TR201910848T4 - İntraselüler olarak ayrilabi̇len bi̇r bağa sahi̇p i̇mmunokonjugatlar - Google Patents
İntraselüler olarak ayrilabi̇len bi̇r bağa sahi̇p i̇mmunokonjugatlar Download PDFInfo
- Publication number
- TR201910848T4 TR201910848T4 TR2019/10848T TR201910848T TR201910848T4 TR 201910848 T4 TR201910848 T4 TR 201910848T4 TR 2019/10848 T TR2019/10848 T TR 2019/10848T TR 201910848 T TR201910848 T TR 201910848T TR 201910848 T4 TR201910848 T4 TR 201910848T4
- Authority
- TR
- Turkey
- Prior art keywords
- antibody
- cancer
- group
- antibodies
- conjugate
- Prior art date
Links
- 229940127121 immunoconjugate Drugs 0.000 title description 23
- 238000011282 treatment Methods 0.000 claims abstract description 33
- 206010028980 Neoplasm Diseases 0.000 claims description 93
- 239000000427 antigen Substances 0.000 claims description 91
- 108091007433 antigens Proteins 0.000 claims description 91
- 102000036639 antigens Human genes 0.000 claims description 91
- 241000282414 Homo sapiens Species 0.000 claims description 75
- 230000027455 binding Effects 0.000 claims description 74
- 238000009739 binding Methods 0.000 claims description 73
- -1 EGP-1 Proteins 0.000 claims description 71
- 210000004027 cell Anatomy 0.000 claims description 64
- 230000008685 targeting Effects 0.000 claims description 60
- 201000011510 cancer Diseases 0.000 claims description 59
- 150000001413 amino acids Chemical class 0.000 claims description 40
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 35
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 35
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 claims description 17
- 230000000295 complement effect Effects 0.000 claims description 17
- 230000003211 malignant effect Effects 0.000 claims description 16
- 239000000539 dimer Substances 0.000 claims description 14
- 230000036210 malignancy Effects 0.000 claims description 14
- 102100027212 Tumor-associated calcium signal transducer 2 Human genes 0.000 claims description 13
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 claims description 12
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 claims description 12
- 102000034655 MIF Human genes 0.000 claims description 12
- 241001529936 Murinae Species 0.000 claims description 12
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 claims description 12
- 102000006354 HLA-DR Antigens Human genes 0.000 claims description 11
- 108010058597 HLA-DR Antigens Proteins 0.000 claims description 11
- 206010039491 Sarcoma Diseases 0.000 claims description 11
- 102100032367 C-C motif chemokine 5 Human genes 0.000 claims description 10
- 201000009030 Carcinoma Diseases 0.000 claims description 10
- 108010055166 Chemokine CCL5 Proteins 0.000 claims description 10
- 102100021943 C-C motif chemokine 2 Human genes 0.000 claims description 9
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 claims description 9
- 101710155857 C-C motif chemokine 2 Proteins 0.000 claims description 8
- 206010018338 Glioma Diseases 0.000 claims description 8
- 102100030595 HLA class II histocompatibility antigen gamma chain Human genes 0.000 claims description 8
- 101001082627 Homo sapiens HLA class II histocompatibility antigen gamma chain Proteins 0.000 claims description 8
- 201000001441 melanoma Diseases 0.000 claims description 8
- 208000032612 Glial tumor Diseases 0.000 claims description 7
- 102100038080 B-cell receptor CD22 Human genes 0.000 claims description 6
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 claims description 6
- 102000015728 Mucins Human genes 0.000 claims description 6
- 108010063954 Mucins Proteins 0.000 claims description 6
- 102000007066 Prostate-Specific Antigen Human genes 0.000 claims description 6
- 108010072866 Prostate-Specific Antigen Proteins 0.000 claims description 6
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 6
- 102000007000 Tenascin Human genes 0.000 claims description 6
- 108010008125 Tenascin Proteins 0.000 claims description 6
- 102000013529 alpha-Fetoproteins Human genes 0.000 claims description 6
- 108010026331 alpha-Fetoproteins Proteins 0.000 claims description 6
- 210000004369 blood Anatomy 0.000 claims description 6
- 239000008280 blood Substances 0.000 claims description 6
- 108700012439 CA9 Proteins 0.000 claims description 5
- 102100024423 Carbonic anhydrase 9 Human genes 0.000 claims description 5
- 102100025473 Carcinoembryonic antigen-related cell adhesion molecule 6 Human genes 0.000 claims description 5
- 102100031940 Epithelial cell adhesion molecule Human genes 0.000 claims description 5
- 101000914326 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 6 Proteins 0.000 claims description 5
- 102100037362 Fibronectin Human genes 0.000 claims description 4
- 108010067306 Fibronectins Proteins 0.000 claims description 4
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 claims description 4
- 102100034256 Mucin-1 Human genes 0.000 claims description 4
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 claims description 4
- 206010054094 Tumour necrosis Diseases 0.000 claims description 4
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims description 4
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims description 4
- 229950003734 milatuzumab Drugs 0.000 claims description 4
- 239000000843 powder Substances 0.000 claims description 4
- 210000000130 stem cell Anatomy 0.000 claims description 4
- 102000003846 Carbonic anhydrases Human genes 0.000 claims description 3
- 108090000209 Carbonic anhydrases Proteins 0.000 claims description 3
- 108010053085 Complement Factor H Proteins 0.000 claims description 3
- 102000016550 Complement Factor H Human genes 0.000 claims description 3
- 102100038651 Four and a half LIM domains protein 1 Human genes 0.000 claims description 3
- 101710127220 Four and a half LIM domains protein 1 Proteins 0.000 claims description 3
- 101000920667 Homo sapiens Epithelial cell adhesion molecule Proteins 0.000 claims description 3
- 101000972286 Homo sapiens Mucin-4 Proteins 0.000 claims description 3
- 108010048043 Macrophage Migration-Inhibitory Factors Proteins 0.000 claims description 3
- 102100037791 Macrophage migration inhibitory factor Human genes 0.000 claims description 3
- 102000003735 Mesothelin Human genes 0.000 claims description 3
- 108090000015 Mesothelin Proteins 0.000 claims description 3
- 102100022693 Mucin-4 Human genes 0.000 claims description 3
- KUIFHYPNNRVEKZ-VIJRYAKMSA-N O-(N-acetyl-alpha-D-galactosaminyl)-L-threonine Chemical compound OC(=O)[C@@H](N)[C@@H](C)O[C@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1NC(C)=O KUIFHYPNNRVEKZ-VIJRYAKMSA-N 0.000 claims description 3
