoglobulins, whereas some, most or all amino acids within one or more CDR regions are unchanged. Small additions, deletions, insertions, substitutions or modifications of amino acids are permissible as long as they do not abrogate the ability of the antibody to bind to a particular antigen.
- a “humanized” antibody retains an antigenic specificity similar to that of the original antibody.
- a “chimeric antibody” refers to an antibody in which the variable regions are derived from one species and the constant regions are derived from another species, such as an antibody in which the variable regions are derived from a mouse antibody and the constant regions are derived from a human antibody.
- isotype refers to the antibody class (e.g., IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE antibody) that is encoded by the heavy chain constant region genes.
- antibody class e.g., IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE antibody
- Allotype refers to naturally occurring variants within a specific isotype group, which variants differ in a few amino acids (see, e.g., Jefferis et al. (2009) mAbs 1:1). Antibodies described herein may be of any allotype. As used herein, antibodies referred to as “IgG1f” or “IgG1.1f” isotype are IgG1 and effectorless IgG1.1 antibodies, respectively, of the allotype “f,” i.e., having 214R, 356E and 358M according to the EU index as in Kabat, as shown, e.g., in SEQ ID NO: 5 (see underlined residues in SEQ ID NO: 5 of Table 23).
- an antibody recognizing an antigen and “an antibody specific for an antigen” are used interchangeably herein with the term “an antibody which binds specifically to an antigen.”
- an “isolated antibody,” as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to OX40 is substantially free of antibodies that specifically bind antigens other than OX40).
- An isolated antibody that specifically binds to an epitope of OX40 may, however, have cross-reactivity to other OX40 proteins from different species.
- an antibody that “inhibits binding of OX40-L to OX40” is intended to refer to an antibody that inhibits the binding of OX40-L to OX40, e.g., in binding assays using hOX40-293 cells, with an EC50 of about 1 ⁇ g/mL or less, such as about 0.9 ⁇ g/mL or less, about 0.85 ⁇ g/mL or less, about 0.8 ⁇ g/mL or less, about 0.75 ⁇ g/mL or less, about 0.7 ⁇ g/mL or less, about 0.65 ⁇ g/mL or less, about 0.6 ⁇ g/mL or less, about 0.55 ⁇ g/mL or less, about 0.5 ⁇ g/mL or less, about 0.45 ⁇ g/mL or less, about 0.4 ⁇ g/mL or less, about 0.35 ⁇ g/mL or less, about 0.3 ⁇ g/mL or less, about 0.25 ⁇ g/mL or less
- effector function refers to the interaction of an antibody Fc region with an Fc receptor or ligand, or a biochemical event that results therefrom.
- exemplary “effector functions” include C1q binding, complement dependent cytotoxicity (CDC), Fc receptor binding, Fc ⁇ R-mediated effector functions such as ADCC and antibody dependent cell-mediated phagocytosis (ADCP), and downregulation of a cell surface receptor (e.g., the B cell receptor; BCR).
- CDC complement dependent cytotoxicity
- Fc receptor binding Fc ⁇ R-mediated effector functions
- ADCP antibody dependent cell-mediated phagocytosis
- BCR B cell surface receptor
- Such effector functions generally require the Fc region to be combined with a binding domain (e.g., an antibody variable domain).
- Fc receptor or “FcR” is a receptor that binds to the Fc region of an immunoglobulin.
- FcRs that bind to an IgG antibody comprise receptors of the Fc ⁇ R family, including allelic variants and alternatively spliced forms of these receptors.
- the Fc ⁇ R family consists of three activating (Fc ⁇ RI, Fc ⁇ RIII, and Fc ⁇ RIV in mice; Fc ⁇ RIA, Fc ⁇ RIIA, and Fc ⁇ RIIIA in humans) and one inhibitory (Fc ⁇ RIIB) receptor.
- Table 1 Various properties of human Fc ⁇ Rs are summarized in Table 1.
- NK cells selectively express one activating Fc receptor (Fc ⁇ RIII in mice and Fc ⁇ RIIIA in humans) but not the inhibitory Fc ⁇ RIIB in mice and humans.
- Human IgG1 binds to most human Fc receptors and is considered equivalent to murine IgG2a with respect to the types of activating Fc receptors that it binds to.
- an “Fc region” fragment crystallizable region or “Fc domain” or “Fc” refers to the C-terminal region of the heavy chain of an antibody that mediates the binding of the immunoglobulin to host tissues or factors, including binding to Fc receptors located on various cells of the immune system (e.g., effector cells) or to the first component (C1q) of the classical complement system.
- an Fc region comprises the constant region of an antibody excluding the first constant region immunoglobulin domain (e.g., CH1 or CL).
- the Fc region comprises C H2 and C H3 constant domains in each of the antibody's two heavy chains; IgM and IgE Fc regions comprise three heavy chain constant domains (C H domains 2-4) in each polypeptide chain.
- the Fc region comprises immunoglobulin domains C ⁇ 2 and C ⁇ 3 and the hinge between C ⁇ 1 and C ⁇ 2.
- the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position C226 or P230 (or amino acid between these two amino acids) to the carboxy-terminus of the heavy chain, wherein the numbering is according to the EU index as in Kabat. Kabat et al. (1991) Sequences of Proteins of Immunological Interest , National Institutes of Health, Bethesda, Md.; see also FIGS. 3C-3F of U.S. Pat. App. Pub. No. 2008/0248028.
- the C H2 domain of a human IgG Fc region extends from about amino acid 231 to about amino acid 340, whereas the C H3 domain is positioned on C-terminal side of a C H2 domain in an Fc region, i.e., it extends from about amino acid 341 to about amino acid 447 of an IgG.
- the Fc region may be a native sequence Fc, including any allotypic variant, or a variant Fc (e.g., a non-naturally occurring Fc).
- Fc may also refer to this region in isolation or in the context of an Fc-comprising protein polypeptide such as a “binding protein comprising an Fc region,” also referred to as an “Fc fusion protein” (e.g., an antibody or immunoadhesin).
- a binding protein comprising an Fc region also referred to as an “Fc fusion protein” (e.g., an antibody or immunoadhesin).
- a “hinge”, “hinge domain” or “hinge region” or “antibody hinge region” refers to the domain of a heavy chain constant region that joins the CH1 domain to the CH2 domain and includes the upper, middle, and lower portions of the hinge (Roux et al. J. Immunol. 1998 161:4083).
- the hinge provides varying levels of flexibility between the binding and effector regions of an antibody and also provides sites for intermolecular, disulfide bonding between the two heavy chain constant regions.
- a hinge starts at Glu216 and ends at Gly237 for all IgG isotypes (Roux et al., 1998 J Immunol 161:4083).
- the sequences of wildtype IgG1, IgG2, IgG3 and IgG4 hinges are shown in Tables 2 and 23.
- hinge includes wild-type hinges (such as those set forth in Table 23), as well as variants thereof (e.g., non-naturally-occurring hinges or modified hinges).
- IgG2 hinge includes wildtype IgG2 hinge, as shown in Table 23, and variants having 1, 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions.
- Exemplary IgG2 hinge variants include IgG2 hinges in which 1, 2, 3 or all 4 cysteines (C219, C220, C226 and C229) are changed to another amino acid.
- an IgG2 comprises a C219S substitution.
- a hinge is a hybrid hinge that comprises sequences from at least two isotypes.
- a hinge may comprise the upper, middle or lower hinge from one isotype and the remainder of the hinge from one or more other isotypes.
- a hinge can be an IgG2/IgG1 hinge, and may comprise, e.g., the upper and middle hinges of IgG2 and the lower hinge of IgG1.
- a hinge may have effector function or be deprived of effector function.
- the lower hinge of wildtype IgG1 provides effector function.
- CH1 domain refers to the heavy chain constant region linking the variable domain to the hinge in a heavy chain constant domain.
- a CH1 domain starts at A118 and ends at V215.
- the term “CH1 domain” includes wildtype CH1 domains (such as having SEQ ID NO: 202 for IgG1 and SEQ ID NO: 203 for IgG2; Table 23), as well as variants thereof (e.g., non-naturally occurring CH1 domains or modified CH1 domains).
- the term “CH1 domain” includes wildtype CH1 domains and variants having 1, 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions.
- Exemplary CH1 domains include CH1 domains with mutations that modify a biological activity of an antibody, such as ADCC, CDC or half-life. Modifications to the CH1 domain that affect a biological activity of an antibody are provided herein.
- CH2 domain refers to the heavy chain constant region linking the hinge to the CH3 domain in a heavy chain constant domain. As used herein, a CH2 domain starts at P238 and ends at K340.
- CH2 domain includes wildtype CH2 domains (such as having SEQ ID NO: 204 for IgG1 and SEQ ID NO: 205 for IgG2; Table 23), as well as variants thereof (e.g., non-naturally occurring CH2 domains or modified CH2 domains).
- the term “CH2 domain” includes wildtype CH2 domains and variants having 1, 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions.
- CH2 domains include CH2 domains with mutations that modify a biological activity of an antibody, such as ADCC, CDC or half-life.
- a CH2 domain comprises the substitutions A330S/P331S that reduce effector function.
- Other modifications to the CH2 domain that affect a biological activity of an antibody are provided herein.
- CH3 domain refers to the heavy chain constant region that is C-terminal to the CH2 domain in a heavy chain constant domain. As used herein, a CH3 domain starts at G341 and ends at K447.
- CH3 domain includes wildtype CH3 domains (such as having SEQ ID NO: 206 for IgG1 and SEQ ID NO: 207 for IgG2; Table 23), as well as variants thereof (e.g., non-naturally occurring CH3 domains or modified CH3 domains).
- CH3 domain includes wildtype CH3 domains and variants having 1, 2, 3, 4, 5, 1-3, 1-5, 3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions, deletions or additions.
- exemplary CH3 domains include CH3 domains with mutations that modify a biological activity of an antibody, such as ADCC, CDC or half-life. Modifications to the CH3 domain that affect a biological activity of an antibody are provided herein.
- a “native sequence Fc region” or “native sequence Fc” comprises an amino acid sequence that is identical to the amino acid sequence of an Fc region found in nature.
- Native sequence human Fc regions include a native sequence human IgG1 Fc region; native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
- Native sequence Fcs include the various allotypes of Fcs (see, e.g., Jefferis et al. (2009) mAbs 1:1).
- epitopes within protein antigens can be formed both from contiguous amino acids (usually a linear epitope) or noncontiguous amino acids juxtaposed by tertiary folding of the protein (usually a conformational epitope). Epitopes formed from contiguous amino acids are typically, but not always, retained on exposure to denaturing solvents, whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
- An epitope typically includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in a unique spatial conformation.
- Methods for determining what epitopes are bound by a given antibody i.e., epitope mapping
- epitope mapping include, for example, immunoblotting and immunoprecipitation assays, wherein overlapping or contiguous peptides (e.g., from OX40) are tested for reactivity with a given antibody (e.g., an anti-OX40 antibody).
- Methods of determining spatial conformation of epitopes include techniques in the art and those described herein, for example, x-ray crystallography, 2-dimensional nuclear magnetic resonance and HDX-MS (see, e.g., Epitope Mapping Protocols in Methods in Molecular Biology , Vol. 66, G. E. Morris, Ed. (1996)).
- epitopope mapping refers to the process of identification of the molecular determinants on the antigen involved in antibody-antigen recognition.
- the term “binds to the same epitope” with reference to two or more antibodies means that the antibodies bind to the same group of amino acid residues, as determined by a given method.
- Techniques for determining whether antibodies bind to the “same epitope on OX40” with the antibodies described herein include art-recognized epitope mapping methods, such as x-ray analyses of crystals of antigen:antibody complexes which provides atomic resolution of the epitope and hydrogen/deuterium exchange mass spectrometry (HDX-MS).
- Antibodies that “compete with another antibody for binding to a target” refer to antibodies that (partially or completely) inhibit the binding of the other antibody to the target. Whether two antibodies compete with each other for binding to a target, i.e., whether and to what extent one antibody inhibits the binding of the other antibody to a target, may be determined using known competition experiments. In certain embodiments, an antibody competes with, and inhibits binding of another antibody to a target by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100%. The level of inhibition or competition may be different depending on which antibody is the “blocking antibody” (i.e., the cold antibody that is incubated first with the target).
- blocking antibody i.e., the cold antibody that is incubated first with the target.
- Competing antibodies bind to the same epitope, an overlapping epitope, or to adjacent epitopes (e.g., as evidenced by steric hindrance).
- RIA solid phase direct or indirect radioimmunoassay
- EIA solid phase direct or indirect enzyme immunoassay
- sandwich competition assay see Stahli et al., Methods in Enzymology 9:242 (1983)
- solid phase direct biotin-avidin EIA see Kirkland et al., J. Immunol. 137:3614 (1986)
- solid phase direct labeled assay solid phase direct labeled sandwich assay
- solid phase direct label RIA using I-125 label see Morel et al., Mol. Immunol.
- the terms “specific binding,” “selective binding,” “selectively binds,” and “specifically binds,” refer to antibody binding to an epitope on a predetermined antigen but not to other antigens.
- the antibody binds with an equilibrium dissociation constant (K D ) of approximately less than 10 ⁇ 7 M, such as approximately less than 10 ⁇ 8 M, 10 ⁇ 9 M or 10 ⁇ 10 M or even lower when determined by, e.g., surface plasmon resonance (SPR) technology in a BIACORE 2000 surface plasmon resonance (SPR) instrument using the predetermined antigen, e.g., recombinant human OX40, as the analyte and the antibody as the ligand, and (ii) binds to the predetermined antigen with an affinity that is at least two-fold greater than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely
- K D equilibrium dissociation
- an antibody that “specifically binds to human OX40” refers to an antibody that binds to soluble or cell bound human OX40 with a K D of 10 ⁇ 7 M or less, such as approximately less than 10 ⁇ 8 M, 10 ⁇ 9 M or 10 ⁇ 10 M or even lower.
- An antibody that “cross-reacts with cynomolgus OX40” refers to an antibody that binds to cynomolgus OX40 with a K D of 10 ⁇ 7 M or less, such as approximately less than 10 ⁇ 8 M, 10 ⁇ 9 M or 10 ⁇ 10 M or even lower.
- antibodies that do not cross-react with OX40 from a non-human species exhibit essentially undetectable binding against these proteins in standard binding assays.
- K assoc or “k a ”, as used herein, is intended to refer to the association rate constant of a particular antibody-antigen interaction
- k dis or “k d ,” as used herein, is intended to refer to the dissociation rate constant of a particular antibody-antigen interaction
- K D is intended to refer to the equilibrium dissociation constant, which is obtained from the ratio of k d to k a (i.e., k d /k a ) and is expressed as a molar concentration (M).
- K D values for antibodies can be determined using methods well established in the art. A preferred method for determining the K D of an antibody is by using surface plasmon resonance, preferably using a biosensor system such as a Biacore® SPR system or flow cytometry and Scatchard analysis.
- high affinity for an IgG antibody refers to an antibody having a K D of 10 ⁇ 8 M or less, more preferably 10 ⁇ 9 M or less and even more preferably 10 ⁇ 10 M or less for a target antigen.
- “high affinity” binding can vary for other antibody isotypes.
- “high affinity” binding for an IgM isotype refers to an antibody having a K D of 10 ⁇ 7 M or less, more preferably 10 ⁇ 8 M or less.
- EC50 in the context of an in vitro or in vivo assay using an antibody or antigen binding fragment thereof, refers to the concentration of an antibody or an antigen-binding portion thereof that induces a response that is 50% of the maximal response, i.e., halfway between the maximal response and the baseline.
- binds to immobilized OX40 refers to the ability of an antibody described herein to bind to OX40, for example, expressed on the surface of a cell or attached to a solid support.
- cross-reacts refers to the ability of an antibody described herein to bind to OX40 from a different species.
- an antibody described herein that binds human OX40 may also bind OX40 from another species (e.g., cynomolgus OX40).
- cross-reactivity may be measured by detecting a specific reactivity with purified antigen in binding assays (e.g., SPR, ELISA) or binding to, or otherwise functionally interacting with, cells physiologically expressing OX40.
- Methods for determining cross-reactivity include standard binding assays as described herein, for example, by BIACORE® surface plasmon resonance (SPR) analysis using a BIACORE® 2000 SPR instrument (Biacore AB, Uppsala, Sweden), or flow cytometric techniques.
- SPR surface plasmon resonance
- naturally-occurring refers to the fact that an object can be found in nature.
- a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally-occurring.
- a “polypeptide” refers to a chain comprising at least two consecutively linked amino acid residues, with no upper limit on the length of the chain.
- One or more amino acid residues in the protein may contain a modification such as, but not limited to, glycosylation, phosphorylation or a disulfide bond.
- a “protein” may comprise one or more polypeptides.
- nucleic acid molecule is intended to include DNA molecules and RNA molecules.
- a nucleic acid molecule may be single-stranded or double-stranded, and may be cDNA.
- conservative sequence modifications of the sequences set forth herein, e.g., in Table 23, i.e., nucleotide and amino acid sequence modifications which do not abrogate the binding of the antibody encoded by the nucleotide sequence or containing the amino acid sequence, to the antigen.
- conservative sequence modifications include conservative nucleotide and amino acid substitutions, as well as, nucleotide and amino acid additions and deletions.
- modifications can be introduced into a sequence in Table 23 by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis.
- Conservative sequence modifications include conservative amino acid substitutions, in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g.
- a predicted nonessential amino acid residue in an anti-OX40 antibody is preferably replaced with another amino acid residue from the same side chain family.
- Methods of identifying nucleotide and amino acid conservative substitutions that do not eliminate antigen binding are well-known in the art (see, e.g., Brummell et al., Biochem. 32:1180-1187 (1993); Kobayashi et al. Protein Eng. 12(10):879-884 (1999); and Burks et al. Proc. Natl. Acad. Sci. USA 94:412-417 (1997)).
- mutations can be introduced randomly along all or part of an anti-OX40 antibody coding sequence, such as by saturation mutagenesis, and the resulting modified anti-OX40 antibodies can be screened for improved binding activity.
- nucleic acids For nucleic acids, the term “substantial homology” indicates that two nucleic acids, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate nucleotide insertions or deletions, in at least about 80% of the nucleotides, usually at least about 90% to 95%, and more preferably at least about 98% to 99.5% of the nucleotides. Alternatively, substantial homology exists when the segments will hybridize under selective hybridization conditions, to the complement of the strand.
- polypeptides the term “substantial homology” indicates that two polypeptides, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate amino acid insertions or deletions, in at least about 80% of the amino acids, usually at least about 90% to 95%, and more preferably at least about 98% to 99.5% of the amino acids.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non-limiting examples below.
- the percent identity between two nucleotide sequences can be determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide or amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller (CABIOS, 4:11-17 (1989)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch ( J. Mol.
- nucleic acid and protein sequences described herein can further be used as a “query sequence” to perform a search against public databases to, for example, identify related sequences.
- Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10.
- Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25(17):3389-3402.
- the default parameters of the respective programs e.g., XBLAST and NBLAST
- XBLAST and NBLAST can be used. See www.ncbi.nlm.nih.gov.
- the nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
- a nucleic acid is “isolated” or “rendered substantially pure” when purified away from other cellular components or other contaminants, e.g., other cellular nucleic acids (e.g., the other parts of the chromosome) or proteins, by standard techniques, including alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis and others well known in the art. See, F. Ausubel, et al., ed. Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York (1987).
- Nucleic acids e.g., cDNA
- cDNA may be mutated, in accordance with standard techniques to provide gene sequences. For coding sequences, these mutations, may affect amino acid sequence as desired.
- DNA sequences substantially homologous to or derived from native V, D, J, constant, switches and other such sequences described herein are contemplated.
- vector as used herein, is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
- viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as “recombinant expression vectors” (or simply, “expression vectors”)
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector.
- viral vectors e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses
- recombinant host cell (or simply “host cell”), as used herein, is intended to refer to a cell that comprises a nucleic acid that is not naturally present in the cell, and maybe a cell into which a recombinant expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term “host cell” as used herein.
- an antigen refers to any natural or synthetic immunogenic substance, such as a protein, peptide, or hapten.
- An antigen may be OX40 or a fragment thereof.
- An antigen may also be a tumor antigen, against which protective or therapeutic immune responses are desired, e.g., antigens expressed by a tumor cell (e.g., for use as a tumor vaccine to be administered in combination with an anti-OX40 antibody).
- Antigens include tumor-associated antigens for the prevention or treatment of cancers.
- tumor-associated antigens include, but are not limited to, sequences comprising all or part of the sequences of ⁇ hCG, gp100 or Pmel17, HER2/neu, WT1, mesothelin, CEA, gp100, MART1, TRP-2, melan-A, NY-ESO-1, NY-BR-1, NY-CO-58, MN (gp250), idiotype, MAGE-1, MAGE-3, MAGE-A3, Tyrosinase, Telomerase, SSX2 and MUC-1 antigens, and germ cell derived tumor antigens.
- Tumor associated antigens also include the blood group antigens, for example, Le a , Le b , LeX, LeY, H-2, B-1, B-2 antigens.
- more than one antigen can be included in a construct.
- a MAGE antigen can be combined with other antigens such as melanin A, tyrosinase, and gp100 along with adjuvants such as GM-CSF or IL-12, and linked to an anti-APC antibody.
- an “immune response” refers to a biological response within a vertebrate against foreign agents, which response protects the organism against these agents and diseases caused by them.
- An immune response is mediated by the action of a cell of the immune system (for example, a T lymphocyte, B lymphocyte, natural killer (NK) cell, macrophage, eosinophil, mast cell, dendritic cell or neutrophil) and soluble macromolecules produced by any of these cells or the liver (including antibodies, cytokines, and complement) that results in selective targeting, binding to, damage to, destruction of, and/or elimination from the vertebrate's body of invading pathogens, cells or tissues infected with pathogens, cancerous or other abnormal cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues.
- An immune reaction includes, e.g., activation or inhibition of a T cell, e.g., an effector T cell or a Th cell, such as a CD4+ or CD8
- an “immunomodulator” or “immunoregulator” refers to an agent, e.g., a component of a signaling pathway, that may be involved in modulating, regulating, or modifying an immune response.
- “Modulating,” “regulating,” or “modifying” an immune response refers to any alteration in a cell of the immune system or in the activity of such cell (e.g., an effector T cell). Such modulation includes stimulation or suppression of the immune system which may be manifested by an increase or decrease in the number of various cell types, an increase or decrease in the activity of these cells, or any other changes which can occur within the immune system.
- Both inhibitory and stimulatory immunomodulators have been identified, some of which may have enhanced function in a tumor microenvironment.
- the immunomodulator is located on the surface of a T cell.
- An “immunomodulatory target” or “immunoregulatory target” is an immunomodulator that is targeted for binding by, and whose activity is altered by the binding of, a substance, agent, moiety, compound or molecule.
- Immunomodulatory targets include, for example, receptors on the surface of a cell (“immunomodulatory receptors”) and receptor ligands (“immunomodulatory ligands”).
- Immunotherapy refers to the treatment of a subject afflicted with, or at risk of contracting or suffering a recurrence of, a disease by a method comprising inducing, enhancing, suppressing or otherwise modifying an immune response.
- Immunosing therapy or “immunostimulatory therapy” refers to a therapy that results in increasing (inducing or enhancing) an immune response in a subject for, e.g., treating cancer.
- “Potentiating an endogenous immune response” means increasing the effectiveness or potency of an existing immune response in a subject. This increase in effectiveness and potency may be achieved, for example, by overcoming mechanisms that suppress the endogenous host immune response or by stimulating mechanisms that enhance the endogenous host immune response.
- T effector (“T eff ”) cells refers to T cells (e.g., CD4+ and CD8+ T cells) with cytolytic activities as well as T helper (Th) cells, which secrete cytokines and activate and direct other immune cells, but does not include regulatory T cells (Treg cells).
- T eff T eff cells
- T helper cells which secrete cytokines and activate and direct other immune cells, but does not include regulatory T cells (Treg cells).
- Anti-OX40 antibodies described herein activate T eff cells, e.g., CD4+ and CD8+ T eff cells.
- An increased ability to stimulate an immune response or the immune system can result from an enhanced agonist activity of T cell costimulatory receptors and/or an enhanced antagonist activity of inhibitory receptors.
- An increased ability to stimulate an immune response or the immune system may be reflected by a fold increase of the EC 50 or maximal level of activity in an assay that measures an immune response, e.g., an assay that measures changes in cytokine or chemokine release, cytolytic activity (determined directly on target cells or indirectly via detecting CD107a or granzymes) and proliferation.
- the ability to stimulate an immune response or the immune system activity may be enhanced by at least 10%, 30%, 50%, 75%, 2 fold, 3 fold, 5 fold or more.
- linkage refers to the association of two or more molecules.
- the linkage can be covalent or non-covalent.
- the linkage also can be genetic (i.e., recombinantly fused). Such linkages can be achieved using a wide variety of art recognized techniques, such as chemical conjugation and recombinant protein production.
- administering refers to the physical introduction of a composition comprising a therapeutic agent to a subject, using any of the various methods and delivery systems known to those skilled in the art.
- Preferred routes of administration for antibodies described herein include intravenous, intraperitoneal, intramuscular, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion.
- parenteral administration means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intraperitoneal, intramuscular, intraarterial, intrathecal, intralymphatic, intralesional, intracapsular, intraorbital, intracardiac, intradermal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion, as well as in vivo electroporation.
- an antibody described herein can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically.
- Administering can also be performed, for example, once, a plurality of times, and/or over one or more extended periods.
- T cell-mediated response refers to a response mediated by T cells, including effector T cells (e.g., CD8 + cells) and helper T cells (e.g., CD4 + cells).
- T cell mediated responses include, for example, T cell cytotoxicity and proliferation.
- cytotoxic T lymphocyte (CTL) response refers to an immune response induced by cytotoxic T cells. CTL responses are mediated primarily by CD8 + T cells.
- the terms “inhibits” or “blocks” are used interchangeably and encompass both partial and complete inhibition/blocking.
- the anti-OX40 antibody inhibits binding of OX40-L to OX40 by at least about 50%, for example, about 60%, 70%, 80%, 90%, 95%, 99%, or 100%, determined, e.g., as further described herein.
- the anti-OX40 antibody inhibits binding of OX40-L to OX40 by no more than 50%, for example, by about 40%, 30%, 20%, 10%, 5% or 1%, determined, e.g., as further described herein.
- the term “inhibits growth” of a tumor includes any measurable decrease in the growth of a tumor, e.g., the inhibition of growth of a tumor by at least about 10%, for example, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 99%, or 100%.
- cancer refers a broad group of diseases characterized by the uncontrolled growth of abnormal cells in the body. Unregulated cell division may result in the formation of malignant tumors or cells that invade neighboring tissues and may metastasize to distant parts of the body through the lymphatic system or bloodstream.
- treat refers to any type of intervention or process performed on, or administering an active agent to, the subject with the objective of reversing, alleviating, ameliorating, inhibiting, or slowing down or preventing the progression, development, severity or recurrence of a symptom, complication, condition or biochemical indicia associated with a disease.
- Prophylaxis refers to administration to a subject who does not have a disease, to prevent the disease from occurring or minimize its effects if it does.
- a “hematological malignancy” includes a lymphoma, leukemia, myeloma or a lymphoid malignancy, as well as a cancer of the spleen and the lymph nodes.
- Exemplary lymphomas include both B cell lymphomas (a B-cell hematological cancer) and T cell lymphomas.
- B-cell lymphomas include both Hodgkin's lymphomas and most non-Hodgkin's lymphomas.
- Non-limiting examples of B cell lymphomas include diffuse large B-cell lymphoma, follicular lymphoma, mucosa-associated lymphatic tissue lymphoma, small cell lymphocytic lymphoma (overlaps with chronic lymphocytic leukemia), mantle cell lymphoma (MCL), Burkitt's lymphoma, mediastinal large B cell lymphoma, Waldenström macroglobulinemia, nodal marginal zone B cell lymphoma, splenic marginal zone lymphoma, intravascular large B-cell lymphoma, primary effusion lymphoma, lymphomatoid granulomatosis.
- T cell lymphomas include extranodal T cell lymphoma, cutaneous T cell lymphomas, anaplastic large cell lymphoma, and angioimmunoblastic T cell lymphoma.
- Hematological malignancies also include leukemia, such as, but not limited to, secondary leukemia, chronic lymphocytic leukemia, acute myelogenous leukemia, chronic myelogenous leukemia, and acute lymphoblastic leukemia.
- Hematological malignancies further include myelomas, such as, but not limited to, multiple myeloma and smoldering multiple myeloma.
- Other hematological and/or B cell- or T-cell-associated cancers are encompassed by the term hematological malignancy.
- an effective dose or “effective dosage” is defined as an amount sufficient to achieve or at least partially achieve a desired effect.
- a “therapeutically effective amount” or “therapeutically effective dosage” of a drug or therapeutic agent is any amount of the drug that, when used alone or in combination with another therapeutic agent, promotes disease regression evidenced by a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction.
- an effective amount comprises an amount sufficient to cause a tumor to shrink and/or to decrease the growth rate of the tumor (such as to suppress tumor growth) or to prevent or delay other unwanted cell proliferation. In certain embodiments, an effective amount is an amount sufficient to delay tumor development. In some embodiments, an effective amount is an amount sufficient to prevent or delay tumor recurrence. An effective amount can be administered in one or more administrations.
- the effective amount of the drug or composition may: (i) reduce the number of cancer cells; (ii) reduce tumor size; (iii) inhibit, retard, slow to some extent and may stop cancer cell infiltration into peripheral organs; (iv) inhibit, i.e., slow to some extent and may stop, tumor metastasis; (v) inhibit tumor growth; (vi) prevent or delay occurrence and/or recurrence of tumor; and/or (vii) relieve to some extent one or more of the symptoms associated with the cancer.
- an “effective amount” is the amount of anti-OX40 antibody and the amount of anti-PD-1 antibody (e.g., nivolumab) or anti-CTLA-4 antibody (e.g., ipilimumab), in combination, clinically proven to affect a significant decrease in cancer or slowing of progression of cancer, such as an advanced solid tumor.
- the terms “fixed dose”, “flat dose” and “flat-fixed dose” are used interchangeably and refer to a dose that is administered to a patient without regard for the weight or body surface area (BSA) of the patient. The fixed or flat dose is therefore not provided as a mg/kg dose, but rather as an absolute amount of the agent.
- a “body surface area (BSA)-based dose” refers to a dose that is adjusted to the body-surface area (BSA) of the individual patient.
- a BSA-based dose may be provided as mg/kg body weight.
- Du Bois formula see Du Bois D, Du Bois E F (June 1916) Archives of Internal Medicine 17 (6): 863-71; and Verbraecken, J. et al. (April 2006). Metabolism—Clinical and Experimental 55 (4): 515-24).
- Other exemplary BSA formulas include the Mosteller formula (Mosteller R D.
- a “prophylactically effective amount” or a “prophylactically effective dosage” of a drug is an amount of the drug that, when administered alone or in combination with another therapeutic agent to a subject at risk of developing a disease or of suffering a recurrence of disease, inhibits the development or recurrence of the disease.
- the ability of a therapeutic or prophylactic agent to promote disease regression or inhibit the development or recurrence of the disease can be evaluated using a variety of methods known to the skilled practitioner, such as in human subjects during clinical trials, in animal model systems predictive of efficacy in humans, or by assaying the activity of the agent in in vitro assays.
- an anti-cancer agent is a drug that slows cancer progression or promotes cancer regression in a subject.
- a therapeutically effective amount of the drug promotes cancer regression to the point of eliminating the cancer.
- “Promoting cancer regression” means that administering an effective amount of the drug, alone or in combination with an anti-neoplastic agent, results in a reduction in tumor growth or size, necrosis of the tumor, a decrease in severity of at least one disease symptom, an increase in frequency and duration of disease symptom-free periods, a prevention of impairment or disability due to the disease affliction, or otherwise amelioration of disease symptoms in the patient.
- Pharmacological effectiveness refers to the ability of the drug to promote cancer regression in the patient.
- Physiological safety refers to an acceptably low level of toxicity, or other adverse physiological effects at the cellular, organ and/or organism level (adverse effects) resulting from administration of the drug.
- a therapeutically effective amount or dosage of the drug preferably inhibits cell growth or tumor growth by at least about 20%, more preferably by at least about 40%, even more preferably by at least about 60%, and still more preferably by at least about 80% relative to untreated subjects.
- a therapeutically effective amount or dosage of the drug completely inhibits cell growth or tumor growth, i.e., preferably inhibits cell growth or tumor growth by 100%.
- the ability of a compound to inhibit tumor growth can be evaluated using the assays described infra. Alternatively, this property of a composition can be evaluated by examining the ability of the compound to inhibit cell growth, such inhibition can be measured in vitro by assays known to the skilled practitioner.
- tumor regression may be observed and may continue for a period of at least about 20 days, more preferably at least about 40 days, or even more preferably at least about 60 days.
- patient and “subject” refer to any human or non-human animal that receives either prophylactic or therapeutic treatment.
- the methods and compositions described herein can be used to treat a subject or patient having cancer, such as an advanced solid tumor.
- non-human animal includes all vertebrates, e.g., mammals and non-mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, reptiles, etc.
- antibodies e.g., fully human antibodies, which are characterized by particular functional features or properties.
- the antibodies specifically bind human OX40.
- antibodies may cross react with OX40 from one or more non-human primates, such as cynomolgus OX40.
- Such antibodies are useful in the treatment of cancer when used as monotherapy, or when used in combination with an immuno-oncology agent, such as an anti-PD-1 antibody (e.g., nivolumab) or anti-CTLA-4 antibody (e.g., ipilimumab).
- Anti-OX40 antibodies described herein exhibit one or more or all of the following functional properties:
- the antibodies bind to OX40 with high affinity, for example, with a K D of 10 ⁇ 7 M or less, 10 ⁇ 8 M or less, 10 ⁇ 9 M or less, 10 ⁇ 10 M or less, 10 ⁇ 11 M or less, 10 ⁇ 12 M or less, 10 ⁇ 12 M to 10 ⁇ 7 M, 10 ⁇ 11 M to 10 ⁇ 7 M, 10 ⁇ 10 M to 10 ⁇ 7 M, or 10 ⁇ 9 M to 10 ⁇ 7 M.
- a K D 10 ⁇ 7 M or less, 10 ⁇ 8 M or less, 10 ⁇ 9 M or less, 10 ⁇ 10 M or less, 10 ⁇ 11 M or less, 10 ⁇ 12 M or less, 10 ⁇ 12 M to 10 ⁇ 7 M, 10 ⁇ 11 M to 10 ⁇ 7 M, 10 ⁇ 10 M to 10 ⁇ 7 M, or 10 ⁇ 9 M to 10 ⁇ 7 M.
- an anti-OX40 antibody binds to soluble human OX40, e.g., as determined by BIACORE® SPR analysis, with a K D of 10 ⁇ 7 M or less, 10 ⁇ 8 M or less, 10 ⁇ 9 M (1 nM) or less, 10 ⁇ 10 M or less, 10 ⁇ 12 M to 10 ⁇ 7 M, 10 ⁇ 11 M to 10 ⁇ 7 M, 10 ⁇ 10 M to 10 ⁇ 7 M, 10 ⁇ 9 M to 10 ⁇ 7 M, or 10 ⁇ 8 M to 10 ⁇ 7 M.
- the anti-OX40 antibody binds to bound (e.g., cell membrane bound) human OX40, such as on activated human T cells, e.g., as determined by flow cytometry, with a K D of 10 ⁇ 7 M or less, 10 ⁇ 8 M or less, 10 ⁇ 9 M (1 nM) or less, 10 ⁇ 10 M or less, 10 ⁇ 12 M to 10 ⁇ 7 M, 10 ⁇ 11 M to 10 ⁇ 8 M, 10 ⁇ 10 M to 10 ⁇ 8 M, 10 ⁇ 9 M to 10 ⁇ 8 M, 10 ⁇ 11 M to 10 ⁇ 9 M, or 10 ⁇ 10 M to 10 ⁇ 9 M.
- bound (e.g., cell membrane bound) human OX40 such as on activated human T cells, e.g., as determined by flow cytometry, with a K D of 10 ⁇ 7 M or less, 10 ⁇ 8 M or less, 10 ⁇ 9 M (1 nM) or less, 10 ⁇ 10 M or less, 10 ⁇ 12 M
- an anti-OX40 antibody binds to bound (e.g., cell membrane bound) human OX40, such as on activated human T cells, e.g., as determined by FACS, with an EC 50 of 10 ⁇ 7 M or less, 10 ⁇ 8 M or less, 10 ⁇ 9 M (1 nM) or less, 10 ⁇ 10 M or less, 10 ⁇ 12 M to 10 ⁇ 7 M, 10 ⁇ 11 M to 10 ⁇ 8 M, 10 ⁇ 10 M to 10 ⁇ 8 M, 10 ⁇ 9 M to 10 ⁇ 8 M, 10 ⁇ 11 M to 10 ⁇ 9 M, or 10 ⁇ 10 M to 10 ⁇ 9 M.
- bound (e.g., cell membrane bound) human OX40 such as on activated human T cells, e.g., as determined by FACS, with an EC 50 of 10 ⁇ 7 M or less, 10 ⁇ 8 M or less, 10 ⁇ 9 M (1 nM) or less, 10 ⁇ 10 M or less, 10 ⁇ 12 M to 10 ⁇
- the anti-OX40 antibody binds to soluble human OX40 with a K D of 10 ⁇ 7 M or less, 10 ⁇ 8 M or less, 10 ⁇ 9 M (1 nM) or less, 10 ⁇ 10 M or less, 10 ⁇ 12 M to 10 ⁇ 7 M, 10 ⁇ 11 M to 10 ⁇ 7 M, 10 ⁇ 10 M to 10 ⁇ 7 M, 10 ⁇ 9 M to 10 ⁇ 7 M, or 10 ⁇ 8 M to 10 ⁇ 7 M, and to cell membrane bound human OX40 with a K D or EC 50 of 10 ⁇ 7 M or less, 10 ⁇ 8 M or less, 10 ⁇ 9 M (1 nM) or less, 10 ⁇ 10 M or less, 10 ⁇ 12 M to 10 ⁇ 7 M, 10 ⁇ 11 M to 10 ⁇ 8 M, 10 ⁇ 10 M to 10 ⁇ 8 M, 10 ⁇ 9 M to 10 ⁇ 8 M, 10 ⁇ 11 M to 10 ⁇ 9 M, or 10 ⁇ 10 M to 10 ⁇ 9 M.
- Anti-OX40 antibodies described herein may bind to cynomolgus OX40, e.g., bind to membrane bound cynomolgus OX40, e.g., with an EC 50 of 100 nM or less, 10 nM or less, 100 nM to 0.01 nM, 100 nM to 0.1 nM, 100 nM to 1 nM, or 10 nM to 1 nM, e.g., as measured by FACS (e.g., as described in the Examples).
- Anti-OX40 antibodies described herein may stimulate or enhance an immune response, e.g., by activating T eff cells, limiting the suppression of Teffector cells by Treg cells, depleting and/or inhibiting tumor Treg cells and/or activating NK cells, e.g., in the tumor.