- 108700020796 Oncogene Proteins 0.000 claims description 3
- 102000043276 Oncogene Human genes 0.000 claims description 3
- 108010082093 Placenta Growth Factor Proteins 0.000 claims description 3
- 108091008605 VEGF receptors Proteins 0.000 claims description 3
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 claims description 3
- SRHNADOZAAWYLV-XLMUYGLTSA-N alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc Chemical compound O[C@H]1[C@H](O)[C@H](O)[C@H](C)O[C@H]1O[C@H]1[C@H](O[C@H]2[C@@H]([C@@H](NC(C)=O)[C@H](O)O[C@@H]2CO)O[C@H]2[C@H]([C@H](O)[C@H](O)[C@H](C)O2)O)O[C@H](CO)[C@H](O)[C@@H]1O SRHNADOZAAWYLV-XLMUYGLTSA-N 0.000 claims description 3
- 102000006815 folate receptor Human genes 0.000 claims description 3
- 108020005243 folate receptor Proteins 0.000 claims description 3
- 150000002270 gangliosides Chemical class 0.000 claims description 3
- 208000019691 hematopoietic and lymphoid cell neoplasm Diseases 0.000 claims description 3
- 238000012737 microarray-based gene expression Methods 0.000 claims description 3
- 238000012243 multiplex automated genomic engineering Methods 0.000 claims description 3
- 230000005747 tumor angiogenesis Effects 0.000 claims description 3
- 102100039398 C-X-C motif chemokine 2 Human genes 0.000 claims description 2
- 102000001301 EGF receptor Human genes 0.000 claims description 2
- 108060006698 EGF receptor Proteins 0.000 claims description 2
- 101100061856 Homo sapiens CXCL2 gene Proteins 0.000 claims description 2
- 101001133081 Homo sapiens Mucin-2 Proteins 0.000 claims description 2
- 206010021143 Hypoxia Diseases 0.000 claims description 2
- 102100034263 Mucin-2 Human genes 0.000 claims description 2
- 230000007954 hypoxia Effects 0.000 claims description 2
- 230000006698 induction Effects 0.000 claims description 2
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 claims 3
- 102000003666 Placenta Growth Factor Human genes 0.000 claims 2
- 101000972284 Homo sapiens Mucin-3A Proteins 0.000 claims 1
- 101000972282 Homo sapiens Mucin-5AC Proteins 0.000 claims 1
- 101000972276 Homo sapiens Mucin-5B Proteins 0.000 claims 1
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 claims 1
- 102100022497 Mucin-3A Human genes 0.000 claims 1
- 102100022494 Mucin-5B Human genes 0.000 claims 1
- 235000008331 Pinus X rigitaeda Nutrition 0.000 claims 1
- 235000011613 Pinus brutia Nutrition 0.000 claims 1
- 241000018646 Pinus brutia Species 0.000 claims 1
- 102000002259 TNF-Related Apoptosis-Inducing Ligand Receptors Human genes 0.000 claims 1
- 108010000449 TNF-Related Apoptosis-Inducing Ligand Receptors Proteins 0.000 claims 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 49
- 201000010099 disease Diseases 0.000 abstract description 38
- 238000000034 method Methods 0.000 description 119
- 239000000562 conjugate Substances 0.000 description 109
- 239000003814 drug Substances 0.000 description 90
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 78
- 229940079593 drug Drugs 0.000 description 67
- 235000001014 amino acid Nutrition 0.000 description 47
- 108090000765 processed proteins & peptides Proteins 0.000 description 47
- 108090000623 proteins and genes Proteins 0.000 description 45
- 125000005647 linker group Chemical group 0.000 description 42
- 229940024606 amino acid Drugs 0.000 description 39
- 239000000047 product Substances 0.000 description 34
- 239000000203 mixture Substances 0.000 description 32
- 230000001225 therapeutic effect Effects 0.000 description 32
- FJHBVJOVLFPMQE-QFIPXVFZSA-N 7-Ethyl-10-Hydroxy-Camptothecin Chemical compound C1=C(O)C=C2C(CC)=C(CN3C(C4=C([C@@](C(=O)OC4)(O)CC)C=C33)=O)C3=NC2=C1 FJHBVJOVLFPMQE-QFIPXVFZSA-N 0.000 description 31
- 102000004169 proteins and genes Human genes 0.000 description 30
- 235000018102 proteins Nutrition 0.000 description 29
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 28
- 239000002202 Polyethylene glycol Substances 0.000 description 27
- 238000006467 substitution reaction Methods 0.000 description 27
- 229920001223 polyethylene glycol Polymers 0.000 description 26
- 238000002360 preparation method Methods 0.000 description 25
- 238000004128 high performance liquid chromatography Methods 0.000 description 24
- 102000004196 processed proteins & peptides Human genes 0.000 description 24
- 239000012636 effector Substances 0.000 description 23
- 238000003818 flash chromatography Methods 0.000 description 22
- 239000000543 intermediate Substances 0.000 description 22
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 21
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 20
- 206010058314 Dysplasia Diseases 0.000 description 20
- 229940127093 camptothecin Drugs 0.000 description 20
- 230000000973 chemotherapeutic effect Effects 0.000 description 20
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 20
- 239000002246 antineoplastic agent Substances 0.000 description 19
- 230000021615 conjugation Effects 0.000 description 19
- 108020001507 fusion proteins Proteins 0.000 description 18
- 102000037865 fusion proteins Human genes 0.000 description 18
- 238000001819 mass spectrum Methods 0.000 description 18
- 229940124597 therapeutic agent Drugs 0.000 description 18
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 17
- 125000003277 amino group Chemical group 0.000 description 17
- 125000002534 ethynyl group Chemical group [H]C#C* 0.000 description 17
- 239000012634 fragment Substances 0.000 description 17
- 239000002904 solvent Substances 0.000 description 17
- 101150044980 Akap1 gene Proteins 0.000 description 16
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 16
- 102000004127 Cytokines Human genes 0.000 description 16
- 108090000695 Cytokines Proteins 0.000 description 16
- 241000700605 Viruses Species 0.000 description 16
- 229940044683 chemotherapy drug Drugs 0.000 description 16
- 238000002560 therapeutic procedure Methods 0.000 description 16
- 208000023275 Autoimmune disease Diseases 0.000 description 15
- 244000052769 pathogen Species 0.000 description 15
- 230000008569 process Effects 0.000 description 15
- 230000000770 proinflammatory effect Effects 0.000 description 15
- 210000001519 tissue Anatomy 0.000 description 15
- VHYFNPMBLIVWCW-UHFFFAOYSA-N 4-Dimethylaminopyridine Chemical compound CN(C)C1=CC=NC=C1 VHYFNPMBLIVWCW-UHFFFAOYSA-N 0.000 description 14
- 241000725303 Human immunodeficiency virus Species 0.000 description 14
- RDOXTESZEPMUJZ-UHFFFAOYSA-N anisole Chemical compound COC1=CC=CC=C1 RDOXTESZEPMUJZ-UHFFFAOYSA-N 0.000 description 14
- 102000005962 receptors Human genes 0.000 description 14
- 108020003175 receptors Proteins 0.000 description 14
- 108091023037 Aptamer Proteins 0.000 description 13
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Natural products NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 13
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 13
- 125000003275 alpha amino acid group Chemical group 0.000 description 13
- 210000003719 b-lymphocyte Anatomy 0.000 description 13
- 239000011159 matrix material Substances 0.000 description 13
- 229960001592 paclitaxel Drugs 0.000 description 13
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 12
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 12
- 150000001540 azides Chemical class 0.000 description 12
- FZFAMSAMCHXGEF-UHFFFAOYSA-N chloro formate Chemical compound ClOC=O FZFAMSAMCHXGEF-UHFFFAOYSA-N 0.000 description 12
- 210000004408 hybridoma Anatomy 0.000 description 12
- 238000002823 phage display Methods 0.000 description 12
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 11
- 239000004971 Cross linker Substances 0.000 description 11
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 11
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 11
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 11
- 229930012538 Paclitaxel Natural products 0.000 description 11
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 11
- HSFWRNGVRCDJHI-UHFFFAOYSA-N alpha-acetylene Natural products C#C HSFWRNGVRCDJHI-UHFFFAOYSA-N 0.000 description 11
- 238000001727 in vivo Methods 0.000 description 11
- 208000015181 infectious disease Diseases 0.000 description 11
- 239000000126 substance Substances 0.000 description 11
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical group NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 10
- 102000008130 Cyclic AMP-Dependent Protein Kinases Human genes 0.000 description 10
- 150000008575 L-amino acids Chemical class 0.000 description 10
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 10
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 10
- 108090000190 Thrombin Proteins 0.000 description 10
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 10
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 10
- 125000000539 amino acid group Chemical group 0.000 description 10
- 239000011230 binding agent Substances 0.000 description 10
- 238000006243 chemical reaction Methods 0.000 description 10
- 150000001875 compounds Chemical class 0.000 description 10
- 208000035475 disorder Diseases 0.000 description 10
- 238000000605 extraction Methods 0.000 description 10
- 239000002955 immunomodulating agent Substances 0.000 description 10
- 229940121354 immunomodulator Drugs 0.000 description 10
- 229920001184 polypeptide Polymers 0.000 description 10
- 125000006239 protecting group Chemical group 0.000 description 10
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 10
- 229960004072 thrombin Drugs 0.000 description 10
- 108700012359 toxins Proteins 0.000 description 10
- AXKGIPZJYUNAIW-UHFFFAOYSA-N (4-aminophenyl)methanol Chemical compound NC1=CC=C(CO)C=C1 AXKGIPZJYUNAIW-UHFFFAOYSA-N 0.000 description 9
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 9
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 9
- 241000699666 Mus <mouse, genus> Species 0.000 description 9
- 210000001744 T-lymphocyte Anatomy 0.000 description 9
- 230000015572 biosynthetic process Effects 0.000 description 9
- 239000003795 chemical substances by application Substances 0.000 description 9
- 238000006352 cycloaddition reaction Methods 0.000 description 9
- PNZXMIKHJXIPEK-UHFFFAOYSA-N cyclohexanecarboxamide Chemical compound NC(=O)C1CCCCC1 PNZXMIKHJXIPEK-UHFFFAOYSA-N 0.000 description 9
- 229960004679 doxorubicin Drugs 0.000 description 9
- 201000002528 pancreatic cancer Diseases 0.000 description 9
- 208000008443 pancreatic carcinoma Diseases 0.000 description 9
- 239000002245 particle Substances 0.000 description 9
- 239000003053 toxin Substances 0.000 description 9
- 231100000765 toxin Toxicity 0.000 description 9
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 8
- 102000019034 Chemokines Human genes 0.000 description 8
- 108010012236 Chemokines Proteins 0.000 description 8
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 8
- 208000017604 Hodgkin disease Diseases 0.000 description 8
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 8
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 8
- 230000008901 benefit Effects 0.000 description 8
- 230000001588 bifunctional effect Effects 0.000 description 8
- 239000003153 chemical reaction reagent Substances 0.000 description 8
- JXTHNDFMNIQAHM-UHFFFAOYSA-N dichloroacetic acid Chemical compound OC(=O)C(Cl)Cl JXTHNDFMNIQAHM-UHFFFAOYSA-N 0.000 description 8
- 230000000694 effects Effects 0.000 description 8
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 8
- 229940027941 immunoglobulin g Drugs 0.000 description 8
- 208000014018 liver neoplasm Diseases 0.000 description 8
- 238000000746 purification Methods 0.000 description 8
- FPGGTKZVZWFYPV-UHFFFAOYSA-M tetrabutylammonium fluoride Chemical compound [F-].CCCC[N+](CCCC)(CCCC)CCCC FPGGTKZVZWFYPV-UHFFFAOYSA-M 0.000 description 8
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 8
- INAUWOVKEZHHDM-PEDBPRJASA-N (7s,9s)-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-7-[(2r,4s,5s,6s)-5-hydroxy-6-methyl-4-morpholin-4-yloxan-2-yl]oxy-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound Cl.N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1 INAUWOVKEZHHDM-PEDBPRJASA-N 0.000 description 7
- 241000894006 Bacteria Species 0.000 description 7
- 206010009944 Colon cancer Diseases 0.000 description 7
- 108010050904 Interferons Proteins 0.000 description 7
- 102000014150 Interferons Human genes 0.000 description 7
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 7
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 7
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 7
- 241000699670 Mus sp. Species 0.000 description 7
- 125000000217 alkyl group Chemical group 0.000 description 7
- IVRMZWNICZWHMI-UHFFFAOYSA-N azide group Chemical group [N-]=[N+]=[N-] IVRMZWNICZWHMI-UHFFFAOYSA-N 0.000 description 7
- 239000002158 endotoxin Substances 0.000 description 7
- 229940047124 interferons Drugs 0.000 description 7
- 201000007270 liver cancer Diseases 0.000 description 7
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 7
- UZKWTJUDCOPSNM-UHFFFAOYSA-N methoxybenzene Substances CCCCOC=C UZKWTJUDCOPSNM-UHFFFAOYSA-N 0.000 description 7