- the anti-OX40 antibodies may activate or costimulate T eff cells as evidenced, e.g., by enhanced cytokine (e.g., IL-2 and IFN- ⁇ ) secretion and/or enhanced proliferation.
- CD3 stimulation is also provided.
- the OX40 antibody increases IL-2 secretion by a factor of 50%, 100% (i.e., 2 fold), 3 fold, 4 fold, 5 fold or more, optionally with a maximum of up to 10 fold, 30 fold, 100 fold, as measured, e.g., on primary human T cells or T cells expressing human OX40 (e.g., as further described in the Examples).
- the OX40 antibody increases IFN- ⁇ secretion by a factor of 50%, 100% (i.e., 2 fold), 3 fold, 4 fold, 5 fold or more, optionally with a maximum of up to 10 fold, 30 fold, 100 fold, as measured, e.g., on primary human T cells or T cells expressing human OX40 (e.g., as further described in the Examples).
- Anti-OX40 antibodies described herein may inhibit binding of human OX40L to human OX40 on cells, e.g., 293 cells expressing human OX40 (i.e., hOX40-293 cells), e.g., with an EC 50 of 10 nM or less, 1 nM or less, 0.01 nM to 10 nM, 0.1 nM to 10 nM, or 0.1 nM to 1 nM (see Example 6).
- Anti-OX40 antibodies described herein bind to an epitope on OX40, as determined, for example, by binding to fragments of human OX40.
- the antibody binds to all or a portion of the sequence DVVSSKPCKPCTWCNLR (SEQ ID NO: 178) of human OX40 (SEQ ID NO: 2) as determined, for example, by HDX or by binding of the antibodies to fragments of human OX40, followed by enzymatic cleavage (see Example 11).
- the antibody binds to all or a portion of the sequence DSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGK (SEQ ID NO: 179) of human OX40 (SEQ ID NO: 2).
- the anti-OX40 antibodies described herein bind to all or a portion of the sequence SQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLR (SEQ ID NO: 182).
- the anti-OX40 antibodies described herein bind to all or a portion of the sequence PCKPCTWCNLR (SEQ ID NO: 183).
- the anti-OX40 antibodies that bind to all or a portion of the sequence DVVSSKPCKPCTWCNLR (SEQ ID NO: 178) further bind to all or a portion of the sequence QLCTATQDTVCR (SEQ ID NO: 184).
- the anti-OX40 antibodies described herein bind to all or a portion of the sequence SQNTVCRPCGPGFYN (SEQ ID NO: 185).
- Anti-OX40 antibodies described herein may compete for binding to OX40 with (or inhibit binding of) anti-OX40 antibodies comprising CDRs or variable regions described herein, e.g., 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and/or 20C1.
- anti-OX40 antibodies inhibit binding of 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and/or 20C1 to human OX40 by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or by 100%.
- the antibodies induce or enhance T cell activation with multivalent crosslinking through, e.g., FcR binding.
- the antibodies are multivalent, e.g., bivalent. In certain embodiments, the antibodies are not monovalent.
- the antibodies have 1, 2, 3, 4, 5, or 6 of the following features:
- an antibody that exhibits one or more of these functional properties will be understood to relate to a statistically significant difference in the particular activity relative to that seen in the absence of the antibody (e.g., or when a control antibody of irrelevant specificity is present).
- the anti-OX40 antibody increases a measured parameter (e.g., T cell proliferation, cytokine production) by at least 10% of the measured parameter, more preferably by at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 100% (i.e, 2 fold), 3 fold, 5 fold, or 10 fold.
- the antibody may decrease a measured parameter (e.g., tumor volume, OX40-L binding to OX40, quantity of regulatory T cells in tumors) by at least 10% of the measured parameter, more preferably by at least 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90%, 95%, or 99%.
- a measured parameter e.g., tumor volume, OX40-L binding to OX40, quantity of regulatory T cells in tumors
- the anti-OX40 antibodies are not native antibodies or are not naturally-occurring antibodies, e.g., anti-OX40 antibodies with post-translational modifications that are different from those of antibodies that are naturally occurring, such as by having more, less, or a different type of post-translational modification.
- antibodies described herein are antibodies, e.g., monoclonal antibodies, having the CDR and/or variable region sequences of antibodies 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1, isolated and structurally characterized as described in Example 1, as well as antibodies having at least 80% identity (e.g., at least 85%, at least 90%, at least 95%, or at least 99% identity) to the variable region or CDR sequences of antibodies 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1.
- monoclonal antibodies having the CDR and/or variable region sequences of antibodies 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1, isolated and
- V H amino acid sequences of 3F4, 14B6 (14B6-1 and 14B6-2), 23H3, 6E1 (6E1-1 and 6E1-2), 18E9, 8B11, 20B3, 14A2 (14A2-1 and 14A2-2), and 20C1 are set forth in SEQ ID NOs: 17, 28, 37, 48, 57, 65, 73, 84, and 93, respectively.
- V L amino acid sequences of 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1 are set forth in SEQ ID NOs: 18, 29, 30, 38, 49, 50, 58, 66, 74, 85, 86, and 94, respectively.
- antibodies, or antigen binding portion thereof comprising heavy and light chain variable regions, wherein the heavy chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 17, 28, 37, 48, 57, 65, 73, 84, and 93.
- antibodies, or antigen binding portions thereof comprising heavy and light chain variable regions, wherein the light chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 18, 29, 30, 38, 49, 50, 58, 66, 74, 85, 86, and 94.
- antibodies, or antigen-binding portion thereof comprising: heavy and light chain variable region sequences comprising SEQ ID NOs: 17 and 18; 28 and 29; 28 and 30; 37 and 38; 48 and 49; 48 and 50; 57 and 58; 65 and 66; 73 and 74; 84 and 85; 84 and 86; 93 and 94.
- Anti-OX40 antibodies described herein may comprise the heavy and light chain CDR1s, CDR2s and CDR3s of 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1, or combinations thereof.
- the amino acid sequences of the V H CDR1s of 3F4, 14B6 (14B6-1 and 14B6-2), 23H3, 6E1 (6E1-1 and 6E1-2), 18E9, 8B11, 20B3, 14A2 (14A2-1 and 14A2-2), and 20C1 are set forth in SEQ ID NOs: 11, 19, 31, 39, 51, 59, 67, 75, and 87, respectively.
- amino acid sequences of the V H CDR2s of 3F4, 14B6 (14B6-1 and 14B6-2), 23H3, 6E1 (6E1-1 and 6E1-2), 18E9, 8B11, 20B3, 14A2 (14A2-1 and 14A2-2), and 20C1 are set forth in SEQ ID NOs: 12, 20, 32, 40, 52, 60, 68, 76, and 88, respectively.
- amino acid sequences of the V H CDR3s of 3F4, 14B6 (14B6-1 and 14B6-2), 23H3, 6E1 (6E1-1 and 6E1-2), 18E9, 8B11, 20B3, 14A2 (14A2-1 and 14A2-2), and 20C1 are set forth in SEQ ID NOs: 13, 21, 33, 41, 53, 61, 69, 77, and 89.
- amino acid sequences of the V L CDR1s of 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1 are set forth in SEQ ID NOs: 14, 22, 25, 34, 42, 45, 54, 62, 70, 78, 81, and 90, respectively.
- amino acid sequences of the V L CDR2s of 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1 are set forth in SEQ ID NOs: 15, 23, 26, 35, 43, 46, 55, 63, 71, 79, 82, and 91, respectively.
- the amino acid sequences of the V L CDR3s of 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1 are set forth in SEQ ID NOs: 16, 24, 27, 36, 44, 47, 56, 64, 72, 80, 83, and 92, respectively.
- the CDR regions are delineated using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
- V H CDR1, 2 and 3 sequences and V L CDR1, 2 and 3 sequences can be “mixed and matched” (i.e., CDRs from different antibodies can be mixed and match, although each antibody must contain a V H CDR1, 2 and 3 and a V L CDR1, 2 and 3) to create other anti-OX40 binding antibodies.
- OX40 binding of such “mixed and matched” antibodies can be tested using the binding assays described above and in the Examples (e.g., ELISAs).
- the CDR1, CDR2 and/or CDR3 sequence from a particular V H sequence is replaced with a structurally similar CDR sequence(s).
- V L CDR sequences are mixed and matched, the CDR1, CDR2 and/or CDR3 sequence from a particular V L sequence preferably is replaced with a structurally similar CDR sequence(s).
- V H and V L sequences can be created by substituting one or more V H and/or V L CDR region sequences with structurally similar sequences from the CDR sequences disclosed herein for monoclonal antibodies 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1.
- “Mixed and matched” antibodies having binding affinity, bioactivity and/or other properties equivalent or superior to the specific antibodies disclosed herein may be selected for use in the methods of the present invention.
- isolated antibodies, or antigen binding portion thereof comprising:
- a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 11, 19, 31, 39, 51, 59, 67, 75, and 87;
- a heavy chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 20, 32, 40, 52, 60, 68, 76, and 88;
- a heavy chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 13, 21, 33, 41, 53, 61, 69, 77, and 89;
- a light chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 22, 25, 34, 42, 45, 54, 62, 70, 78, 81, and 90;
- a light chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 15, 23, 26, 35, 43, 46, 55, 63, 71, 79, 82, and 91;
- a light chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 16, 24, 27, 36, 44, 47, 56, 64, 72, 80, 83, and 92;
- the antibody specifically binds to human OX40.
- the antibody comprises heavy and light chain variable regions, wherein the heavy chain variable region CDR1, CDR2, and CDR3 regions comprise: SEQ ID NOs: 11-13; 19-21; 31-33; 39-41; 51-53; 59-61; 67-69; 74-77; 87-89; and 87, 317, and 89, respectively;
- the antibody specifically binds to human OX40.
- the antibody comprises heavy and light chain variable regions, wherein the light chain variable region CDR1, CDR2, and CDR3 regions comprise: SEQ ID NOs: 14-16; 22-24; 25-27; 34-36; 42-44; 45-47; 54-56; 62-64; 70-72; 78-80; 81-83; and 90-92, respectively;
- the antibody specifically binds to human OX40.
- the antibody comprises heavy and light chain variable regions, wherein the antibody comprises:
- heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 31-33, respectively, and/or light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 34-36, respectively;
- the antibody specifically binds to human OX40.
- the antibody comprises heavy and light chain variable regions, wherein the antibody comprises:
- a VH domain, or one or more CDRs thereof, described herein may be linked to a constant domain for forming a heavy chain, e.g., a full length heavy chain.
- a VL domain, or one or more CDRs thereof, described herein may be linked to a constant domain for forming a light chain, e.g., a full length light chain.
- a full length heavy chain (with the exception of the C-terminal lysine (K) or with the exception of the C-terminal glycine and lysine (GK), which may be absent) and full length light chain combine to form a full length antibody.
- N-terminal glutamine and glutamate residues may also be converted to pyroglutamate residues on both light and heavy chains.
- a VH domain described herein may be fused to the constant domain of a human IgG, e.g., IgG1, IgG2, IgG3 or IgG4, which are either naturally-occurring or modified, e.g., as further described herein.
- a heavy chain may comprise the amino acid sequence of any VH domain described herein fused to the human IgG1 amino acid sequence set forth in SEQ ID NO: 5.
- the human IgG1 constant domain may also be that of an allotypic variant.
- an allotypic variant of IgG1 comprises an R107K, E189D and M191L (underlined above, with numbering according to that in SEQ ID NO: 6). Within the full length heavy region, these amino acid substitutions are numbered R214K, E356D and M358L.
- a VL domain described herein may be fused to the constant domain of a human kappa or lambda light chain.
- a light chain may comprise the amino acid sequence of any VL domain described herein fused to the human IgG1 kappa light chain amino acid sequence set forth in SEQ ID NO: 7.
- the heavy chain constant region comprises a lysine or another amino acid at the C-terminus, e.g., it comprises the following last amino acids: LSPGK (SEQ ID NO: 8) for the heavy chain.
- the heavy chain constant region is lacking one or more amino acids at the C-terminus, and has, e.g., the C-terminal sequence LSPG (SEQ ID NO: 9) or LSP.
- amino acid sequences of exemplary heavy and light chains are set forth in Table 23 and correspond to SEQ ID NOs: 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 124 and 125 for the heavy chains and SEQ ID NOs: 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, and 122 for the light chains.
- Heavy and light chains comprising an amino acid sequence that is at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, 80%, 75% or 70% identical to any of the heavy or light chains set forth in Table 23 (or their variable regions), e.g., SEQ ID NOs: 95 and 96; 97 and 98; 99 and 100; 101 and 102; 103 and 104; 105 and 106; 107 and 108; 109 and 110; 111 and 112; 113 and 114; 115 and 116; 117 and 118; 119 and 120; 121 and 122; 123 and 116; 124 and 116; and 125 and 116 may be used for forming anti-human OX40 antibodies having the desired characteristics, e.g., those further described herein.
- Exemplary variants are those comprising an allotypic variation, e.g., in the constant domain, and/or a mutation in the variable or constant regions, such as the mutations disclosed herein.
- Heavy and light chains comprising an amino acid sequence that differs in at most 1-30, 1-25, 1-20, 1-15, 1-10, 1-5, 1-4, 1-3, 1-2 or 1 amino acid (by substitution, addition or deletion) from any of the heavy or light chains set forth in Table 23 (or their variable regions) may be used for forming anti-human OX40 antibodies having the desired characteristics, e.g., those further described herein.
- the antibodies described above exhibit one or more, two or more, three or more, four or more, five or more, six, or all of the following functional properties:
- Such antibodies include, for example, human antibodies, humanized antibodies, or chimeric antibodies.
- the anti-OX40 antibodies described herein bind to amino acid residues within the following region of mature human OX40 (SEQ ID NO: 2):
- the anti-OX40 antibodies described herein bind to amino acid residues within the following region of mature human OX40 (SEQ ID NO: 2):
- the anti-OX40 antibodies described herein that bind to all or a portion of the sequence DVVSSKPCKPCTWCNLR (SEQ ID NO: 178) bind to all or a portion of the sequence SQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLR (SEQ ID NO: 182).
- the anti-OX40 antibodies described herein that bind to all or a portion of the sequence DVVSSKPCKPCTWCNLR (SEQ ID NO: 178) bind to all or a portion of the sequence PCKPCTWCNLR (SEQ ID NO: 183).
- the anti-OX40 antibodies that bind to all or a portion of the sequence DVVSSKPCKPCTWCNLR (SEQ ID NO: 178) further bind to all or a portion of the sequence QLCTATQDTVCR (SEQ ID NO: 184).
- the anti-OX40 antibodies described herein that bind to all or a portion of the sequence DVVSSKPCKPCTWCNLR (SEQ ID NO: 178) further bind to all or a portion of the sequence SQNTVCRPCGPGFYN (SEQ ID NO: 185).
- anti-OX40 antibodies described herein may be of any isotype, e.g., IgG1, IgG2, IgG3 and IgG4, or combinations thereof and/or modifications thereof.
- anti-OX40 antibodies comprise a modified heavy chain constant region that alters the properties of the antibody.
- cross-linking of anti-OX40 antibodies with unmodified hIgG1 constant regions induce OX40 signaling and promote T cell activation, and specifically to promote T cell proliferation, IFN- ⁇ secretion, and IL-2 secretion.
- Cross-linking can occur by, e.g., binding to human CD32A Fc ⁇ receptors (Fc ⁇ Rs) expressed on the surface of transfected CHO cells in an assay utilizing co-cultures of CHO-CD3-CD32A cells and human primary CD4 T cells.
- Fc ⁇ Rs human CD32A Fc ⁇ receptors
- Cross-linking can also occur, e.g., by adding a soluble polyclonal anti-human Fc ⁇ antibody in cultures of staphylococcus enterotoxin B (SEB)-activated human peripheral blood mononuclear cells (PBMCs).
- SEB staphylococcus enterotoxin B
- PBMCs peripheral blood mononuclear cells
- Anti-OX40 antibodies with modified heavy chain constant regions may have the ability to alter the activities of the antibodies relative to antibodies with a fully IgG1 heavy chain constant region.
- Exemplary activities that may be altered include, but are not limited to, (1) T cell activation in the presence or absence of cross-linking, (2) T cell proliferation in the presence or absence of cross-linking, and/or (3) cytokine secretion (e.g., IFN- ⁇ , IL-2) in the presence or absence of cross-linking.
- the methods described in the Examples can be used to determine whether the anti-OX40 antibodies with modified heavy chain constant regions exhibit these altered activities (see, e.g., Example 27). In preferred embodiments, these altered activities do not markedly affect the antigen-binding properties of the antibodies, which can be assessed using, e.g., FACS, SPR).
- a modified heavy chain constant region comprises a hinge of the IgG2 isotype (an “IgG2 hinge”) and a CH1, CH2 and CH3 domain.
- a modified heavy chain constant region comprises an IgG2 hinge and a CH1, CH2 and CH3 domain, wherein at least one of the CH1, CH2 and CH3 domains is not of the IgG2 isotype.
- the IgG2 hinge may be a wildtype IgG2 hinge, e.g., a wildtype human IgG2 hinge (e.g., ERKCCVECPPCPAPPVAG; SEQ ID NO: 208) or a variant thereof, provided that the IgG2 hinge retains the ability to confer to the antibody an altered activity relative to the same antibody that comprises a non-IgG2 hinge.
- an IgG2 hinge variant retains similar rigidity or stiffness to that of a wildtype IgG2 hinge.
- the rigidity of a hinge can be determined, e.g., by computer modeling, electron microscopy, spectroscopy such as Nuclear Magnetic Resonance (NMR), X-ray crystallography (B-factors), or Sedimentation Velocity Analytical ultracentrifugation (AUC) to measure or compare the radius of gyration of antibodies comprising the hinge.
- a hinge may have similar or higher rigidity relative to another hinge if an antibody comprising the hinge has a value obtained from one of the tests described in the previous sentence that differs from the value of the same antibody with a different hinge, e.g., an IgG1 hinge, in less than 5%, 10%, 25%, 50%, 75%, or 100%.
- An exemplary human IgG2 hinge variant is an IgG2 hinge that comprises a substitution of one or more of the four cysteine residues (i.e., C219, C220, C226 and C229). A cysteine may be replaced by a serine.
- An exemplary IgG2 hinge is a human IgG2 hinge comprising a C219S mutation (e.g., ERKSCVECPPCPAPPVAG; SEQ ID NO: 209).
- IgG2 hinge variants that may be used include human IgG2 hinges comprising a C220, C226 and/or C229 substitution, e.g., a C220S, C226S or C229S mutation (which may be combined with a C219S mutation).
- An IgG2 hinge may also be an IgG2 hinge in which a portion of the hinge is that of another isotype (i.e., it is a chimeric hinge), provided that the rigidity of the chimeric hinge is at least similar to that of a wildtype IgG2 hinge.
- an IgG2 hinge may be an IgG2 hinge in which the lower hinge (as defined in Table 2) is of an IgG1 isotype, and is, e.g., a wildtype IgG1 lower hinge.
- Additional IgG2 hinge mutations that may be used in an IgG2 hinge include the SE (S267E), SELF (S267E/L328F), SDIE (S239D/I332E), SEFF and GASDALIE (G236A/S239D/A330L/I332E) mutations.
- a “hybrid” or “chimeric” hinge is referred to as being of a specific isotype if more than half of the consecutive amino acids of the hinge are from that isotype.
- a hinge having an upper and middle hinge of IgG2 and the lower hinge of IgG1 is considered to be an IgG2 hinge.
- an anti-OX40 antibody comprises a modified heavy chain constant region that comprises an IgG2 hinge comprising one of the following sequences:
- X is any amino acid, except a cysteine
- 1-5, 1-3, 1-2 or 1 amino acid is inserted between amino acid residues CVE and CPP.
- THT or GGG is inserted.
- 1, 1-2, or 1-3 amino acids are inserted between the hinge and CH2 domain.
- a glycine may be inserted between the hinge and CH2 domain.
- the hinge comprises SEQ ID NO: 208, 209, 210, 211, or 212, wherein A235 and G237 are deleted or substituted with another amino acid. In certain embodiments, the hinge comprises SEQ ID NO: 208, 209, 210, 211, or 212, wherein G237 is deleted or substituted with another amino acid. In certain embodiments, the hinge comprises SEQ ID NO: 447, 448, 449, 450, or 451, wherein V234 and A235 are deleted or substituted with another amino acid.
- a modified heavy chain constant region comprises a hinge that consists of or consists essentially of one of the sequences shown above, e.g., any one of SEQ ID NOs: 208-232, and in certain embodiments, does not comprise additional hinge amino acid residues.
- a modified heavy chain constant region comprises a CH1 domain that is a wildtype CH1 domain of the IgG1 or IgG2 isotype (“IgG1 CH1 domain” or “IgG2 CH1 domain,” respectively).
- CH1 domains of the isotypes IgG3 and IgG4 (“IgG3 CH1 domain and “IgG2 CH1 domain,” respectively) may also be used.
- a CH1 domain may also be a variant of a wildtype CH1 domain, e.g., a variant of a wildtype IgG1, IgG2, IgG3 or IgG4 CH1 domain.
- Exemplary variants of CH1 domains include A114C and T173C and/or C131, e.g., C131S.
- the CH2 domain is a human IgG1 CH2 domain with an A330S and P331S mutation, wherein the CH2 domain has reduced effector function relative to the same CH2 mutation without the mutations.
- Other mutations are further set forth herein elsewhere.
- variants of the CH1, hinge, CH2 or CH3 domains may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more mutations, and/or at most 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 mutation, or 1-10 or 1-5 mutations, or comprise an amino acid sequence that is at least about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to that of the corresponding wildtype domain (CH1, hinge, CH2, or CH3 domain, respectively), provided that the heavy chain constant region comprising the specific variant retains the necessary biological activity.
- Table 3 sets forth exemplary human heavy chain constant regions comprising a human CH1, hinge, CH2 and/or CH3 domains, wherein each domain is either a wildtype domain or a variant thereof that provides the desired biological activity to the heavy chain constant region.
- An unfilled cell in Table 3 indicates that the domain is present or not, and if present can be of any isotype, e.g., IgG1, IgG2, IgG3 or IgG4.
- an antibody comprising the heavy chain constant region 1 in Table 3 is an antibody that comprises a heavy chain constant region comprising at least an IgG2 hinge, and which may also comprise a CH1, CH2 and/or CH3 domain, and if present, which CH1, CH2 and/or CH3 domain is of an IgG1, IgG2, IgG3 or IgG4 isotype.
- an antibody comprising a heavy chain constant region 8 is an antibody comprising a heavy chain constant region comprising an IgG1 CH1 domain, and IgG2 hinge, an IgG1 CH2 domain, and which may or may not also comprise a CH3 domain, which if present, may be of an IgG1, IgG2, IgG3 or IgG4 isotype.
- an anti-OX40 antibody comprises a heavy chain constant region shown in Table 3 and may have altered activity relative to the same antibody comprising a heavy chain constant region that does not comprise that specific heavy chain constant region.
- an antibody comprising a heavy chain constant region shown in Table 3 or 4 may have an altered activity relative to the same antibody comprising a heavy chain constant region that does not comprise an IgG2 hinge or the same IgG2 hinge.
- an antibody comprising a heavy chain constant region shown in Table 3 or 4 may have an altered activity relative to the same antibody comprising a heavy chain constant region that comprises a non-IgG2 hinge, and comprises, e.g., an IgG1, IgG3 or IgG4 hinge.
- an antibody comprising a heavy chain constant region 22 shown in Table 3 may have an altered activity relative to (i) the same antibody comprising a heavy chain constant region that does not comprise an IgG2 hinge, and comprises, e.g., a non-IgG2 hinge (e.g., an IgG1, IgG3 or IgG4 hinge); (ii) the same antibody comprising a heavy chain constant region that does not comprise an IgG2 hinge and an IgG1 CH1, and comprises, e.g., a non-IgG2 hinge and/or a non-IgG1 CH1; (iii) the same antibody comprising a heavy chain constant region that does not comprise an IgG2 hinge and an IgG2 CH2, and comprises, e.g., a non-IgG2 hinge and/or a non-IgG2 CH2; (iv) the same antibody comprising a heavy chain constant region that does not comprise an IgG2 hinge and an IgG1 CH3, and
- modified heavy chain constant regions that may be linked to anti-OX40 variable regions, e.g., the variable regions described herein, are provided in Table 4, which sets forth the identity of each of the domains.
- IgG1f 256 wild type IgG1f IgG1.1f 257 standard inert IgG1.1f IgG2.3 258 IgG2 A-form (C219S) IgG2.5 259 IgG2 B-form (C131S) IgG2.3G1-KH 260 CH1, upper hinge and lower hinge/ upper CH2 of IgG2.3, all else IgG1f IgG2.5G1-KH 261 CH1, upper hinge and lower hinge/ upper CH2 of IgG2.5, all else IgG1f IgG2.3G1-AY 262 CH1 and upper hinge of IgG2.3, all else IgG1f IgG2.5G1-AY 263 CH1 and upper hinge of IgG2.5, all else IgG1f IgG2.3G1.1f-KH 264 CH1, upper hinge and lower hinge/ upper CH2 of IgG2.3, all else IgG1.1f IgG2.5G1.1f-KH 265
- an anti-OX40 antibody comprises a modified heavy chain constant region comprising an IgG2 hinge comprising any one of SEQ ID NOs: 238, 239, 240, 241, and 208-232 or a variant thereof, such as an IgG2 hinge comprising an amino acid sequence that (i) differs from any one of SEQ ID NOs: 238, 239, 240, 241, and 208-232 in 1, 2, 3, 4 or 5 amino acids substitutions, additions or deletions; (ii) differs from any one of SEQ ID NOs: 238, 239, 240, 241, and 208-232 in at most 5, 4, 3, 2, or 1 amino acids substitutions, additions or deletions; (iii) differs from any one of SEQ ID NOs: 238, 239, 240, 241, and 208-232 in 1-5, 1-3, 1-2, 2-5 or 3-5 amino acids substitutions, additions or deletions and/or (iv) comprises an amino acid sequence that is at least about 75%, 80%,
- an anti-OX40 antibody comprises a modified heavy chain constant region comprising an IgG1 CH1 domain comprising SEQ ID NO: 202 or an IgG2 CH1 domain comprising SEQ ID NO: 203, or a variant of SEQ ID NO: 202 or 203, which variant (i) differs from SEQ ID NO: 202 or 203 in 1, 2, 3, 4 or 5 amino acids substitutions, additions or deletions; (ii) differs from SEQ ID NO: 202 or 203 in at most 5, 4, 3, 2, or 1 amino acids substitutions, additions or deletions; (iii) differs from SEQ ID NO: 202 or 203 in 1-5, 1-3, 1-2, 2-5 or 3-5 amino acids substitutions, additions or deletions and/or (iv) comprises an amino acid sequence that is at least about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 202 or 203, wherein in any of (i)-(
- an anti-OX40 antibody comprises a modified heavy chain constant region comprising an IgG1 CH3 domain comprising SEQ ID NO: 206, or a variant of SEQ ID NO: 206, which variant (i) differs from SEQ ID NO: 206 in 1, 2, 3, 4 or 5 amino acids substitutions, additions or deletions; (ii) differs from SEQ ID NO: 206 in at most 5, 4, 3, 2, or 1 amino acids substitutions, additions or deletions; (iii) differs from SEQ ID NO: 206 in 1-5, 1-3, 1-2, 2-5 or 3-5 amino acids substitutions, additions or deletions and/or (iv) comprises an amino acid sequence that is at least about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to SEQ ID NO: 206, wherein in any of (i)-(iv), an amino acid substitution may be a conservative amino acid substitution or a non-conservative amino acid substitution; and wherein the modified heavy
- Modified heavy chain constant regions may also comprise a combination of the CH1, hinge, CH2 and CH3 domains described above.
- an anti-OX40 antibody comprises a modified heavy chain constant region comprising any one of SEQ ID NOs: 244-281, or a variant of any one of SEQ ID NOs: 244-281, which variant (i) differs from any one of SEQ ID NOs: 244-281 in 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acids substitutions, additions or deletions; (ii) differs from any one of SEQ ID NOs: 244-281 in at most 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acids substitutions, additions or deletions; (iii) differs from any one of SEQ ID NOs: 244-281 in 1-5, 1-3, 1-2, 2-5, 3-5, 1-10, or 5-10 amino acids substitutions, additions or deletions and/or (iv) comprises an amino acid sequence that is at least about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to any one of SEQ ID NOs: 244-281
- Modified heavy chain constant regions may have (i) similar, reduced or increased effector function (e.g., binding to an Fc ⁇ R) relative to a wildtype heavy chain constant region and or (ii) similar, reduced or increased half-life (or binding to the FcRn receptor) relative to a wildtype heavy chain constant region.
- effector function e.g., binding to an Fc ⁇ R
- half-life or binding to the FcRn receptor
- anti-OX40 antibodies described herein comprise a heavy chain variable region from a particular germline heavy chain immunoglobulin gene and/or a light chain variable region from a particular germline light chain immunoglobulin gene.
- human antibodies specific for OX40 have been prepared that comprise a heavy chain variable region that is the product of or derived from human germline VH 1-08 gene, VH 6-6 gene, VH 5-51 gene, VH 3-9 gene, VH DP44 gene, VH 3-30.3 gene, VH 3-10 gene, and/or VH 3-13 gene.
- isolated monoclonal antibodies specific for human OX40, or antigen-binding portions thereof comprising a heavy chain variable region that is the product of or derived from a human VH germline gene selected from the group consisting of: VH 1-08 gene, VH 6-6 gene, VH 5-51 gene, VH 3-9 gene, VH DP44 gene, VH 3-30.3 gene, VH 3-10 gene, and VH 3-13 gene.
- Human antibodies specific for OX40 have been prepared that comprise a light chain variable region that is the product of or derived from human germline VK L5 gene, VK L6 gene, VK L15 gene, VK A27 gene, and/or VK O14/O4 gene. Accordingly, provide herein are isolated monoclonal antibodies, or antigen-binding portions thereof, comprising a light chain variable region that is the product of or derived from a human VK germline gene selected from the group consisting of: VK L5 gene, VK L6 gene, VK L15 gene, VK A27 gene, and VK O14/O4 gene.
- Preferred antibodies described herein are those comprising a heavy chain variable region that is the product of or derived from one of the above-listed human germline VH genes and also comprising a light chain variable region that is the product of or derived from one of the above-listed human germline VK genes.
- a human antibody comprises heavy or light chain variable regions that is “the product of” or “derived from” a particular germline sequence if the variable regions of the antibody are obtained from a system that uses human germline immunoglobulin genes.
- Such systems include immunizing a transgenic mouse carrying human immunoglobulin genes with the antigen of interest or screening a human immunoglobulin gene library displayed on phage with the antigen of interest.
- a human antibody that is “the product of” or “derived from” a human germline immunoglobulin sequence can be identified as such by comparing the amino acid sequence of the human antibody to the amino acid sequences of human germline immunoglobulins and selecting the human germline immunoglobulin sequence that is closest in sequence (i.e., greatest % identity) to the sequence of the human antibody.
- a human antibody that is “the product of” or “derived from” a particular human germline immunoglobulin sequence may contain amino acid differences as compared to the germline sequence, due to, for example, naturally-occurring somatic mutations or intentional introduction of site-directed mutation.
- a selected human antibody typically is at least 90% identical in amino acids sequence to an amino acid sequence encoded by a human germline immunoglobulin gene and contains amino acid residues that identify the human antibody as being human when compared to the germline immunoglobulin amino acid sequences of other species (e.g., murine germline sequences).
- a human antibody may be at least 95%, or even at least 96%, 97%, 98%, or 99% identical in amino acid sequence to the amino acid sequence encoded by the germline immunoglobulin gene.
- a human antibody derived from a particular human germline sequence will display no more than 10 amino acid differences from the amino acid sequence encoded by the human germline immunoglobulin gene.
- the human antibody may display no more than 5, or even no more than 4, 3, 2, or 1 amino acid difference from the amino acid sequence encoded by the germline immunoglobulin gene.
- an isolated anti-OX40 antibody, or antigen binding portion thereof may comprise a heavy chain variable region and a light chain variable region, wherein:
- the heavy chain variable region comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 318, 17, 28, 37, 48, 57, 65, 73, 84, and 93, or comprises 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, 1-5, 1-10, 1-15, 1-20, 1-25, or 1-50 amino acid changes (i.e., amino acid substitutions, additions or deletions) relative to an amino acid sequence selected from the group consisting of SEQ ID NOs: 318, 17, 28, 37, 48, 57, 65, 73, 84, and 93;
- the light chain variable region comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 18, 29, 30, 38, 49, 50, 58, 66, 74, 85, 86, and 94, or comprises 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, 1-5, 1-10, 1-15, 1-20, 1-25, or 1-50 amino acid changes (i.e., amino acid substitutions, additions or deletions) relative to an amino acid sequence selected from the group consisting of SEQ ID NOs: 18, 29, 30, 38, 49, 50, 58, 66, 74, 85, 86, and 94;
- the antibody exhibits 1, 2, 3, 4, 5, 6, or all of the following functional properties:
- soluble human OX40 e.g., with a K D of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g., as measured by Biacore;
- binding to cynomolgus OX40 e.g., binding to membrane bound cynomolgus OX40, e.g., with an EC 50 of 10 nM or less (e.g., 0.01 nM to 10 nM), e.g., as measured by FACS;
- the antibody can be, for example, a human antibody, a humanized antibody or a chimeric antibody.
- the anti-OX40 antibody, or antigen binding portion thereof may comprise a heavy chain and a light chain, wherein:
- the heavy chain comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 124 and 125, or comprises 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, 1-5, 1-10, 1-15, 1-20, 1-25, or 1-50 amino acid changes (i.e., amino acid substitutions, additions or deletions) relative to an amino acid sequence selected from the group consisting of SEQ ID NOs: 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 124 and 125;
- the light chain comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NOs: 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, and 122, or comprises 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, 1-5, 1-10, 1-15, 1-20, 1-25, or 1-50 amino acid changes (i.e., amino acid substitutions, additions or deletions) relative to an amino acid sequence selected from the group consisting of SEQ ID NOs: 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, and 122;
- the antibody exhibits 1, 2, 3, 4, 5, 6, or all of the following functional properties:
- anti-OX40 antibodies comprising a VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2, and/or VLCDR3 that differs from the corresponding CDR of 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and/or 20C1, in 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, or 1-5 amino acid changes (i.e., amino acid substitutions, additions or deletions).
- the antibody comprises 1-5 amino acid changes in each of 1, 2, 3, 4, 5 or 6 of the CDRs relative to the corresponding sequence in 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and/or 20C1. In certain embodiments, the antibody comprises at total of 1-5 amino acid changes across all CDRs relative to the CDRs in 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and/or 20C1.
- Anti-OX40 antibodies provided herein may comprise a heavy chain variable region comprising CDR1, CDR2 and CDR3 sequences and a light chain variable region comprising CDR1, CDR2 and CDR3 sequences, wherein one or more of these CDR sequences comprise specified amino acid sequences based on the antibodies described herein (e.g., 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1), or conservative modifications thereof, and wherein the antibodies retain the desired functional properties of the anti-OX40 antibodies described herein.
- the anti-OX40 antibody, or antigen binding portion thereof may comprise a heavy chain variable region comprising CDR1, CDR2, and CDR3 sequences and a light chain variable region comprising CDR1, CDR2, and CDR3 sequences, wherein:
- the heavy chain variable region CDR2 sequence comprises an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 12, 20, 32, 40, 52, 60, 68, 76, 88, and 317, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions; and the light chain variable region CDR2 sequence comprises an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 15, 23, 26, 35, 43, 46, 55, 63, 71, 79, 82, and 91, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions.
- the heavy chain variable region CDR1 sequence comprises an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 11, 19, 31, 39, 51, 59, 67, 75, and 87, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions; and the light chain variable region CDR1 sequence comprises an amino acid sequence selected from the group consisting of amino acid sequences of SEQ ID NOs: 14, 22, 25, 34, 42, 45, 54, 62, 70, 78, 81, and 90, and conservative modifications thereof, e.g., 1, 2, 3, 4, 5, 1-2, 1-3, 1-4 or 1-5 conservative amino acid substitutions.
- the antibodies can be, for example, human antibodies, humanized antibodies or chimeric antibodies.
- Conservative amino acid substitutions may also be made in portions of the antibodies other than, or in addition to, the CDRs.
- conservative amino acid modifications may be made in a framework region or in the Fc region.
- a variable region or a heavy or light chain may comprise 1, 2, 3, 4, 5, 1-2, 1-3, 1-4, 1-5, 1-10, 1-15, 1-20, 1-25, or 1-50 conservative amino acid substitutions relative to the anti-OX40 antibody sequences provided herein.
- the anti-OX40 antibody comprises a combination of conservative and non-conservative amino acid modification.
- antibodies that compete for binding to OX40 with the anti-OX40 antibodies described herein e.g., antibodies 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1).
- competing antibodies can be identified based on their ability to competitively inhibit binding to OX40 of one or more of monoclonal antibodies 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1 in standard OX40 binding assays.
- standard ELISA assays or competitive ELISA assays can be used in which a recombinant human OX40 protein is immobilized on a plate, various concentrations of unlabeled first antibody are added, the plate is washed, labeled second antibody is added, washed, and the amount of bound label is measured. If the increasing concentration of the unlabeled (first) antibody (also referred to as the “blocking antibody”) inhibits the binding of the labeled (second) antibody, the first antibody is said to inhibit the binding of the second antibody to the target on the plate, or is said to compete with the binding of the second antibody.
- BIACORE® SPR analysis can be used to assess the ability of the antibodies to compete. The ability of a test antibody to inhibit the binding of an anti-OX40 antibody described herein to OX40 demonstrates that the test antibody can compete with the antibody for binding to OX40.
- anti-OX40 antibodies that inhibit the binding of the anti-OX40 antibodies described herein to OX40 on cells, e.g., activated T cells, by at least 10%, 20%, 30%, 40%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, by using, e.g., FACS as described in the Examples.
- anti-OX40 antibodies which bind to the same epitope as one or more of the anti-OX40 antibodies described herein (e.g., antibodies 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1), as determined using art-recognized epitope mapping techniques, such as those described below.
- Art-recognized epitope mapping techniques include, for example, structural methods, such as X-ray crystal structure determination (e.g., WO2005/044853), molecular modeling and nuclear magnetic resonance (NMR) spectroscopy, including NMR determination of the H-D exchange rates of labile amide hydrogens in OX40 when free and when bound in a complex with an antibody of interest (Zinn-Justin et al. Biochemistry 1992; 31:11335-47; Zinn-Justin et al. Biochemistry 1993; 32, 6884-91).
- crystallization may be accomplished using any known method in the art (e.g. Giege et al. Acta Crystallogr 1994; D50:339-50; McPherson, Eur J Biochem 1990; 189:1-23), including microbatch (e.g. Chayen, Structure 19976; 5:1269-74), hanging-drop vapor diffusion (e.g. McPherson, J Biol Chem 1976; 251:6300-3), seeding and dialysis. It is desirable to use a protein preparation having a concentration of at least about 1 mg/mL and preferably about 10 mg/mL to about 20 mg/mL.