- 239000011541 reaction mixture Substances 0.000 description 7
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 6
- 229960000549 4-dimethylaminophenol Drugs 0.000 description 6
- 208000030507 AIDS Diseases 0.000 description 6
- 239000004475 Arginine Substances 0.000 description 6
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 6
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 6
- 108060003951 Immunoglobulin Proteins 0.000 description 6
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 6
- ODKSFYDXXFIFQN-BYPYZUCNSA-N L-arginine Chemical compound OC(=O)[C@@H](N)CCCN=C(N)N ODKSFYDXXFIFQN-BYPYZUCNSA-N 0.000 description 6
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 6
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 6
- 239000002253 acid Substances 0.000 description 6
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 6
- 229960003121 arginine Drugs 0.000 description 6
- 235000009697 arginine Nutrition 0.000 description 6
- 102000018358 immunoglobulin Human genes 0.000 description 6
- 230000002458 infectious effect Effects 0.000 description 6
- NWYYWIJOWOLJNR-RXMQYKEDSA-N l-valinol Chemical group CC(C)[C@H](N)CO NWYYWIJOWOLJNR-RXMQYKEDSA-N 0.000 description 6
- 238000003032 molecular docking Methods 0.000 description 6
- 210000000056 organ Anatomy 0.000 description 6
- 239000002243 precursor Substances 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 150000003573 thiols Chemical class 0.000 description 6
- UCPYLLCMEDAXFR-UHFFFAOYSA-N triphosgene Chemical compound ClC(Cl)(Cl)OC(=O)OC(Cl)(Cl)Cl UCPYLLCMEDAXFR-UHFFFAOYSA-N 0.000 description 6
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 5
- 206010003571 Astrocytoma Diseases 0.000 description 5
- 206010006187 Breast cancer Diseases 0.000 description 5
- 208000026310 Breast neoplasm Diseases 0.000 description 5
- 102100022002 CD59 glycoprotein Human genes 0.000 description 5
- 102000014914 Carrier Proteins Human genes 0.000 description 5
- 208000035473 Communicable disease Diseases 0.000 description 5
- 102100025680 Complement decay-accelerating factor Human genes 0.000 description 5
- 239000004471 Glycine Substances 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- 101000897400 Homo sapiens CD59 glycoprotein Proteins 0.000 description 5
- 101000856022 Homo sapiens Complement decay-accelerating factor Proteins 0.000 description 5
- 101000961414 Homo sapiens Membrane cofactor protein Proteins 0.000 description 5
- 108010002352 Interleukin-1 Proteins 0.000 description 5
- 108090001005 Interleukin-6 Proteins 0.000 description 5
- 239000004472 Lysine Substances 0.000 description 5
- 102100039373 Membrane cofactor protein Human genes 0.000 description 5
- 241000699660 Mus musculus Species 0.000 description 5
- 206010035226 Plasma cell myeloma Diseases 0.000 description 5
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 5
- 208000021386 Sjogren Syndrome Diseases 0.000 description 5
- 238000012452 Xenomouse strains Methods 0.000 description 5
- 206010003246 arthritis Diseases 0.000 description 5
- 229960001230 asparagine Drugs 0.000 description 5
- 235000009582 asparagine Nutrition 0.000 description 5
- 108091008324 binding proteins Proteins 0.000 description 5
- 125000002843 carboxylic acid group Chemical group 0.000 description 5
- 208000029742 colonic neoplasm Diseases 0.000 description 5
- 238000005859 coupling reaction Methods 0.000 description 5
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 5
- 229960002433 cysteine Drugs 0.000 description 5
- 235000018417 cysteine Nutrition 0.000 description 5
- 238000010511 deprotection reaction Methods 0.000 description 5
- 238000011161 development Methods 0.000 description 5
- 230000018109 developmental process Effects 0.000 description 5
- 102000034356 gene-regulatory proteins Human genes 0.000 description 5
- 108091006104 gene-regulatory proteins Proteins 0.000 description 5
- 229960002449 glycine Drugs 0.000 description 5
- 229940088597 hormone Drugs 0.000 description 5
- 239000005556 hormone Substances 0.000 description 5
- 230000028993 immune response Effects 0.000 description 5
- 238000009169 immunotherapy Methods 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 230000003834 intracellular effect Effects 0.000 description 5
- 210000004072 lung Anatomy 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 5
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 206010039073 rheumatoid arthritis Diseases 0.000 description 5
- 238000011830 transgenic mouse model Methods 0.000 description 5
- 239000013598 vector Substances 0.000 description 5
- CTYHQVFFQRDJSN-LHEWISCISA-N (2s)-2-(9h-fluoren-9-ylmethoxycarbonylamino)-6-[[(4-methoxyphenyl)-diphenylmethyl]amino]hexanoic acid Chemical compound C1=CC(OC)=CC=C1C(C=1C=CC=CC=1)(C=1C=CC=CC=1)NCCCC[C@@H](C(O)=O)NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C21 CTYHQVFFQRDJSN-LHEWISCISA-N 0.000 description 4
- NOPNWHSMQOXAEI-PUCKCBAPSA-N (7s,9s)-7-[(2r,4s,5s,6s)-4-(2,3-dihydropyrrol-1-yl)-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione Chemical compound N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCC=C1 NOPNWHSMQOXAEI-PUCKCBAPSA-N 0.000 description 4
- BEVWMRQFVUOPJT-UHFFFAOYSA-N 2,4-dimethyl-1,3-thiazole-5-carboxamide Chemical compound CC1=NC(C)=C(C(N)=O)S1 BEVWMRQFVUOPJT-UHFFFAOYSA-N 0.000 description 4
- NWYYWIJOWOLJNR-UHFFFAOYSA-N 2-Amino-3-methyl-1-butanol Chemical compound CC(C)C(N)CO NWYYWIJOWOLJNR-UHFFFAOYSA-N 0.000 description 4
- 108010039209 Blood Coagulation Factors Proteins 0.000 description 4
- 102000015081 Blood Coagulation Factors Human genes 0.000 description 4
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical compound NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 4
- GKQLYSROISKDLL-UHFFFAOYSA-N EEDQ Chemical compound C1=CC=C2N(C(=O)OCC)C(OCC)C=CC2=C1 GKQLYSROISKDLL-UHFFFAOYSA-N 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- 241000233866 Fungi Species 0.000 description 4
- 206010021245 Idiopathic thrombocytopenic purpura Diseases 0.000 description 4
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 4
- 102100020793 Interleukin-13 receptor subunit alpha-2 Human genes 0.000 description 4
- 208000008839 Kidney Neoplasms Diseases 0.000 description 4
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 4
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 4
- 208000034578 Multiple myelomas Diseases 0.000 description 4