- Crystallization may be best achieved in a precipitant solution containing polyethylene glycol 1000-20,000 (PEG; average molecular weight ranging from about 1000 to about 20,000 Da), preferably about 5000 to about 7000 Da, more preferably about 6000 Da, with concentrations ranging from about 10% to about 30% (w/v). It may also be desirable to include a protein stabilizing agent, e.g., glycerol at a concentration ranging from about 0.5% to about 20%. A suitable salt, such as sodium chloride, lithium chloride or sodium citrate may also be desirable in the precipitant solution, preferably in a concentration ranging from about 1 mM to about 1000 mM.
- PEG polyethylene glycol 1000-20,000
- a protein stabilizing agent e.g., glycerol
- a suitable salt such as sodium chloride, lithium chloride or sodium citrate may also be desirable in the precipitant solution, preferably in a concentration ranging from about 1 mM to about 1000 mM.
- the precipitant is preferably buffered to a pH of from about 3.0 to about 5.0, preferably about 4.0.
- Specific buffers useful in the precipitant solution may vary and are well-known in the art (Scopes, Protein Purification: Principles and Practice, Third ed., (1994) Springer-Verlag, New York). Examples of such buffers include, but are not limited to, HEPES, Tris, MES and acetate. Crystals may be grow at a wide range of temperatures, including 2° C., 4° C., 8° C. and 26° C.
- Antibody:antigen crystals may be studied using well-known X-ray diffraction techniques and may be refined using computer software such as X-PLOR (Yale University, 1992, distributed by Molecular Simulations, Inc.; see e.g. Blundell & Johnson, Meth. Enzymol. 1985; 114 & 115, H. W. Wyckoff et al., eds., Academic Press; U.S. Patent Application Publication No. 2004/0014194), and BUSTER (Bricogne, Acta Cryst 1993; D49:37-60; Bricogne, Meth Enzymol 1997; 276A:361-423; Carter & Sweet, eds.; Roversi et al., Acta Cryst. 2000; D56:1313-23).
- X-PLOR Yale University, 1992, distributed by Molecular Simulations, Inc.; see e.g. Blundell & Johnson, Meth. Enzymol. 1985; 114 & 115
- epitope mapping methods monitor the binding of the antibody to antigen fragments or mutated variations of the antigen where loss of binding due to a modification of an amino acid residue within the antigen sequence is often considered an indication of an epitope component.
- One such method is alanine scanning mutagenesis, as described, e.g., by Cunningham and Wells, Science 1989; 244:1081-5.
- Another suitable method is deep mutational scanning (see, e.g., Araya et al., Trends in Biotechnology 2011; 29:435-42; Forsyth et al., mAbs 2013; 5:523-32).
- computational combinatorial methods for epitope mapping including the mapping of conformational discontinuous epitopes, can be used.
- epitope mapping can be achieved by testing binding of an antibody to peptides comprising fragments of OX40, e.g., non-denatured or denatured fragments.
- a series of overlapping peptides encompassing the sequence of OX40 may be synthesized and screened for binding, e.g., in a direct ELISA, a competitive ELISA (where the peptide is assessed for its ability to prevent binding of an antibody to OX40 bound to a well of a microtiter plate) or on a chip.
- Epitopes also can be identified by MS-based protein footprinting, such as Hydrogen/deuterium exchange mass spectrometry (HDX-MS) and Fast Photochemical Oxidation of Proteins (FPOP).
- HDX-MS Hydrogen/deuterium exchange mass spectrometry
- FPOP Fast Photochemical Oxidation of Proteins
- HDX-MS may be conducted, for example, as described in the Examples herein and by Wei et al., Drug Discovery Today 2014; 19:95.
- FPOP may be conducted, for example, as described by Hambley et al. ( J American Soc Mass Spectrometry 2005; 16:2057).
- Antibodies that compete for binding with the anti-OX40 antibodies described herein may be produced and identified using art-known methods. For example, mice may be immunized with human OX40 as described herein, hybridomas produced, and the resulting monoclonal antibodies screened for the ability to compete with an antibody described herein for binding to OX40 using the methods described above.
- Antibodies that bind to the same epitope as the anti-OX40 antibodies described herein may be produced by immunizing mice with a smaller fragment of OX40 containing the epitope to which the antibody binds.
- the epitope or region comprising the epitope can be identified using the methods described above. Alternatively, the method of Jespers et al. ( Biotechnology 1994; 12:899) may be used to guide the selection of antibodies recognizing the same epitope and therefore exhibiting similar properties to the anti-OX40 antibodies described herein.
- the heavy chain of the anti-OX40 antibody is paired with a repertoire of (preferably human) light chains to select a OX40-binding antibody, and then the new light chain is paired with a repertoire of (preferably human) heavy chains to select a (preferably human) OX40-binding antibody recognizing the same epitope or epitope region on OX40 as an anti-OX40 antibody described herein.
- variants of an antibody described herein can be obtained by mutagenesis of cDNA encoding the heavy and light chains of the antibody.
- antibodies which bind to all or a portion of the sequence DVVSSKPCKPCTWCNLR (SEQ ID NO: 178), corresponding to amino acid residues 46-62 of mature human OX40 (SEQ ID NO: 2), as determined by the methods in the Examples.
- the anti-OX40 antibodies described herein that bind to all or a portion of the sequence SQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLR (SEQ ID NO: 182), as determined by the methods in the Examples.
- the anti-OX40 antibodies described herein that bind to all or a portion of the sequence PCKPCTWCNLR (SEQ ID NO: 183), as determined by the methods in the Examples.
- the anti-OX40 antibodies that bind to all or a portion of the sequence DVVSSKPCKPCTWCNLR (SEQ ID NO: 178) further bind to all or a portion of the sequence QLCTATQDTVCR (SEQ ID NO: 184), as determined by the methods in the Examples.
- anti-OX40 antibodies described herein that bind to all or a portion of the sequence SQNTVCRPCGPGFYN (SEQ ID NO: 185), as determined by the methods in the Examples.
- the anti-OX40 antibody binds within the region DSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGK (SEQ ID NO: 179), corresponding to amino acid residues 89-124 of mature human OX40 (SEQ ID NO: 2), as determined by the methods in the Examples.
- engineered and modified antibodies that can be prepared using an antibody having one or more of the V H and/or V L sequences disclosed herein as starting material to engineer a modified antibody, which modified antibody may have altered properties from the starting antibody.
- An antibody can be engineered by modifying one or more residues within one or both variable regions (i.e., V H and/or V L ), for example within one or more CDR regions and/or within one or more framework regions. Additionally or alternatively, an antibody can be engineered by modifying residues within the constant region(s), for example to alter the effector function(s) of the antibody.
- CDR grafting One type of variable region engineering that can be performed is CDR grafting.
- Antibodies interact with target antigens predominantly through amino acid residues that are located in the six heavy and light chain complementarity determining regions (CDRs). For this reason, the amino acid sequences within CDRs are more diverse between individual antibodies than sequences outside of CDRs. Because CDR sequences are responsible for most antibody-antigen interactions, it is possible to express recombinant antibodies that mimic the properties of specific reference antibodies by constructing expression vectors that include CDR sequences from the specific reference antibody grafted onto framework sequences from a different antibody with different properties (see, e.g., Riechmann, L. et al. (1998) Nature 332:323-327; Jones, P. et al.
- another embodiment pertains to a monoclonal antibody, or antigen binding portion thereof, comprising a heavy chain variable region comprising CDR1, CDR2, and CDR3 sequences comprising an amino acid sequence selected from the group consisting of SEQ ID SEQ ID NOs: 11-13; 19-21; 31-33; 39-41; 51-53; 59-61; 67-69; 74-77; and 87-89, respectively, and a light chain variable region comprising CDR1, CDR2, and CDR3 sequences comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 14-16; 22-24; 25-27; 34-36; 42-44; 45-47; 54-56; 62-64; 70-72; 78-80; 81-83; and 90-92, respectively.
- such antibodies contain the V H and V L CDR sequences of monoclonal antibodies 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1, yet may contain different framework sequences.
- Such framework sequences can be obtained from public DNA databases or published references that include germline antibody gene sequences.
- germline DNA sequences for human heavy and light chain variable region genes can be found in the “VBase” human germline sequence database (available on the Internet at www.mrc-cpe.cam.ac.uk/vbase), as well as in Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; Tomlinson, I. M., et al.
- V H CDR1, 2 and 3 sequences, and the V L CDR1, 2 and 3 sequences can be grafted onto framework regions that have the identical sequence as that found in the germline immunoglobulin gene from which the framework sequence derive, or the CDR sequences can be grafted onto framework regions that contain up to 20, preferably conservative, amino acid substitutions as compared to the germline sequences.
- Engineered antibodies described herein include those in which modifications have been made to framework residues within V H and/or V L , e.g. to improve the properties of the antibody. Typically such framework modifications are made to decrease the immunogenicity of the antibody. For example, one approach is to “backmutate” one or more framework residues to the corresponding germline sequence. More specifically, an antibody that has undergone somatic mutation may contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody framework sequences to the germline sequences from which the antibody is derived.
- the somatic mutations can be “backmutated” to the germline sequence by, for example, site-directed mutagenesis or PCR-mediated mutagenesis. Such “backmutated” antibodies are also intended to be encompassed.
- Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as “deimmunization” and is described in further detail in U.S. Patent Publication No. 20030153043 by Carr et al.
- variable region modification is to mutate amino acid residues within the CDR regions to improve one or more binding properties (e.g., affinity) of the antibody of interest.
- Site-directed mutagenesis or PCR-mediated mutagenesis can be performed to introduce the mutation(s) and the effect on antibody binding, or other functional property of interest, can be evaluated in in vitro or in vivo assays as described herein and provided in the Examples. Preferably conservative modifications (as discussed above) are introduced.
- the mutations may be amino acid additions, deletions, or preferably substitutions. Moreover, typically no more than one, two, three, four or five residues within a CDR region are altered.
- anti-OX40 monoclonal antibodies comprising a heavy chain variable region comprising: (a) a V H CDR1 region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 11, 19, 31, 39, 51, 59, 67, 75, and 87, or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 11, 19, 31, 39, 51, 59, 67, 75, and 87; (b) a V H CDR2 region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 20, 32, 40, 52, 60, 68, 76, 88, and 317, or an amino acid sequence having one, two, three, four or five amino acid substitutions, deletions or additions as compared to SEQ ID NOs: 12, 20, 32, 40, 52, 60, 68, 76, and 88; (c) a V H CDR1 region comprising an amino acid sequence selected from the group consist
- Methionine residues in CDRs of antibodies can be oxidized, resulting in potential chemical degradation and consequent reduction in potency of the antibody. Accordingly, one or more methionine residues in the heavy and/or light chain CDRs of the anti-OX40 antibodies described herein may be replaced with amino acid residues that do not undergo oxidative degradation.
- deamidation sites may be removed from the antibodies, particularly in the CDRs.
- glycosylation sites within the antigen binding domain are preferably eliminated to prevent glycosylation that may interfere with antigen binding. See, e.g., U.S. Pat. No. 5,714,350.
- the antibodies described herein are modified to selectively block antigen binding in tissues and environments where antigen binding would be detrimental, but allow antigen binding where it would be beneficial.
- a blocking peptide “mask” is generated that specifically binds to the antigen binding surface of the antibody and interferes with antigen binding, which mask is linked to each of the binding arms of the antibody by a peptidase cleavable linker. See, e.g., U.S. Pat. No. 8,518,404 to CytomX.
- Such constructs are useful for treatment of cancers in which protease levels are greatly increased in the tumor microenvironment compared with non-tumor tissues. Selective cleavage of the cleavable linker in the tumor microenvironment allows disassociation of the masking/blocking peptide, enabling antigen binding selectively in the tumor, rather than in peripheral tissues in which antigen binding might cause unwanted side effects.
- a bivalent binding compound comprising two antigen binding domains is developed that binds to both antigen binding surfaces of the (bivalent) antibody and interfere with antigen binding, in which the two binding domains masks are linked to each other (but not the antibody) by a cleavable linker, for example cleavable by a peptidase.
- a cleavable linker for example cleavable by a peptidase.
- Such masking ligands are useful for treatment of cancers in which protease levels are greatly increased in the tumor microenvironment compared with non-tumor tissues.
- Selective cleavage of the cleavable linker in the tumor microenvironment allows disassociation of the two binding domains from each other, reducing the avidity for the antigen-binding surfaces of the antibody.
- the resulting dissociation of the masking ligand from the antibody enables antigen binding selectively in the tumor, rather than in peripheral tissues in which antigen binding might cause unwanted side effects.
- the Fc portion of the antibody interact with the immune system generally in complex ways to elicit any number of biological effects. Effector functions, such as the Fc region of an immunoglobulin, are responsible for many important antibody functions, such as antigen-dependent cellular cytotoxicity (ADCC), complement dependent cytotoxicity (CDC), and antibody-dependent cell-mediated phagocytosis (ADCP), result in killing of target cells, albeit by different mechanisms.
- ADCC antigen-dependent cellular cytotoxicity
- CDC complement dependent cytotoxicity
- ADCP antibody-dependent cell-mediated phagocytosis
- IgA heavy chain constant region
- IgG heavy chain constant region
- IgG is separated into four subclasses known as IgG1, IgG2, IgG3, and IgG4.
- IgG molecules interact with three classes of Fc ⁇ receptors (Fc ⁇ R) specific for the IgG class of antibody, namely Fc ⁇ RI, Fc ⁇ RII, and Fc ⁇ RIII.
- Fc ⁇ R Fc ⁇ receptors
- the important sequences for the binding of IgG to the Fc ⁇ R receptors have been reported to be located in the CH2 and CH3 domains.
- the serum half-life of an antibody is influenced by the ability of that antibody to bind to the neonatal Fc receptor (FcRn).
- Anti-OX40 antibodies described herein may comprise the variable domains of the invention combined with constant domains comprising different Fc regions, selected based on the biological activities (if any) of the antibody for the intended use. Salfeld (2007) Nat. Biotechnol. 25:1369.
- Human IgGs for example, can be classified into four subclasses, IgG1, IgG2, IgG3, and IgG4, and each these of these comprises an Fc region having a unique profile for binding to one or more of Fc ⁇ receptors (activating receptors Fc ⁇ RI (CD64), Fc ⁇ RIIA, Fc ⁇ RIIC (CD32); Fc ⁇ RIIIA and Fc ⁇ RIIIB (CD16) and inhibiting receptor Fc ⁇ RIIB), and for the first component of complement (C1q).
- Fc ⁇ receptors activating receptors Fc ⁇ RI (CD64), Fc ⁇ RIIA, Fc ⁇ RIIC (CD32); Fc ⁇ RIIIA and Fc ⁇ RIIIB (CD16) and inhibiting receptor Fc ⁇ RIIB
- C1q first component of complement
- IgG1 and IgG3 bind to all Fc ⁇ receptors; IgG2 binds to Fc ⁇ RIIA H131 , and with lower affinity to Fc ⁇ RIIA R131 Fc ⁇ RIIIA V158 ; IgG4 binds to Fc ⁇ RI, Fc ⁇ RIIA, Fc ⁇ RIIB, Fc ⁇ RIIC, and Fc ⁇ RIIIA V158 ; and the inhibitory receptor Fc ⁇ RIIB has a lower affinity for IgG1, IgG2 and IgG3 than all other Fc ⁇ receptors. Bruhns et al. (2009) Blood 113:3716.
- an IgG1 constant domain rather than an IgG2 or IgG4, might be chosen for use in a drug where ADCC is desired;
- IgG3 might be chosen if activation of Fc ⁇ RIIIA-expressing NK cells, monocytes, or macrophages;
- IgG4 might be chosen if the antibody is to be used to desensitize allergy patients.
- IgG4 may also be selected if it is desired that the antibody lack all effector function.
- anti-OX40 variable regions described herein may be linked (e.g., covalently linked or fused) to an Fc, e.g., an IgG1, IgG2, IgG3 or IgG4 Fc, which may be of any allotype or isoallotype, e.g., for IgG1: G1m, G1m1(a), G1m2(x), G1m3(f), G1m17(z); for IgG2: G2m, G2m23(n); for IgG3: G3m, G3m21(g1), G3m28(g5), G3m11(b0), G3m5(b1), G3m13(b3), G3m14(b4), G3m10(b5), G3m15(s), G3m16(t), G3m6(c3), G3m24(c5), G3m26(u), G3m27(v). See, e.g.,
- anti-OX40 variable regions described herein are linked to an Fc that binds to one or more activating Fc receptors (Fc ⁇ I/CD64, Fc ⁇ IIa/CD32 or Fc ⁇ IIIa/CD16), and thereby stimulate ADCC and may cause T cell depletion.
- anti-OX40 variable regions described herein are linked to an Fc that causes depletion.
- anti-OX40 variable regions described herein are linked to a human IgG1 or IgG3 Fc, i.e., the antibodies are of the IgG1 or IgG3 isotype.
- anti-OX40 antibodies are depleting antibodies.
- anti-OX40 antibodies are of an isotype, (either naturally occurring or non-naturally occurring (e.g., including mutation(s)) isotype that stimulate T reg cell depletion or elimination at the tumor site and concomitant activation of T eff cells.
- anti-OX40 antibodies create an elevated T eff to T reg ratio at the tumor site, which is indicative of potent anti-tumor activity, and preferably without significantly depleting T reg and T eff cells that are outside of the tumor, e.g., in the periphery.
- anti-OX40 antibodies block the immunosuppressive activity of T regs .
- anti-OX40 antibodies have an Fc receptor with reduced or eliminated FcR binding, e.g., reduced binding to activating FcRs.
- anti-OX40 antibodies have an Fc that binds to or has enhanced binding to FcRIIb, which can provide enhanced agonism. See, e.g., WO 2012/087928; Li & Ravetch (2011) Science 333:1030; Wilson et al. (2011) Cancer Cell 19:101; White et al. (2011) J. Immunol. 187:1754.
- Anti-OX40 variable regions described herein may be linked to a non-naturally occurring Fc region, e.g., an effectorless or mostly effectorless Fc (e.g., human IgG2 or IgG4) or, alternatively, an Fc with enhanced binding to one or more activating Fc receptors (Fc ⁇ I, Fc ⁇ IIa or Fc ⁇ IIIa), such as to enhance T reg depletion in the tumor environment.
- an effectorless or mostly effectorless Fc e.g., human IgG2 or IgG4
- an Fc with enhanced binding to one or more activating Fc receptors Fc ⁇ I, Fc ⁇ IIa or Fc ⁇ IIIa
- Variable regions described herein may be linked to an Fc comprising one or more modification, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity.
- an antibody described herein may be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or it may be modified to alter its glycosylation, to alter one or more functional properties of the antibody.
- the numbering of residues in the Fc region is that of the EU index of Kabat.
- Sequence variants disclosed herein are provided with reference to the residue number followed by the amino acid that is substituted in place of the naturally occurring amino acid, optionally preceded by the naturally occurring residue at that position. Where multiple amino acids may be present at a given position, e.g. if sequences differ between naturally occurring isotypes, or if multiple mutations may be substituted at the position, they are separated by slashes (e.g. “X/Y/Z”).
- Fc region variants will generally comprise at least one amino acid modification in the Fc region. Combining amino acid modifications is thought to be particularly desirable.
- the variant Fc region may include two, three, four, five, etc substitutions therein, e.g. of the specific Fc region positions identified herein. Exemplary Fc sequence variants are disclosed herein, and are also provided at U.S. Pat. Nos.
- ADCC activity may be reduced by modifying the Fc region.
- sites that affect binding to Fc receptors may be removed, preferably sites other than salvage receptor binding sites.
- an Fc region may be modified to remove an ADCC site.
- ADCC sites are known in the art; see, for example, Sarmay et al. (1992) Molec . Immunol. 29 (5): 633-9 with regard to ADCC sites in IgG1.
- the G236R and L328R variant of human IgG1 effectively eliminates Fc ⁇ R binding. Horton et al. (2011) J. Immunol. 186:4223 and Chu et al. (2008) Mol. Immunol. 45:3926.
- the Fc having reduced binding to Fc ⁇ Rs comprised the amino acid substitutions L234A, L235E and G237A. Gross et al. (2001) Immunity 15:289.
- CDC activity may also be reduced by modifying the Fc region. Mutations at IgG1 positions D270, K322, P329 and P331, specifically alanine mutations D270A, K322A, P329A and P331A, significantly reduce the ability of the corresponding antibody to bind C1q and activate complement. Idusogie et al. (2000) J. Immunol. 164:4178; WO 99/51642. Modification of position 331 of IgG1 (e.g. P331S) has been shown to reduce complement binding. Tao et al. (1993) J. Exp. Med. 178:661 and Canfield & Morrison (1991) J. Exp. Med. 173:1483. In another example, one or more amino acid residues within amino acid positions 231 to 239 are altered to thereby reduce the ability of the antibody to fix complement. WO 94/29351.
- the Fc with reduced complement fixation has the amino acid substitutions A330S and P331S. Gross et al. (2001) Immunity 15:289.
- IgG4 antibodies may be used, or antibodies or fragments lacking the Fc region or a substantial portion thereof can be devised, or the Fc may be mutated to eliminate glycosylation altogether (e.g. N297A).
- a hybrid construct of human IgG2 (C H 1 domain and hinge region) and human IgG4 (C H 2 and C H 3 domains) has been generated that is devoid of effector function, lacking the ability to bind the Fc ⁇ Rs (like IgG2) and unable to activate complement (like IgG4).
- the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to reduce all effector function(s) of the antibody.
- one or more amino acids selected from amino acid residues 234, 235, 236, 237, 297, 318, 320 and 322 can be replaced with a different amino acid residue such that the antibody has decreased affinity for an effector ligand but retains the antigen-binding ability of the parent antibody.
- the effector ligand to which affinity is altered can be, for example, an Fc receptor (residues 234, 235, 236, 237, 297) or the C1 component of complement (residues 297, 318, 320, 322).
- Fc modifications reducing effector function also include substitutions, insertions, and deletions at positions 234, 235, 236, 237, 267, 269, 325, and 328, such as 234G, 235G, 236R, 237K, 267R, 269R, 325L, and 328R.
- An Fc variant may comprise 236R/328R.
- Other modifications for reducing Fc ⁇ R and complement interactions include substitutions 297A, 234A, 235A, 237A, 318A, 228P, 236E, 268Q, 309L, 330S, 331 S, 220S, 226S, 229S, 238S, 233P, and 234V.
- Effector functions can be reduced, while maintaining neonatal FcR binding (maintaining half-life), by mutating IgG residues at one or more of positions 233-236 and 327-331, such as E233P, L234V, L235A, optionally G2364, A327G, A330S and P331S in IgG1; E233P, F234V, L235A, optionally G2364 in IgG4; and A330S and P331S in IgG2. See Armour et al. (1999) Eur. J. Immunol.
- mutations that reduce effector function include L234A and L235A in IgG1 (Alegre et al. (1994) Transplantation 57:1537); V234A and G237A in IgG2 (Cole et al. (1997) J. Immunol. 159:3613; see also U.S. Pat. No. 5,834,597); and S228P and L235E for IgG4 (Reddy et al. (2000) J. Immunol. 164:1925).
- Another combination of mutations for reducing effector function in a human IgG1 include L234F, L235E and P331S. Oganesyan et al.
- Fc variants having reduced ADCC and/or CDC are disclosed at Glaesner et al. (2010) Diabetes Metab. Res. Rev. 26:287 (F234A and L235A to decrease ADCC and ADCP in an IgG4); Hutchins et al. (1995) Proc. Nat'l Acad. Sci . ( USA ) 92:11980 (F234A, G237A and E318A in an IgG4); An et al. (2009) MAbs 1:572 and U.S. Pat. App. Pub. 2007/0148167 (H268Q, V309L, A330S and P331S in an IgG2); McEarchern et al.
- an Fc is chosen that has essentially no effector function, i.e., it has reduced binding to Fc ⁇ Rs and reduced complement fixation.
- An exemplary Fc, e.g., IgG1 Fc, that is effectorless comprises the following five mutations: L234A, L235E, G237A, A330S and P331S. Gross et al. (2001) Immunity 15:289. Exemplary heavy chains comprising these mutations are set forth in the Sequence Listing, as detailed at Table 23 (e.g. SEQ ID NO: 11). These five substitutions may be combined with N297A to eliminate glycosylation as well.
- ADCC activity may be increased by modifying the Fc region.
- human IgG1 ⁇ IgG3>>IgG4 ⁇ IgG2 so an IgG1 constant domain, rather than an IgG2 or IgG4, might be chosen for use in a drug where ADCC is desired.
- the Fc region may be modified to increase antibody dependent cellular cytotoxicity (ADCC) and/or to increase the affinity for an Fc ⁇ receptor by modifying one or more amino acids at the following positions: 234, 235, 236, 238, 239, 240, 241, 243, 244, 245, 247, 248, 249, 252, 254, 255, 256, 258, 262, 263, 264, 265, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 299, 301, 303, 305, 307, 309, 312, 313, 315, 320, 322, 324, 325, 326, 327, 329, 330, 331, 332, 333, 334, 335, 337, 338, 340, 360, 373, 376, 378, 382, 388, 389, 398, 414, 416, 419, 430, 433, 434
- Exemplary substitutions include 236A, 239D, 239E, 268D, 267E, 268E, 268F, 324T, 332, and 332E.
- Exemplary variants include 239D/332E, 236A/332E, 236A/239D/332E, 268F/324T, 267E/268F, 267E/324T, and 267E/268F/324T.
- human IgG1 Fcs comprising the G236A variant, which can optionally be combined with I332E, have been shown to increase the Fc ⁇ IIA/Fc ⁇ IIB binding affinity ratio approximately 15-fold.
- IgG1 mutants containing L235V, F243L, R292P, Y300L, V305I and P396L mutations which exhibited enhanced binding to Fc ⁇ RIIIa and concomitantly enhanced ADCC activity in transgenic mice expressing human Fc ⁇ RIIIa in models of B cell malignancies and breast cancer have been identified. Stavenhagen et al. (2007) Cancer Res. 67:8882; U.S. Pat. No. 8,652,466; Nordstrom et al. (2011) Breast Cancer Res. 13:R123.
- IgG isotypes also exhibit differential CDC activity (IgG3>IgG1>>IgG2 ⁇ IgG4).
- CDC differential CDC activity
- the ability to recruit complement (CDC) may be enhanced by mutations at K326 and/or E333 in an IgG2, such as K326W (which reduces ADCC activity) and E333S, to increase binding to C1q, the first component of the complement cascade.
- K326W which reduces ADCC activity
- Fc variants that enhance affinity for the inhibitory receptor Fc ⁇ RIIb may also be used, e.g. to enhance apoptosis-inducing or adjuvant activity.
- Such variants may provide an antibody with immunomodulatory activities related to Fc ⁇ RIIb + cells, including for example B cells and monocytes.
- the Fc variants provide selectively enhanced affinity to Fc ⁇ RIIb relative to one or more activating receptors.
- Modifications for altering binding to Fc ⁇ RIIb include one or more modifications at a position selected from the group consisting of 234, 235, 236, 237, 239, 266, 267, 268, 325, 326, 327, 328, and 332, according to the EU index.
- Exemplary substitutions for enhancing Fc ⁇ RIIb affinity include but are not limited to 234D, 234E, 234F, 234W, 235D, 235F, 235R, 235Y, 236D, 236N, 237D, 237N, 239D, 239E, 266M, 267D, 267E, 268D, 268E, 327D, 327E, 328F, 328W, 328Y, and 332E.
- Exemplary substitutions include 235Y, 236D, 239D, 266M, 267E, 268D, 268E, 328F, 328W, and 328Y.
- Other Fc variants for enhancing binding to Fc ⁇ RIIb include 235Y/267E, 236D/267E, 239D/268D, 239D/267E, 267E/268D, 267E/268E, and 267E/328F.
- the S267E, G236D, S239D, L328F and I332E variants, including the S267E+L328F double variant, of human IgG1 are of particular value in specifically enhancing affinity for the inhibitory FcyRIIb receptor. Chu et al. (2008) Mol.
- the antibody is modified to increase its biological half-life.
- Various approaches are possible. For example, this may be done by increasing the binding affinity of the Fc region for FcRn.
- the antibody is altered within the CH1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Pat. Nos. 5,869,046 and 6,121,022 by Presta et al.
- Fc variants that increase binding to FcRn and/or improve pharmacokinetic properties include substitutions at positions 259, 308, and 434, including for example 259I, 308F, 428L, 428M, 434S, 434H, 434F, 434Y, and 434M.
- Other variants that increase Fc binding to FcRn include: 250E, 250Q, 428L, 428F, 250Q/428L (Hinton et al., 2004, J. Biol. Chem. 279(8): 6213-6216, Hinton et al.
- a combination Fc variant comprising M252Y, S254T and T256E, increases half-life-nearly 4-fold.
- a related IgG1 modification providing increased FcRn affinity but reduced pH dependence (M252Y/S254T/T256E/H433K/N434F) has been used to create an IgG1 construct (“MST-HN Abdeg”) for use as a competitor to prevent binding of other antibodies to FcRn, resulting in increased clearance of that other antibody, either endogenous IgG (e.g. in an autoimmune setting) or another exogenous (therapeutic) mAb.
- endogenous IgG e.g. in an autoimmune setting
- hybrid IgG isotypes may be used to increase FcRn binding, and potentially increase half-life.
- an IgG1/IgG3 hybrid variant may be constructed by substituting IgG1 positions in the CH2 and/or CH3 region with the amino acids from IgG3 at positions where the two isotypes differ.
- a hybrid variant IgG antibody may be constructed that comprises one or more substitutions, e.g., 274Q, 276K, 300F, 339T, 356E, 358M, 384S, 392N, 397M, 422I, 435R, and 436F.
- the serum half-life of the antibodies of the present invention can also be increased by pegylation.
- An antibody can be pegylated to, for example, increase the biological (e.g., serum) half-life of the antibody.
- the antibody, or fragment thereof typically is reacted with a polyethylene glycol (PEG) reagent, such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment.
- PEG polyethylene glycol
- the pegylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer).
- Antibody fragments may also be fused to human serum albumin, e.g. in a fusion protein construct, to increase half-life. Yeh et al. (1992) Proc. Nat'l Acad. Sci. 89:1904.
- a bispecific antibody may be constructed with a first antigen binding domain of the present invention and a second antigen binding domain that binds to human serum albumin (HSA).
- HSA human serum albumin
- specialized polypeptide sequences can be added to antibody fragments to increase half-life, e.g. “XTEN” polypeptide sequences. Schellenberger et al. (2009) Nat. Biotechnol. 27:1186; Int'l Pat. Appl. Pub. WO 2010/091122.
- IgG4 constant domain When using an IgG4 constant domain, it is preferable to include the substitution S228P, which mimics the hinge sequence in IgG1 and thereby stabilizes IgG4 molecules, e.g. reducing Fab-arm exchange between the therapeutic antibody and endogenous IgG4 in the patient being treated. Labrijn et al. (2009) Nat. Biotechnol. 27:767; Reddy et al. (2000) J. Immunol. 164:1925.
- a potential protease cleavage site in the hinge of IgG1 constructs can be eliminated by D221G and K222S modifications, increasing the stability of the antibody.
- WO 2014/043344 A potential protease cleavage site in the hinge of IgG1 constructs can be eliminated by D221G and K222S modifications, increasing the stability of the antibody.
- the affinities and binding properties of an Fc variant for its ligands may be determined by a variety of in vitro assay methods (biochemical or immunological based assays) known in the art including but not limited to, equilibrium methods (e.g., enzyme-linked immunoabsorbent assay (ELBA), or radioimmunoassay (RIA)), or kinetics (e.g., BIACORE® SPR analysis), and other methods such as indirect binding assays, competitive inhibition assays, fluorescence resonance energy transfer (FRET), gel electrophoresis and chromatography (e.g., gel filtration).
- in vitro assay methods biochemical or immunological based assays
- equilibrium methods e.g., enzyme-linked immunoabsorbent assay (ELBA), or radioimmunoassay (RIA)
- kinetics e.g., BIACORE® SPR analysis
- indirect binding assays e.g., competitive inhibition assays, fluorescence resonance energy transfer (
- These and other methods may utilize a label on one or more of the components being examined and/or employ a variety of detection methods including but not limited to chromogenic, fluorescent, luminescent, or isotopic labels.
- detection methods including but not limited to chromogenic, fluorescent, luminescent, or isotopic labels.
- aglycosylated antibodies generally lack effector function, mutations can be introduced to restore that function.
- Aglycosylated antibodies e.g. those resulting from N297A/C/D/or H mutations or produced in systems (e.g. E. coli ) that do not glycosylate proteins, can be further mutated to restore Fc ⁇ R binding, e.g. S298G and/or T299A/G/or H (WO 2009/079242), or E382V and M428I (Jung et al. (2010) Proc. Nat'l Acad. Sci ( USA ) 107:604).
- an antibody with enhanced ADCC can be made by altering glycosylation. For example, removal of fucose from heavy chain Asn297-linked oligosaccharides has been shown to enhance ADCC, based on improved binding to Fc ⁇ RIIIa. Shields et al. (2002) JBC 277:26733; Niwa et al. (2005) J. Immunol. Methods 306: 151; Cardarelli et al. (2009) Clin. Cancer Res. 15:3376 (MDX-1401); Cardarelli et al. (2010) Cancer Immunol. Immunotherap. 59:257 (MDX-1342).
- Such low fucose antibodies may be produced, e.g., in knockout Chinese hamster ovary (CHO) cells lacking fucosyltransferase (FUT8) (Yamane-Ohnuki et al. (2004) Biotechnol. Bioeng. 87:614), or in other cells that generate afucosylated antibodies. See, e.g., Zhang et al. (2011) mAbs 3:289 and Li et al. (2006) Nat. Biotechnol. 24:210 (both describing antibody production in glycoengineered Pichia pastoris .); Mossner et al. (2010) Blood 115:4393; Shields et al. (2002) J. Biol. Chem.
- ADCC can also be enhanced as described in PCT Publication WO 03/035835, which discloses use of a variant CHO cell line, Lec13, with reduced ability to attach fucose to Asn(297)-linked carbohydrates, also resulting in hypofucosylation of antibodies expressed in that host cell (see also Shields, R. L. et al. (2002) J. Biol. Chem. 277:26733-26740).
- fucose analogs may be added to culture medium during antibody production to inhibit incorporation of fucose into the carbohydrate on the antibody (see, e.g., WO 2009/135181).
- PCT Publication WO 99/54342 by Umana et al. describes cell lines engineered to express glycoprotein-modifying glycosyl transferases (e.g., beta(1,4)-N-acetylglucosaminyltransferase III (GnTIII)) such that antibodies expressed in the engineered cell lines exhibit increased bisecting GlcNac structures which results in increased ADCC activity of the antibodies (see also Umana et al. (1999) Nat. Biotech. 17:176-180).
- glycoprotein-modifying glycosyl transferases e.g., beta(1,4)-N-acetylglucosaminyltransferase III (GnTIII)
- Glycoengineering can also be used to modify the anti-inflammatory properties of an IgG construct by changing the ⁇ 2,6 sialyl content of the carbohydrate chains attached at Asn297 of the Fc regions, wherein an increased proportion of ⁇ 2,6 sialylated forms results in enhanced anti-inflammatory effects.
- ⁇ 2,6 sialylated forms results in enhanced anti-inflammatory effects.
- reduction in the proportion of antibodies having ⁇ 2,6 sialylated carbohydrates may be useful in cases where anti-inflammatory properties are not wanted.
- amino acid sequence of the Fc region may be modified to mimic the effect of ⁇ 2,6 sialylation, for example by inclusion of an F241A modification (see, e.g., WO 2013/095966).
- Antibodies described herein can contain one or more glycosylation sites in either the light or heavy chain variable region. Such glycosylation sites may result in increased immunogenicity of the antibody or an alteration of the pK of the antibody due to altered antigen binding (Marshall et al (1972) Annu Rev Biochem 41:673-702; Gala and Morrison (2004) J. Immunol 172:5489-94; Wallick et al (1988) J Exp Med 168:1099-109; Spiro (2002) Glycobiology 12:43R-56R; Parekh et al (1985) Nature 316:452-7; Mimura et al. (2000) Mol Immunol 37:697-706).
- the anti-OX40 antibody does not contain variable region glycosylation. This can be achieved either by selecting antibodies that do not contain the glycosylation motif in the variable region or by mutating residues within the glycosylation region.
- the antibodies described herein do not contain asparagine isomerism sites.
- the deamidation of asparagine may occur on N-G or D-G sequences and result in the creation of an isoaspartic acid residue that introduces a kink into the polypeptide chain and decreases its stability (isoaspartic acid effect).
- the amino acid sequence Asp-Gly is present in the heavy and/or light chain CDR sequences of the antibody, the sequence is substituted with an amino acid sequence that does not undergo isomerization.
- the antibody comprises the heavy chain variable region CDR2 sequence set forth in SEQ ID NO: 76, but wherein the Asp or Gly in the Asp-Gly sequence (LISY DG SRKHYADSVKG; SEQ ID NO: 76) is replaced with an amino acid sequence that does not undergo isomerization, for example, an Asp-Ser or a Ser-Gly sequence.
- the antibody comprises the heavy chain variable region CDR2 sequence set forth in SEQ ID NO: 88, but wherein the Asp or Gly in the Asp-Gly sequence (AIDT DG GTFYADSVRG; SEQ ID NO: 88) is replaced with an amino acid sequence that does not undergo isomerization, for example, a Ser-Gly, an Asp-Ala, or a Ser-Thr sequence.
- Each antibody will have a unique isoelectric point (pI), which generally falls in the pH range between 6 and 9.5.
- the pI for an IgG1 antibody typically falls within the pH range of 7-9.5 and the pI for an IgG4 antibody typically falls within the pH range of 6-8.
- pI isoelectric point
- an anti-OX40 antibody that contains a pI value that falls in the normal range. This can be achieved either by selecting antibodies with a pI in the normal range or by mutating charged surface residues.
- each antibody will have a characteristic melting temperature, with a higher melting temperature indicating greater overall stability in vivo (Krishnamurthy R and Manning M C (2002) Curr Pharm Biotechnol 3:361-71).
- the T M1 the temperature of initial unfolding
- the melting point of an antibody can be measured using differential scanning calorimetry (Chen et al (2003) Pharm Res 20:1952-60; Ghirlando et al (1999) Immunol Lett 68:47-52) or circular dichroism (Murray et al. (2002) J. Chromatogr Sci 40:343-9).
- antibodies are selected that do not degrade rapidly. Degradation of an antibody can be measured using capillary electrophoresis (CE) and MALDI-MS (Alexander A J and Hughes D E (1995) Anal Chem 67:3626-32).
- CE capillary electrophoresis
- MALDI-MS Alexander A J and Hughes D E (1995) Anal Chem 67:3626-312.
- the anti-OX40 antibodies disclosed herein e.g., the OX40.21 antibody have increased stability.
- antibodies are selected that have minimal aggregation effects, which can lead to the triggering of an unwanted immune response and/or altered or unfavorable pharmacokinetic properties.