- CMVRBCDBISKHME-URBSQPMJSA-N N([C@@H](CCCCN)C(=O)NC1=CC=C(C=C1)COC(=O)O[C@]1(CC)C(=O)OCC2=C1C=C1N(C2=O)CC2=C(C3=CC(O)=CC=C3N=C21)CC)C(=O)COCC(=O)NCCOCCOCCOCCOCCOCCOCCOCCOCCN(N=N1)C=C1CNC(=O)C(CC1)CCC1CN1C(=O)C=CC1=O Chemical compound N([C@@H](CCCCN)C(=O)NC1=CC=C(C=C1)COC(=O)O[C@]1(CC)C(=O)OCC2=C1C=C1N(C2=O)CC2=C(C3=CC(O)=CC=C3N=C21)CC)C(=O)COCC(=O)NCCOCCOCCOCCOCCOCCOCCOCCOCCN(N=N1)C=C1CNC(=O)C(CC1)CCC1CN1C(=O)C=CC1=O CMVRBCDBISKHME-URBSQPMJSA-N 0.000 description 4
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 description 4
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 4
- 206010061535 Ovarian neoplasm Diseases 0.000 description 4
- 102100035194 Placenta growth factor Human genes 0.000 description 4
- 108010029485 Protein Isoforms Proteins 0.000 description 4
- 102000001708 Protein Isoforms Human genes 0.000 description 4
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 4
- 208000005718 Stomach Neoplasms Diseases 0.000 description 4
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 description 4
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 4
- QTQUJRIHTSIVOF-UHFFFAOYSA-N amino(phenyl)methanol Chemical compound NC(O)C1=CC=CC=C1 QTQUJRIHTSIVOF-UHFFFAOYSA-N 0.000 description 4
- 238000011717 athymic nude mouse Methods 0.000 description 4
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 description 4
- 125000001743 benzylic group Chemical group 0.000 description 4
- 239000003114 blood coagulation factor Substances 0.000 description 4
- ODWXUNBKCRECNW-UHFFFAOYSA-M bromocopper(1+) Chemical compound Br[Cu+] ODWXUNBKCRECNW-UHFFFAOYSA-M 0.000 description 4
- 238000002512 chemotherapy Methods 0.000 description 4
- 230000001684 chronic effect Effects 0.000 description 4
- 238000010168 coupling process Methods 0.000 description 4
- 229940127089 cytotoxic agent Drugs 0.000 description 4
- 201000001981 dermatomyositis Diseases 0.000 description 4
- 229960005215 dichloroacetic acid Drugs 0.000 description 4
- 238000006471 dimerization reaction Methods 0.000 description 4
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 4
- 239000003118 drug derivative Substances 0.000 description 4
- 208000002169 ectodermal dysplasia Diseases 0.000 description 4
- 229940088598 enzyme Drugs 0.000 description 4
- 239000013604 expression vector Substances 0.000 description 4
- 239000006260 foam Substances 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 206010017758 gastric cancer Diseases 0.000 description 4
- 208000005017 glioblastoma Diseases 0.000 description 4
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 4
- 235000004554 glutamine Nutrition 0.000 description 4
- 229960002743 glutamine Drugs 0.000 description 4
- 125000004029 hydroxymethyl group Chemical group [H]OC([H])([H])* 0.000 description 4
- 230000002584 immunomodulator Effects 0.000 description 4
- 108040003607 interleukin-13 receptor activity proteins Proteins 0.000 description 4
- 150000002500 ions Chemical class 0.000 description 4
- 210000000244 kidney pelvis Anatomy 0.000 description 4
- 230000003902 lesion Effects 0.000 description 4
- 208000020816 lung neoplasm Diseases 0.000 description 4
- 125000000325 methylidene group Chemical group [H]C([H])=* 0.000 description 4
- 201000006417 multiple sclerosis Diseases 0.000 description 4
- 230000009826 neoplastic cell growth Effects 0.000 description 4
- 238000011275 oncology therapy Methods 0.000 description 4
- 201000008968 osteosarcoma Diseases 0.000 description 4
- 238000001556 precipitation Methods 0.000 description 4
- 238000000926 separation method Methods 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 208000000587 small cell lung carcinoma Diseases 0.000 description 4
- 239000011734 sodium Substances 0.000 description 4
- 239000007787 solid Substances 0.000 description 4
- 125000006850 spacer group Chemical group 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 230000009870 specific binding Effects 0.000 description 4
- 206010041823 squamous cell carcinoma Diseases 0.000 description 4
- 201000011549 stomach cancer Diseases 0.000 description 4
- 125000003396 thiol group Chemical group [H]S* 0.000 description 4
- 230000009261 transgenic effect Effects 0.000 description 4
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 4
- 229960005486 vaccine Drugs 0.000 description 4
- YIMDLWDNDGKDTJ-QLKYHASDSA-N 3'-deamino-3'-(3-cyanomorpholin-4-yl)doxorubicin Chemical compound N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1C#N YIMDLWDNDGKDTJ-QLKYHASDSA-N 0.000 description 3
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 3
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 3
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 3
- 241000024188 Andala Species 0.000 description 3
- 206010005003 Bladder cancer Diseases 0.000 description 3
- 208000003174 Brain Neoplasms Diseases 0.000 description 3
- 108010062802 CD66 antigens Proteins 0.000 description 3
- 206010008342 Cervix carcinoma Diseases 0.000 description 3
- 102000007644 Colony-Stimulating Factors Human genes 0.000 description 3
- 108010071942 Colony-Stimulating Factors Proteins 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- QOSSAOTZNIDXMA-UHFFFAOYSA-N Dicylcohexylcarbodiimide Chemical compound C1CCCCC1N=C=NC1CCCCC1 QOSSAOTZNIDXMA-UHFFFAOYSA-N 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 108010016626 Dipeptides Proteins 0.000 description 3
- 102000003951 Erythropoietin Human genes 0.000 description 3
- 108090000394 Erythropoietin Proteins 0.000 description 3
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 3
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical class NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 3
- 101000595923 Homo sapiens Placenta growth factor Proteins 0.000 description 3
- 102000014429 Insulin-like growth factor Human genes 0.000 description 3
- 102100037792 Interleukin-6 receptor subunit alpha Human genes 0.000 description 3
- 108010063738 Interleukins Proteins 0.000 description 3
- 102000015696 Interleukins Human genes 0.000 description 3
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- 125000000998 L-alanino group Chemical group [H]N([*])[C@](C([H])([H])[H])([H])C(=O)O[H] 0.000 description 3
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 3
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 3
- 206010025323 Lymphomas Diseases 0.000 description 3
- 208000000172 Medulloblastoma Diseases 0.000 description 3
- 206010027476 Metastases Diseases 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- RJQXTJLFIWVMTO-TYNCELHUSA-N Methicillin Chemical compound COC1=CC=CC(OC)=C1C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 RJQXTJLFIWVMTO-TYNCELHUSA-N 0.000 description 3