- antibodies are acceptable with aggregation of 25% or less, preferably 20% or less, even more preferably 15% or less, even more preferably 10% or less and even more preferably 5% or less.
- Aggregation can be measured by several techniques, including size-exclusion column (SEC), high performance liquid chromatography (HPLC), and light scattering.
- anti-OX40 antibodies having V H and V L sequences disclosed herein can be used to create new anti-OX40 antibodies by modifying the VH and/or VL sequences, or the constant region(s) of the antibodies.
- the structural features of anti-OX40 antibodies described herein e.g. 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1 are used to create structurally related anti-OX40 antibodies that retain at least one functional property of the antibodies described herein, such as binding to human OX40 and cynomolgus OX40.
- one or more CDR regions of 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1, or mutations thereof can be combined recombinantly with known framework regions and/or other CDRs to create additional, recombinantly-engineered, anti-OX40 antibodies, as discussed above.
- Other types of modifications include those described in the previous section.
- the starting material for the engineering method is one or more of the V H and/or V L sequences provided herein, or one or more CDR regions thereof.
- the engineered antibody it is not necessary to actually prepare (i.e., express as a protein) an antibody having one or more of the V H and/or V L sequences provided herein, or one or more CDR regions thereof. Rather, the information contained in the sequence(s) is used as the starting material to create a “second generation” sequence(s) derived from the original sequence(s) and then the “second generation” sequence(s) is prepared and expressed as a protein.
- a heavy chain variable region antibody sequence comprising a CDR1 sequence selected from the group consisting of SEQ ID NOs: 11, 19, 31, 39, 51, 59, 67, 75, and 87, a CDR2 sequence selected from the group consisting of SEQ ID NOs: 12, 20, 32, 40, 52, 60, 68, 76, 88, and 317 and/or a CDR3 sequence selected from the group consisting of SEQ ID NOs: 13, 21, 33, 41, 53, 61, 69, 77, and 89; and (ii) a light chain variable region antibody sequence comprising a CDR1 sequence selected from the group consisting of SEQ ID NOs: 14, 22, 25, 34, 42, 45, 54, 62, 70, 78, 81, and 90, a CDR2 sequence selected from the group consisting of SEQ ID NOs: 15, 23, 26, 35, 43, 46, 55, 63, 71, 79, 82, and 91, and/or a CDR3 sequence selected
- Standard molecular biology techniques can be used to prepare and express the altered antibody sequence.
- the antibody encoded by the altered antibody sequence(s) is one that retains one, some or all of the functional properties of the anti-OX40 antibodies described herein, which include,
- mutations can be introduced randomly or selectively along all or part of an anti-OX40 antibody coding sequence and the resulting modified anti-OX40 antibodies can be screened for binding activity and/or other functional properties as described herein.
- Mutational methods have been described in the art.
- PCT Publication WO 02/092780 by Short describes methods for creating and screening antibody mutations using saturation mutagenesis, synthetic ligation assembly, or a combination thereof.
- PCT Publication WO 03/074679 by Lazar et al. describes methods of using computational screening methods to optimize physiochemical properties of antibodies.
- nucleic acid molecules that encode the antibodies described herein.
- the nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
- a nucleic acid is “isolated” or “rendered substantially pure” when purified away from other cellular components or other contaminants, e.g., other cellular nucleic acids (e.g., other chromosomal DNA, e.g., the chromosomal DNA that is linked to the isolated DNA in nature) or proteins, by standard techniques, including alkaline/SDS treatment, CsCl banding, column chromatography, restriction enzymes, agarose gel electrophoresis and others well known in the art. See, F.
- a nucleic acid can be, for example, DNA or RNA and may or may not contain intronic sequences. In a certain embodiments, the nucleic acid is a cDNA molecule.
- Nucleic acids provided herein can be obtained using standard molecular biology techniques.
- hybridomas e.g., hybridomas prepared from transgenic mice carrying human immunoglobulin genes as described further below
- cDNAs encoding the light and heavy chains of the antibody made by the hybridoma can be obtained by standard PCR amplification or cDNA cloning techniques.
- nucleic acid encoding the antibody can be recovered from the library.
- Preferred nucleic acids molecules are those encoding the VH and VL sequences of 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1.
- Exemplary DNA sequences encoding the VH sequences of 3F4, 14B6, 23H3, 6E1, 18E9, 8B11, 20B3, 14A2, and 20C1 are set forth in SEQ ID NOs: 126, 128, 131, 133, 136, 138, 140, 142, and 145, respectively.
- Exemplary DNA sequences encoding the VL sequences of 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1 are set forth in SEQ ID NOs: 127, 129, 130, 132, 134, 135, 137, 139, 141, 143, 144, and 146, respectively.
- Exemplary DNA sequences encoding heavy chain sequences are set forth in SEQ ID NOs: 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, 167, 169171, 173, 175, 176, and 177.
- Exemplary DNA sequences encoding light chain sequences are set forth in SEQ ID NOs: 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, and 174.
- Exemplary nucleotide sequences encoding the mature VH and VL domains of an anti-OX40 antibody are set forth in SEQ ID NOs: 145 and 146, respectively.
- An exemplary nucleotide sequence encoding the heavy chain of an anti-OX40 antibody is set forth in SEQ ID NO: 177.
- An exemplary nucleotide sequence encoding the light chain of an OX40 antibody is set forth in SEQ ID NO: 168.
- Methods for making the anti-OX40 antibodies provided herein can include expressing the heavy chain and the light chains in a cell line comprising the nucleotide sequences encoding the heavy and light chains with a signal peptide. Host cells comprising these nucleotide sequences are also provided herein.
- VH and VL segments are obtained, these DNA fragments can be further manipulated by standard recombinant DNA techniques, for example to convert the variable region genes to full-length antibody chain genes, to Fab fragment genes or to a scFv gene.
- a VL- or VH-encoding DNA fragment is operatively linked to another DNA fragment encoding another protein, such as an antibody constant region or a flexible linker.
- the isolated DNA encoding the VH region can be converted to a full-length heavy chain gene by operatively linking the VH-encoding DNA to another DNA molecule encoding heavy chain constant regions (hinge, CH1, CH2 and/or CH3).
- heavy chain constant regions hinge, CH1, CH2 and/or CH3.
- the sequences of human heavy chain constant region genes are known in the art (see e.g., Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification.
- the heavy chain constant region can be an IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM or IgD constant region, for example, an IgG1 region.
- the VH-encoding DNA can be operatively linked to another DNA molecule encoding only the heavy chain CH1 constant region.
- the isolated DNA encoding the VL region can be converted to a full-length light chain gene (as well as a Fab light chain gene) by operatively linking the VL-encoding DNA to another DNA molecule encoding the light chain constant region, CL.
- the sequences of human light chain constant region genes are known in the art (see e.g., Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification.
- the light chain constant region can be a kappa or lambda constant region.
- the VH- and VL-encoding DNA fragments are operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gly 4 -Ser) 3 , such that the VH and VL sequences can be expressed as a contiguous single-chain protein, with the VL and VH regions joined by the flexible linker (see e.g., Bird et al. (1988) Science 242:423-426; Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883; McCafferty et al., (1990) Nature 348:552-554).
- a flexible linker e.g., encoding the amino acid sequence (Gly 4 -Ser) 3
- nucleic acid molecules encoding VH and VL sequences that are homologous to those of the 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1 monoclonal antibodies.
- nucleic acid molecules encode VH and VL sequences that are at least 70% identical, for example, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical, to nucleic acid molecules encoding the VH and VL sequences of the 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1 monoclonal antibodies.
- nucleic acid molecules with conservative substitutions i.e., substitutions that do not alter the resulting amino acid sequence upon translation of nucleic acid molecule, e.g., for codon optimization.
- Anti-OX40 antibodies described herein can be produced using a variety of known techniques, such as the standard somatic cell hybridization technique described by Kohler and Milstein, Nature 256: 495 (1975). Although somatic cell hybridization procedures are preferred, in principle, other techniques for producing monoclonal antibodies also can be employed, e.g., viral or oncogenic transformation of B lymphocytes, phage display technique using libraries of human antibody genes.
- hybridomas The preferred animal system for preparing hybridomas is the murine system.
- Hybridoma production in the mouse is a very well-established procedure. Immunization protocols and techniques for isolation of immunized splenocytes for fusion are known in the art. Fusion partners (e.g., murine myeloma cells) and fusion procedures are also known.
- Chimeric or humanized antibodies described herein can be prepared based on the sequence of a murine monoclonal antibody prepared as described above.
- DNA encoding the heavy and light chain immunoglobulins can be obtained from the murine hybridoma of interest and engineered to contain non-murine (e.g., human) immunoglobulin sequences using standard molecular biology techniques.
- the murine variable regions can be linked to human constant regions using methods known in the art (see e.g., U.S. Pat. No. 4,816,567 to Cabilly et al.).
- the murine CDR regions can be inserted into a human framework using methods known in the art (see e.g., U.S. Pat. No. 5,225,539 to Winter, and U.S. Pat. Nos. 5,530,101; 5,585,089; 5,693,762 and 6,180,370 to Queen et al.).
- the antibodies described herein are human monoclonal antibodies.
- Such human monoclonal antibodies directed against OX40 can be generated using transgenic or transchromosomic mice carrying parts of the human immune system rather than the mouse system.
- transgenic and transchromosomic mice include mice referred to herein as HuMAb mice and KM mice, respectively, and are collectively referred to herein as “human Ig mice.”
- the HuMAb Mouse® (Medarex, Inc.) contains human immunoglobulin gene miniloci that encode unrearranged human heavy ( ⁇ and ⁇ ) and ⁇ light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous ⁇ and ⁇ chain loci (see e.g., Lonberg, et al. (1994) Nature 368(6474): 856-859). Accordingly, the mice exhibit reduced expression of mouse IgM or ⁇ , and in response to immunization, the introduced human heavy and light chain transgenes undergo class switching and somatic mutation to generate high affinity human IgG ⁇ monoclonal (Lonberg, N. et al. (1994), supra; reviewed in Lonberg, N.
- antibodies described herein are raised using a mouse that carries human immunoglobulin sequences on transgenes and transchomosomes, such as a mouse that carries a human heavy chain transgene and a human light chain transchromosome.
- KM mice a mouse that carries a human heavy chain transgene and a human light chain transchromosome.
- transgenic animal systems expressing human immunoglobulin genes are available in the art and can be used to raise anti-OX40 antibodies described herein.
- an alternative transgenic system referred to as the Xenomouse (Abgenix, Inc.) can be used; such mice are described in, for example, U.S. Pat. Nos. 5,939,598; 6,075,181; 6,114,598; 6, 150,584 and 6,162,963 to Kucherlapati et al.
- mice carrying both a human heavy chain transchromosome and a human light chain tranchromosome referred to as “TC mice” can be used; such mice are described in Tomizuka et al. (2000) Proc. Natl. Acad. Sci. USA 97:722-727.
- cows carrying human heavy and light chain transchromosomes have been described in the art (Kuroiwa et al. (2002) Nature Biotechnology 20:889-894) and can be used to raise anti-OX40 antibodies described herein.
- Additional mouse systems described in the art for raising human antibodies include (i) the VelocImmune® mouse (Regeneron Pharmaceuticals, Inc.), in which the endogenous mouse heavy and light chain variable regions have been replaced, via homologous recombination, with human heavy and light chain variable regions, operatively linked to the endogenous mouse constant regions, such that chimeric antibodies (human V/mouse C) are raised in the mice, and then subsequently converted to fully human antibodies using standard recombinant DNA techniques; and (ii) the MeMo® mouse (Merus Biopharmaceuticals, Inc.), in which the mouse contains unrearranged human heavy chain variable regions but a single rearranged human common light chain variable region.
- mice and use thereof to raise antibodies, are described in, for example, WO 2009/15777, US 2010/0069614, WO 2011/072204, WO 2011/097603, WO 2011/163311, WO 2011/163314, WO 2012/148873, US 2012/0070861 and US 2012/0073004.
- Human monoclonal antibodies described herein can also be prepared using phage display methods for screening libraries of human immunoglobulin genes. Such phage display methods for isolating human antibodies are established in the art. See for example: U.S. Pat. Nos. 5,223,409; 5,403,484; and U.S. Pat. No. 5,571,698 to Ladner et al.; U.S. Pat. Nos. 5,427,908 and 5,580,717 to Dower et al.; U.S. Pat. Nos. 5,969,108 and 6,172,197 to McCafferty et al.; and U.S. Pat. Nos. 5,885,793; 6,521,404; 6,544,731; 6,555,313; 6,582,915 and 6,593,081 to Griffiths et al.
- Human monoclonal antibodies described herein can also be prepared using SCID mice into which human immune cells have been reconstituted such that a human antibody response can be generated upon immunization.
- SCID mice into which human immune cells have been reconstituted such that a human antibody response can be generated upon immunization.
- Such mice are described in, for example, U.S. Pat. Nos. 5,476,996 and 5,698,767 to Wilson et al.
- transgenic or transchromosomal mice containing human immunoglobulin genes can be immunized with a purified or enriched preparation of the OX40 antigen and/or cells expressing OX40 or fragment thereof, as described for other antigens, for example, by Lonberg et al. (1994) Nature 368(6474): 856-859; Fishwild et al. (1996) Nature Biotechnology 14: 845-851 and WO 98/24884.
- mice can be immunized with DNA encoding human OX40 or fragment thereof.
- the mice will be 6-16 weeks of age upon the first infusion.
- a purified or enriched preparation (5-50 ⁇ g) of the recombinant OX40 antigen can be used to immunize the HuMAb mice intraperitoneally.
- mice can also be immunized with cells expressing OX40, e.g., a cell line, to promote immune responses.
- exemplary cell lines include OX40-overexpressing stable CHO and Raji cell lines.
- the HuMAb transgenic mice respond best when initially immunized intraperitoneally (IP) or subcutaneously (SC) with antigen in Ribi's adjuvant, followed by every other week IP/SC immunizations (up to a total of 10) with antigen in Ribi's adjuvant.
- IP intraperitoneally
- SC subcutaneously
- the immune response can be monitored over the course of the immunization protocol with plasma samples being obtained by retroorbital bleeds.
- the plasma can be screened by ELISA and FACS (as described below), and mice with sufficient titers of anti-OX40 human immunoglobulin can be used for fusions.
- Mice can be boosted intravenously with antigen 3 days before sacrifice and removal of the spleen and lymph nodes.
- mice are typically immunized for each antigen.
- HCo7, HCo12, and KM strains are used.
- both HCo7 and HCo12 transgene can be bred together into a single mouse having two different human heavy chain transgenes (HCo7/HCo12).
- splenocytes and/or lymph node cells from immunized mice can be isolated and fused to an appropriate immortalized cell line, such as a mouse myeloma cell line.
- an appropriate immortalized cell line such as a mouse myeloma cell line.
- the resulting hybridomas can be screened for the production of antigen-specific antibodies.
- single cell suspensions of splenic lymphocytes from immunized mice can be fused to Sp2/0 nonsecreting mouse myeloma cells (ATCC, CRL 1581) with 50% PEG.
- Cells are plated at approximately 2 ⁇ 10 5 in flat bottom microtiter plate, followed by a two week incubation in selective medium containing 10% fetal Clone Serum, 18% “653” conditioned media, 5% origen (IGEN), 4 mM L-glutamine, 1 mM sodium pyruvate, 5 mM HEPES, 0.055 mM 2-mercaptoethanol, 50 units/ml penicillin, 50 mg/ml streptomycin, 50 mg/ml gentamycin and 1 ⁇ HAT (Sigma). After approximately two weeks, cells can be cultured in medium in which the HAT is replaced with HT. Individual wells can then be screened by ELISA for human monoclonal IgM and IgG antibodies.
- the antibody secreting hybridomas can be replated, screened again, and if still positive for human IgG, the monoclonal antibodies can be subcloned at least twice by limiting dilution. The stable subclones can then be cultured in vitro to generate small amounts of antibody in tissue culture medium for characterization.
- selected hybridomas can be grown in two-liter spinner-flasks for monoclonal antibody purification.
- Supernatants can be filtered and concentrated before affinity chromatography with protein A-sepharose (Pharmacia, Piscataway, N.J.).
- Eluted IgG can be checked by gel electrophoresis and high performance liquid chromatography to ensure purity.
- the buffer solution can be exchanged into PBS, and the concentration can be determined by OD280 using 1.43 extinction coefficient.
- the antibodies can then be aliquoted and stored at ⁇ 80° C.
- Antibodies can be produced in a host cell transfectoma using, for example, a combination of recombinant DNA techniques and gene transfection methods as is well known in the art (Morrison, S. (1985) Science 229:1202).
- DNAs encoding partial or full-length light and heavy chains can be obtained by standard molecular biology techniques (e.g., PCR amplification or cDNA cloning using a hybridoma that expresses the antibody of interest) and the DNAs can be inserted into expression vectors such that the genes are operatively linked to transcriptional and translational control sequences.
- operatively linked is intended to mean that an antibody gene is ligated into a vector such that transcriptional and translational control sequences within the vector serve their intended function of regulating the transcription and translation of the antibody gene.
- the expression vector and expression control sequences are chosen to be compatible with the expression host cell used.
- the antibody light chain gene and the antibody heavy chain gene can be inserted into separate vector or both genes are inserted into the same expression vector.
- the antibody genes are inserted into the expression vector(s) by standard methods (e.g., ligation of complementary restriction sites on the antibody gene fragment and vector, or blunt end ligation if no restriction sites are present).
- the light and heavy chain variable regions of the antibodies described herein can be used to create full-length antibody genes of any antibody isotype by inserting them into expression vectors already encoding heavy chain constant and light chain constant regions of the desired isotype such that the V H segment is operatively linked to the C H segment(s) within the vector and the V L segment is operatively linked to the C L segment within the vector.
- the recombinant expression vector can encode a signal peptide that facilitates secretion of the antibody chain from a host cell.
- the antibody chain gene can be cloned into the vector such that the signal peptide is linked in-frame to the amino terminus of the antibody chain gene.
- the signal peptide can be an immunoglobulin signal peptide or a heterologous signal peptide (i.e., a signal peptide from a non-immunoglobulin protein).
- Exemplary signal sequences for use in antibody heavy and light chains include the signal sequences originally found in the anti-OX40 antibodies described herein.
- recombinant expression vectors may carry regulatory sequences that control the expression of the antibody chain genes in a host cell.
- regulatory sequence is intended to include promoters, enhancers and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of the antibody chain genes.
- Such regulatory sequences are described, for example, in Goeddel (Gene Expression Technology. Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990)). It will be appreciated by those skilled in the art that the design of the expression vector, including the selection of regulatory sequences, may depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc.
- Preferred regulatory sequences for mammalian host cell expression include viral elements that direct high levels of protein expression in mammalian cells, such as promoters and/or enhancers derived from cytomegalovirus (CMV), Simian Virus 40 (SV40), adenovirus, (e.g., the adenovirus major late promoter (AdMLP) and polyoma.
- CMV cytomegalovirus
- SV40 Simian Virus 40
- AdMLP adenovirus major late promoter
- nonviral regulatory sequences may be used, such as the ubiquitin promoter or ⁇ -globin promoter.
- regulatory elements composed of sequences from different sources such as the SR ⁇ promoter system, which contains sequences from the SV40 early promoter and the long terminal repeat of human T cell leukemia virus type 1 (Takebe, Y. et al. (1988) Mol. Cell. Biol. 8:466-472).
- recombinant expression vectors may carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes.
- the selectable marker gene facilitates selection of host cells into which the vector has been introduced (see, e.g., U.S. Pat. Nos. 4,399,216, 4,634,665 and 5,179,017, all by Axel et al.).
- the selectable marker gene confers resistance to drugs, such as G418, hygromycin or methotrexate, on a host cell into which the vector has been introduced.
- Preferred selectable marker genes include the dihydrofolate reductase (DHFR) gene (for use in dhfr ⁇ host cells with methotrexate selection/amplification) and the neo gene (for G418 selection).
- DHFR dihydrofolate reductase
- the expression vector(s) encoding the heavy and light chains is transfected into a host cell by standard techniques.
- the various forms of the term “transfection” are intended to encompass a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., electroporation, calcium-phosphate precipitation, DEAE-dextran transfection and the like.
- Preferred mammalian host cells for expressing the recombinant antibodies described herein include Chinese Hamster Ovary (CHO cells) (including dhfr ⁇ CHO cells, described in Urlaub and Chasin, (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in R. J. Kaufman and P. A. Sharp (1982) Mol. Biol. 159:601-621), NSO myeloma cells, COS cells and SP2 cells.
- Chinese Hamster Ovary CHO cells
- dhfr ⁇ CHO cells described in Urlaub and Chasin, (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in R. J. Kaufman and P. A. Sharp (1982) Mol. Biol. 159:601-621
- NSO myeloma cells
- another preferred expression system is the GS gene expression system disclosed in WO 87/04462, WO 89/01036 and EP 338,841.
- the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or, more preferably, secretion of the antibody into the culture medium in which the host cells are grown.
- Antibodies can be recovered from the culture medium using standard protein purification methods.
- the N- and C-termini of antibody polypeptide chains of the present invention may differ from the expected sequence due to commonly observed post-translational modifications.
- C-terminal lysine residues are often missing from antibody heavy chains.
- N-terminal glutamine residues, and to a lesser extent glutamate residues, are frequently converted to pyroglutamate residues on both light and heavy chains of therapeutic antibodies.
- Anti-OX40 antibodies described herein can be tested for binding to OX40 by, for example, standard ELISA. Briefly, microtiter plates are coated with purified OX40 at 1-2 ⁇ g/ml in PBS, and then blocked with 5% bovine serum albumin in PBS. Dilutions of antibody (e.g., dilutions of plasma from OX40-immunized mice) are added to each well and incubated for 1-2 hours at 37° C.
- the plates are washed with PBS/Tween and then incubated with secondary reagent (e.g., for human antibodies, a goat-anti-human IgG Fc-specific polyclonal reagent) conjugated to horseradish peroxidase (HRP) for 1 hour at 37° C.
- secondary reagent e.g., for human antibodies, a goat-anti-human IgG Fc-specific polyclonal reagent conjugated to horseradish peroxidase (HRP) for 1 hour at 37° C.
- HRP horseradish peroxidase
- ABTS substrate Moss Inc, product: ABTS-1000
- Sera from immunized mice are then further screened by flow cytometry for binding to a cell line expressing human OX40, but not to a control cell line that does not express OX40.
- the binding of anti-OX40 antibodies is assessed by incubating OX40 expressing CHO cells with the anti-OX40 antibody at 1:20 dilution. The cells are washed and binding is detected with a PE-labeled anti-human IgG Ab. Flow cytometric analyses are performed using a FACScan flow cytometry (Becton Dickinson, San Jose, Calif.). Preferably, mice which develop the highest titers will be used for fusions.
- An ELISA assay as described above can be used to screen for antibodies and, thus, hybridomas that produce antibodies that show positive reactivity with the OX40 immunogen.
- Hybridomas that produce antibodies that bind, preferably with high affinity, to OX40 can then be subcloned and further characterized.
- One clone from each hybridoma, which retains the reactivity of the parent cells (by ELISA), can then be chosen for making a cell bank, and for antibody purification.
- selected hybridomas can be grown in two-liter spinner-flasks for monoclonal antibody purification.
- Supernatants can be filtered and concentrated before affinity chromatography with protein A-sepharose (Pharmacia, Piscataway, N.J.).
- Eluted IgG can be checked by gel electrophoresis and high performance liquid chromatography to ensure purity.
- the buffer solution can be exchanged into PBS, and the concentration can be determined by OD 280 using 1.43 extinction coefficient.
- the monoclonal antibodies can be aliquoted and stored at ⁇ 80° C.
- each antibody can be biotinylated using commercially available reagents (Pierce, Rockford, Ill.). Biotinylated MAb binding can be detected with a streptavidin labeled probe. Competition studies using unlabeled monoclonal antibodies and biotinylated monoclonal antibodies can be performed using OX40 coated-ELISA plates as described above.
- isotype ELISAs can be performed using reagents specific for antibodies of a particular isotype. For example, to determine the isotype of a human monoclonal antibody, wells of microtiter plates can be coated with 1 ⁇ g/ml of anti-human immunoglobulin overnight at 4° C. After blocking with 1% BSA, the plates are reacted with 1 ⁇ g/ml or less of test monoclonal antibodies or purified isotype controls, at ambient temperature for one to two hours. The wells can then be reacted with either human IgG1 or human IgM-specific alkaline phosphatase-conjugated probes. Plates are developed and analyzed as described above.
- flow cytometry can be used, as described in the Examples. Briefly, cell lines expressing membrane-bound OX40 (grown under standard growth conditions) are mixed with various concentrations of monoclonal antibodies in PBS containing 0.1% BSA at 4° C. for 1 hour. After washing, the cells are reacted with Fluorescein-labeled anti-IgG antibody under the same conditions as the primary antibody staining. The samples can be analyzed by FACScan instrument using light and side scatter properties to gate on single cells and binding of the labeled antibodies is determined. An alternative assay using fluorescence microscopy may be used (in addition to or instead of) the flow cytometry assay. Cells can be stained exactly as described above and examined by fluorescence microscopy. This method allows visualization of individual cells, but may have diminished sensitivity depending on the density of the antigen.
- Anti-OX40 antibodies can be further tested for reactivity with the OX40 antigen by Western blotting. Briefly, cell extracts from cells expressing OX40 can be prepared and subjected to sodium dodecyl sulfate polyacrylamide gel electrophoresis. After electrophoresis, the separated antigens will be transferred to nitrocellulose membranes, blocked with 20% mouse serum, and probed with the monoclonal antibodies to be tested. IgG binding can be detected using anti-IgG alkaline phosphatase and developed with BCIP/NBT substrate tablets (Sigma Chem. Co., St. Louis, Mo.).
- Methods for analyzing binding affinity, cross-reactivity, and binding kinetics include standard assays known in the art, for example, BIACORE® SPR analysis using a BIACORE® 2000 SPR instrument (Biacore AB, Uppsala, Sweden).
- the anti-OX40 antibody specifically binds to the extracellular region of human OX40.
- the antibody may specifically bind to a particular domain (e.g., a functional domain) within the extracellular domain of OX40.
- the antibody specifically binds to the site on OX40 to which OX40-L binds.
- the antibody specifically binds to the extracellular region of human OX40 and the extracellular region of cynomolgus OX40.
- Anti-OX40 antibodies described herein can be used for diagnostic purposes, including sample testing and in vivo imaging, and for this purpose the antibody (or binding fragment thereof) can be conjugated to an appropriate detectable agent, to form an immunoconjugate.
- appropriate agents are detectable labels that include radioisotopes, for whole body imaging, and radioisotopes, enzymes, fluorescent labels and other suitable antibody tags for sample testing.
- the detectable labels can be any of the various types used currently in the field of in vitro diagnostics, including particulate labels including metal sols such as colloidal gold, isotopes such as I 125 or Tc 99 presented for instance with a peptidic chelating agent of the N 2 S 2 , N 3 S or N 4 type, chromophores including fluorescent markers, biotin, luminescent markers, phosphorescent markers and the like, as well as enzyme labels that convert a given substrate to a detectable marker, and polynucleotide tags that are revealed following amplification such as by polymerase chain reaction.
- a biotinylated antibody would then be detectable by avidin or streptavidin binding.
- Suitable enzyme labels include horseradish peroxidase, alkaline phosphatase and the like.
- the label can be the enzyme alkaline phosphatase, detected by measuring the presence or formation of chemiluminescence following conversion of 1,2 dioxetane substrates such as adamantyl methoxy phosphoryloxy phenyl dioxetane (AMPPD), disodium 3-(4-(methoxyspiro ⁇ 1,2-dioxetane-3,2′-(5′-chloro)tricyclo ⁇ 3.3.1.1 3,7 ⁇ decan ⁇ -4-yl) phenyl phosphate (CSPD), as well as CDP and CDP-Star® or other luminescent substrates well-known to those in the art, for example the chelates of suitable lanthanides such as Terbium(III) and Europium(III).
- AMPPD adamantyl methoxy phosphoryloxy phenyl dioxetane
- the detection means is determined by the chosen label. Appearance of the label or its reaction products can be achieved using the naked eye, in the case where the label is particulate and accumulates at appropriate levels, or using instruments such as a spectrophotometer, a luminometer, a fluorimeter, and the like, all in accordance with standard practice.
- conjugation methods result in linkages which are substantially (or nearly) non-immunogenic, e.g., peptide- (i.e. amide-), sulfide-, (sterically hindered), disulfide-, hydrazone-, and ether linkages.
- linkages are nearly non-immunogenic and show reasonable stability within serum (see e.g. Senter, P. D., Curr. Opin. Chem. Biol. 13 (2009) 235-244; WO 2009/059278; WO 95/17886).
- coupling to the C-terminal end of the antibody or moiety is performed.
- C-terminal modification of a protein e.g. of a Fab-fragment can e.g. be performed as described (Sunbul, M. and Yin, J., Org. Biomol. Chem. 7 (2009) 3361-3371).
- site specific reaction and covalent coupling is based on transforming a natural amino acid into an amino acid with a reactivity which is orthogonal to the reactivity of the other functional groups present.
- a specific cysteine within a rare sequence context can be enzymatically converted in an aldehyde (see Frese, M. A., and Dierks, T., ChemBioChem. 10 (2009) 425-427). It is also possible to obtain a desired amino acid modification by utilizing the specific enzymatic reactivity of certain enzymes with a natural amino acid in a given sequence context (see, e.g., Taki, M. et al., Prot. Eng. Des. Sel.
- Site specific reaction and covalent coupling can also be achieved by the selective reaction of terminal amino acids with appropriate modifying reagents.
- EP 1 074 563 describes a conjugation method which is based on the faster reaction of a cysteine within a stretch of negatively charged amino acids than a cysteine located in a stretch of positively charged amino acids.
- the moiety may also be a synthetic peptide or peptide mimic.
- a polypeptide is chemically synthesized, amino acids with orthogonal chemical reactivity can be incorporated during such synthesis (see e.g. de Graaf et al., Bioconjug. Chem. 20 (2009) 1281-1295). Since a great variety of orthogonal functional groups is at stake and can be introduced into a synthetic peptide, conjugation of such peptide to a linker is standard chemistry.
- the conjugate with 1:1 stoichiometry may be separated by chromatography from other conjugation side-products.
- This procedure can be facilitated by using a dye labeled binding pair member and a charged linker.
- mono conjugated polypeptides are easily separated from non-labeled polypeptides and polypeptides which carry more than one linker, since the difference in charge and molecular weight can be used for separation.
- the fluorescent dye can be useful for purifying the complex from un-bound components, like a labeled monovalent binder.
- the moiety attached to the anti-OX40 antibody is selected from the group consisting of a binding moiety, a labeling moiety, and a biologically active moiety.
- Anti-OX40 antibodies described herein also may be conjugated to a therapeutic agent to form an immunoconjugate such as an antibody-drug conjugate (ADC).
- Suitable therapeutic agents include antimetabolites, alkylating agents, DNA minor groove binders, DNA intercalators, DNA crosslinkers, histone deacetylase inhibitors, nuclear export inhibitors, proteasome inhibitors, topoisomerase I or II inhibitors, heat shock protein inhibitors, tyrosine kinase inhibitors, antibiotics, and anti-mitotic agents.
- the antibody and therapeutic agent preferably are conjugated via a linker cleavable such as a peptidyl, disulfide, or hydrazone linker.
- the linker is a peptidyl linker such as Val-Cit, Ala-Val, Val-Ala-Val, Lys-Lys, Pro-Val-Gly-Val-Val (SEQ ID NO: 180), Ala-Asn-Val, Val-Leu-Lys, Ala-Ala-Asn, Cit-Cit, Val-Lys, Lys, Cit, Ser, or Glu.
- the ADCs can be prepared as described in U.S. Pat. Nos.
- the antibody is conjugated to a drug, with the antibody functioning as a targeting agent for directing the ADC to a target cell expressing its antigen, such as a cancer cell.
- the antigen is a tumor associated antigen, i.e., one that is uniquely expressed or overexpressed by the cancer cell.
- the drug is released, either inside the target cell or in its vicinity, to act as a therapeutic agent.
- the drug preferably is a cytotoxic drug that causes death of the targeted cancer cell.
- Cytotoxic drugs that can be used in ADCs include the following types of compounds and their analogs and derivatives:
- an ADC may analyze for a non-integer DAR, reflecting a statistical average.
- the architecture of an ADC may be represented by the following formula:
- n 1, 2, or 3.
- the linker contains a cleavable group that is cleaved inside or in the vicinity of the target cell, to release the drug. In other embodiments, the linker does not contain a cleavable group but, rather, the ADC relies on catabolism of the antibody to release the drug.
- cleavable group is a pH sensitive group.
- the pH in blood plasma is slightly above neutral, while the pH inside a lysosome—where most ADCs end up after internalization inside a target cell—is acidic, circa 5.
- acid-sensitive groups include cis-aconityl amides and hydrazones, as described in Shen et al., U.S. Pat. No. 4,631,190 (1986); Shen et al., U.S. Pat. No.
- the cleavable group is a disulfide.
- Disulfides can be cleaved by a thiol-disulfide exchange mechanism, at a rate dependent on the ambient thiol concentration. As the intracellular concentration of glutathione and other thiols is higher than their serum concentrations, the cleavage rate of a disulfide will be higher intracellularly, i.e., after internalization of the ADC.
- the rate of thiol-disulfide exchange can be modulated by adjustment of the steric and electronic characteristics of the disulfide (e.g., an alkyl-aryl disulfide versus an alkyl-alkyl disulfide; substitution on the aryl ring, etc.), enabling the design of disulfide linkages that have enhanced serum stability or a particular cleavage rate.
- disulfide cleavable groups in conjugates see, e.g., Thorpe et al., Cancer Res. 1988, 48, 6396; Santi et al., U.S. Pat. No. 7,541,530 B2 (2009); Ng et al., U.S.
- a preferred cleavable group is a peptide that is cleaved selectively by a protease inside the target cell, as opposed to by a protease in the serum.
- a cleavable peptide group comprises from 1 to 20 amino acids, preferably from 1 to 6 amino acids, more preferably from 1 to 3 amino acids.
- the amino acid(s) can be natural and/or non-natural ⁇ -amino acids. Natural amino acids are those encoded by the genetic code, as well as amino acids derived therefrom, e.g., hydroxyproline, ⁇ -carboxyglutamate, citrulline, and O-phosphoserine.
- amino acid also includes amino acid analogs and mimetics.
- Analogs are compounds having the same general H 2 N(R)CHCO 2 H structure of a natural amino acid, except that the R group is not one found among the natural amino acids.
- Examples of analogs include homoserine, norleucine, methionine-sulfoxide, and methionine methyl sulfonium.
- An amino acid mimetic is a compound that has a structure different from the general chemical structure of an ⁇ -amino acid but functions in a manner similar to one.
- the amino acid can be of the “L” stereochemistry of the genetically encoded amino acids, as well as of the enantiomeric “D” stereochemistry.
- a cleavable peptide group comprises an amino acid sequence selected for cleavage by an endosomal or lysosomal protease, especially the latter.
- proteases include cathepsins B, C, D, H, L and S, especially cathepsin B.
- Cathepsin B preferentially cleaves peptides at a sequence -AA 2 -AA 1 - where AA 1 is a basic or strongly hydrogen bonding amino acid (such as lysine, arginine, or citrulline) and AA 2 is a hydrophobic amino acid (such as phenylalanine, valine, alanine, leucine, or isoleucine), for example Val-Cit (where Cit denotes citrulline) or Val-Lys, written in the N-to-C direction.
- AA 1 is a basic or strongly hydrogen bonding amino acid (such as lysine, arginine, or citrulline)
- AA 2 is a hydrophobic amino acid (such as phenylalanine, valine, alanine, leucine, or isoleucine)
- Val-Cit where Cit denotes citrulline
- Val-Lys written in the N-to-C direction.
- Another enzyme that can be utilized for cleaving peptidyl linkers is legumain, a lysosomal cysteine protease that preferentially cleaves at Ala-Ala-Asn.
- the linker in ADCs comprises a di- or tripeptide that is preferentially cleaved by a protease located inside the target cell.
- the di- or tripeptide is cleavable by cathepsin B, more preferably a Val-Cit or Val-Lys dipeptide.
- Single amino acid cleavable peptide groups also can be used, as disclosed in Chen et al., US 2010/0113476 A1 (2010), the disclosure of which is incorporated herein by reference.
- the cleavable group can be chosen such that it is cleaved by a protease present in the extracellular matrix in the vicinity of the target cell, e.g., a protease released by nearby dying cells or a tumor-associated protease.
- a protease present in the extracellular matrix in the vicinity of the target cell
- exemplary extracellular tumor-associated proteases are matrix metalloproteases (MMP), plasmin, thimet oligopeptidase (TOP) and CD10.
- the linker can further include a self-immolating moiety located adjacent to a cleavable peptide group.
- the self-immolating group serves as a spacer that prevents the antibody and/or the drug moiety from sterically interfering with the cleavage of the peptide group by a protease but thereafter spontaneously releases itself (i.e., self-immolates) so as to not interfere with the action of the drug.
- a self-immolating moiety located adjacent to a cleavable peptide group.
- the self-immolating group serves as a spacer that prevents the antibody and/or the drug moiety from sterically interfering with the cleavage of the peptide group by a protease but thereafter spontaneously releases itself (i.e., self-immolates) so as to not interfere with the action of the drug.
- a preferred self-immolating group is a p-aminobenzyl oxycarbonyl (PABC) group, whose structure and mechanism of action is depicted below:
- an ADC has a linker comprising a di- or tripeptide that is preferentially cleaved by a protease located inside the target cell and, adjacent to the di- or tripeptide, a self-immolating group.
- the di- or tripeptide is cleavable by cathepsin B.
- the self-immolating group is a PABC group.
- an ⁇ -amino group in the side chain of a lysine residue in the antibody is reacted with 2-iminothiolane to introduce a free thiol (—SH) group.
- the thiol group can react with a maleimide or other nucleophile acceptor group to effect conjugation, as illustrated below:
- an antibody of this invention has one or more lysine residues (preferably two or three) modified by reaction with iminothiolane.
- An alternative conjugation technique employs copper-free “click chemistry,” in which an azide group adds across the strained alkyne bond of a cyclooctyne to form an 1,2,3-triazole ring. See, e.g., Agard et al., J. Amer. Chem. Soc. 2004, 126, 15046; Best, Biochemistry 2009, 48, 6571, the disclosures of which are incorporated herein by reference.
- the azide can be located on the antibody and the cyclooctyne on the drug moiety, or vice-versa.
- a preferred cyclooctyne group is dibenzocyclooctyne (DIBO).
- DIBO dibenzocyclooctyne
- Various reagents having a DIBO group are available from Invitrogen/Molecular Probes, Eugene, Oreg. The reaction below illustrates click chemistry conjugation for the instance in which the DIBO group is attached to the antibody:
- the linker comprises a 1,2,3-triazole ring.