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 3
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 3
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 206010033128 Ovarian cancer Diseases 0.000 description 3
- 102000057297 Pepsin A Human genes 0.000 description 3
- 108090000284 Pepsin A Proteins 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- 206010060862 Prostate cancer Diseases 0.000 description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 206010038389 Renal cancer Diseases 0.000 description 3
- 241000725643 Respiratory syncytial virus Species 0.000 description 3
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 3
- 206010041067 Small cell lung cancer Diseases 0.000 description 3
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 3
- 229940123237 Taxane Drugs 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 239000004473 Threonine Substances 0.000 description 3
- 102000036693 Thrombopoietin Human genes 0.000 description 3
- 108010041111 Thrombopoietin Proteins 0.000 description 3
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 3
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 3
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 3
- 208000008383 Wilms tumor Diseases 0.000 description 3
- PPZYBFUYKJPWBY-UHFFFAOYSA-N acetylene azide Chemical group C#C.[N-]=[N+]=[N-] PPZYBFUYKJPWBY-UHFFFAOYSA-N 0.000 description 3
- 208000009956 adenocarcinoma Diseases 0.000 description 3
- 229960003767 alanine Drugs 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 229940045799 anthracyclines and related substance Drugs 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 229940088710 antibiotic agent Drugs 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 229910052786 argon Inorganic materials 0.000 description 3
- 229960005261 aspartic acid Drugs 0.000 description 3
- 235000003704 aspartic acid Nutrition 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 3
- 125000004744 butyloxycarbonyl group Chemical group 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 3
- 201000010881 cervical cancer Diseases 0.000 description 3
- 229940047120 colony stimulating factors Drugs 0.000 description 3
- 206010012601 diabetes mellitus Diseases 0.000 description 3
- 239000002552 dosage form Substances 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 210000000981 epithelium Anatomy 0.000 description 3
- 229940105423 erythropoietin Drugs 0.000 description 3
- 150000002148 esters Chemical class 0.000 description 3
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 3
- 210000001035 gastrointestinal tract Anatomy 0.000 description 3
- 235000013922 glutamic acid Nutrition 0.000 description 3
- 229960002989 glutamic acid Drugs 0.000 description 3
- 239000004220 glutamic acid Substances 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 229960002885 histidine Drugs 0.000 description 3
- 230000002267 hypothalamic effect Effects 0.000 description 3
- 238000003384 imaging method Methods 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 108040006858 interleukin-6 receptor activity proteins Proteins 0.000 description 3
- 229940047122 interleukins Drugs 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 3
- 229960000310 isoleucine Drugs 0.000 description 3
- 201000010982 kidney cancer Diseases 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 201000005202 lung cancer Diseases 0.000 description 3
- 235000018977 lysine Nutrition 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 229910052751 metal Inorganic materials 0.000 description 3
- 239000002184 metal Substances 0.000 description 3
- 230000009401 metastasis Effects 0.000 description 3
- 229960003085 meticillin Drugs 0.000 description 3
- 208000025113 myeloid leukemia Diseases 0.000 description 3
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 3
- 201000008383 nephritis Diseases 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 150000007523 nucleic acids Chemical class 0.000 description 3
- 244000045947 parasite Species 0.000 description 3
- 230000001717 pathogenic effect Effects 0.000 description 3
- 229940111202 pepsin Drugs 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 235000019833 protease Nutrition 0.000 description 3
- 238000011363 radioimmunotherapy Methods 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 3
- 201000000306 sarcoidosis Diseases 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 208000037969 squamous neck cancer Diseases 0.000 description 3
- 208000011580 syndromic disease Diseases 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 3
- 229960000303 topotecan Drugs 0.000 description 3
- 231100000167 toxic agent Toxicity 0.000 description 3
- 239000003440 toxic substance Substances 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- 210000000626 ureter Anatomy 0.000 description 3
- 239000004474 valine Substances 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- 230000000007 visual effect Effects 0.000 description 3
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 2
- NGNBDVOYPDDBFK-UHFFFAOYSA-N 2-[2,4-di(pentan-2-yl)phenoxy]acetyl chloride Chemical compound CCCC(C)C1=CC=C(OCC(Cl)=O)C(C(C)CCC)=C1 NGNBDVOYPDDBFK-UHFFFAOYSA-N 0.000 description 2
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 2
- 108010011122 A Kinase Anchor Proteins Proteins 0.000 description 2
- 102000014022 A Kinase Anchor Proteins Human genes 0.000 description 2
- 241000203022 Acholeplasma laidlawii Species 0.000 description 2
- 208000026872 Addison Disease Diseases 0.000 description 2
- USFZMSVCRYTOJT-UHFFFAOYSA-N Ammonium acetate Chemical compound N.CC(O)=O USFZMSVCRYTOJT-UHFFFAOYSA-N 0.000 description 2
- 239000005695 Ammonium acetate Substances 0.000 description 2
- 206010061424 Anal cancer Diseases 0.000 description 2
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 2
- 241000223838 Babesia bovis Species 0.000 description 2
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 2
- 206010004593 Bile duct cancer Diseases 0.000 description 2
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 2
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 2
- 241000120506 Bluetongue virus Species 0.000 description 2
- 102100037086 Bone marrow stromal antigen 2 Human genes 0.000 description 2
- 241000589969 Borreliella burgdorferi Species 0.000 description 2
- 241000589567 Brucella abortus Species 0.000 description 2
- 102100032528 C-type lectin domain family 11 member A Human genes 0.000 description 2
- 101710167766 C-type lectin domain family 11 member A Proteins 0.000 description 2