- Yet another conjugation technique involves introducing a non-natural amino acid into an antibody, with the non-natural amino acid providing a functionality for conjugation with a reactive functional group in the drug moiety.
- the non-natural amino acid p-acetylphenylalanine can be incorporated into an antibody or other polypeptide, as taught in Tian et al., WO 2008/030612 A2 (2008).
- the ketone group in p-acetylphenylalanine can be a conjugation site by the formation of an oxime with a hydroxylamino group on the linker-drug moiety.
- non-natural amino acid p-azidophenylalanine can be incorporated into an antibody to provide an azide functional group for conjugation via click chemistry, as discussed above.
- Non-natural amino acids can also be incorporated into an antibody or other polypeptide using cell-free methods, as taught in Goerke et al., US 2010/0093024 A1 (2010) and Goerke et al., Biotechnol. Bioeng. 2009, 102 (2), 400-416. The foregoing disclosures are incorporated herein by reference.
- the antibody has one or more amino acids replaced by a non-natural amino acid, which preferably is p-acetylphenylalanine or p-azidophenylalanine, more preferably p-acetylphenylalanine.
- Still another conjugation technique uses the enzyme transglutaminase (preferably bacterial transglutaminase or BTG), as taught in Jeger et al., Angew. Chem. Int. Ed. 2010, 49, 9995.
- BTG forms an amide bond between the side chain carboxamide of a glutamine and an alkyleneamino group, which can be, for example, the ⁇ -amino group of a lysine or a 5-amino-n-pentyl group.
- the glutamine residue is located on the antibody, while the alkyleneamino group is located on the linker-drug moiety, as shown below:
- the positioning of a glutamine residue on a polypeptide chain has a large effect on its susceptibility to BTG mediated transamidation. None of the glutamine residues on an antibody are normally BTG substrates. However, if the antibody is deglycosylated—the glycosylation site being asparagine 297 (N297)—nearby glutamine 295 (Q295) is rendered BTG susceptible. Alternatively, an antibody can be synthesized glycoside free by introducing an N297A mutation in the constant region, to eliminate the N297 glycosylation site.
- an N297Q substitution in an antibody not only eliminates glycosylation, but also introduces a second glutamine residue (at position 297) that too is susceptible BTG-mediated transamidation.
- the anti-OX40 antibody is deglycosylated.
- the anti-OX40 antibody has an N297Q substitution.
- Sortase A is taught in Levary et al., PLoS One 2011, 6(4), e18342; Proft, Biotechnol. Lett. 2010, 32, 1-10; Ploegh et al., WO 2010/087994 A2 (2010); and Mao et al., WO 2005/051976 A2 (2005), the disclosures of which are incorporated herein by reference.
- the Sortase A recognition motif typically LPXTG (SEQ ID NO: 181), where X is any natural amino acid
- GGG nucleophilic acceptor motif
- Anti-OX40 antibodies described herein also can be used for detecting OX40, such as human OX40, e.g., human OX40 in tissues or tissue samples.
- the antibodies may be used, e.g., in an ELISA assay or in flow cytometry.
- the anti-OX40 antibody is contacted with cells, e.g., cells in a tissue, for a time appropriate for specific binding to occur, and then a reagent, e.g., an antibody that detects the anti-OX40 antibody, is added. Exemplary assays are provided in the Examples.
- the anti-OX40 antibody may be a fully human antibody, or it may be a chimeric antibody, such as an antibody having human variable regions and murine constant regions or a portion thereof.
- Exemplary methods for detecting OX40, e.g., human OX40, in a sample (cell or tissue sample) comprise (i) contacting a sample with an anti-OX40 antibody, for a time sufficient for allowing specific binding of the anti-OX40 antibody to OX40 in the sample, and (2) contacting the sample with a detection reagent, e.g., an antibody, that specifically binds to the anti-OX40 antibody, such as to the Fc region of the anti-OX40 antibody, to thereby detect OX40 bound by the anti-OX40 antibody. Wash steps may be included after the incubation with the antibody and/or detection reagent.
- Anti-OX40 antibodies for use in these methods do not have to be linked to a label or detection agents, as a separate detection agent can be used.
- Anti-OX40 antibodies described herein may be used for forming bispecific molecules.
- the antibody, or antigen-binding portions thereof can be derivatized or linked to another functional molecule, e.g., another peptide or protein (e.g., another antibody or ligand for a receptor) to generate a bispecific molecule that binds to at least two different binding sites or target molecules.
- the anti-OX40 antibody may be linked to an antibody or scFv that binds specifically to any protein that may be used as potential targets for combination treatments, such as the proteins described herein (e.g., antibodies to PD-1, PD-L1, or LAG-3).
- the antibody may be derivatized or linked to more than one other functional molecule to generate multispecific molecules that bind to more than two different binding sites and/or target molecules.
- multispecific molecules are also intended to be encompassed by the term “bispecific molecule” as used herein.
- the anti-OX40 antibody can be functionally linked (e.g., by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other binding molecules, such as another antibody, antibody fragment, peptide or binding mimetic, such that a bispecific molecule results.
- bispecific molecules comprising at least one first binding specificity for OX40 and a second binding specificity for a second target epitope.
- the bispecific molecule is multispecific, e.g., the molecule further includes a third binding specificity.
- the bispecific molecules comprises as a binding specificity at least one antibody, or an antibody fragment thereof, including, e.g., an Fab, Fab′, F(ab′) 2 , Fv, or a single chain Fv (scFv).
- the antibody may also be a light chain or heavy chain dimer, or any minimal fragment thereof such as a Fv or a single chain construct as described in Ladner et al. U.S. Pat. No. 4,946,778, the contents of which is expressly incorporated by reference.
- human monoclonal antibodies are preferred, other antibodies can be employed in the bispecific molecules described herein, including, e.g., murine, chimeric and humanized antibodies.
- Bispecific molecules provided herein can be prepared by conjugating the constituent binding specificities using methods known in the art. For example, each binding specificity of the bispecific molecule can be generated separately and then conjugated to one another. When the binding specificities are proteins or peptides, a variety of coupling or cross-linking agents can be used for covalent conjugation.
- cross-linking agents examples include protein A, carbodiimide, N-succinimidyl-S-acetyl-thioacetate (SATA), 5,5′-dithiobis(2-nitrobenzoic acid) (DTNB), o-phenylenedimaleimide (oPDM), N-succinimidyl-3-(2-pyridyldithio)propionate (SPDP), and sulfosuccinimidyl 4-(N-maleimidomethyl) cyclohaxane-1-carboxylate (sulfo-SMCC) (see e.g., Karpovsky et al. (1984) J. Exp. Med.
- Preferred conjugating agents are SATA and sulfo-SMCC, both available from Pierce Chemical Co. (Rockford, Ill.).
- the binding specificities are antibodies, they can be conjugated via sulfhydryl bonding of the C-terminus hinge regions of the two heavy chains.
- the hinge region is modified to contain an odd number of sulfhydryl residues, preferably one, prior to conjugation.
- both binding specificities can be encoded in the same vector and expressed and assembled in the same host cell.
- This method is particularly useful where the bispecific molecule is a mAb ⁇ mAb, mAb ⁇ Fab, mAb ⁇ (scFv) 2 , Fab ⁇ F(ab′) 2 or ligand ⁇ Fab fusion protein.
- a bispecific antibody may comprise an antibody comprising an scFv at the C-terminus of each heavy chain.
- a bispecific molecule described herein can be a single chain molecule comprising one single chain antibody and a binding determinant, or a single chain bispecific molecule comprising two binding determinants. Bispecific molecules may comprise at least two single chain molecules. Methods for preparing bispecific molecules are described for example in U.S. Pat. No.
- Binding of the bispecific molecules to their specific targets can be confirmed using art-recognized methods, such as enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), FACS analysis, bioassay (e.g., growth inhibition), or Western Blot assay.
- ELISA enzyme-linked immunosorbent assay
- RIA radioimmunoassay
- FACS analysis bioassay (e.g., growth inhibition)
- bioassay e.g., growth inhibition
- Western Blot assay Western Blot assay.
- Each of these assays generally detects the presence of protein-antibody complexes of particular interest by employing a labeled reagent (e.g., an antibody) specific for the complex of interest.
- a labeled reagent e.g., an antibody
- compositions e.g., a pharmaceutical compositions, containing one or more anti-OX40 antibodies, alone or in combination with antibodies to other targets, formulated together with a pharmaceutically acceptable carrier.
- Such compositions may include one or a combination of (e.g., two or more different) antibodies, or immunoconjugates or bispecific molecules described herein.
- the composition can comprise a combination of antibodies (or immunoconjugates or bispecifics) described herein that bind to different epitopes on OX40 or that have complementary activities.
- the composition comprises an anti-OX40 antibody at a concentration of at least 1 mg/ml, 5 mg/ml, 10 mg/ml, 50 mg/ml, 100 mg/ml, 150 mg/ml, 200 mg/ml, 1-300 mg/ml, or 100-300 mg/ml.
- compositions described herein also can be administered in combination therapies, i.e., combined with other agents.
- the combination therapy can include administration of an anti-OX40 antibody described herein combined with at least one other anti-cancer and/or T-cell stimulating (e.g., activating) agent.
- T-cell stimulating e.g., activating
- therapeutic agents that can be used in combination therapy are described in greater detail below in the section on uses of the antibodies described herein.
- therapeutic compositions disclosed herein include other compounds, drugs, and/or agents used for the treatment of cancer.
- Such compounds, drugs, and/or agents can include, for example, chemotherapy drugs, small molecule drugs or antibodies that stimulate the immune response to a given cancer.
- therapeutic compositions can include, for example, one or more of an anti-CTLA-4 antibody, an anti-PD-1 antibody, an anti-PDL-1 antibody, an anti-GITR antibody, an anti-CD137 antibody, or an anti-LAG-3 antibody.
- “pharmaceutically acceptable carriers” include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion).
- the active compound i.e., antibody, immunoconjugate, or bispecific molecule
- the active compound i.e., antibody, immunoconjugate, or bispecific molecule, may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
- compositions described herein may include one or more pharmaceutically acceptable salts.
- a “pharmaceutically acceptable salt” refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S. M., et al. (1977) J. Pharm. Sci. 66:1-19). Examples of such salts include acid addition salts and base addition salts.
- Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like.
- nontoxic inorganic acids such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like
- nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like.
- Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N′-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
- compositions described herein also may include a pharmaceutically acceptable anti-oxidant.
- pharmaceutically acceptable antioxidants include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
- water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like
- oil-soluble antioxidants such as ascorbyl palmitate, butylated hydroxy
- aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
- vegetable oils such as olive oil
- injectable organic esters such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures, supra, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
- Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- the use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions described herein is contemplated.
- a pharmaceutical composition may comprise a preservative or may be devoid of a preservative. Supplementary active compounds can be incorporated into the compositions.
- compositions typically must be sterile and stable under the conditions of manufacture and storage.
- the composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated herein.
- the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration.
- the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred percent, this amount will range from about 0.01 percent to about ninety-nine percent of active ingredient, preferably from about 0.1 percent to about 70 percent, most preferably from about 1 percent to about 30 percent of active ingredient in combination with a pharmaceutically acceptable carrier.
- Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
- Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms described herein are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
- the dosage ranges from about 0.0001 to 100 mg/kg, about 0.01 to 5 mg/kg, about 0.01 to 10 mg/kg, about 0.1 to 1 mg/kg, about 0.1 to 0.5 mg/kg, or about 0.5 to 0.8 mg/kg of the host body weight.
- dosages can be 0.2 mg/kg body weight, 0.3 mg/kg body weight, 0.5 mg/kg body weight, 1 mg/kg body weight, 3 mg/kg body weight, 5 mg/kg body weight or 10 mg/kg body weight or within the range of 1-10 mg/kg.
- the dosage is 0.2 mg/kg.
- the dosage is 0.25 mg/kg.
- the dosage is 0.5 mg/kg.
- An exemplary treatment regime entails administration once per week, once every two weeks, once every three weeks, once every four weeks, once a month, once every 3 months or once every three to 6 months.
- Exemplary dosage regimens for the antibodies described herein include 1 mg/kg body weight or 3 mg/kg body weight via intravenous administration, with the antibody being given using one of the following dosing schedules: (i) every four weeks for six dosages, then every three months; (ii) every three weeks; (iii) 3 mg/kg body weight once followed by 1 mg/kg body weight every three weeks.
- the antibodies are administered at a fixed dose.
- the anti-OX40 antibody is administered at a fixed dose of about 25 to about 320 mg, for example, about 25 to about 160 mg, about 25 to about 80 mg, about 25 to about 40 mg, about 40 to about 320 mg, about 40 to about 160 mg, about 40 to about 80 mg, about 80 to about 320 mg, about 30 to about 160 mg, or about 160 to about 320 mg.
- the anti-OX40 antibody is administered at a dose of 20 mg or about 20 mg.
- the anti-OX40 antibody is administered at a dose of 40 mg or about 40 mg.
- the anti-OX40 antibody is administered at a dose of 80 mg or about 80 mg. In another embodiment, the anti-OX40 antibody is administered at a dose of 160 mg or about 160 mg. In another embodiment, the anti-OX40 antibody is administered at a dose of 320 mg or about 320 mg.
- the anti-PD-1 antibody is administered at a fixed dose of about 100 to 300 mg,
- the dosage of the immuno-oncology agent can be 240 mg or about 240 mg, 360 mg or about 360 mg, or 480 mg or about 480 mg.
- the dose of the anti-PD1 antibody ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg, of the host body weight.
- dosages can be 0.3 mg/kg body weight or about 0.3 mg/kg body weight, 1 mg/kg body weight or about 1 mg/kg body weight, 3 mg/kg body weight or about 3 mg/kg body weight, 5 mg/kg body weight or about 5 mg/kg body weight, or 10 mg/kg body weight or about 10 mg/kg body weight, or within the range of 1-10 mg/kg.
- the dosage of the anti-PD-1 antibody is 240 mg or about 240 mg administered once every 2 weeks (Q2W). This dosage can be adjusted proportionately (at 120 mg per week) for longer or shorter periods, e.g., 360 mg administered once every 3 weeks (Q3W) or 480 mg administered once every 4 weeks (Q4W).
- the anti-CTLA-4 antibody is administered at a dose of about 0.1 mg/kg to about 10 mg/kg.
- dosages can be 1 mg/kg or about 1 mg/kg or 3 mg/kg or about 3 mg/kg, of the host body weight.
- Exemplary dosage regimens for combination treatment with an anti-OX40 and anti-PD-1 or anti-CTLA-4 antibody are provided infra under the section titled “Uses and Methods.”
- the anti-OX40 antibody is administered to a patient with an infusion duration of about 15 minutes to about 60 minutes, for example, about 30 minutes.
- the anti-PD-1 antibody (e.g., nivolumab) is administered to a patient with an infusion duration of about 15 minutes to about 60 minutes, for example, about 30 minutes, when administered at a dose of 3 mg/kg (0.1 mg/kg/min). In certain embodiments, the anti-PD-1 antibody is administered to a patient with an infusion duration of about 45 minutes to 75 minutes, for example, about 60 minutes, when administered at a dose of 10 mg/kg.
- the anti-CTLA-4 antibody (e.g., ipilimumab) is administered to a patient with an infusion duration of about 15 minutes to 120 minutes, for example, about 30 minutes when administered at a dose of 3 mg/kg. In certain embodiments, the anti-CTLA-4 antibody is administered to a patient with an infusion duration of about 15 minutes to 120 minutes, for example, 90 minutes, when administered at a dose of 10 mg/kg.
- the anti-OX40 antibody when administered on the same day, is administered before the anti-PD-1 or anti-CTLA-4 antibody. In certain embodiments, when administered on the same day, the anti-OX40 antibody is administered after the anti-PD-1 or anti-CTLA-4 antibody. In certain embodiments, when administered on the same day, the anti-OX40 antibody is administered simultaneously with the anti-PD-1 or anti-CTLA-4 antibody.
- the anti-OX40 antibody when administered on the same day, is administered about 15 to 45 minutes (e.g., about 30 minutes) before the anti-PD-1 or anti-CTLA-4 antibody. In certain embodiments, when administered on the same day, the anti-OX40 antibody is administered about 15 to 45 minutes (e.g., about 30 minutes) after the anti-PD-1 or anti-CTLA-4 antibody.
- anti-OX40 antibodies provided herein can be administered at a flat dose (flat dose regimen).
- two or more monoclonal antibodies with different binding specificities are administered simultaneously, such that the dosage of each antibody administered falls within the ranges above.
- the antibodies usually are administered on multiple occasions. Intervals between single dosages can be, for example, weekly, monthly, every three months or yearly. Intervals can also be irregular as indicated by measuring blood levels of antibody to the target antigen in the patient. In some methods, dosage is adjusted to achieve a plasma antibody concentration of about 1-1000 ⁇ g/ml and in some methods about 25-300 ⁇ g/ml.
- Anti-OX40 antibodies described herein may be administered with another antibody at the dosage regimen of the other antibody.
- the anti-OX40 antibody may be administered with an anti-PD-1 antibody, such as nivolumab (OPDIVO), every two weeks as an i.v. infusion over 60 minutes until disease progression or unacceptable toxicity occurs.
- the anti-OX40 antibody may be administered with pembrolizumab (KEYTRUDA) every 3 weeks as an i.v. infusion over 30 minutes until disease progression or unacceptable toxicity occurs.
- Antibodies can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the antibody in the patient. In general, human antibodies show the longest half-life, followed by humanized antibodies, chimeric antibodies, and nonhuman antibodies. The dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime.
- Actual dosage levels of the active ingredients in the pharmaceutical compositions described herein may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
- the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions described herein employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
- “Therapeutically effective dosages” of the antibodies described herein preferably results in a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction.
- a therapeutically effective dose preferably results in increased survival, and/or prevention of further deterioration of physical symptoms associated with cancer.
- Symptoms of cancer are well-known in the art and include, for example, unusual mole features, a change in the appearance of a mole, including asymmetry, border, color and/or diameter, a newly pigmented skin area, an abnormal mole, darkened area under nail, breast lumps, nipple changes, breast cysts, breast pain, death, weight loss, weakness, excessive fatigue, difficulty eating, loss of appetite, chronic cough, worsening breathlessness, coughing up blood, blood in the urine, blood in stool, nausea, vomiting, liver metastases, lung metastases, bone metastases, abdominal fullness, bloating, fluid in peritoneal cavity, vaginal bleeding, constipation, abdominal distension, perforation of colon, acute peritonitis (infection, fever, pain), pain, vomiting blood, heavy sweating, fever, high blood pressure, anemia, diarrhea, jaundice, dizziness, chills, muscle spasms, colon metastases, lung metastases, bladder metastases, liver metastases, bone metasta
- a therapeutically effective dose may prevent or delay onset of cancer, such as may be desired when early or preliminary signs of the disease are present.
- Laboratory tests utilized in the diagnosis of cancer include chemistries (including the measurement of OX40 levels), hematology, serology and radiology. Accordingly, any clinical or biochemical assay that monitors any of the foregoing may be used to determine whether a particular treatment is a therapeutically effective dose for treating cancer.
- One of ordinary skill in the art would be able to determine such amounts based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected.
- Antibodies and compositions described herein can be administered via one or more routes of administration using one or more of a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. Preferred routes of administration for antibodies described herein include intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion.
- parenteral administration means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
- the antibody can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically.
- a non-parenteral route such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically.
- the active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
- a controlled release formulation including implants, transdermal patches, and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems , J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
- Antibody compositions can be administered with medical devices known in the art.
- the composition is administered with a needleless hypodermic injection device, such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556.
- a needleless hypodermic injection device such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556.
- Examples of well-known implants and modules for use in administering the antibodies include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,486,194, which discloses a therapeutic device for administering medicants through the skin; U.S. Pat
- the anti-OX40 antibodies are formulated to ensure proper distribution in vivo.
- the blood-brain barrier excludes many highly hydrophilic compounds.
- they can be formulated, for example, in liposomes.
- liposomes For methods of manufacturing liposomes, see, e.g., U.S. Pat. Nos. 4,522,811; 5,374,548; and 5,399,331.
- the liposomes may comprise one or more moieties which are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g., V. V. Ranade (1989) J. Clin. Pharmacol. 29:685).
- Exemplary targeting moieties include folate or biotin (see, e.g., U.S. Pat. No. 5,416,016 to Low et al.); mannosides (Umezawa et al., (1988) Biochem. Biophys. Res. Commun. 153:1038); antibodies (P. G. Bloeman et al. (1995) FEBS Lett. 357:140; M. Owais et al. (1995) Antimicrob. Agents Chemother. 39:180); surfactant protein A receptor (Briscoe et al. (1995) Am. J. Physiol. 1233:134); p120 (Schreier et al. (1994) J. Biol. Chem. 269:9090); see also K. Keinanen; M. L. Laukkanen (1994) FEBS Lett. 346:123; J. J. Killion; I. J. Fidler (1994) Immunomethods 4:273.
- Anti-OX40 antibodies and compositions described herein have numerous in vitro and in vivo applications involving, for example, enhancement of immune response by activating OX40 signaling, or detection of OX40.
- the antibodies are human antibodies.
- anti-OX40 antibodies described herein can be contacted with cells in culture, in vitro or ex vivo, or administered to human subjects, e.g., in vivo, to enhance immunity in a variety of diseases.
- methods of modifying an immune response in a subject comprising administering to the subject an antibody, or antigen-binding portion thereof, described herein such that the immune response in the subject is modified.
- the response is enhanced, stimulated or up-regulated.
- Preferred subjects include human patients in whom enhancement of an immune response would be desirable.
- the methods are particularly suitable for treating human patients having a disorder that can be treated by augmenting an immune response (e.g., a T-cell mediated immune response, e.g., an antigen specific T cell response).
- the methods are particularly suitable for treatment of cancer in vivo.
- anti-OX40 antibodies described herein can be administered together with an antigen of interest or the antigen may already be present in the subject to be treated (e.g., a tumor-bearing or virus-bearing subject). When anti-OX40 antibodies are administered together with another agent, the two can be administered separately or simultaneously.
- Also encompassed are methods for detecting the presence of human OX40 antigen in a sample, or measuring the amount of human OX40 antigen, comprising contacting the sample, and a control sample, with anti-OX40 antibodies (or antigen binding portions thereof) described herein, under conditions that allow for formation of a complex between the antibody and human OX40. The formation of a complex is then detected, wherein a difference complex formation between the sample compared to the control sample is indicative the presence of human OX40 antigen in the sample.
- the anti-OX40 antibodies described herein also can be used to purify human OX40 via immunoaffinity purification.
- anti-OX40 antibodies described herein to stimulate or co-stimulate T cell responses, e.g., antigen-specific T cell responses
- CD3 stimulation is also included (e.g., by coincubation with a cell expressing membrane CD3), which stimulation can be provided at the same time, before, or after stimulation with an anti-OX40 antibody.
- the method comprises contacting T cells with an anti-OX40 antibody described herein, and optionally with an anti-CD3 antibody, such that an antigen-specific T cell response is stimulated.
- Any suitable indicator of an antigen-specific T cell response can be used to measure the antigen-specific T cell response.
- suitable indicators include increased T cell proliferation in the presence of the antibody and/or increase cytokine production in the presence of the antibody.
- interleukin-2 and/or interferon- ⁇ production by the antigen-specific T cell is stimulated.
- T cells that can be enhanced or co-stimulated with anti-OX40 antibodies include CD4+ T cells and CD8+ T cells.
- the T cells can be T eff cells, e.g., CD4+ T eff cells, CD8+ T eff cells, Thelper (T h ) cells and T cytotoxic (T c ) cells.
- an immune response e.g., an antigen-specific T cell response
- the subject is a tumor-bearing subject and an immune response against the tumor is stimulated.
- a tumor may be a solid tumor or a liquid tumor, e.g., a hematological malignancy.
- a tumor is an immunogenic tumor.
- a tumor is non-immunogenic.
- a tumor is PD-L1 positive.
- a tumor is PD-L1 negative.
- a subject may also be a virus-bearing subject and an immune response against the virus is stimulated.
- methods for inhibiting growth of tumor cells in a subject comprising administering to the subject a therapeutically effective amount of an anti-OX40 antibody described herein such that growth of the tumor is inhibited in the subject.
- methods of treating viral infection in a subject comprising administering to the subject an anti-OX40 antibody described herein such that the viral infection is treated in the subject.
- An Fc may, e.g., be an Fc with effector function or enhanced effector function, such as binding or having enhanced binding to one or more activating Fc receptors.
- T reg depletion occurs without significant depletion or inhibition of T eff in the tumor microenvironment, and without significant depletion or inhibition of T eff cells and T reg cells outside of the tumor microenvironment, e.g., in the periphery.
- the subject has higher levels of OX40 on T reg cells than on T eff cells, e.g., in the tumor microenvironment.
- the subject is treated with an anti-OX40 antibody having an Fc that enhances agonism, e.g., binds to or has enhanced binding to the inhibitory FcRIIb.
- Anti-OX40 antibodies may deplete Tregs in tumors and/or Tregs in tumor infiltrating lymphocytes (TILs).
- the anti-OX40 antibody is given to a subject as an adjunctive therapy.
- Treatments of subjects having cancer with the anti-OX40 antibody may lead to prolonged survival, e.g., long-term durable response relative to the current standard of care; long term survival of at least 3 months, 6 months, 9 months, 1, 2, 3, 4, 5, 10 or more years, or recurrence-free survival of at least 3 months, 6 months, 9 months, 1, 2, 3, 4, 5, or 10 or more years.
- treatment of a subject having cancer with the anti-OX40 antibody prevents recurrence of cancer or delays recurrence of cancer by, e.g., 3 months, 6 months, 9 months, 1, 2, 3, 4, 5, or 10 or more years.
- the anti-OX40 antibody treatment can be used as a first-, second-, or third-line treatment.
- the anti-OX40 antibody is not significantly toxic.
- the antibody is not significantly toxic to an organ of a human, e.g., one or more of the liver, kidney, brain, lungs, and heart, as determined, e.g., in clinical trials.
- the antibody does not significantly trigger an undesirable immune response, e.g., autoimmunity or inflammation.
- treatment of a subject with the anti-OX40 antibody does not result in overstimulation of the immune system to the extent that the subject's immune system then attacks the subject itself (e.g., autoimmune response) or results in, e.g., anaphylaxis.
- the antibodies preferably do not cause anaphylaxis.
- treatment of a subject with the anti-OX40 antibody does not cause significant inflammatory reactions, e.g., immune-mediated pneumonitis, immune-mediated colitis, immune mediated hepatitis, immune-mediated nephritis or renal dysfunction, immune-mediated hypophysitis, immune-mediated hypothyroidism and hyperthyroidism, or other immune-mediated adverse reactions.
- inflammatory reactions e.g., immune-mediated pneumonitis, immune-mediated colitis, immune mediated hepatitis, immune-mediated nephritis or renal dysfunction, immune-mediated hypophysitis, immune-mediated hypothyroidism and hyperthyroidism, or other immune-mediated adverse reactions.
- the anti-OX40 antibody provides synergistic anti-tumor effects in combination with another cancer therapy, such as a compound that stimulates the immune system (e.g., an immune-oncology agent), e.g., a compound described herein or a compound modulating a target described herein.
- a compound that stimulates the immune system e.g., an immune-oncology agent
- a compound described herein or a compound modulating a target described herein e.g., a compound described herein or a compound modulating a target described herein.
- Activation of OX40 by anti-OX40 antibodies can enhance the immune response to cancerous cells in the patient. Accordingly, provided herein are methods for treating a subject having cancer, comprising administering to the subject the anti-OX40 antibodies described herein, such that the subject is treated, e.g., such that growth of cancerous tumors is inhibited or reduced and/or that the tumors regress and/or that prolonged survival is achieved.
- the anti-OX40 antibody can be used alone to inhibit the growth of cancerous tumors.
- the anti-OX40 antibody can be used in conjunction with another agent, e.g., another immunogenic agent, a standard cancer treatment, or another antibody, as described below.
- kits for treating cancer e.g., by inhibiting growth of tumor cells, in a subject, comprising administering to the subject a therapeutically effective amount of anti-OX40 antibodies described herein.
- the antibody may be a human antibody. Additionally or alternatively, the antibody can be a chimeric or humanized antibody.
- combination therapies comprising administration of an anti-OX40 antibody and an anti-PD-1 or anti-CTLA-4 antibody to treat subjects having tumors (e.g., advanced solid tumors).
- tumors e.g., advanced solid tumors.
- an anti-OX40 antibody and an anti-PD-1 antibody or anti-CTLA-4 antibody are administered to a patient with a tumor (e.g., advanced solid tumor) according to a defined clinical dosage regimen.
- the anti-OX40 antibody is OX40.21.
- the anti-PD-1 antibody is BMS-936558 (nivolumab).
- the anti-CTLA-4 antibody is ipilimumab (Yervoy®).
- dosage regimens are adjusted to provide the optimum desired response (e.g., an effective response).
- adjunctive or combined administration includes simultaneous administration of the compounds in the same or different dosage form, or separate administration of the compounds (e.g., sequential administration).
- the anti-OX40 and anti-PD-1 antibody or anti-CTLA-4 antibody can be simultaneously administered in a single formulation.
- the anti-OX40 and anti-PD-1 antibody or anti-CTLA-4 antibody can be formulated for separate administration and are administered concurrently or sequentially (e.g., one antibody is administered within about 30 minutes prior to administration of the second antibody).
- the anti-PD1 antibody or anti-CTLA-4 antibody can be administered first and followed by (e.g., immediately followed by) the administration of the anti-OX40 antibody, or vice versa.
- the anti-PD-1 antibody or anti-CTLA-4 antibody is administered prior to administration of the anti-OX40 antibody.
- the anti-PD-1 antibody or anti-CTLA-4 antibody is administered after administration of the anti-OX40 antibody.
- the anti-OX40 antibody and anti-PD-1 antibody or anti-CTLA-4 antibody are administered concurrently. Such concurrent or sequential administration preferably results in both antibodies being simultaneously present in treated patients.
- Cancers whose growth may be inhibited with anti-OX40 antibodies, or combination therapy with an anti-OX40 and an anti-PD-1 or anti-CTLA-4 antibody include cancers typically responsive to immunotherapy and those that are not typically responsive to immunotherapy. Cancers may be cancers with solid tumors or blood malignancies (liquid tumors).
- Non-limiting examples of cancers for treatment include squamous cell carcinoma, small-cell lung cancer, non-small cell lung cancer, squamous non-small cell lung cancer (NSCLC), non squamous NSCLC, glioma, gastrointestinal cancer, renal cancer (e.g.
- ovarian cancer clear cell carcinoma
- kidney cancer e.g., renal cell carcinoma (RCC)
- prostate cancer e.g. hormone refractory prostate adenocarcinoma
- thyroid cancer neuroblastoma, pancreatic cancer, glioblastoma (glioblastoma multiforme), cervical cancer, stomach cancer, bladder cancer, hepatoma, breast cancer, colon carcinoma, and head and neck cancer (or carcinoma), gastric cancer, germ cell tumor, pediatric sarcoma, sinonasal natural killer, melanoma (e.g., metastatic malignant melanoma, such as cutaneous or intraocular malignant melanoma), bone cancer, skin cancer, uterine cancer, cancer of the anal region, testicular cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, cancer of the esophagus, cancer
- the methods described herein may also be used for treatment of metastatic cancers, unresectable and/or refractory cancers (e.g., cancers refractory to previous immunotherapy, e.g., with a blocking CTLA-4 or PD-1 antibody), and recurrent cancers.
- unresectable and/or refractory cancers e.g., cancers refractory to previous immunotherapy, e.g., with a blocking CTLA-4 or PD-1 antibody
- recurrent cancers e.g., metastatic cancers, unresectable and/or refractory cancers (e.g., cancers refractory to previous immunotherapy, e.g., with a blocking CTLA-4 or PD-1 antibody)
- the patient being treated with the anti-OX40 antibody, or combination of anti-OX40 antibody and anti-PD-1 or anti-CTLA-4 antibody has an advanced solid tumor.
- the patient to be treated has cervical cancer.
- the patient to be treated has colorectal (CRC) cancer.
- the patient to be treated has bladder cancer (e.g., unresectable locally advanced or metastatic bladder cancer).
- the patient to be treated has ovarian cancer (e.g., unresectable locally advanced or metastatic ovarian cancer).
- the patient being treated with the anti-OX40 antibody, or combination of anti-OX40 antibody and anti-PD-1 or anti-CTLA-4 antibody has non-small cell lung cancer (NSCLC).
- NSCLC non-small cell lung cancer
- the patient to be treated has squamous cell carcinoma of the head and neck (SCCHN).
- SCCHN head and neck
- B-NHL B-cell non-Hodgkin's lymphoma
- the patient to be treated has myeloma.
- the patient has melanoma.
- the patient to be treated has diffuse large B-cell lymphoma (DLBCL).
- DLBCL diffuse large B-cell lymphoma
- the anti-OX40 antibody is administered to patients having a cancer that exhibited an inadequate response to a prior treatment, e.g., a prior treatment with an immuno-oncology drug, or patients having a cancer that is refractory or resistant, either intrinsically refractory or resistant (e.g., refractory to a PD-1 pathway antagonist), or a wherein the resistance or refractory state is acquired.
- a prior treatment e.g., a prior treatment with an immuno-oncology drug
- patients having a cancer that is refractory or resistant either intrinsically refractory or resistant (e.g., refractory to a PD-1 pathway antagonist), or a wherein the resistance or refractory state is acquired.
- subjects who are not responsive or not sufficiently responsive to a first therapy or who see disease progression following treatment e.g., anti-PD-1 treatment
- the anti-OX40 antibody is administered to patients who have not previously received (i.e., been treated with) an immuno-oncology agent, e.g., a PD-1 pathway antagonist.
- an immuno-oncology agent e.g., a PD-1 pathway antagonist.
- the anti-OX40 antibody may be administered with a standard of care treatment (e.g., surgery, radiation, and chemotherapy).
- a maintenance therapy e.g., a therapy that is intended to prevent the occurrence or recurrence of tumors.
- the anti-OX40 antibody may be administered with another treatment, e.g., radiation, surgery, or chemotherapy.
- anti-OX40 antibody adjunctive therapy may be administered when there is a risk that micrometastases may be present and/or in order to reduce the risk of a relapse.
- the anti-OX40 antibody can be administered as a monotherapy, or as the only immunostimulating therapy.
- the anti-OX40 antibody can also be combined with an immunogenic agent, such as cancerous cells, purified tumor antigens (including recombinant proteins, peptides, and carbohydrate molecules), cells, and cells transfected with genes encoding immune stimulating cytokines (He et al (2004) J. Immunol. 173:4919-28).
- Non-limiting examples of tumor vaccines that can be used include peptides of melanoma antigens, such as peptides of gp100, MAGE antigens, Trp-2, MART1 and/or tyrosinase, or tumor cells transfected to express the cytokine GM-CSF (discussed further below).
- tumors have been shown to be immunogenic such as melanomas.
- OX40 activation By lowering the threshold of T cell activation via OX40 activation, the tumor responses in the host can be activated, allowing treatment of non-immunogenic tumors or those having limited immunogenicity.
- the anti-OX40 antibody can be used in conjunction with a vaccination protocol.
- Many experimental strategies for vaccination against tumors have been devised (see Rosenberg, S., 2000, Development of Cancer Vaccines, ASCO Educational Book Spring: 60-62; Logothetis, C., 2000, ASCO Educational Book Spring: 300-302; Khayat, D. 2000, ASCO Educational Book Spring: 414-428; Foon, K. 2000, ASCO Educational Book Spring: 730-738; see also Restifo, N. and Sznol, M., Cancer Vaccines, Ch. 61, pp. 3023-3043 in DeVita et al. (eds.), 1997, Cancer: Principles and Practice of Oncology, Fifth Edition).
- a vaccine is prepared using autologous or allogeneic tumor cells. These cellular vaccines have been shown to be most effective when the tumor cells are transduced to express GM-CSF. GM-CSF has been shown to be a potent activator of antigen presentation for tumor vaccination (Dranoff et al. (1993) Proc. Natl. Acad. Sci U.S.A. 90: 3539-43).
- tumor specific antigens are differentiation antigens expressed in the tumors and in the cell from which the tumor arose, for example melanocyte antigens gp100, MAGE antigens, and Trp-2. More importantly, many of these antigens can be shown to be the targets of tumor specific T cells found in the host. OX40 activation can be used in conjunction with a collection of recombinant proteins and/or peptides expressed in a tumor in order to generate an immune response to these proteins.
- the tumor antigen can include the protein telomerase, which is required for the synthesis of telomeres of chromosomes and which is expressed in more than 85% of human cancers and in only a limited number of somatic tissues (Kim et al. (1994) Science 266: 2011-2013).
- Tumor antigen can also be “neo-antigens”expressed in cancer cells because of somatic mutations that alter protein sequence or create fusion proteins between two unrelated sequences (i.e., bcr-abl in the Philadelphia chromosome), or idiotype from B cell tumors.
- tumor vaccines can include the proteins from viruses implicated in human cancers such a Human Papilloma Viruses (HPV), Hepatitis Viruses (HBV and HCV) and Kaposi's Herpes Sarcoma Virus (KHSV).
- HPV Human Papilloma Viruses
- HBV Hepatitis Viruses
- KHSV Kaposi's Herpes Sarcoma Virus
- Another form of tumor specific antigen which can be used in conjunction with OX40 activation is purified heat shock proteins (HSP) isolated from the tumor tissue itself. These heat shock proteins contain fragments of proteins from the tumor cells and these HSPs are highly efficient at delivery to antigen presenting cells for eliciting tumor immunity (Suot & Srivastava (1995) Science 269:1585-1588; Tamura et al. (1997) Science 278:117-120).
- DC Dendritic cells
- DC's can be produced ex vivo and loaded with various protein and peptide antigens as well as tumor cell extracts (Nestle et al. (1998) Nature Medicine 4: 328-332). DCs can also be transduced by genetic means to express these tumor antigens as well. DCs have also been fused directly to tumor cells for the purposes of immunization (Kugler et al. (2000) Nature Medicine 6:332-336). As a method of vaccination, DC immunization can be effectively combined with OX40 activation to activate more potent anti-tumor responses.
- Anti-OX40 antibodies described herein can also be combined with chemotherapeutic regimes. In these instances, it may be possible to reduce the dose of chemotherapeutic reagent administered (Mokyr et al. (1998) Cancer Research 58: 5301-5304).
- the anti-OX40 antibody can be used in combination with decarbazine to treat melanoma.
- the anti-OX40 antibody can be used in combination with interleukin-2 (IL-2) to treat melanoma.
- IL-2 interleukin-2
- combination therapies that may result in synergy with anti-OX40 antibodies through cell death are radiation, surgery, and hormone deprivation. Each of these protocols creates a source of tumor antigen in the host.
- Angiogenesis inhibitors can also be used in combination with the anti-OX40 antibody. Inhibition of angiogenesis leads to tumor cell death which may feed tumor antigen into host antigen presentation pathways.