- 206010007953 Central nervous system lymphoma Diseases 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 206010008748 Chorea Diseases 0.000 description 2
- 206010008909 Chronic Hepatitis Diseases 0.000 description 2
- 206010009900 Colitis ulcerative Diseases 0.000 description 2
- 206010010452 Congenital ectodermal dysplasia Diseases 0.000 description 2
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 2
- 201000007336 Cryptococcosis Diseases 0.000 description 2
- 241000221204 Cryptococcus neoformans Species 0.000 description 2
- 201000003808 Cystic echinococcosis Diseases 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- 208000013558 Developmental Bone disease Diseases 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 241000244170 Echinococcus granulosus Species 0.000 description 2
- 206010014733 Endometrial cancer Diseases 0.000 description 2
- 206010014759 Endometrial neoplasm Diseases 0.000 description 2
- 206010014967 Ependymoma Diseases 0.000 description 2
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 2
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 description 2
- 206010015150 Erythema Diseases 0.000 description 2
- 206010015226 Erythema nodosum Diseases 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 108090000371 Esterases Proteins 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 208000006168 Ewing Sarcoma Diseases 0.000 description 2
- 241000714165 Feline leukemia virus Species 0.000 description 2
- 108010003471 Fetal Proteins Proteins 0.000 description 2
- 102000004641 Fetal Proteins Human genes 0.000 description 2
- KRHYYFGTRYWZRS-UHFFFAOYSA-M Fluoride anion Chemical compound [F-] KRHYYFGTRYWZRS-UHFFFAOYSA-M 0.000 description 2
- 102000012673 Follicle Stimulating Hormone Human genes 0.000 description 2
- 108010079345 Follicle Stimulating Hormone Proteins 0.000 description 2
- 201000010915 Glioblastoma multiforme Diseases 0.000 description 2
- 206010018372 Glomerulonephritis membranous Diseases 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 208000024869 Goodpasture syndrome Diseases 0.000 description 2
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 2
- 208000031886 HIV Infections Diseases 0.000 description 2
- 208000037357 HIV infectious disease Diseases 0.000 description 2
- 201000004331 Henoch-Schoenlein purpura Diseases 0.000 description 2
- 206010019617 Henoch-Schonlein purpura Diseases 0.000 description 2
- 241000711549 Hepacivirus C Species 0.000 description 2
- 241000700721 Hepatitis B virus Species 0.000 description 2
- 206010019755 Hepatitis chronic active Diseases 0.000 description 2
- 241000228404 Histoplasma capsulatum Species 0.000 description 2
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 2
- 101000935587 Homo sapiens Flavin reductase (NADPH) Proteins 0.000 description 2
- 101001001487 Homo sapiens Phosphatidylinositol-glycan biosynthesis class F protein Proteins 0.000 description 2
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 2
- 108010000521 Human Growth Hormone Proteins 0.000 description 2
- 102000002265 Human Growth Hormone Human genes 0.000 description 2
- 239000000854 Human Growth Hormone Substances 0.000 description 2
- 241000701074 Human alphaherpesvirus 2 Species 0.000 description 2
- 241000701085 Human alphaherpesvirus 3 Species 0.000 description 2
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 2
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 2
- 206010020850 Hyperthyroidism Diseases 0.000 description 2
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 description 2
- 208000031814 IgA Vasculitis Diseases 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- 235000019766 L-Lysine Nutrition 0.000 description 2
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- 241000589248 Legionella Species 0.000 description 2
- 208000007764 Legionnaires' Disease Diseases 0.000 description 2
- 241000222736 Leishmania tropica Species 0.000 description 2
- 102000009151 Luteinizing Hormone Human genes 0.000 description 2
- 108010073521 Luteinizing Hormone Proteins 0.000 description 2
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 2
- 241000712899 Lymphocytic choriomeningitis mammarenavirus Species 0.000 description 2
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 2
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 2
- 241000712079 Measles morbillivirus Species 0.000 description 2
- 241000520674 Mesocestoides corti Species 0.000 description 2
- 241000713333 Mouse mammary tumor virus Species 0.000 description 2
- 241000711386 Mumps virus Species 0.000 description 2
- 241000714177 Murine leukemia virus Species 0.000 description 2
- 241000711408 Murine respirovirus Species 0.000 description 2
- 208000000112 Myalgia Diseases 0.000 description 2
- 241000204031 Mycoplasma Species 0.000 description 2
- 241000204028 Mycoplasma arginini Species 0.000 description 2
- 241000202956 Mycoplasma arthritidis Species 0.000 description 2
- 241000202938 Mycoplasma hyorhinis Species 0.000 description 2
- 241000202894 Mycoplasma orale Species 0.000 description 2
- 241000202934 Mycoplasma pneumoniae Species 0.000 description 2
- 241000202889 Mycoplasma salivarium Species 0.000 description 2
- 241000588653 Neisseria Species 0.000 description 2
- 241000588650 Neisseria meningitidis Species 0.000 description 2
- 206010029260 Neuroblastoma Diseases 0.000 description 2
- 241000243985 Onchocerca volvulus Species 0.000 description 2
- 208000004286 Osteochondrodysplasias Diseases 0.000 description 2
- 206010034277 Pemphigoid Diseases 0.000 description 2
- 201000011152 Pemphigus Diseases 0.000 description 2
- FADYJNXDPBKVCA-STQMWFEESA-N Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 FADYJNXDPBKVCA-STQMWFEESA-N 0.000 description 2
- 208000007641 Pinealoma Diseases 0.000 description 2
- 241000223960 Plasmodium falciparum Species 0.000 description 2
- 241000223810 Plasmodium vivax Species 0.000 description 2
- 206010065159 Polychondritis Diseases 0.000 description 2
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 2
- 101000762949 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) Exotoxin A Proteins 0.000 description 2
- 241000711798 Rabies lyssavirus Species 0.000 description 2
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 2
- 208000015634 Rectal Neoplasms Diseases 0.000 description 2
- 208000006265 Renal cell carcinoma Diseases 0.000 description 2
- 241000702263 Reovirus sp. Species 0.000 description 2
- 208000004453 Retinal Dysplasia Diseases 0.000 description 2
- 201000000582 Retinoblastoma Diseases 0.000 description 2
- 108010083644 Ribonucleases Proteins 0.000 description 2
- 102000006382 Ribonucleases Human genes 0.000 description 2
- 241000606701 Rickettsia Species 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 241000710799 Rubella virus Species 0.000 description 2
- 206010061934 Salivary gland cancer Diseases 0.000 description 2
- 241000242678 Schistosoma Species 0.000 description 2
- 241000242680 Schistosoma mansoni Species 0.000 description 2
- 206010039710 Scleroderma Diseases 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 241000700584 Simplexvirus Species 0.000 description 2
- 241000710960 Sindbis virus Species 0.000 description 2
- 206010072610 Skeletal dysplasia Diseases 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical class [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 241000191967 Staphylococcus aureus Species 0.000 description 2
- 241000193985 Streptococcus agalactiae Species 0.000 description 2
- 241000193996 Streptococcus pyogenes Species 0.000 description 2
- 208000027522 Sydenham chorea Diseases 0.000 description 2
- 208000000389 T-cell leukemia Diseases 0.000 description 2
- 208000028530 T-cell lymphoblastic leukemia/lymphoma Diseases 0.000 description 2
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 2
- 241001672171 Taenia hydatigena Species 0.000 description 2
- 241000244154 Taenia ovis Species 0.000 description 2
- 241000244159 Taenia saginata Species 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- 208000024313 Testicular Neoplasms Diseases 0.000 description 2
- 241000223779 Theileria parva Species 0.000 description 2
- 206010043540 Thromboangiitis obliterans Diseases 0.000 description 2
- 102000011923 Thyrotropin Human genes 0.000 description 2
- 108010061174 Thyrotropin Proteins 0.000 description 2
- 241000223997 Toxoplasma gondii Species 0.000 description 2
- 108010009583 Transforming Growth Factors Proteins 0.000 description 2
- 102000009618 Transforming Growth Factors Human genes 0.000 description 2
- 241000589884 Treponema pallidum Species 0.000 description 2
- 241000243777 Trichinella spiralis Species 0.000 description 2
- 241000223104 Trypanosoma Species 0.000 description 2
- 241000223105 Trypanosoma brucei Species 0.000 description 2
- 241000223109 Trypanosoma cruzi Species 0.000 description 2
- 241000223097 Trypanosoma rangeli Species 0.000 description 2
- 201000006704 Ulcerative Colitis Diseases 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 208000023915 Ureteral Neoplasms Diseases 0.000 description 2
- 206010046392 Ureteric cancer Diseases 0.000 description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 2
- 241000711975 Vesicular stomatitis virus Species 0.000 description 2
- 206010047741 Vulval cancer Diseases 0.000 description 2
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 2
- 241000710886 West Nile virus Species 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 208000017733 acquired polycythemia vera Diseases 0.000 description 2
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 239000000853 adhesive Substances 0.000 description 2
- 230000001070 adhesive effect Effects 0.000 description 2
- 125000003545 alkoxy group Chemical group 0.000 description 2
- 150000001412 amines Chemical class 0.000 description 2
- 229940043376 ammonium acetate Drugs 0.000 description 2
- 235000019257 ammonium acetate Nutrition 0.000 description 2
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 2
- 208000007502 anemia Diseases 0.000 description 2
- 239000005557 antagonist Substances 0.000 description 2
- 230000001093 anti-cancer Effects 0.000 description 2
- 230000036436 anti-hiv Effects 0.000 description 2
- 230000000840 anti-viral effect Effects 0.000 description 2
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 2
- 229940009098 aspartate Drugs 0.000 description 2
- 229940120638 avastin Drugs 0.000 description 2
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- 239000012267 brine Substances 0.000 description 2
- 229940056450 brucella abortus Drugs 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 208000000594 bullous pemphigoid Diseases 0.000 description 2
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical class C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 2
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 2
- 229960004562 carboplatin Drugs 0.000 description 2
- 230000003197 catalytic effect Effects 0.000 description 2
- 239000003638 chemical reducing agent Substances 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 2
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 239000002131 composite material Substances 0.000 description 2
- 229910052802 copper Inorganic materials 0.000 description 2
- 239000010949 copper Substances 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 229940111134 coxibs Drugs 0.000 description 2
- 239000003255 cyclooxygenase 2 inhibitor Substances 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000011026 diafiltration Methods 0.000 description 2
- HPNMFZURTQLUMO-UHFFFAOYSA-N diethylamine Chemical compound CCNCC HPNMFZURTQLUMO-UHFFFAOYSA-N 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 229960001904 epirubicin Drugs 0.000 description 2
- 229930013356 epothilone Natural products 0.000 description 2
- HESCAJZNRMSMJG-KKQRBIROSA-N epothilone A Chemical class C/C([C@@H]1C[C@@H]2O[C@@H]2CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)O1)O)C)=C\C1=CSC(C)=N1 HESCAJZNRMSMJG-KKQRBIROSA-N 0.000 description 2
- 229950009760 epratuzumab Drugs 0.000 description 2
- 231100000321 erythema Toxicity 0.000 description 2
- 208000021045 exocrine pancreatic carcinoma Diseases 0.000 description 2
- 239000012467 final product Substances 0.000 description 2
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 2
- 229940028334 follicle stimulating hormone Drugs 0.000 description 2
- 125000000524 functional group Chemical group 0.000 description 2
- 230000002496 gastric effect Effects 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 229940049906 glutamate Drugs 0.000 description 2
- 229930195712 glutamate Natural products 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 230000003394 haemopoietic effect Effects 0.000 description 2
- 201000010536 head and neck cancer Diseases 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- 201000005787 hematologic cancer Diseases 0.000 description 2
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 2
- 201000000284 histiocytoma Diseases 0.000 description 2
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 2
- 239000001257 hydrogen Substances 0.000 description 2
- 229910052739 