- Tumors evade host immune surveillance by a large variety of mechanisms. Many of these mechanisms may be overcome by the inactivation of proteins which are expressed by the tumors and which are immunosuppressive. These include among others TGF- ⁇ (Kehrl et al. (1986) J. Exp. Med. 163: 1037-1050), IL-10 (Howard & O'Garra (1992) Immunology Today 13: 198-200), and Fas ligand (Hahne et al. (1996) Science 274: 1363-1365). Antibodies to each of these entities can be used in combination with anti-OX40 antibodies to counteract the effects of the immunosuppressive agent and favor tumor immune responses by the host.
- Anti-CD40 antibodies are able to substitute effectively for T cell helper activity (Ridge et al. (1998) Nature 393: 474-478) and can be used in conjunction with anti-OX40 antibodies.
- T cell costimulatory molecules such as CTLA-4 (e.g., U.S. Pat. No. 5,811,097), OX-40 (Weinberg et al. (2000) Immunol 164: 2160-2169), 4-1BB (Melero et al.
- Inhibitors of PD1 or PD-L1 may also be used in conjunction with anti-OX40 antibodies.
- kits for treating patients who have been exposed to particular toxins or pathogens comprising administering to the subject anti-OX40 antibodies described herein, such that the subject is treated for the infectious disease.
- the anti-OX40 antibody is a chimeric or humanized antibody.
- anti-OX40 antibodies can be used alone, or as an adjuvant, in combination with vaccines, to stimulate the immune response to pathogens, toxins, and self-antigens.
- pathogens for which this therapeutic approach can be particularly useful include pathogens for which there is currently no effective vaccine, or pathogens for which conventional vaccines are less than completely effective. These include, but are not limited to HIV, Hepatitis (A, B, & C), Influenza, Herpes, Giardia, Malaria, Leishmania, Staphylococcus aureus, Pseudomonas aeruginosa .
- Anti-OX40 antibodies may be useful against established infections by agents such as HIV that present altered antigens over the course of the infections. These novel epitopes are recognized as foreign at the time of anti-OX40 antibody administration, thus provoking a strong T cell response.
- pathogenic fungi causing infections treatable by the methods described herein include Candida ( albicans, krusei, glabrata, tropicalis , etc.), Cryptococcus neoformans, Aspergillus ( fumigatus, niger , etc.), Genus Mucorales ( mucor, absidia, rhizopus ), Sporothrix schenkii, Blastomyces dermatitidis, Paracoccidioides brasiliensis, Coccidioides immitis and Histoplasma capsulatum.
- pathogenic parasites causing infections treatable by the methods described herein include Entamoeba histolytica, Balantidium coli, Naegleriafowleri, Acanthamoeba sp., Giardia lambia, Cryptosporidium sp., Pneumocystis carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei, Trypanosoma cruzi, Leishmania donovani, Toxoplasma gondii, Nippostrongylus brasiliensis.
- anti-OX40 antibodies can be combined with other forms of immunotherapy such as cytokine treatment (e.g., interferons, GM-CSF, G-CSF, IL-2), or bispecific antibody therapy, which provides for enhanced presentation of tumor antigens (see, e.g., Holliger (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak (1994) Structure 2:1121-1123).
- cytokine treatment e.g., interferons, GM-CSF, G-CSF, IL-2
- bispecific antibody therapy which provides for enhanced presentation of tumor antigens
- Anti-OX40 antibodies may provoke and amplify autoimmune responses. Indeed, induction of anti-tumor responses using tumor cell and peptide vaccines reveals that many anti-tumor responses involve anti-self reactivities (van Elsas et al. (2001) J. Exp. Med. 194:481-489; Overwijk, et al. (1999) Proc. Natl. Acad. Sci. U.S.A. 96: 2982-2987; Hurwitz, (2000) supra; Rosenberg & White (1996) J. Immunother Emphasis Tumor Immunol 19 (1): 81-4). Therefore, anti-OX40 antibodies can be used in conjunction with various self proteins in order to devise vaccination protocols to efficiently generate immune responses against these self proteins for disease treatment. For example, Alzheimer's disease involves inappropriate accumulation of A ⁇ peptide in amyloid deposits in the brain; antibody responses against amyloid are able to clear these amyloid deposits (Schenk et al., (1999) Nature 400: 173-177).
- Analogous methods as described above for the use of anti-OX40 antibodies can be used for induction of therapeutic autoimmune responses to treat patients having an inappropriate accumulation of other self-antigens, such as amyloid deposits, including A ⁇ in Alzheimer's disease, cytokines such as TNF ⁇ , and IgE.
- the anti-OX40 antibodies described herein can be used to stimulate antigen-specific immune responses by coadministration of the antibodies with an antigen of interest (e.g., a vaccine). Accordingly, provided herein are methods of enhancing an immune response to an antigen in a subject, comprising administering to the subject: (i) the antigen; and (ii) an anti-OX40 antibody such that an immune response to the antigen in the subject is enhanced.
- the antibody may be a human anti-OX40 antibody (such as any of the human anti-OX40 antibodies described herein). In other embodiments, the antibody can be a chimeric or humanized antibody.
- the antigen can be, for example, a tumor antigen, a viral antigen, a bacterial antigen or an antigen from a pathogen.
- antigens include those discussed in the sections above, such as the tumor antigens (or tumor vaccines) discussed above, or antigens from the viruses, bacteria or other pathogens described above.
- a peptide or fusion protein comprising the epitope to which the anti-OX40 antibody binds is used as a vaccine instead of, or in addition to, the anti-OX40 antibody.
- Suitable routes of administering the antibody compositions e.g., human monoclonal antibodies, multispecific and bispecific molecules and immunoconjugates
- the antibody compositions can be administered by injection (e.g., intravenous or subcutaneous).
- Suitable dosages of the molecules used will depend on the age and weight of the subject and the concentration and/or formulation of the antibody composition.
- Such therapeutic agents include, among others, anti-neoplastic agents such as doxorubicin (adriamycin), cisplatin bleomycin sulfate, carmustine, chlorambucil, dacarbazine and cyclophosphamide hydroxyurea which, by themselves, are only effective at levels which are toxic or subtoxic to a patient.
- anti-neoplastic agents such as doxorubicin (adriamycin), cisplatin bleomycin sulfate, carmustine, chlorambucil, dacarbazine and cyclophosphamide hydroxyurea which, by themselves, are only effective at levels which are toxic or subtoxic to a patient.
- Cisplatin is intravenously administered as a 100 mg/ml dose once every four weeks and adriamycin is intravenously administered as a 60-75 mg/ml dose once every 21 days.
- Co-administration of anti-OX40 antibodies, or antigen binding fragments thereof, described herein with chemotherapeutic agents provides two anti-cancer agents which operate via different mechanisms which yield a cytotoxic effect to human tumor cells.
- Such co-administration can address problems related to the development of resistance to drugs or a change in the antigenicity of the tumor cells which would render them unreactive with the antibody.
- kits comprising the anti-OX40 antibody compositions described herein (e.g., human antibodies, bispecific or multispecific molecules, or immunoconjugates) and instructions for use.
- the kit can further contain at least one additional reagent, or one or more additional human antibodies described herein (e.g., a human antibody having a complementary activity which binds to an epitope in OX40 distinct from the first human antibody).
- Kits typically include a label indicating the intended use of the contents of the kit.
- the term label includes any writing, or recorded material supplied on or with the kit, or which otherwise accompanies the kit.
- Suitable protocols for treating a solid tumor (e.g., an advanced solid tumor) in a human patient include, for example, administering to the patient an effective amount of an anti-OX40 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 318, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 94, wherein the method comprises at least one administration cycle, wherein the cycle is a period of two weeks (Q2W), wherein for each of the at least one cycles, at least one dose of the anti-OX40 antibody is administered at a dose of 1 mg/kg body weight; a fixed dose of 20, 40, 80, 160, or 320 mg; a dose of about 1 mg/kg body weight; or a fixed dose of about 20, 40, 80, 160, or 320 mg.
- an anti-OX40 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region
- Another suitable protocol for treating a solid tumor in a human patient includes, for example, administering to the patient an effective amount of each of:
- an anti-OX40 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 318, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 94, and
- an anti-PD-1 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 301, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 302,
- the method comprises at least one administration cycle, wherein the cycle is a period of two weeks, wherein for each of the at least one cycles, at least one dose of the anti-OX40 antibody is administered at a dose of 1 mg/kg body weight; a fixed dose of 20, 40, 80, 160, or 320 mg; a dose of about 1 mg/kg body weight; or a fixed dose of about 20, 40, 80, 160, or 320 mg, and at least one dose of the anti-PD-1 antibody is administered at flat dose of 240 mg or a flat dose of about 240 mg.
- the anti-PD-1 antibody is administered once every three weeks (q3w) at a fixed dose of 360 mg, or once every four weeks (q4w) at a dose of 480 mg.
- Another suitable protocol for treating a solid tumor in a human patient includes, for example, administering to the patient an effective amount of each of:
- an anti-OX40 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 318, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 94, and
- an anti-CTLA-4 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 309, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 310,
- the method comprises at least one administration cycle, wherein the cycle is a period of three weeks (q3w), wherein for each of the at least one cycles, at least one dose of the anti-OX40 antibody is administered at a dose of 1 mg/kg body weight; a fixed dose of 20, 40, 80, 160, or 320 mg; a dose of about 1 mg/kg body weight; or a fixed dose of about 20, 40, 80, 160, or 320 mg, and at least one dose of the anti-CTLA-4 antibody is administered at flat dose of 1 mg/kg body weight or a flat dose of about 1 mg/kg body weight.
- the anti-OX40 antibody is administered together with the anti-CTLA-4 antibody for at least one cycle, followed by anti-OX40 antibody monotherapy for at least one cycle. In certain embodiments, the anti-OX40 antibody is administered together with ipilimumab for the initial four cycles, followed by anti-OX40 antibody monotherapy for subsequent cycles.
- the anti-OX40 antibody and anti-PD-1 antibody are administered at the following doses:
- the anti-OX40 antibody and anti-CTLA-4 antibody are administered at the following doses:
- the dose of the anti-OX40 and/or anti-PD-1 or anti-CTLA-4 antibody is calculated per body weight, e.g., mg/kg body weight.
- the dose of the anti-OX40 and/or anti-PD-1 or anti-CTLA-4 antibody is a flat-fixed dose.
- the dose of the anti-OX40 and/or anti-PD-1 or anti-CTLA-4 antibody is varied over time.
- the anti-OX40 and/or anti-PD-1 or anti-CTLA-4 antibody may be initially administered at a high dose and may be lowered over time.
- the anti-OX40 and/or anti-PD-1 or anti-CTLA-4 antibody is initially administered at a low dose and increased over time.
- the amount of the anti-OX40 and/or anti-PD-1 or anti-CTLA-4 antibody administered is constant for each dose. In another embodiment, the amount of antibody administered varies with each dose. For example, the maintenance (or follow-on) dose of the antibody can be higher or the same as the loading dose which is first administered. In another embodiment, the maintenance dose of the antibody can be lower or the same as the loading dose.
- the anti-OX40 and/or anti-PD-1 or anti-CTLA-4 antibody are formulated for intravenous administration.
- the anti-OX40 antibody, or anti-OX40 antibody and anti-PD-1 or CTLA-4 antibody are administered on Day 1 of each cycle.
- the anti-OX40 and/or anti-PD-1 or anti-CTLA-4 antibody are administered once per week, once every two weeks, once every three weeks, or once every four weeks, or as long as a clinical benefit is observed or until there is a complete response, confirmed progressive disease or unmanageable toxicity.
- a cycle of administration is two weeks, which can be repeated, as necessary. In another embodiment, the cycle is three weeks. In some embodiments, the treatment consists of up to eight cycles. In other embodiments, the treatment consists of up to 12 cycles.
- one dose each of an anti-OX40 antibody and an anti-PD-1 antibody is administered per two week cycle. In another embodiment, one dose each of the anti-PD-1 antibody and anti-OX40 antibody is administered per three week cycle. In another embodiment, one dose each of the anti-PD-1 antibody and anti-OX40 antibody is administered per four week cycle.
- one dose each of the anti-OX40 antibody and anti-CTLA-4 antibody is administered per three week cycle. In some embodiments, one dose each of the anti-OX40 antibody and anti-CTLA-4 antibody is administered per three week cycle for the first four cycles, followed by anti-OX40 antibody monotherapy for the fifth through eighth cycles.
- the anti-OX40 antibody and anti-PD-1 or anti-CTLA-4 antibody are administered as a first line of treatment (e.g., the initial or first treatment).
- the anti-OX40 antibody and anti-PD-1 or anti-CTLA-4 antibody are administered as a second line of treatment (e.g., after the initial or first treatment, including after relapse and/or where the first treatment has failed).
- the invention features any of the aforementioned embodiments, wherein the anti-PD-1 antibody is replaced by, or combined with, an anti-PD-L1 or anti-PD-L2 antibody.
- the human patient has a cancer selected from the group consisting of cervical cancer, bladder cancer, colorectal cancer, and ovarian cancer.
- the anti-OX40 antibody comprises a heavy chain variable region CDR1 comprising the sequence set forth in SEQ ID NO: 87, a heavy chain variable region CDR2 comprising the sequence set forth in SEQ ID NO: 317, a heavy chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 89, a light chain variable region CDR1 comprising the sequence set forth in SEQ ID NO: 90, a light chain variable region CDR2 comprising the sequence set forth in SEQ ID NO: 91, and a light chain variable region CDR3 comprising the sequence set forth in SEQ ID NO: 92.
- the anti-OX40 antibody comprises heavy and light chain variable regions comprising the sequences set forth in SEQ ID NOs: 318 and 94, respectively. In certain embodiments, the anti-OX40 antibody comprises heavy and light chain sequences comprising the sequences set forth in SEQ ID NOs: 124 and 116, respectively.
- the anti-PD-1 antibody comprises a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequences set forth in SEQ ID NOs: 303-305, respectively, and light chain variable region CDR1, CDR2, and CDR3 comprising the sequences set forth in SEQ ID NOs: 306-308, respectively.
- the anti-PD-1 antibody comprises heavy and light chain variable regions sequences set forth in SEQ ID NOs: 301 and 302, respectively.
- the anti-PD-1 antibody comprises heavy and light chain sequences set forth in SEQ ID NOs: 299 and 300, respectively.
- the anti-CTLA-4 antibody comprises a heavy chain variable region CDR1, CDR2, and CDR3 comprising the sequences set forth in SEQ ID NOs: 311-313, respectively, and light chain variable region CDR1, CDR2, and CDR3 comprising the sequences set forth in SEQ ID NOs: 314-316, respectively.
- the anti-CTLA-4 antibody comprises heavy and light chain variable regions sequences set forth in SEQ ID NOs: 309 and 310, respectively.
- responses to therapy may include:
- CR Complete Response
- Any (RECIST V1.1) pathological lymph nodes (whether target or non-target) must have reduction in short axis to ⁇ 10 mm.
- Partial Response (PR) At least a 30% decrease in the sum of the (RECIST V1.1) diameters of target lesions, taking as reference the baseline sum diameters.
- Progressive Disease (PD) At least a 20% increase in the sum of the (RECIST V1.1) diameters of target lesions, taking as reference the smallest sum on study (this includes the baseline sum if that is the smallest on study). In addition to the relative increase of 20%, the sum must also demonstrate an absolute increase of at least 5 mm. (Note: the appearance of one or more new lesions is also considered progression).
- responses to therapy may include:
- CR Complete Response
- All lymph nodes must be non-pathological in size ( ⁇ 10 mm short axis).
- Progressive Disease (PD) Unequivocal progression of existing non- (RECIST V1.1) target lesions. The appearance of one or more new lesions is also considered progression.
- Non-target Disease lesion(s) does not constitute progressive (irRECIST) disease unless/until Tumor Burden increases by 20% (ie the sum of the diameters at nadir of target lesions and any new measurable lesions increases by the required amount).
- Tumor Burden increases by 20% (ie the sum of the diameters at nadir of target lesions and any new measurable lesions increases by the required amount).
- Non-target lesions are not considered in the definition of Stable Disease and Partial Response.
- Patients treated according to the methods disclosed herein preferably experience improvement in at least one sign of cancer.
- improvement is measured by a reduction in the quantity and/or size of measurable tumor lesions.
- lesions can be measured on chest x-rays or CT or MRI films.
- cytology or histology can be used to evaluate responsiveness to a therapy.
- the patient treated exhibits a complete response (CR), a partial response (PR), stable disease (SD), immune-related complete disease (irCR), immune-related partial response (irPR), or immune-related stable disease (irSD).
- the patient treated experiences tumor shrinkage and/or decrease in growth rate, i.e., suppression of tumor growth.
- unwanted cell proliferation is reduced or inhibited.
- one or more of the following can occur: the number of cancer cells can be reduced; tumor size can be reduced; cancer cell infiltration into peripheral organs can be inhibited, retarded, slowed, or stopped; tumor metastasis can be slowed or inhibited; tumor growth can be inhibited; recurrence of tumor can be prevented or delayed; one or more of the symptoms associated with cancer can be relieved to some extent.
- administration of effective amounts of the anti-OX40 antibody and anti-PD-1 or anti-CTLA-4 antibody according to any of the methods provided herein produces at least one therapeutic effect selected from the group consisting of reduction in size of a tumor, reduction in number of metastatic lesions appearing over time, complete remission, partial remission, or stable disease.
- the improvement of clinical benefit rate is about 20% 20%, 30%, 40%, 50%, 60%, 70%, 80% or more compared to an anti-OX40 antibody or anti-PD-1 or anti-CTLA-4 antibody alone.
- anti-OX40 antibodies described herein can be used in combination therapy, as described below.
- Methods of combination therapy include those in which an anti-OX40 antibody, or a combination of anti-OX40 antibody and anti-PD-1 or anti-CTLA-4 antibody, is coadministered with one or more additional agents, e.g., small molecule drugs, antibodies or antigen binding portions thereof, and which are effective in stimulating immune responses to thereby further enhance, stimulate or upregulate immune responses in a subject.
- additional agents e.g., small molecule drugs, antibodies or antigen binding portions thereof.
- the administration of an anti-OX40 antibody and an antagonist anti-PD-1 antibody to mice can result in a synergic effect in inhibiting tumor growth.
- the anti-OX40 antibody can be combined with (i) an agonist of a stimulatory (e.g., co-stimulatory) molecule (e.g., receptor or ligand) and/or (ii) an antagonist of an inhibitory signal or molecule (e.g., receptor or ligand) on immune cells, such as T cells, both of which result in amplifying immune responses, such as antigen-specific T cell responses.
- a stimulatory e.g., co-stimulatory
- an antagonist of an inhibitory signal or molecule e.g., receptor or ligand
- an immuno-oncology agent is (i) an agonist of a stimulatory (including a co-stimulatory) molecule (e.g., receptor or ligand) or (ii) an antagonist of an inhibitory (including a co-inhibitory) molecule (e.g., receptor or ligand) on cells involved in innate immunity, e.g., NK cells, and wherein the immuno-oncology agent enhances innate immunity.
- Such immuno-oncology agents are often referred to as immune checkpoint regulators, e.g., immune checkpoint inhibitor or immune checkpoint stimulator.
- the anti-OX40 antibody is administered with an agent that targets a stimulatory or inhibitory molecule that is a member of the immunoglobulin super family (IgSF).
- the anti-OX40 antibody may be administered to a subject with an agent that targets a member of the IgSF family to increase an immune response.
- the anti-OX40 antibody may be administered with an agent that targets (or binds specifically to) a member of the B7 family of membrane-bound ligands that includes B7-1, B7-2, B7-H1 (PD-L1), B7-DC (PD-L2), B7-H2 (ICOS-L), B7-H3, B7-H4, B7-H5 (VISTA), and B7-H6 or a co-stimulatory or co-inhibitory receptor binding specifically to a B7 family member.
- an agent that targets (or binds specifically to) a member of the B7 family of membrane-bound ligands that includes B7-1, B7-2, B7-H1 (PD-L1), B7-DC (PD-L2), B7-H2 (ICOS-L), B7-H3, B7-H4, B7-H5 (VISTA), and B7-H6 or a co-stimulatory or co-inhibitory receptor binding specifically to a B7 family member.
- the anti-OX40 antibody may also be administered with an agent that targets a member of the TNF and TNFR family of molecules (ligands or receptors), such as CD40 and CD40L, GITR, GITR-L, CD70, CD27L, CD30, CD30L, 4-1BBL, CD137, TRAIL/Apo2-L, TRAILR1/DR4, TRAILR2/DR5, TRAILR3, TRAILR4, OPG, RANK, RANKL, TWEAKR/Fn14, TWEAK, BAFFR, EDAR, XEDAR, TACI, APRIL, BCMA, LT ⁇ R, LIGHT, DcR3, HVEM, VEGI/TL1A, TRAMP/DR3, EDA1, EDA2, TNFR1, Lymphotoxin ⁇ /TNF ⁇ , TNFR2, TNF ⁇ , LT ⁇ R, Lymphotoxin ⁇ 1 ⁇ 2, FAS, FASL, RELT, DR6, TROY, and
- T cell responses can be stimulated by a combination of anti-OX40 antibodies and one or more of the following agents:
- agents that modulate one of the above proteins and may be combined with the anti-OX40 antibody for treating cancer include: YervoyTM (ipilimumab) or Tremelimumab (to CTLA-4), galiximab (to B7.1), BMS-936558 (to PD-1), MK-3475 (to PD-1), AMP224 (to B7DC), BMS-936559 (to B7-H1), MPDL3280A (to B7-H1), MEDI-570 (to ICOS), AMG557 (to B7H2), MGA271 (to B7H3), IMP321 (to LAG-3), BMS-663513 (to CD137), PF-05082566 (to CD137), CDX-1127 (to CD27), Atacicept (to TACI), CP-870893 (to CD40), Lucatumumab (to CD40), Dacetuzumab (to CD40), Muromonab-CD3 (to CD3), Ip
- Anti-OX40 antibodies may also be administered with pidilizumab (CT-011).
- the anti-OX40 antibody can be combined with antagonists of KIR (e.g., lirilumab).
- T cell activation is also regulated by soluble cytokines, and anti-OX40 antibodies may be administered to a subject, e.g., having cancer, with antagonists of cytokines that inhibit T cell activation or agonists of cytokines that stimulate T cell activation.
- anti-OX40 antibodies can be used in combination with (i) antagonists (or inhibitors or blocking agents) of proteins of the IgSF family or B7 family or the TNF family that inhibit T cell activation or antagonists of cytokines that inhibit T cell activation (e.g., IL-6, IL-10, TGF- ⁇ , VEGF; “immunosuppressive cytokines”) and/or (ii) agonists of stimulatory receptors of the IgSF family, B7 family or the TNF family or of cytokines that stimulate T cell activation, for stimulating an immune response, e.g., for treating proliferative diseases, such as cancer.
- cytokines that inhibit T cell activation e.g., IL-6, IL-10, TGF- ⁇ , VEGF; “immunosuppressive cytokines”
- agonists of stimulatory receptors of the IgSF family, B7 family or the TNF family or of cytokines that stimulate T cell activation for stimulating an immune
- agents for combination therapies include agents that inhibit or deplete macrophages or monocytes, including but not limited to CSF-1R antagonists such as CSF-1R antagonist antibodies including RG7155 (WO11/70024, WO11/107553, WO11/131407, WO13/87699, WO13/119716, WO13/132044) or FPA-008 (WO11/140249; WO13169264; WO14/036357).
- CSF-1R antagonists such as CSF-1R antagonist antibodies including RG7155 (WO11/70024, WO11/107553, WO11/131407, WO13/87699, WO13/119716, WO13/132044) or FPA-008 (WO11/140249; WO13169264; WO14/036357).
- the anti-OX40 antibodies may also be administered with agents that inhibit TGF- ⁇ signaling.
- agents that enhance tumor antigen presentation e.g., dendritic cell vaccines, GM-CSF secreting cellular vaccines, CpG oligonucleotides, and imiquimod, or therapies that enhance the immunogenicity of tumor cells (e.g., anthracyclines).
- agents that enhance tumor antigen presentation e.g., dendritic cell vaccines, GM-CSF secreting cellular vaccines, CpG oligonucleotides, and imiquimod
- therapies that enhance the immunogenicity of tumor cells e.g., anthracyclines.
- therapies that may be combined with the anti-OX40 antibodies include therapies that deplete or block Treg cells, e.g., an agent that specifically binds to CD25.
- Another therapy that may be combined with the anti-OX40 antibodies is a therapy that inhibits a metabolic enzyme such as indoleamine dioxigenase (IDO), dioxigenase, arginase, or nitric oxide synthetase.
- IDO indoleamine dioxigenase
- dioxigenase dioxigenase
- arginase arginase
- nitric oxide synthetase nitric oxide synthetase
- agents that may be used with the anti-OX40 antibodies includes agents that inhibit the formation of adenosine or inhibit the adenosine A2A receptor.
- therapies that may be combined with anti-OX40 antibodies for treating cancer include therapies that reverse/prevent T cell anergy or exhaustion and therapies that trigger an innate immune activation and/or inflammation at a tumor site.
- the anti-OX40 antibody may be combined with more than one immuno-oncology agent, and may be, e.g., combined with a combinatorial approach that targets multiple elements of the immune pathway, such as one or more of the following: a therapy that enhances tumor antigen presentation (e.g., dendritic cell vaccine, GM-CSF secreting cellular vaccines, CpG oligonucleotides, imiquimod); a therapy that inhibits negative immune regulation e.g., by inhibiting CTLA-4 and/or PD1/PD-L1/PD-L2 pathway and/or depleting or blocking Tregs or other immune suppressing cells; a therapy that stimulates positive immune regulation, e.g., with agonists that stimulate the CD-137 and/or GITR pathway and/or stimulate T cell effector function; a therapy that increases systemically the frequency of anti-tumor T cells; a therapy that depletes or inhibits Tregs, such as Tregs in the tumor, e.g., using an
- Anti-OX40 antibodies can be used together with one or more of agonistic agents that ligate positive costimulatory receptors, blocking agents that attenuate signaling through inhibitory receptors, antagonists, and one or more agents that increase systemically the frequency of anti-tumor T cells, agents that overcome distinct immune suppressive pathways within the tumor microenvironment (e.g., block inhibitory receptor engagement (e.g., PD-L1/PD-1 interactions), deplete or inhibit Tregs (e.g., using an anti-CD25 monoclonal antibody (e.g., daclizumab) or by ex vivo anti-CD25 bead depletion), inhibit metabolic enzymes such as IDO, or reverse/prevent T cell anergy or exhaustion) and agents that trigger innate immune activation and/or inflammation at tumor sites.
- agonistic agents that ligate positive costimulatory receptors e.g., blocking agents that attenuate signaling through inhibitory receptors, antagonists, and one or more agents that increase systemically
- the anti-OX40 antibody is administered to a subject together with a BRAF inhibitor if the subject is BRAF V600 mutation positive.
- the anti-OX40 antibody is administered together with another immunostimulatory antibody.
- an anti-PD-1 antagonist e.g., antagonist antibody
- an anti-PD-L1 antagonist e.g., antagonist antibody
- an antagonist anti-CTLA-4 antagonist e.g., antagonist antibody and/or an anti-LAG3 antagonist, e.g., an antagonist antibody
- an anti-PD-1 antagonist e.g., antagonist antibody
- an anti-PD-L1 antagonist e.g., antagonist antibody
- an antagonist anti-CTLA-4 antagonist e.g., antagonist antibody and/or an anti-LAG3 antagonist
- an antagonist antibody such that an immune response is stimulated in the subject, for example to inhibit tumor growth or to stimulate an anti-viral response.
- the subject is administered the anti-OX40 antibody and an antagonist anti-PD-1 antibody.
- the subject is administered the anti-OX40 antibody and an antagonist anti-PD-L1 antibody. In one embodiment, the subject is administered the anti-OX40 antibody and an antagonist anti-CTLA-4 antibody. In one embodiment, the anti-OX40 antibody is a human antibody. Alternatively, the anti-OX40 antibody can be, for example, a chimeric or humanized antibody. In one embodiment, the at least one additional immunostimulatory antibody (e.g., an antagonist anti-PD-1, an antagonist anti-PD-L1, an antagonist anti-CTLA-4 and/or an antagonist anti-LAG3 antibody) is a human antibody.
- an antagonist anti-PD-1, an antagonist anti-PD-L1, an antagonist anti-CTLA-4 and/or an antagonist anti-LAG3 antibody is a human antibody.
- the at least one additional immunostimulatory antibody can be, for example, a chimeric or humanized antibody (e.g., prepared from a mouse anti-PD-1, anti-PD-L1, anti-CTLA-4 and/or anti-LAG3 antibody).
- a chimeric or humanized antibody e.g., prepared from a mouse anti-PD-1, anti-PD-L1, anti-CTLA-4 and/or anti-LAG3 antibody.
- a hyperproliferative disease e.g., cancer
- administering the anti-OX40 antibody with an antagonist PD-1 antibody, an antagonist PD-L1 antibody, an anti-CTLA-4 antibody, or an anti-LAG3 antibody comprising administering the anti-OX40 antibody with an antagonist PD-1 antibody, an antagonist PD-L1 antibody, an anti-CTLA-4 antibody, or an anti-LAG3 antibody to a subject.
- one or both antibodies are administered at a subtherapeutic dose.
- methods for altering an adverse event associated with treatment of a hyperproliferative disease with an immunostimulatory agent comprising administering the anti-OX40 antibody and a subtherapeutic dose of an anti-PD-1, anti-PD-L1, anti-CTLA-4, or anti-LAG3 antibody to a subject (e.g., a human).
- the anti-OX40 antibody comprises the CDRs or variable regions of 3F4, 14B6-1, 14B6-2, 23H3, 6E1-1, 6E1-2, 18E9, 8B11, 20B3, 14A2-1, 14A2-2, and 20C1, or is another agonist anti-OX40 antibody described herein.
- Suitable PD-1 antagonists for use in the methods described herein include, without limitation, ligands, antibodies (e.g., monoclonal antibodies and bispecific antibodies), and multivalent agents.
- the PD-1 antagonist is a fusion protein, e.g., an Fc fusion protein, such as AMP-244.
- the PD-1 antagonist is an anti-PD-1 or anti-PD-L1 antibody.
- An exemplary anti-PD-1 antibody is nivolumab (BMS-936558) or an antibody that comprises the CDRs or variable regions of one of antibodies 17D8, 2D3, 4H1, 5C4, 7D3, 5F4 and 4A11 described in WO 2006/121168.
- an anti-PD1 antibody is MK-3475 (Lambrolizumab) described in WO2012/145493; and AMP-514 described in WO 2012/145493.
- Further known PD-1 antibodies and other PD-1 inhibitors include those described in WO 2009/014708, WO 03/099196, WO 2009/114335, WO 2011/066389, WO 2011/161699, WO 2012/145493, U.S. Pat. Nos.
- any of the anti-PD-1 antibodies disclosed in WO2013/173223 may also be used.
- An anti-PD-1 antibody that competes for binding with, and/or binds to the same epitope on PD-1 as, as one of these antibodies may also be used in combination treatments.
- Another approach to target the PD-1 receptor is the recombinant protein composed of the extracellular domain of PD-L2 (B7-DC) fused to the Fc portion of IgG1, called AMP-224.
- the antibody has at least about 90% variable region amino acid sequence identity with the above-mentioned antibodies.
- the anti-OX40 antibody is used in combination with nivolumab, which comprises heavy and light chains comprising the sequences shown in SEQ ID NOs: 299 and 300, respectively, or antigen binding fragments and variants thereof.
- the antibody has heavy and light chain CDRs or variable regions of nivolumab. Accordingly, in one embodiment, the antibody comprises CDR1, CDR2, and CDR3 domains of the VH of nivolumab having the sequence set forth in SEQ ID NO: 301, and CDR1, CDR2 and CDR3 domains of the VL of nivolumab having the sequence set forth in SEQ ID NO: 302.
- the antibody comprises CDR1, CDR2 and CDR3 domains comprising the sequences set forth in SEQ ID NOs: 303-305, respectively, and CDR1, CDR2 and CDR3 domains comprising the sequences set forth in SEQ ID NOs: 306-308, respectively.
- the antibody comprises VH and/or VL regions comprising the amino acid sequences set forth in SEQ ID NO: 301 and/or SEQ ID NO: 302, respectively.
- the antibody has at least about 90%, e.g., at least about 90%, 95%, or 99% variable region identity with SEQ ID NO: 301 or SEQ ID NO: 302.
- Exemplary anti-PD-L1 antibodies include BMS-936559 (referred to as 12A4 in WO 2007/005874 and U.S. Pat. No. 7,943,743), or an antibody that comprises the CDRs or variable regions of 3G10, 12A4, 10A5, 5F8, 10H10, 1B12, 7H1, 11E6, 12B7 and 13G4, which are described in PCT Publication WO 07/005874 and U.S. Pat. No. 7,943,743.
- the anti-PD-L1 antibody is MEDI4736 (also known as Anti-B7-H1), MPDL3280A (also known as RG7446), MSB0010718C (WO2013/79174), or rHigM12B7.
- any of the anti-PD-L1 antibodies disclosed in WO2013/173223, WO2011/066389, WO2012/145493, U.S. Pat. Nos. 7,635,757 and 8,217,149 and U.S. Publication No. 2009/145493 may also be used.
- Exemplary anti-CTLA-4 antibodies include YervoyTM (ipilimumab or antibody 10D1, described in PCT Publication WO 01/14424), tremelimumab (formerly ticilimumab, CP-675,206), or an anti-CTLA-4 antibody described in any of the following publications: WO 98/42752; WO 00/37504; U.S. Pat. No. 6,207,156; Hurwitz et al. (1998) Proc. Natl. Acad. Sci. USA 95(17):10067-10071; Camacho et al. (2004) J. Clin. Oncology 22(145): Abstract No. 2505 (antibody CP-675206); and Mokyr et al. (1998) Cancer Res. 58:5301-5304. Any of the anti-CTLA-4 antibodies disclosed in WO2013/173223 may also be used.
- anti-LAGS antibodies include antibodies comprising the CDRs or variable regions of antibodies 25F7, 26H10, 25E3, 8B7, 11F2 or 17E5, which are described in U.S. Patent Publication No. US2011/0150892, WO10/19570 and WO2014/008218.
- an anti-LAG-3 antibody is BMS-986016.
- Other art recognized anti-LAG-3 antibodies that can be used include IMP731 and IMP-321, described in US 2011/007023, WO08/132601, and WO09/44273.
- the anti-OX40 antibody is used in combination with ipilimumab.
- the antibody has heavy and light chain CDRs or variable regions of ipilimumab. Accordingly, in one embodiment, the antibody comprises CDR1, CDR2, and CDR3 domains of the VH of ipilimumab having the sequence set forth in SEQ ID NO: 309, and CDR1, CDR2 and CDR3 domains of the VL of ipilimumab having the sequence set forth in SEQ ID NO: 310.
- the antibody comprises CDR1, CDR2 and CDR3 domains comprising the sequences set forth in SEQ ID NOs: 311-313, respectively, and CDR1, CDR2 and CDR3 domains comprising the sequences set forth in SEQ ID NOs: 314-316, respectively.
- the antibody comprises VH and/or VL regions comprising the amino acid sequences set forth in SEQ ID NO: 309 and/or SEQ ID NO: 310, respectively.
- the antibody has at least about 90%, e.g., at least about 90%, 95%, or 99% variable region identity with SEQ ID NO: 309 or SEQ ID NO: 310.
- anti-OX40 antibodies and antagonists e.g., antagonist antibodies
- one or more second target antigens such as LAG-3 and/or CTLA-4 and/or PD-1 and/or PD-L1
- cancers whose growth may be inhibited using anti-OX40 antibodies include cancers typically responsive to immunotherapy and those that are not typically responsive to immunotherapy.
- Representative examples of cancers for treatment with the combination therapy of the instant disclosure include those cancers listed herein.
- the combination of therapeutic antibodies discussed herein can be administered concurrently as a single composition in a pharmaceutically acceptable carrier, or concurrently as separate compositions with each antibody in a pharmaceutically acceptable carrier.
- the combination of therapeutic antibodies can be administered sequentially.
- the order of the sequential administration can be reversed or kept in the same order at each time point of administration, and sequential administrations can be combined with concurrent administrations, or any combination thereof.
- the first administration of a combination of anti-OX40 antibody and anti-PD1 antibody can be concurrent
- the second administration can be sequential with anti-PD1 antibody first and the anti-OX40 antibody second
- the third administration can be sequential with the anti-OX40 antibody first and anti-PD1 antibody second
- Another representative dosing scheme involves a first administration that is sequential with the anti-OX40 first and anti-PD1 antibody (and/or anti-CTLA-4 antibody and/or anti-PD-L1 antibody and/or anti-LAG-3 antibody) second, and subsequent administrations may be concurrent.
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject of the anti-OX40 antibody and an immuno-oncology agent.
- immune-oncology agents include CD137 (4-1BB) agonists (e.g., an agonistic CD137 antibody such as urelumab or PF-05082566 (WO12/32433)); GITR agonists (e.g., an agonistic anti-GITR antibody), CD40 agonists (e.g., an agonistic CD40 antibody); CD40 antagonists (e.g., an antagonistic CD40 antibody such as lucatumumab (HCD122), dacetuzumab (SGN-40), CP-870,893 or Chi Lob 7/4); CD27 agonists (e.g., an agonistic CD27 antibody such as varlilumab (CDX-1127)), MGA271 (to B7H3) (WO11/109400
- the anti-OX40 antibody is administered prior to administration of a second agent, e.g., an immuno-oncology agent.
- a second agent e.g., an immuno-oncology agent.
- the anti-OX40 antibody is administered concurrently with the second agent, e.g., an immunology-oncology agent.
- the anti-OX40 antibody is administered after administration of the second agent.
- the administration of the two agents may start at times that are, e.g., 30 minutes, 60 minutes, 90 minutes, 120 minutes, 3 hours, 6 hours, 12 hours, 24 hours, 36 hours, 48 hours, 3 days, 5 days, 7 days, or one or more weeks apart, or administration of the second agent may start, e.g., 30 minutes, 60 minutes, 90 minutes, 120 minutes, 3 hours, 6 hours, 12 hours, 24 hours, 36 hours, 48 hours, 3 days, 5 days, 7 days, or one or more weeks after the first agent has been administered.
- the anti-OX40 antibody and a second agent are administered simultaneously, e.g., are infused simultaneously, e.g., over a period of 30 or 60 minutes, to a patient.
- the anti-OX40 antibody may be co-formulated with the second agent, e.g., an immuno-oncology agent.
- the anti-OX40 antibody as sole immunotherapeutic agent, or a combination of the anti-OX40 antibody and one or more additional immunotherapeutic antibodies can be further combined with an immunogenic agent, such as cancerous cells, purified tumor antigens (including recombinant proteins, peptides, and carbohydrate molecules), cells, and cells transfected with genes encoding immune stimulating cytokines (He et al. (2004) J. Immunol. 173:4919-28).
- an immunogenic agent such as cancerous cells, purified tumor antigens (including recombinant proteins, peptides, and carbohydrate molecules), cells, and cells transfected with genes encoding immune stimulating cytokines (He et al. (2004) J. Immunol. 173:4919-28).
- Non-limiting examples of tumor vaccines that can be used include peptides of melanoma antigens, such as peptides of gp100, MAGE antigens, Trp-2, MART1 and/or tyrosinase, or tumor cells transfected to express the cytokine GM-CSF (discussed further below).
- a combination of the anti-OX40 antibody and one or more additional antibodies e.g., CTLA-4 and/or PD-1 and/or PD-L1 and/or LAG-3 blockade
- additional antibodies e.g., CTLA-4 and/or PD-1 and/or PD-L1 and/or LAG-3 blockade
- a combination of the anti-OX40 antibody and one or more additional antibodies can be effectively combined with chemotherapeutic regimes.
- additional antibodies e.g., CTLA-4 and/or PD-1 and/or PD-L1 and/or LAG-3 blockade
- the dose of other chemotherapeutic reagent administered with the combination can be reduced (Mokyr et al. (1998) Cancer Research 58: 5301-5304).
- such a combination may include the anti-OX40 antibody with or without and an additional antibody (e.g., anti-CTLA-4 antibodies and/or anti-PD-1 antibodies and/or anti-PD-L1 antibodies and/or anti-LAG-3 antibodies), further in combination with decarbazine or interleukin-2 (IL-2) for the treatment of melanoma.
- an additional antibody e.g., anti-CTLA-4 antibodies and/or anti-PD-1 antibodies and/or anti-PD-L1 antibodies and/or anti-LAG-3 antibodies
- IL-2 interleukin-2
- combination therapies that may result in synergy with a combination of the anti-OX40 antibody with or without and CTLA-4 and/or PD-1 and/or PD-L1 and/or LAG-3 blockade through cell death include radiation, surgery, or hormone deprivation. Each of these protocols creates a source of tumor antigen in the host.
- Angiogenesis inhibitors can also be combined with a combination of the anti-OX40 antibody and CTLA-4 and/or PD-1 and/or PD-L1 and/or LAG-3 blockade. Inhibition of angiogenesis leads to tumor cell death, which can be a source of tumor antigen fed into host antigen presentation pathways.
- the anti-OX40 antibody can be used as the sole immunotherapeutic agent, or a combination of the anti-OX40 antibody and CTLA-4 and/or PD-1 and/or PD-L1 and/or LAG-3 blocking antibodies, can also be used in combination with bispecific antibodies that target Fc ⁇ or Fc ⁇ receptor-expressing effector cells to tumor cells (see, e.g., U.S. Pat. Nos. 5,922,845 and 5,837,243). Bispecific antibodies can be used to target two separate antigens. The T cell arm of these responses would be augmented by the use of a combination of the anti-OX40 antibody and CTLA-4 and/or PD-1 and/or PD-L1 and/or LAG-3 blockade.
- the anti-OX40 antibody can be used as the sole immunotherapeutic agent, or a combination of the anti-OX40 antibody and additional immunostimulating agent, e.g., anti-CTLA-4 antibody and/or anti-PD-1 antibody and/or anti-PD-L1 antibody and/or LAG-3 agent (e.g., antibody) can be used in conjunction with an anti-neoplastic antibody, such as Rituxan® (rituximab), Herceptin® (trastuzumab), Bexxar® (tositumomab), Zevalin® (ibritumomab), Campath® (alemtuzumab), Lymphocide® (eprtuzumab), Avastin® (bevacizumab), and Tarceva® (erlotinib), and the like.
- additional immunostimulating agent e.g., anti-CTLA-4 antibody and/or anti-PD-1 antibody and/or anti-PD-L1 antibody and/or LAG-3 agent
- cancer cell death e.g., tumor cells
- the immunostimulating agent e.g., OX40, CTLA-4, PD-1, PD-L1 or LAG-3 agent, e.g., antibody
- a treatment of a hyperproliferative disease can include an anti-cancer agent (e.g., antibody) in combination with the anti-OX40 antibody and optionally an additional immunostimulating agent, e.g., anti-CTLA-4 and/or anti-PD-1 and/or anti-PD-L1 and/or anti-LAG-3 agent (e.g., antibody), concurrently or sequentially or any combination thereof, which can potentiate an anti-tumor immune responses by the host.
- an anti-cancer agent e.g., antibody
- an additional immunostimulating agent e.g., anti-CTLA-4 and/or anti-PD-1 and/or anti-PD-L1 and/or anti-LAG-3 agent (e.g., antibody
- Tumors evade host immune surveillance by a large variety of mechanisms. Many of these mechanisms may be overcome by the inactivation of proteins, which are expressed by the tumors and which are immunosuppressive. These include, among others, TGF- ⁇ (Kehrl et al. (1986) J. Exp. Med. 163: 1037-1050), IL-10 (Howard & O'Garra (1992) Immunology Today 13: 198-200), and Fas ligand (Hahne et al. (1996) Science 274: 1363-1365).
- Antibodies to each of these entities can be further combined with the anti-OX40 antibody with or without an additional immunostimulating agent, e.g., an anti-CTLA-4 and/or anti-PD-1 and/or anti-PD-L1 and/or anti-LAG-3 agent, such as antibody, to counteract the effects of immunosuppressive agents and favor anti-tumor immune responses by the host.
- an additional immunostimulating agent e.g., an anti-CTLA-4 and/or anti-PD-1 and/or anti-PD-L1 and/or anti-LAG-3 agent, such as antibody
- agents that can be used to activate host immune responsiveness can be further used in combination with the anti-OX40 antibody with or without an additional immunostimulating agent, such as anti-CTLA-4 and/or anti-PD-1 and/or anti-PD-L1 and/or anti-LAG-3 antibody.
- additional immunostimulating agent such as anti-CTLA-4 and/or anti-PD-1 and/or anti-PD-L1 and/or anti-LAG-3 antibody.
- Anti-CD40 antibodies can be used in conjunction with the anti-OX40 antibody and optionally an additional immunostimulating agent, e.g., an anti-CTLA-4 and/or anti-PD-1 and/or anti-PD-L1 and/or anti-LAG-3 agent, e.g., antibody.
- Other activating antibodies to T cell costimulatory molecules Weinberg et al., supra, Melero et al. supra, Hutloff et al., supra, may also provide for increased levels of T cell activation.
- Anti-OX40 immunotherapy alone or combined with CTLA-4 and/or PD-1 and/or PD-L1 and/or LAG-3 blockade can be used to increase the effectiveness of the donor engrafted tumor specific T cells.
- a hyperproliferative disease e.g., cancer
- an immunostimulatory agent comprising administering the anti-OX40 antibody with or without an anti-CTLA-4 and/or anti-PD-1 and/or anti-PD-L1 and/or anti-LAG-3 agent (e.g., antibody), to a subject.
- the methods described herein provide for a method of reducing the incidence of immunostimulatory therapeutic antibody-induced colitis or diarrhea by administering a non-absorbable steroid to the patient.
- a “non-absorbable steroid” is a glucocorticoid that exhibits extensive first pass metabolism such that, following metabolism in the liver, the bioavailability of the steroid is low, i.e., less than about 20%.
- the non-absorbable steroid is budesonide.
- Budesonide is a locally-acting glucocorticosteroid, which is extensively metabolized, primarily by the liver, following oral administration.
- ENTOCORT EC® (Astra-Zeneca) is a pH- and time-dependent oral formulation of budesonide developed to optimize drug delivery to the ileum and throughout the colon.
- ENTOCORT EC® is approved in the U.S. for the treatment of mild to moderate Crohn's disease involving the ileum and/or ascending colon.
- the usual oral dosage of ENTOCORT EC® for the treatment of Crohn's disease is 6 to 9 mg/day.
- ENTOCORT EC® is released in the intestines before being absorbed and retained in the gut mucosa. Once it passes through the gut mucosa target tissue, ENTOCORT EC® is extensively metabolized by the cytochrome P450 system in the liver to metabolites with negligible glucocorticoid activity. Therefore, the bioavailability is low (about 10%).
- budesonide results in an improved therapeutic ratio compared to other glucocorticoids with less extensive first-pass metabolism.
- Budesonide results in fewer adverse effects, including less hypothalamic-pituitary suppression, than systemically-acting corticosteroids.
- chronic administration of ENTOCORT EC® can result in systemic glucocorticoid effects such as hypercorticism and adrenal suppression. See PDR 58 th ed. 2004; 608-610.
- the anti-OX40 antibody with or without CTLA-4 and/or PD-1 and/or PD-L1 and/or LAG-3 blockade i.e., anti-CTLA-4 and/or anti-PD-1 and/or anti-PD-Ll and/or anti-LAG-3 antibodies
- a non-absorbable steroid in conjunction with a non-absorbable steroid can be further combined with a salicylate.
- Salicylates include 5-ASA agents such as, for example: sulfasalazine (AZULFIDINE®, Pharmacia & UpJohn); olsalazine (DIPENTUM®, Pharmacia & UpJohn); balsalazide (COLAZAL®, Salix Pharmaceuticals, Inc.); and mesalamine (ASACOL®, Procter & Gamble Pharmaceuticals; PENTASA®, Shire US; CANASA®, Axcan Scandipharm, Inc.; ROWASA®, Solvay).
- 5-ASA agents such as, for example: sulfasalazine (AZULFIDINE®, Pharmacia & UpJohn); olsalazine (DIPENTUM®, Pharmacia & UpJohn); balsalazide (COLAZAL®, Salix Pharmaceuticals, Inc.); and mesalamine (ASACOL®, Procter & Gamble Pharmaceuticals; PENTASA®, Shire US; CANASA®, Axcan Scandipharm
- a salicylate administered in combination with the anti-OX40 antibody with or without anti-CTLA-4 and/or anti-PD-1 and/or anti-PD-L1 and/or LAG-3 antibodies and a non-absorbable steroid can include any overlapping or sequential administration of the salicylate and the non-absorbable steroid for the purpose of decreasing the incidence of colitis induced by the immunostimulatory antibodies.
- methods for reducing the incidence of colitis induced by the immunostimulatory antibodies described herein encompass administering a salicylate and a non-absorbable concurrently or sequentially (e.g., a salicylate is administered 6 hours after a non-absorbable steroid), or any combination thereof.
- a salicylate and a non-absorbable steroid can be administered by the same route (e.g., both are administered orally) or by different routes (e.g., a salicylate is administered orally and a non-absorbable steroid is administered rectally), which may differ from the route(s) used to administer the anti-OX40 antibody and anti-CTLA-4 and/or anti-PD-1 and/or anti-PD-L1 and/or anti-LAG-3 antibodies.
- Anti-OX40 antibodies and combination antibody therapies described herein may also be used in conjunction with other well-known therapies that are selected for their particular usefulness against the indication being treated (e.g., cancer). Combinations with anti-OX40 antibodies may be used sequentially with known pharmaceutically acceptable agent(s).
- anti-OX40 antibodies and combination antibody therapies described herein can be used in combination (e.g., simultaneously or separately) with an additional treatment, such as irradiation, chemotherapy (e.g., using camptothecin (CPT-11), 5-fluorouracil (5-FU), cisplatin, doxorubicin, irinotecan, paclitaxel, gemcitabine, cisplatin, paclitaxel, carboplatin-paclitaxel (Taxol), doxorubicin, 5-fu, or camptothecin+apo21/TRAIL (a 6 ⁇ combo)), one or more proteasome inhibitors (e.g., bortezomib or MG132), one or more Bcl-2 inhibitors (e.g., BH3I-2′ (bcl-x1 inhibitor), indoleamine dioxygenase-1 inhibitor (e.g., INCB24360, indoximod, NLG-919, or F00128
- Anti-OX40 antibodies and combination antibody therapies described herein can further be used in combination with one or more anti-proliferative cytotoxic agents.
- Classes of compounds that may be used as anti-proliferative cytotoxic agents include, but are not limited to, the following:
- Alkylating agents including, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes: Uracil mustard, Chlormethine, Cyclophosphamide (CYTOXANTM) fosfamide, Melphalan, Chlorambucil, Pipobroman, Triethylenemelamine, Triethylenethiophosphoramine, Busulfan, Carmustine, Lomustine, Streptozocin, dacarbazine, and Temozolomide.
- Uracil mustard Chlormethine
- Melphalan Chlorambucil
- Pipobroman Triethylenemelamine
- Triethylenethiophosphoramine Triethylenethiophosphoramine
- Busulfan Carmustine, Lomustine, Streptozocin, dacarbazine, and Temozolomide.
- Antimetabolites including, without limitation, folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors: Methotrexate, 5-Fluorouracil, Floxuridine, Cytarabine, 6-Mercaptopurine, 6-Thioguanine, Fludarabine phosphate, Pentostatine, and Gemcitabine.
- Suitable anti-proliferative agents for combining with anti-OX40 antibodies without limitation, taxanes, paclitaxel (paclitaxel is commercially available as TAXOLTM), docetaxel, discodermolide (DDM), dictyostatin (DCT), Peloruside A, epothilones, epothilone A, epothilone B, epothilone C, epothilone D, epothilone E, epothilone F, furanoepothilone D, desoxyepothilone B1, [17]-dehydrodesoxyepothilone B, [18]dehydrodesoxyepothilones B, C12,13-cyclopropyl-epothilone A, C6-C8 bridged epothilone A, trans-9,10-dehydroepothilone D, cis-9,10-dehydroepothilone D, 16-desmethylepot
- hormones and steroids including synthetic analogs
- steroids such as 17a-Ethinylestradiol, Diethylstilbestrol, Testosterone, Prednisone, Fluoxymesterone, Dromostanolone propionate, Testolactone, Megestrolacetate, Methylprednisolone, Methyl-testosterone, Prednisolone, Triamcinolone, Chlorotrianisene, Hydroxyprogesterone, Aminoglutethimide, Estramustine, Medroxyprogesteroneacetate, Leuprolide, Flutamide, Toremifene, ZOLADEXTM, can also be administered to the patient.
- other agents used in the modulation of tumor growth or metastasis in a clinical setting such as antimimetics, can also be administered as
- the anti-OX40 antibody is administered in combination (concurrently or separately) with nivolumab to treat a patient with cancer, for example, colorectal or bladder cancer.
- the anti-OX40 antibody is administered in combination (concurrently or separately) with ipilimumab to treat a patient with cancer, for example, ovarian, bladder, or prostate cancer.
- chemotherapeutic agents are known to those skilled in the art. In addition, their administration is described in the standard literature. For example, the administration of many of the chemotherapeutic agents is described in the Physicians' Desk Reference (PDR), e.g., 1996 edition (Medical Economics Company, Montvale, N.J. 07645-1742, USA); the disclosure of which is incorporated herein by reference thereto.
- PDR Physicians' Desk Reference
- the chemotherapeutic agent(s) and/or radiation therapy can be administered according to therapeutic protocols well known in the art.
- the administration of the chemotherapeutic agent(s) and/or radiation therapy can be varied depending on the disease being treated and the known effects of the chemotherapeutic agent(s) and/or radiation therapy on that disease.
- the therapeutic protocols e.g., dosage amounts and times of administration
- the therapeutic protocols can be varied in view of the observed effects of the administered therapeutic agents on the patient, and in view of the observed responses of the disease to the administered therapeutic agents.
- kits which include a pharmaceutical composition containing an anti-OX40 antibody (e.g., OX40.21) and an anti-PD-1 (e.g., nivolumab) or anti-CTLA-4 (ipilimumab) antibody, and a pharmaceutically-acceptable carrier, in a therapeutically effective amount adapted for use in the preceding methods.
- the kits optionally also can include instructions, e.g., comprising administration schedules, to allow a practitioner (e.g., a physician, nurse, or patient) to administer the composition contained therein to administer the composition to a patient having cancer (e.g., a solid tumor).
- the kit also can include a syringe.
- kits include multiple packages of the single-dose pharmaceutical compositions each containing an effective amount of the anti-OX40 antibody or anti-PD-1 or anti-CTLA-4 antibody for a single administration in accordance with the methods provided above.
- Instruments or devices necessary for administering the pharmaceutical composition(s) also may be included in the kits.
- a kit may provide one or more pre-filled syringes containing an amount of the anti-OX40 antibody or anti-PD-1 or anti-CTLA-4 antibody.
- the present invention provides a kit for treating a solid tumor in a human patient, the kit comprising a dose of an anti-OX40 antibody comprising CDR1, CDR2 and CDR3 domains of the heavy chain variable region having the sequence set forth in SEQ ID NO: 318, and CDR1, CDR2 and CDR3 domains of the light chain variable region having the sequence set forth in SEQ ID NO: 94, and instructions for use in the methods described herein.
- the antibody, or antigen binding portion thereof, of any one of the preceding embodiments, wherein the antibody increases IL-2 and/or IFN- ⁇ production in OX40-expressing T cells. 6.
- heavy chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 31-33, respectively, and/or light chain CDR1, CDR2, and CDR3 sequences comprising SEQ ID NOs: 34-36, respectively;
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Cell Biology (AREA)
- Engineering & Computer Science (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Microbiology (AREA)
- Reproductive Health (AREA)
- Pregnancy & Childbirth (AREA)
- Gynecology & Obstetrics (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Food Science & Technology (AREA)
- Biotechnology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Endocrinology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/577,375 US20180237534A1 (en) | 2015-05-29 | 2016-05-26 | Antibodies against ox40 and uses thereof |
Applications Claiming Priority (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562168377P | 2015-05-29 | 2015-05-29 | |
| US201562239574P | 2015-10-09 | 2015-10-09 | |
| US201562264691P | 2015-12-08 | 2015-12-08 | |
| US201662327140P | 2016-04-25 | 2016-04-25 | |
| US201662333556P | 2016-05-09 | 2016-05-09 | |
| PCT/US2016/034470 WO2016196228A1 (en) | 2015-05-29 | 2016-05-26 | Antibodies against ox40 and uses thereof |
| US15/577,375 US20180237534A1 (en) | 2015-05-29 | 2016-05-26 | Antibodies against ox40 and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20180237534A1 true US20180237534A1 (en) | 2018-08-23 |
Family
ID=56121193
Family Applications (5)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/577,375 Abandoned US20180237534A1 (en) | 2015-05-29 | 2016-05-26 | Antibodies against ox40 and uses thereof |
| US15/166,114 Active US9644032B2 (en) | 2015-05-29 | 2016-05-26 | Antibodies against OX40 and uses thereof |
| US15/474,731 Active 2037-04-02 US10683357B2 (en) | 2015-05-29 | 2017-03-30 | Antibodies against OX40 and uses thereof |
| US16/847,130 Active US11466092B2 (en) | 2015-05-29 | 2020-04-13 | Antibodies against OX-40 and uses thereof |
| US17/819,287 Abandoned US20230272100A1 (en) | 2015-05-29 | 2022-08-11 | Antibodies against ox-40 and uses thereof |
Family Applications After (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/166,114 Active US9644032B2 (en) | 2015-05-29 | 2016-05-26 | Antibodies against OX40 and uses thereof |
| US15/474,731 Active 2037-04-02 US10683357B2 (en) | 2015-05-29 | 2017-03-30 | Antibodies against OX40 and uses thereof |
| US16/847,130 Active US11466092B2 (en) | 2015-05-29 | 2020-04-13 | Antibodies against OX-40 and uses thereof |
| US17/819,287 Abandoned US20230272100A1 (en) | 2015-05-29 | 2022-08-11 | Antibodies against ox-40 and uses thereof |
Country Status (31)
| Country | Link |
|---|---|
| US (5) | US20180237534A1 (https=) |
| EP (1) | EP3303396B1 (https=) |
| JP (3) | JP6797137B2 (https=) |
| KR (1) | KR20180010264A (https=) |
| CN (1) | CN108137687B (https=) |
| AU (1) | AU2016271111B2 (https=) |
| BR (1) | BR112017025191A2 (https=) |
| CA (1) | CA2987410A1 (https=) |
| CO (1) | CO2017013235A2 (https=) |
| DK (1) | DK3303396T5 (https=) |
| EA (1) | EA035412B1 (https=) |
| ES (1) | ES2936317T3 (https=) |
| FI (1) | FI3303396T3 (https=) |
| HR (1) | HRP20230060T1 (https=) |
| HU (1) | HUE061253T2 (https=) |
| IL (1) | IL255949B2 (https=) |
| LT (1) | LT3303396T (https=) |
| MX (1) | MX2017015041A (https=) |
| MY (1) | MY188049A (https=) |
| PE (1) | PE20180926A1 (https=) |
| PH (1) | PH12017502129A1 (https=) |
| PL (1) | PL3303396T3 (https=) |
| PT (1) | PT3303396T (https=) |
| RS (1) | RS63897B1 (https=) |
| SG (1) | SG10202008304TA (https=) |
| SI (1) | SI3303396T1 (https=) |
| SM (1) | SMT202300013T1 (https=) |
| TN (2) | TN2019000101A1 (https=) |
| TW (1) | TWI732760B (https=) |
| UY (1) | UY36687A (https=) |
| WO (1) | WO2016196228A1 (https=) |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20220281974A1 (en) * | 2015-04-28 | 2022-09-08 | Bristol-Myers Squibb Company | Treatment of pd-l1-positive melanoma using an anti-pd-1 antibody |
| CN115052888A (zh) * | 2019-12-03 | 2022-09-13 | 上海交通大学医学院 | FcγRIIB亲和力增强的抗体Fc区 |
| US11466092B2 (en) | 2015-05-29 | 2022-10-11 | Bristol-Myers Squibb Company | Antibodies against OX-40 and uses thereof |
| JP2023519584A (ja) * | 2020-03-23 | 2023-05-11 | バイオ - テラ ソリューションズ、リミテッド | 免疫細胞活性化剤の開発及び応用 |
| WO2023152116A1 (en) | 2022-02-08 | 2023-08-17 | Hookipa Biotech Gmbh | Combination therapy with arenavirus particles and immune checkpoint modulators or cytokines |
| JP2025131565A (ja) * | 2021-01-28 | 2025-09-09 | アステリア セラピューティクス,インコーポレイテッド | 血漿カリクレイン抗体及びその使用 |
| US12590154B2 (en) | 2012-05-15 | 2026-03-31 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting PD-1/PD-L1 signaling |
| US12590153B2 (en) | 2015-04-28 | 2026-03-31 | Bristol-Myers Squibb Company | Treatment of PD-L1-negative melanoma using an anti-PD-1 antibody and an anti-CTLA-4 antibody |
| US12617850B2 (en) * | 2022-03-22 | 2026-05-05 | Bristol-Myers Squibb Company | Treatment of PD-L1-positive melanoma using an anti-PD-1 antibody |
Families Citing this family (83)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10053513B2 (en) | 2009-11-30 | 2018-08-21 | Janssen Biotech, Inc. | Antibody Fc mutants with ablated effector functions |
| CA2809089C (en) * | 2010-08-23 | 2018-12-18 | Board Of Regents, The University Of Texas System | Anti-ox40 antibodies and methods of using the same |
| KR20160146747A (ko) | 2014-03-31 | 2016-12-21 | 제넨테크, 인크. | 항혈관신생제 및 ox40 결합 효능제를 포함하는 조합 요법 |
| CN121159719A (zh) | 2015-04-17 | 2025-12-19 | 高山免疫科学股份有限公司 | 具有可调的亲和力的免疫调节蛋白 |
| SG11201708804WA (en) | 2015-05-07 | 2017-11-29 | Agenus Inc | Anti-ox40 antibodies and methods of use thereof |
| WO2017063162A1 (zh) | 2015-10-15 | 2017-04-20 | 苏州丁孚靶点生物技术有限公司 | 抗ox40抗体及其应用 |
| CN108883173B (zh) | 2015-12-02 | 2022-09-06 | 阿吉纳斯公司 | 抗体和其使用方法 |
| US20210206854A1 (en) * | 2016-01-27 | 2021-07-08 | Bristol-Myers Squibb Company | Treatment of lung cancer using a combination of an anti-pd-1 antibody and another anti-cancer agent |
| WO2017181152A2 (en) | 2016-04-15 | 2017-10-19 | Alpine Immune Sciences, Inc. | Cd80 variant immunomodulatory proteins and uses thereof |
| RU2769282C2 (ru) | 2016-06-20 | 2022-03-30 | Кимаб Лимитед | Анти-PD-L1 и IL-2 цитокины |
| CN109843327B (zh) | 2016-07-07 | 2022-05-13 | 小利兰·斯坦福大学托管委员会 | 抗体佐剂缀合物 |
| WO2018022945A1 (en) | 2016-07-28 | 2018-02-01 | Alpine Immune Sciences, Inc. | Cd112 variant immunomodulatory proteins and uses thereof |
| ES2981272T3 (es) | 2016-09-23 | 2024-10-08 | Merus Nv | Moléculas de unión que modulan una actividad biológica expresada por una célula |
| MA46770A (fr) | 2016-11-09 | 2019-09-18 | Agenus Inc | Anticorps anti-ox40, anticorps anti-gitr, et leurs procédés d'utilisation |
| US20200347143A1 (en) * | 2016-12-19 | 2020-11-05 | Glenmark Pharmaceuticals S.A. | Novel tnfr agonists and uses thereof |
| AU2018219887B2 (en) | 2017-02-08 | 2024-08-15 | Dragonfly Therapeutics, LLC | Multi-specific binding proteins for activation of natural killer cells and therapeutic uses thereof to treat cancer |
| WO2018148447A1 (en) * | 2017-02-08 | 2018-08-16 | Adimab, Llc | Antibody heavy chain variable domains targeting the nkg2d receptor |
| CN110944661A (zh) | 2017-02-20 | 2020-03-31 | 蜻蜓疗法股份有限公司 | 结合her2、nkg2d和cd16的蛋白质 |
| PE20250933A1 (es) | 2017-03-14 | 2025-04-02 | Five Prime Therapeutics Inc | Anticuerpos de union a vista a ph acido |
| KR20190141146A (ko) | 2017-03-16 | 2019-12-23 | 알파인 이뮨 사이언시즈, 인코포레이티드 | Pd-l2 변이체 면역조절 단백질 및 그의 용도 |
| SG11201907769XA (en) * | 2017-03-16 | 2019-09-27 | Alpine Immune Sciences Inc | Cd80 variant immunomodulatory proteins and uses thereof |
| CN108623685B (zh) * | 2017-03-25 | 2022-07-01 | 信达生物制药(苏州)有限公司 | 抗ox40抗体及其用途 |
| CN108623686A (zh) * | 2017-03-25 | 2018-10-09 | 信达生物制药(苏州)有限公司 | 抗ox40抗体及其用途 |
| BR112019025913A2 (pt) * | 2017-06-09 | 2020-06-30 | Glaxosmithkline Intellectual Property Development Limited | métodos para tratar câncer em um paciente em necesssidade do mesmo e para produzir um anticorpo, anticorpo anti-icos ou fragmento de ligação ao antígeno do mesmo e um anticorpo anti-ox40 ou fragmento de ligação ao antígeno do mesmo, uso de um anticorpo anti-icos ou porção de ligação ao antígeno do mesmo e um anticorpo anti-ox40 ou porção de ligação ao antígeno do mesmo na fabricação de um medicamento, polinucleotídeo que codifica um anticorpo, vetor, e, célula hospedeira. |
| JP2021501801A (ja) * | 2017-11-01 | 2021-01-21 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | 癌の処置に用いるための免疫刺激アゴニスト抗体 |
| EP3713958A4 (en) | 2017-11-24 | 2021-11-03 | Eucure (Beijing) Biopharma Co., Ltd | ANTI-OX40 ANTIBODIES AND USES THEREOF |
| CA3084370A1 (en) | 2018-01-12 | 2019-07-18 | Bristol-Myers Squibb Company | Combination therapy with anti-il-8 antibodies and anti-pd-1 antibodies for treating cancer |
| CA3237846A1 (en) | 2018-02-08 | 2019-08-15 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the nkg2d receptor |
| BR112020015994A2 (pt) | 2018-02-08 | 2020-12-15 | Dragonfly Therapeutics, Inc. | Terapia de combinação do câncer que envolve proteínas de ligação multiespecíficas que ativam células natural killer |
| WO2019157124A1 (en) | 2018-02-08 | 2019-08-15 | Bristol-Myers Squibb Company | Combination of a tetanus toxoid, anti-ox40 antibody and/or anti-pd-1 antibody to treat tumors |
| WO2019164930A1 (en) | 2018-02-20 | 2019-08-29 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind cd33, nkg2d, and cd16, and methods of use |
| BR112020019083A2 (pt) | 2018-03-21 | 2020-12-29 | Five Prime Therapeutics, Inc. | Anticorpos, ácido nucleico, composições, célula e métodos para preparar um anticorpo, para tratar câncer, para tratar uma doença infecciosa, para tratar uma inflamação, para a identificação de um anticorpo, para melhorar a eficácia antitumoral de um anticorpo, para melhorar a farmacocinética de um anticorpo, para selecionar um anticorpo, para melhorar a eficácia de anticorpos, para isolar anticorpos, para detectar vista em uma amostra e para tratar câncer |
| JP7059388B2 (ja) * | 2018-03-23 | 2022-04-25 | イーライ リリー アンド カンパニー | 抗pd-l1抗体との組み合わせのための抗cd137抗体 |
| EP3768715A1 (en) | 2018-03-23 | 2021-01-27 | Bristol-Myers Squibb Company | Antibodies against mica and/or micb and uses thereof |
| TWI831778B (zh) * | 2018-05-11 | 2024-02-11 | 澳門商同潤澳門一人有限公司 | 抗ox40的全人抗體及其製備方法和用途 |
| UA130542C2 (uk) | 2018-05-16 | 2026-03-18 | Янссен Байотек, Інк. | Антитіло до cd38 та терапевтичний засіб, який перенаправляє т-клітини, для лікування множинної мієломи у суб'єкта |
| BR112020023746A2 (pt) | 2018-05-23 | 2021-02-17 | Beigene, Ltd. | anticorpo, composição farmacêutica, método para tratar câncer, ácido nucleico isolado, vetor, célula hospedeira, processo para a produção de um anticorpo e reagente de diagnóstico |
| PE20210687A1 (es) | 2018-07-11 | 2021-04-08 | Bristol Myers Squibb Co | Anticuerpos de union a vista a ph acido |
| US20210277135A1 (en) * | 2018-07-13 | 2021-09-09 | Bristol-Myers Squibb Company | Ox-40 agonist, pd-1 pathway inhibitor and ctla-4 inhibitor combination for use in a method of treating a cancer or a solid tumor |
| KR102835308B1 (ko) | 2018-08-08 | 2025-07-21 | 드래곤플라이 쎄라퓨틱스, 인크. | Nkg2d, cd16 및 종양 관련 항원에 결합하는 단백질 |
| EA202091888A1 (ru) | 2018-08-08 | 2020-10-23 | Драгонфлай Терапьютикс, Инк. | Вариабельные домены антител, нацеленные на рецептор nkg2d |
| EP3833392A4 (en) | 2018-08-08 | 2022-05-18 | Dragonfly Therapeutics, Inc. | MULTISPECIFIC BINDING PROTEINS FOR BINDING CD33, NKG2D AND CD16 AND METHODS OF USE |
| TW202035455A (zh) | 2018-09-26 | 2020-10-01 | 大陸商江蘇恆瑞醫藥股份有限公司 | 抗ox40抗體、其抗原結合片段及其醫藥用途 |
| CA3120868A1 (en) | 2018-11-30 | 2020-06-04 | Alpine Immune Sciences, Inc. | Cd86 variant immunomodulatory proteins and uses thereof |
| WO2020132857A1 (zh) * | 2018-12-25 | 2020-07-02 | 杭州翰思生物医药有限公司 | 抗ox40的单克隆抗体及其应用 |
| WO2020142626A1 (en) * | 2019-01-04 | 2020-07-09 | Gigagen, Inc. | Anti-ox40 binding proteins and methods of use thereof |
| WO2020190725A1 (en) | 2019-03-15 | 2020-09-24 | Bolt Biotherapeutics, Inc. | Immunoconjugates targeting her2 |
| WO2020243570A1 (en) | 2019-05-30 | 2020-12-03 | Bristol-Myers Squibb Company | Cell localization signature and combination therapy |
| KR20220016155A (ko) | 2019-05-30 | 2022-02-08 | 브리스톨-마이어스 스큅 컴퍼니 | 면역-종양학 (i-o) 요법에 적합한 대상체를 확인하는 방법 |
| US20220363760A1 (en) | 2019-05-30 | 2022-11-17 | Bristol-Myers Squibb Company | Multi-tumor gene signature for suitability to immuno-oncology therapy |
| CN110172090B (zh) * | 2019-06-03 | 2020-04-03 | 中山标佳生物科技有限公司 | Cd134单克隆抗体及其制备方法和癌症治疗中的应用 |
| US20230002500A1 (en) * | 2019-11-21 | 2023-01-05 | Beigene, Ltd. | Methods of cancer treatment using anti-ox40 antibodies in combination with anti-tigit antibodies |
| JP2023503399A (ja) * | 2019-11-21 | 2023-01-30 | ベイジーン リミテッド | 抗tim3抗体と組み合わせて抗ox40抗体を用いるがんを治療する方法 |
| JP2023503031A (ja) * | 2019-11-21 | 2023-01-26 | ベイジーン(ベイジン)カンパニー リミテッド | 化学療法剤との組合せでの抗ox40抗体による癌治療の方法 |
| BR112022009147A2 (pt) * | 2019-11-21 | 2022-07-26 | Beigene Ltd | Métodos de tratamento do câncer e métodos para aumentar, potencializar ou estimular uma resposta ou função imune |
| IL293471A (en) | 2019-12-17 | 2022-08-01 | Amgen Inc | Dual interleukin-2 / tnf receptor agonist for use in medicine |
| CN113045654A (zh) * | 2019-12-27 | 2021-06-29 | 南开大学 | 抗ox40抗体及其用途 |
| CN113045655A (zh) * | 2019-12-27 | 2021-06-29 | 高诚生物医药(香港)有限公司 | 抗ox40抗体及其用途 |
| US11365239B2 (en) | 2020-03-20 | 2022-06-21 | Tsb Therapeutics (Beijing) Co., Ltd. | Anti-SARS-COV-2 antibodies and uses thereof |
| JP7512394B2 (ja) | 2020-05-06 | 2024-07-08 | ドラゴンフライ セラピューティクス, インコーポレイテッド | Nkg2d、cd16及びclec12aに結合するタンパク質 |
| WO2021231237A2 (en) * | 2020-05-11 | 2021-11-18 | Augmenta Bioworks, Inc. | Antibodies for sars-cov-2 and uses thereof |
| CN111704671B (zh) * | 2020-08-19 | 2020-11-24 | 广东赛尔生物科技有限公司 | Ox40抗体及其在治疗癌症中的应用 |
| CN114106173A (zh) * | 2020-08-26 | 2022-03-01 | 上海泰槿生物技术有限公司 | 抗ox40抗体、其药物组合物及应用 |
| CN114106174A (zh) * | 2020-08-27 | 2022-03-01 | 苏州景涞医疗科技有限公司 | 低毒性抗ox40抗体、其药物组合物及应用 |
| AU2021334361A1 (en) | 2020-08-31 | 2023-05-11 | Bristol-Myers Squibb Company | Cell localization signature and immunotherapy |
| WO2022103705A1 (en) * | 2020-11-11 | 2022-05-19 | Versapeutics Inc. | Antibody variants against wnt receptor ryk |
| WO2022120179A1 (en) | 2020-12-03 | 2022-06-09 | Bristol-Myers Squibb Company | Multi-tumor gene signatures and uses thereof |
| AR124414A1 (es) | 2020-12-18 | 2023-03-22 | Century Therapeutics Inc | Sistema de receptor de antígeno quimérico con especificidad de receptor adaptable |
| JP2024501029A (ja) | 2020-12-28 | 2024-01-10 | ブリストル-マイヤーズ スクイブ カンパニー | Pd1/pd-l1抗体の皮下投与 |
| US20220233693A1 (en) | 2020-12-28 | 2022-07-28 | Bristol-Myers Squibb Company | Antibody Compositions and Methods of Use Thereof |
| CN112957475B (zh) * | 2021-02-04 | 2022-07-22 | 李文峰 | 一种预防和或治疗肿瘤的组合物及应用 |
| EP4301774A4 (en) | 2021-03-03 | 2025-08-13 | Dragonfly Therapeutics Inc | METHODS OF TREATING CANCER USING MULTI-SPECIFIC BINDING PROTEINS THAT BIND TO NKG2D, CD16, AND A TUMOR-ASSOCIATED ANTIGEN |
| EP4318621B1 (en) | 2021-03-30 | 2025-03-26 | FUJIFILM Corporation | Piezoelectric element and method for manufacturing a piezoelectric element |
| EP4314068A1 (en) | 2021-04-02 | 2024-02-07 | The Regents Of The University Of California | Antibodies against cleaved cdcp1 and uses thereof |
| KR20240116755A (ko) * | 2021-12-17 | 2024-07-30 | 상하이 헨리우스 바이오테크, 인크. | 항-ox40 항체, 다중 특이적 항체 및 이의 사용 방법 |
| WO2023178329A1 (en) | 2022-03-18 | 2023-09-21 | Bristol-Myers Squibb Company | Methods of isolating polypeptides |
| CN119213034A (zh) | 2022-05-17 | 2024-12-27 | 苏州创胜医药集团有限公司 | 双功能蛋白质及其制剂和用途 |
| KR20250022071A (ko) | 2022-06-02 | 2025-02-14 | 브리스톨-마이어스 스큅 컴퍼니 | 항체 조성물 및 이의 이용 방법 |
| EP4583999A1 (en) | 2022-09-09 | 2025-07-16 | Bristol-Myers Squibb Company | Methods of separating chelator |
| WO2024196952A1 (en) | 2023-03-20 | 2024-09-26 | Bristol-Myers Squibb Company | Tumor subtype assessment for cancer therapy |
| WO2025038763A1 (en) | 2023-08-15 | 2025-02-20 | Bristol-Myers Squibb Company | Ceramic hydroxyapatite chromatography flow through method |
| WO2025145207A1 (en) | 2023-12-29 | 2025-07-03 | Bristol-Myers Squibb Company | Combination therapy of kras inhibitor and treg-depleting agent |
| WO2026057844A1 (en) * | 2024-09-16 | 2026-03-19 | Les Laboratoires Servier | Antibodies to ox40 and compositions thereof |
Family Cites Families (238)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| DE3572982D1 (en) | 1984-03-06 | 1989-10-19 | Takeda Chemical Industries Ltd | Chemically modified lymphokine and production thereof |
| US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
| MX9203291A (es) | 1985-06-26 | 1992-08-01 | Liposome Co Inc | Metodo para acoplamiento de liposomas. |
| GB8601597D0 (en) | 1986-01-23 | 1986-02-26 | Wilson R H | Nucleotide sequences |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
| US4881175A (en) | 1986-09-02 | 1989-11-14 | Genex Corporation | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| JP3101690B2 (ja) | 1987-03-18 | 2000-10-23 | エス・ビィ・2・インコーポレイテッド | 変性抗体の、または変性抗体に関する改良 |
| US5013653A (en) | 1987-03-20 | 1991-05-07 | Creative Biomolecules, Inc. | Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| ATE243754T1 (de) | 1987-05-21 | 2003-07-15 | Micromet Ag | Multifunktionelle proteine mit vorbestimmter zielsetzung |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| GB8717430D0 (en) | 1987-07-23 | 1987-08-26 | Celltech Ltd | Recombinant dna product |
| US5804381A (en) | 1996-10-03 | 1998-09-08 | Cornell Research Foundation | Isolated nucleic acid molecule encoding an esophageal cancer associated antigen, the antigen itself, and uses thereof |
| GB8809129D0 (en) | 1988-04-18 | 1988-05-18 | Celltech Ltd | Recombinant dna methods vectors and host cells |
| US5476996A (en) | 1988-06-14 | 1995-12-19 | Lidak Pharmaceuticals | Human immune system in non-human animal |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| GB8823869D0 (en) | 1988-10-12 | 1988-11-16 | Medical Res Council | Production of antibodies |
| WO1990006952A1 (fr) | 1988-12-22 | 1990-06-28 | Kirin-Amgen, Inc. | Facteur de stimulation de colonies de granulocytes modifies chimiquement |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5108921A (en) | 1989-04-03 | 1992-04-28 | Purdue Research Foundation | Method for enhanced transmembrane transport of exogenous molecules |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| DE69120146T2 (de) | 1990-01-12 | 1996-12-12 | Cell Genesys Inc | Erzeugung xenogener antikörper |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6673986B1 (en) | 1990-01-12 | 2004-01-06 | Abgenix, Inc. | Generation of xenogeneic antibodies |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US6300129B1 (en) | 1990-08-29 | 2001-10-09 | Genpharm International | Transgenic non-human animals for producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| WO1993012227A1 (en) | 1991-12-17 | 1993-06-24 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| ATE158021T1 (de) | 1990-08-29 | 1997-09-15 | Genpharm Int | Produktion und nützung nicht-menschliche transgentiere zur produktion heterologe antikörper |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US6255458B1 (en) | 1990-08-29 | 2001-07-03 | Genpharm International | High affinity human antibodies and human antibodies against digoxin |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US6235525B1 (en) | 1991-05-23 | 2001-05-22 | Ludwig Institute For Cancer Research | Isolated nucleic acid molecules coding for tumor rejection antigen precursor MAGE-3 and uses thereof |
| PT1024191E (pt) | 1991-12-02 | 2008-12-22 | Medical Res Council | Produção de auto-anticorpos a partir de reportórios de segmentos de anticorpo e exibidos em fagos |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| US5620886A (en) | 1993-03-18 | 1997-04-15 | Ludwig Institute For Cancer Research | Isolated nucleic acid sequence coding for a tumor rejection antigen precursor processed to at least one tumor rejection antigen presented by HLA-A2 |
| JPH08509612A (ja) | 1993-04-26 | 1996-10-15 | ジェンファーム インターナショナル インコーポレイテッド | 異種抗体を産生することができるトランスジェニック非ヒト動物 |
| AU691811B2 (en) | 1993-06-16 | 1998-05-28 | Celltech Therapeutics Limited | Antibodies |
| US5821332A (en) | 1993-11-03 | 1998-10-13 | The Board Of Trustees Of The Leland Stanford Junior University | Receptor on the surface of activated CD4+ T-cells: ACT-4 |
| EP0702553A1 (en) | 1993-12-27 | 1996-03-27 | BAXTER INTERNATIONAL INC. (a Delaware corporation) | Water soluble non-immunogenic polyamide cross-linking agents |
| US5759546A (en) | 1994-02-04 | 1998-06-02 | Weinberg; Andrew D. | Treatment of CD4 T-cell mediated conditions |
| US6242566B1 (en) | 1994-02-10 | 2001-06-05 | Board Of Trustees Of The Leland Stanford Junior University | Ligand (ACT-4-L) to a receptor on the surface of activated CD4+ T-cells |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6410690B1 (en) | 1995-06-07 | 2002-06-25 | Medarex, Inc. | Therapeutic compounds comprised of anti-Fc receptor antibodies |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| AU727608B2 (en) | 1995-10-03 | 2000-12-14 | Scripps Research Institute, The | CBI analogs of CC-1065 and the duocarmycins |
| JP4046354B2 (ja) | 1996-03-18 | 2008-02-13 | ボード オブ リージェンツ,ザ ユニバーシティ オブ テキサス システム | 増大した半減期を有する免疫グロブリン様ドメイン |
| US5834597A (en) | 1996-05-20 | 1998-11-10 | Protein Design Labs, Inc. | Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same |
| US5922845A (en) | 1996-07-11 | 1999-07-13 | Medarex, Inc. | Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies |
| US6069233A (en) | 1996-10-03 | 2000-05-30 | Memorial Sloan-Kettering Cancer Center | Isolated nucleic acid molecule encoding an esophageal cancer associated antigen, the antigen itself, and uses thereof |
| WO1998023289A1 (en) | 1996-11-27 | 1998-06-04 | The General Hospital Corporation | MODULATION OF IgG BINDING TO FcRn |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| JP2001523958A (ja) | 1997-03-21 | 2001-11-27 | ブライハム アンド ウィミンズ ホスピタル,インコーポレイテッド | 免疫療法のctla−4結合ペプチド |
| EP0983303B1 (en) | 1997-05-21 | 2006-03-08 | Biovation Limited | Method for the production of non-immunogenic proteins |
| US6312700B1 (en) * | 1998-02-24 | 2001-11-06 | Andrew D. Weinberg | Method for enhancing an antigen specific immune response with OX-40L |
| AP1261A (en) | 1998-02-24 | 2004-03-19 | Sisters Of Providence In Oregon | Composition containing an OX-40 receptor binding agent or a nucleic acid encoding the same and methods for enhancing antigen-specific immune response. |
| ATE375365T1 (de) | 1998-04-02 | 2007-10-15 | Genentech Inc | Antikörper varianten und fragmente davon |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| DK1071700T3 (da) | 1998-04-20 | 2010-06-07 | Glycart Biotechnology Ag | Glykosylerings-modifikation af antistoffer til forbedring af antistofafhængig cellulær cytotoksicitet |
| GB9809951D0 (en) | 1998-05-08 | 1998-07-08 | Univ Cambridge Tech | Binding molecules |
| CZ302706B6 (cs) | 1998-12-23 | 2011-09-14 | Pfizer Inc. | Lidská monoklonální protilátka, farmaceutická kompozice tuto protilátku obsahující, bunecná linie produkující tuto protilátku, izolovaná molekula kódující težký nebo lehký retezec uvedené protilátky, hostitelská bunka obsahující tuto izolovanou molek |
| PL209392B1 (pl) | 1999-01-15 | 2011-08-31 | Genentech Inc | Przeciwciało, komórka gospodarza, sposób wytwarzania przeciwciała oraz zastosowanie przeciwciała |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| CA2704600C (en) | 1999-04-09 | 2016-10-25 | Kyowa Kirin Co., Ltd. | A method for producing antibodies with increased adcc activity |
| JP4118462B2 (ja) | 1999-07-19 | 2008-07-16 | 株式会社リコー | 携帯電子機器 |
| EP1074563A1 (en) | 1999-08-02 | 2001-02-07 | F. Hoffmann-La Roche Ag | Chimeric polypeptides enhancing dimer formation through electrostatic interactions and disulfide bond, method for production and uses thereof |
| JP5004390B2 (ja) | 1999-08-23 | 2012-08-22 | デイナ ファーバー キャンサー インスティチュート,インコーポレイテッド | 新規b7−4分子およびその用途 |
| EP1212422B1 (en) | 1999-08-24 | 2007-02-21 | Medarex, Inc. | Human ctla-4 antibodies and their uses |
| EP1210411B1 (en) | 1999-08-25 | 2006-10-18 | Immunex Corporation | Compositions and methods for improved cell culture |
| DK1234031T3 (en) | 1999-11-30 | 2017-07-03 | Mayo Foundation | B7-H1, AN UNKNOWN IMMUNE REGULATORY MOLECULE |
| US6774226B1 (en) | 1999-11-30 | 2004-08-10 | Ludwig Institute For Cancer Research | Isolated nucleic acid molecules encoding cancer associated antigens, the antigens per se, and uses thereof |
| HUP0204475A2 (en) | 2000-02-11 | 2003-04-28 | Merck Patent Gmbh | Enhancing the circulating half-life of antibody-based fusion proteins |
| WO2004043361A2 (en) | 2002-11-08 | 2004-05-27 | Genentech, Inc. | Compositions and methods for the treatment of natural killer cell related diseases |
| WO2001075166A2 (en) | 2000-03-31 | 2001-10-11 | Genentech, Inc. | Compositions and methods for detecting and quantifying gene expression |
| CA2430013C (en) | 2000-11-30 | 2011-11-22 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| US7083784B2 (en) | 2000-12-12 | 2006-08-01 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| US6794501B2 (en) | 2001-05-04 | 2004-09-21 | Ludwig Institute For Cancer Research | Colon cancer antigen panel |
| WO2002092780A2 (en) | 2001-05-17 | 2002-11-21 | Diversa Corporation | Novel antigen binding molecules for therapeutic, diagnostic, prophylactic, enzymatic, industrial, and agricultural applications, and methods for generating and screening thereof |
| ITMI20011465A1 (it) | 2001-07-10 | 2003-01-10 | Novuspharma Spa | Gene ad attivita' oncosoppressiva |
| CA2463879C (en) | 2001-10-25 | 2012-12-04 | Genentech, Inc. | Glycoprotein compositions |
| US20040002587A1 (en) | 2002-02-20 | 2004-01-01 | Watkins Jeffry D. | Fc region variants |
| US8188231B2 (en) | 2002-09-27 | 2012-05-29 | Xencor, Inc. | Optimized FC variants |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| US20040132101A1 (en) | 2002-09-27 | 2004-07-08 | Xencor | Optimized Fc variants and methods for their generation |
| AU2003217912A1 (en) | 2002-03-01 | 2003-09-16 | Xencor | Antibody optimization |
| US20040014194A1 (en) | 2002-03-27 | 2004-01-22 | Schering Corporation | Beta-secretase crystals and methods for preparing and using the same |
| IL149820A0 (en) | 2002-05-23 | 2002-11-10 | Curetech Ltd | Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency |
| DE60317677T2 (de) | 2002-06-13 | 2008-10-30 | Crucell Holland B.V. | Ox40 (=cd134) rezeptor agonisten und therapeutische verwendung |
| DK1534335T4 (en) | 2002-08-14 | 2015-10-05 | Macrogenics Inc | FCGAMMARIIB-SPECIFIC ANTIBODIES AND PROCEDURES FOR USE THEREOF |
| EP1553975B8 (en) | 2002-09-27 | 2023-04-12 | Xencor, Inc. | Optimized fc variants and methods for their generation |
| DK1562972T3 (da) | 2002-10-15 | 2010-12-06 | Facet Biotech Corp | Modifikation af FcRn-bindingsaffiniteter eller serumhalveringstider for antistoffer ved mutagenese |
| CA2512729C (en) | 2003-01-09 | 2014-09-16 | Macrogenics, Inc. | Identification and engineering of antibodies with variant fc regions and methods of using same |
| US20040197312A1 (en) | 2003-04-02 | 2004-10-07 | Marina Moskalenko | Cytokine-expressing cellular vaccine combinations |
| CN1816356A (zh) | 2003-05-14 | 2006-08-09 | 免疫原公司 | 药物缀合物组合物 |
| US20100069614A1 (en) | 2008-06-27 | 2010-03-18 | Merus B.V. | Antibody producing non-human mammals |
| EP1633372B1 (en) | 2003-06-13 | 2011-11-30 | The Trustees of The University of Pennsylvania | Vaccines, immunotherapeutics and methods for using the same |
| WO2005044853A2 (en) | 2003-11-01 | 2005-05-19 | Genentech, Inc. | Anti-vegf antibodies |
| WO2005047459A2 (en) * | 2003-08-04 | 2005-05-26 | University Of Massachusetts | Sars nucleic acids, proteins, antibodies, and uses thereof |
| US8101720B2 (en) | 2004-10-21 | 2012-01-24 | Xencor, Inc. | Immunoglobulin insertions, deletions and substitutions |
| GB0324368D0 (en) | 2003-10-17 | 2003-11-19 | Univ Cambridge Tech | Polypeptides including modified constant regions |
| EP2478912B1 (en) | 2003-11-06 | 2016-08-31 | Seattle Genetics, Inc. | Auristatin conjugates with anti-HER2 or anti-CD22 antibodies and their use in therapy |
| SI1706424T1 (sl) | 2004-01-12 | 2010-01-29 | Applied Molecular Evolution | Variante fc regij |
| EP1720908A2 (en) | 2004-02-17 | 2006-11-15 | Absalus, Inc. | Super-humanized antibodies against respiratory syncytial virus |
| EP1737890A2 (en) | 2004-03-24 | 2007-01-03 | Xencor, Inc. | Immunoglobulin variants outside the fc region |
| US7778814B2 (en) | 2004-03-30 | 2010-08-17 | Siemens Aktiengesellschaft | Method and device for simulating an automation system |
| AU2005274905B2 (en) | 2004-08-04 | 2010-12-23 | Mentrik Biotech, Llc | Variant Fc regions |
| WO2006029459A1 (en) * | 2004-09-13 | 2006-03-23 | Evogenix, Inc | Antibodies specific for hepatocellular carcinoma and other carcinomas and uses thereof |
| US8367805B2 (en) | 2004-11-12 | 2013-02-05 | Xencor, Inc. | Fc variants with altered binding to FcRn |
| US20090145493A1 (en) | 2004-11-23 | 2009-06-11 | Pip Co., Ltd. | Built-in wall water service box |
| US7700099B2 (en) | 2005-02-14 | 2010-04-20 | Merck & Co., Inc. | Non-immunostimulatory antibody and compositions containing the same |
| JP5225069B2 (ja) * | 2005-03-23 | 2013-07-03 | ゲンマブ エー/エス | 多発性骨髄腫の治療のためのcd38に対する抗体 |
| DK2439273T3 (da) | 2005-05-09 | 2019-06-03 | Ono Pharmaceutical Co | Humane monoklonale antistoffer til programmeret død-1(pd-1) og fremgangsmåder til behandling af cancer ved anvendelse af anti-pd-1- antistoffer alene eller i kombination med andre immunterapeutika |
| PL1879573T3 (pl) | 2005-05-10 | 2013-05-31 | Incyte Holdings Corp | Modulatory 2,3-dioksygenazy indoloaminy i sposoby ich zastosowania |
| WO2006130834A2 (en) | 2005-05-31 | 2006-12-07 | Board Of Regents, The University Of Texas System | IGGl ANTIBODIES WITH MUTATED FC PORTION FOR INCREASED BINDING TO FCRN RECEPTOR AND USES THEREOF |
| PT1907424E (pt) | 2005-07-01 | 2015-10-09 | Squibb & Sons Llc | Anticorpos monoclonais humanos para o ligando 1 de morte programada (pd-l1) |
| WO2007038868A2 (en) | 2005-10-03 | 2007-04-12 | The University Of British Columbia | Novel enediyne compound and uses thereof |
| US20080206246A1 (en) | 2006-04-05 | 2008-08-28 | Ravetch Jeffrey V | Polypeptides with enhanced anti-inflammatory and decreased cytotoxic properties and relating methods |
| TWI461436B (zh) | 2005-11-25 | 2014-11-21 | Kyowa Hakko Kirin Co Ltd | 人類cd134(ox40)之人類單株抗體及其製造及使用方法 |
| EA017812B1 (ru) * | 2005-12-08 | 2013-03-29 | Медарекс, Инк. | Выделенное моноклональное антитело или его антигенсвязывающий участок, которые связываются с протеинтирозинкиназой 7 ( ptk7) человека, и их применение |
| US8450351B2 (en) | 2005-12-20 | 2013-05-28 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| US20080286286A1 (en) | 2006-01-13 | 2008-11-20 | Board Of Regents, The University Of Texas System | Methods to Treat Disease States by Influencing the Signaling of Ox-40-Receptors and High Throughput Screening Methods for Identifying Substances Therefor |
| AR062448A1 (es) | 2006-05-25 | 2008-11-12 | Endocyte Inc | Conjugados de analogos de aziridinil-epotilona y composiciones farmaceuticas que comprenden los mismos |
| PE20080316A1 (es) | 2006-05-25 | 2008-04-10 | Bristol Myers Squibb Co | Compuestos de aziridinil-epotilona |
| US20110028688A1 (en) | 2006-06-21 | 2011-02-03 | Genentech, Inc. | Crystal structure of ox40l and ox40l complexed with ox40 receptor |
| CL2007002650A1 (es) | 2006-09-19 | 2008-02-08 | Incyte Corp | Compuestos derivados de heterociclo n-hidroxiamino; composicion farmaceutica, util para tratar cancer, infecciones virales y desordenes neurodegenerativos entre otras. |
| WO2008036642A2 (en) | 2006-09-19 | 2008-03-27 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| EP1914242A1 (en) | 2006-10-19 | 2008-04-23 | Sanofi-Aventis | Novel anti-CD38 antibodies for the treatment of cancer |
| GB0620894D0 (en) | 2006-10-20 | 2006-11-29 | Univ Southampton | Human immune therapies using a CD27 agonist alone or in combination with other immune modulators |
| US8652466B2 (en) | 2006-12-08 | 2014-02-18 | Macrogenics, Inc. | Methods for the treatment of disease using immunoglobulins having Fc regions with altered affinities for FcγRactivating and FcγRinhibiting |
| RU2448979C2 (ru) * | 2006-12-14 | 2012-04-27 | Ридженерон Фармасьютикалз, Инк. | Антитела человека к дельта-подобному лиганду-4 человека |
| TWI412367B (zh) | 2006-12-28 | 2013-10-21 | 梅達雷克斯有限責任公司 | 化學鏈接劑與可裂解基質以及其之綴合物 |
| KR20100014588A (ko) | 2007-02-27 | 2010-02-10 | 제넨테크, 인크. | 길항제 ox40 항체 및 염증성 및 자가면역 질환의 치료에서의 이의 용도 |
| EP1987839A1 (en) | 2007-04-30 | 2008-11-05 | I.N.S.E.R.M. Institut National de la Sante et de la Recherche Medicale | Cytotoxic anti-LAG-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| KR101140483B1 (ko) | 2007-05-02 | 2012-07-11 | 에프. 호프만-라 로슈 아게 | 단백질을 안정화시키는 방법 |
| ES2623925T3 (es) | 2007-05-30 | 2017-07-12 | Postech Academy-Industry- Foundation | Proteínas de fusión de inmunoglobulina |
| WO2009014708A2 (en) | 2007-07-23 | 2009-01-29 | Cell Genesys, Inc. | Pd-1 antibodies in combination with a cytokine-secreting cell and methods of use thereof |
| DE102007036200A1 (de) | 2007-08-02 | 2009-02-05 | Knorr-Bremse Systeme für Nutzfahrzeuge GmbH | Induktiver Weg- oder Drehwinkelsensor mit zwischen zwei Spulen angeordnetem Abschirmblech |
| US20090304719A1 (en) | 2007-08-22 | 2009-12-10 | Patrick Daugherty | Activatable binding polypeptides and methods of identification and use thereof |
| EP2044949A1 (en) | 2007-10-05 | 2009-04-08 | Immutep | Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response |
| JP2011503000A (ja) | 2007-11-02 | 2011-01-27 | セントコア・オーソ・バイオテツク・インコーポレーテツド | 半合成GLP−1ペプチド−Fc融合コンストラクト、その方法及び使用 |
| US10047066B2 (en) | 2007-11-30 | 2018-08-14 | Newlink Genetics Corporation | IDO inhibitors |
| EP2229410A4 (en) | 2007-12-05 | 2012-07-04 | Massachusetts Inst Technology | AGLYCOSYLATED IMMUNOGLOBULIN MUTANES |
| PT2594590E (pt) * | 2007-12-14 | 2015-01-14 | Bristol Myers Squibb Co | Moléculas de ligação ao recetor humano ox40 |
| HRP20150279T1 (hr) | 2007-12-26 | 2015-05-08 | Xencor, Inc. | Fc inaäśice s promijenjenim vezanjem na fcrn |
| EP2262837A4 (en) | 2008-03-12 | 2011-04-06 | Merck Sharp & Dohme | PD-1 BINDING PROTEINS |
| SG10202112838YA (en) | 2008-04-09 | 2021-12-30 | Genentech Inc | Novel compositions and methods for the treatment of immune related diseases |
| WO2009127691A1 (en) | 2008-04-17 | 2009-10-22 | Ablynx N.V. | Peptides capable of binding to serum proteins and compounds, constructs and polypeptides comprising the same |
| WO2009135181A2 (en) | 2008-05-02 | 2009-11-05 | Seattle Genetics, Inc. | Methods and compositions for making antibodies and antibody derivatives with reduced core fucosylation |
| AR072999A1 (es) | 2008-08-11 | 2010-10-06 | Medarex Inc | Anticuerpos humanos que se unen al gen 3 de activacion linfocitaria (lag-3) y los usos de estos |
| WO2010077643A1 (en) | 2008-12-08 | 2010-07-08 | Tegopharm Corporation | Masking ligands for reversible inhibition of multivalent compounds |
| EP3255060A1 (en) | 2008-12-09 | 2017-12-13 | F. Hoffmann-La Roche AG | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| ES2610356T3 (es) | 2009-02-03 | 2017-04-27 | Amunix Operating Inc. | Polipéptidos recombinantes extendidos y composiciones que comprenden los mismos |
| NZ594315A (en) | 2009-02-17 | 2013-05-31 | Ucb Pharma Sa | Antibody molecules having specificity for human ox40 |
| US20110007023A1 (en) | 2009-07-09 | 2011-01-13 | Sony Ericsson Mobile Communications Ab | Display device, touch screen device comprising the display device, mobile device and method for sensing a force on a display device |
| US8394922B2 (en) | 2009-08-03 | 2013-03-12 | Medarex, Inc. | Antiproliferative compounds, conjugates thereof, methods therefor, and uses thereof |
| EP2493862B1 (en) | 2009-10-28 | 2016-10-05 | Newlink Genetics Corporation | Imidazole derivatives as ido inhibitors |
| PL2504364T3 (pl) | 2009-11-24 | 2017-12-29 | Medimmune Limited | Ukierunkowane środki wiążące przeciwko B7-H1 |
| SG181533A1 (en) | 2009-12-07 | 2012-07-30 | Univ Leland Stanford Junior | Methods for enhancing anti-tumor antibody therapy |
| ES2724975T3 (es) | 2009-12-10 | 2019-09-18 | Regeneron Pharma | Ratones que producen anticuerpos de cadena pesada |
| ES2722300T3 (es) | 2009-12-10 | 2019-08-09 | Hoffmann La Roche | Anticuerpos que se unen preferentemente al dominio extracelular 4 de CSF1R y su uso |
| GB201001791D0 (en) | 2010-02-03 | 2010-03-24 | Ucb Pharma Sa | Process for obtaining antibodies |
| US20120021409A1 (en) | 2010-02-08 | 2012-01-26 | Regeneron Pharmaceuticals, Inc. | Common Light Chain Mouse |
| SMT202600080T1 (it) | 2010-02-08 | 2026-03-09 | Regeneron Pharma | Topo con catena leggera comune |
| HUE030100T2 (en) | 2010-02-19 | 2017-04-28 | Xencor Inc | New CTLA4-IG immunoadhesins |
| EP2542256B1 (en) | 2010-03-04 | 2019-05-22 | MacroGenics, Inc. | Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof |
| US9169323B2 (en) | 2010-03-05 | 2015-10-27 | Hoffmann-La Roche Inc. | Antibodies against human CSF-1R |
| JP5989547B2 (ja) | 2010-03-05 | 2016-09-07 | エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト | ヒトcsf−1rに対する抗体及びその使用 |
| CA2795349C (en) | 2010-04-15 | 2016-11-29 | Seattle Genetics, Inc. | Targeted pyrrolobenzodiazepine conjugates |
| JP5875083B2 (ja) | 2010-04-15 | 2016-03-02 | メディミューン リミテッド | 増殖性疾患治療用ピロロベンゾジアゼピン |
| HRP20190047T1 (hr) | 2010-05-04 | 2019-02-22 | Five Prime Therapeutics, Inc. | Protutijela koja se vežu na csf1r |
| PT3034608T (pt) | 2010-06-22 | 2019-05-28 | Regeneron Pharma | Ratinhos expressando uma cadeia leve híbrida de imunoglobulina com uma região variável humana |
| US8907053B2 (en) | 2010-06-25 | 2014-12-09 | Aurigene Discovery Technologies Limited | Immunosuppression modulating compounds |
| EP2399604A1 (en) | 2010-06-25 | 2011-12-28 | F. Hoffmann-La Roche AG | Novel antibody formulation |
| CA2809089C (en) | 2010-08-23 | 2018-12-18 | Board Of Regents, The University Of Texas System | Anti-ox40 antibodies and methods of using the same |
| MX337040B (es) | 2010-09-09 | 2016-02-09 | Pfizer | Moleculas de union a 4-1bb. |
| WO2012087928A2 (en) | 2010-12-20 | 2012-06-28 | The Rockefeller University | Modulating agonistic tnfr antibodies |
| MX352889B (es) | 2011-02-25 | 2017-12-13 | Chugai Pharmaceutical Co Ltd | Anticuerpo de fc especifico para fcyriib. |
| EP3415528B1 (en) | 2011-04-13 | 2021-05-26 | Bristol-Myers Squibb Company | Fc fusion proteins comprising novel linkers or arrangements |
| NO2694640T3 (https=) | 2011-04-15 | 2018-03-17 | ||
| JP6072771B2 (ja) | 2011-04-20 | 2017-02-01 | メディミューン,エルエルシー | B7−h1およびpd−1に結合する抗体およびその他の分子 |
| US8852599B2 (en) | 2011-05-26 | 2014-10-07 | Bristol-Myers Squibb Company | Immunoconjugates, compositions for making them, and methods of making and use |
| JP5708369B2 (ja) | 2011-08-24 | 2015-04-30 | コベルコ建機株式会社 | 作業機械 |
| GB201116092D0 (en) | 2011-09-16 | 2011-11-02 | Bioceros B V | Antibodies and uses thereof |
| SG11201400770SA (en) | 2011-09-20 | 2014-04-28 | Spirogen Sarl | Pyrrolobenzodiazepines as unsymmetrical dimeric pbd compounds for inclusion in targeted conjugates |
| US20130149300A1 (en) | 2011-09-27 | 2013-06-13 | Icon Genetics Gmbh | MONOCLONAL ANTIBODIES WITH ALTERED AFFINITIES FOR HUMAN FCyRI, FCyRIIIa, AND C1q PROTEINS |
| KR101764096B1 (ko) | 2011-11-28 | 2017-08-02 | 메르크 파텐트 게엠베하 | 항-pd-l1 항체 및 그의 용도 |
| RU2658603C2 (ru) | 2011-12-15 | 2018-06-21 | Ф.Хоффманн-Ля Рош Аг | Антитела против человеческого csf-1r и их применения |
| PT2793943T (pt) | 2011-12-19 | 2018-11-13 | Univ Rockefeller | Polipéptidos anti-inflamatórios não siliados |
| WO2013119202A1 (en) | 2012-02-06 | 2013-08-15 | Providence Health & Services - Oregon | Cancer treatment and monitoring methods using ox40 agonists |
| KR20140127855A (ko) | 2012-02-06 | 2014-11-04 | 제넨테크, 인크. | Csf1r 억제제를 사용하는 조성물 및 방법 |
| HUE033704T2 (en) | 2012-02-13 | 2017-12-28 | Bristol Myers Squibb Co | Enediyne compounds, conjugates thereof, and uses and methods therefor |
| AR090263A1 (es) | 2012-03-08 | 2014-10-29 | Hoffmann La Roche | Terapia combinada de anticuerpos contra el csf-1r humano y las utilizaciones de la misma |
| RU2670743C9 (ru) | 2012-05-11 | 2018-12-19 | Файв Прайм Терапьютикс, Инк. | Способы лечения состояний антителами, которые связывают рецептор колониестимулирующего фактора 1 (csf1r) |
| HK1203971A1 (en) | 2012-05-15 | 2015-11-06 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting pd-1/pd-l1 signaling |
| UY34887A (es) | 2012-07-02 | 2013-12-31 | Bristol Myers Squibb Company Una Corporacion Del Estado De Delaware | Optimización de anticuerpos que se fijan al gen de activación de linfocitos 3 (lag-3) y sus usos |
| CN107759690A (zh) | 2012-08-31 | 2018-03-06 | 戊瑞治疗有限公司 | 用结合群落刺激因子1受体(csf1r)的抗体治疗病状的方法 |
| ES2984405T3 (es) | 2012-09-13 | 2024-10-29 | Bristol Myers Squibb Co | Proteínas de dominio de andamio basadas en fibronectina que se unen a la miostatina |
| EP3508215A3 (en) | 2012-12-03 | 2019-10-02 | Bristol-Myers Squibb Company | Enhancing anti-cancer activity of immunomodulatory fc fusion proteins |
| WO2014116846A2 (en) | 2013-01-23 | 2014-07-31 | Abbvie, Inc. | Methods and compositions for modulating an immune response |
| LT2956173T (lt) | 2013-02-14 | 2017-06-26 | Bristol-Myers Squibb Company | Tubulizino junginiai, gavimo ir panaudojimo būdai |
| SG10201708048XA (en) * | 2013-03-18 | 2017-10-30 | Biocerox Prod Bv | Humanized anti-cd134 (ox40) antibodies and uses thereof |
| BR112016000853A2 (pt) | 2013-07-16 | 2017-12-12 | Genentech Inc | métodos para tratar ou retardar, reduzir ou inibir a recidiva ou a progressão do câncer e a progressão de uma doença imune-relacionada em um indivíduo, para aumentar, melhorar ou estimular uma resposta ou função imune em um indivíduo e kit |
| AU2014364593A1 (en) | 2013-12-17 | 2016-07-07 | Genentech, Inc. | Methods of treating cancer using PD-1 axis binding antagonists and an anti-CD20 antibody |
| WO2015095423A2 (en) | 2013-12-17 | 2015-06-25 | Genentech, Inc. | Combination therapy comprising ox40 binding agonists and pd-1 axis binding antagonists |
| PE20170255A1 (es) | 2014-01-24 | 2017-03-22 | Dana Farber Cancer Inst Inc | Moleculas de anticuerpo que se unen a pd-1 y usos de las mismas |
| WO2015131176A1 (en) | 2014-02-28 | 2015-09-03 | Podack Eckhard R | Compositions, methods, and kits for treatment of cancer |
| SG11201607969XA (en) | 2014-03-31 | 2016-10-28 | Genentech Inc | Anti-ox40 antibodies and methods of use |
| KR20160146747A (ko) | 2014-03-31 | 2016-12-21 | 제넨테크, 인크. | 항혈관신생제 및 ox40 결합 효능제를 포함하는 조합 요법 |
| CN121243402A (zh) | 2014-07-09 | 2026-01-02 | 博笛生物科技有限公司 | 用于治疗肿瘤的抗-pd-l1组合 |
| CN105233291A (zh) | 2014-07-09 | 2016-01-13 | 博笛生物科技有限公司 | 用于治疗癌症的联合治疗组合物和联合治疗方法 |
| CN112587672A (zh) | 2014-09-01 | 2021-04-02 | 博笛生物科技有限公司 | 用于治疗肿瘤的抗-pd-l1结合物 |
| KR20170066546A (ko) | 2014-10-03 | 2017-06-14 | 노파르티스 아게 | 조합 요법 |
| TW201619200A (zh) | 2014-10-10 | 2016-06-01 | 麥迪紐有限責任公司 | 人類化抗-ox40抗體及其用途 |
| EP4245376A3 (en) | 2014-10-14 | 2023-12-13 | Novartis AG | Antibody molecules to pd-l1 and uses thereof |
| AU2015335607B2 (en) | 2014-10-24 | 2020-04-23 | Calidi Biotherapeutics (Nevada), Inc. | Combination immunotherapy approach for treatment of cancer |
| WO2016073380A1 (en) | 2014-11-03 | 2016-05-12 | Genentech, Inc. | Method and biomarkers for predicting efficacy and evaluation of an ox40 agonist treatment |
| US11236139B2 (en) | 2014-11-05 | 2022-02-01 | The Regents Of The University Of California | Combination immunotherapy |
| US20160152720A1 (en) | 2014-11-06 | 2016-06-02 | Genentech, Inc. | Combination therapy comprising ox40 binding agonists and tigit inhibitors |
| SG10201807625PA (en) | 2014-11-17 | 2018-10-30 | Genentech Inc | Combination therapy comprising ox40 binding agonists and pd-1 axis binding antagonists |
| EP3233918A1 (en) | 2014-12-19 | 2017-10-25 | Novartis AG | Combination therapies |
| DK3303396T5 (da) | 2015-05-29 | 2024-10-07 | Bristol Myers Squibb Co | Antistoffer mod ox40 og anvendelser deraf |
-
2016
- 2016-05-26 DK DK16729129.3T patent/DK3303396T5/da active
- 2016-05-26 HU HUE16729129A patent/HUE061253T2/hu unknown
- 2016-05-26 ES ES16729129T patent/ES2936317T3/es active Active
- 2016-05-26 TN TNP/2019/000101A patent/TN2019000101A1/en unknown
- 2016-05-26 CN CN201680043991.9A patent/CN108137687B/zh active Active
- 2016-05-26 RS RS20230032A patent/RS63897B1/sr unknown
- 2016-05-26 UY UY0001036687A patent/UY36687A/es unknown
- 2016-05-26 JP JP2017561902A patent/JP6797137B2/ja active Active
- 2016-05-26 PE PE2017002483A patent/PE20180926A1/es unknown
- 2016-05-26 SI SI201631636T patent/SI3303396T1/sl unknown
- 2016-05-26 CA CA2987410A patent/CA2987410A1/en active Pending
- 2016-05-26 AU AU2016271111A patent/AU2016271111B2/en not_active Ceased
- 2016-05-26 TN TNP/2017/000488A patent/TN2017000488A1/en unknown
- 2016-05-26 PT PT167291293T patent/PT3303396T/pt unknown
- 2016-05-26 EP EP16729129.3A patent/EP3303396B1/en active Active
- 2016-05-26 EA EA201792572A patent/EA035412B1/ru not_active IP Right Cessation
- 2016-05-26 MX MX2017015041A patent/MX2017015041A/es unknown
- 2016-05-26 TW TW105116545A patent/TWI732760B/zh not_active IP Right Cessation
- 2016-05-26 LT LTEPPCT/US2016/034470T patent/LT3303396T/lt unknown
- 2016-05-26 PL PL16729129.3T patent/PL3303396T3/pl unknown
- 2016-05-26 BR BR112017025191-4A patent/BR112017025191A2/pt not_active IP Right Cessation
- 2016-05-26 FI FIEP16729129.3T patent/FI3303396T3/fi active
- 2016-05-26 KR KR1020177037201A patent/KR20180010264A/ko not_active Ceased
- 2016-05-26 US US15/577,375 patent/US20180237534A1/en not_active Abandoned
- 2016-05-26 SG SG10202008304TA patent/SG10202008304TA/en unknown
- 2016-05-26 US US15/166,114 patent/US9644032B2/en active Active
- 2016-05-26 MY MYPI2017704574A patent/MY188049A/en unknown
- 2016-05-26 SM SM20230013T patent/SMT202300013T1/it unknown
- 2016-05-26 HR HRP20230060TT patent/HRP20230060T1/hr unknown
- 2016-05-26 WO PCT/US2016/034470 patent/WO2016196228A1/en not_active Ceased
-
2017
- 2017-03-30 US US15/474,731 patent/US10683357B2/en active Active
- 2017-11-23 PH PH12017502129A patent/PH12017502129A1/en unknown
- 2017-11-27 IL IL255949A patent/IL255949B2/en unknown
- 2017-12-21 CO CONC2017/0013235A patent/CO2017013235A2/es unknown
-
2020
- 2020-04-13 US US16/847,130 patent/US11466092B2/en active Active
- 2020-11-17 JP JP2020190794A patent/JP7119051B2/ja active Active
-
2022
- 2022-08-03 JP JP2022124082A patent/JP2022169570A/ja active Pending
- 2022-08-11 US US17/819,287 patent/US20230272100A1/en not_active Abandoned
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12590154B2 (en) | 2012-05-15 | 2026-03-31 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting PD-1/PD-L1 signaling |
| US20220281974A1 (en) * | 2015-04-28 | 2022-09-08 | Bristol-Myers Squibb Company | Treatment of pd-l1-positive melanoma using an anti-pd-1 antibody |
| US12590153B2 (en) | 2015-04-28 | 2026-03-31 | Bristol-Myers Squibb Company | Treatment of PD-L1-negative melanoma using an anti-PD-1 antibody and an anti-CTLA-4 antibody |
| US11466092B2 (en) | 2015-05-29 | 2022-10-11 | Bristol-Myers Squibb Company | Antibodies against OX-40 and uses thereof |
| CN115052888A (zh) * | 2019-12-03 | 2022-09-13 | 上海交通大学医学院 | FcγRIIB亲和力增强的抗体Fc区 |
| EP4071167A4 (en) * | 2019-12-03 | 2024-03-06 | Shanghai Jiao Tong University School of Medicine | ANTIBODIES FC REGION WITH INCREASED FCGRIB AFFINITY |
| JP2023519584A (ja) * | 2020-03-23 | 2023-05-11 | バイオ - テラ ソリューションズ、リミテッド | 免疫細胞活性化剤の開発及び応用 |
| EP4130039A4 (en) * | 2020-03-23 | 2024-07-31 | Bio-Thera Solutions, Ltd. | DEVELOPMENT AND APPLICATION OF AN IMMUNE CELL ACTIVATOR |
| JP7791402B2 (ja) | 2020-03-23 | 2025-12-24 | バイオ - テラ ソリューションズ、リミテッド | 免疫細胞活性化剤の開発及び応用 |
| JP2025131565A (ja) * | 2021-01-28 | 2025-09-09 | アステリア セラピューティクス,インコーポレイテッド | 血漿カリクレイン抗体及びその使用 |
| WO2023152116A1 (en) | 2022-02-08 | 2023-08-17 | Hookipa Biotech Gmbh | Combination therapy with arenavirus particles and immune checkpoint modulators or cytokines |
| US12617850B2 (en) * | 2022-03-22 | 2026-05-05 | Bristol-Myers Squibb Company | Treatment of PD-L1-positive melanoma using an anti-PD-1 antibody |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230272100A1 (en) | Antibodies against ox-40 and uses thereof | |
| US12060421B2 (en) | Antibodies to TIGIT | |
| US20250326841A1 (en) | Antibodies against tim3 and uses thereof | |
| EP3377532B1 (en) | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof | |
| EP3610924B1 (en) | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof | |
| US20190284293A1 (en) | Combination therapy with anti-cd73 antibodies | |
| EP3725808A1 (en) | Antibodies against cd73 and uses thereof | |
| HK1246308B (en) | Antibodies against ox40 and uses thereof | |
| EA040561B1 (ru) | Способ применения антитела к ox40 (варианты) | |
| HK1235726B (en) | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof | |
| HK1235726A1 (en) | Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |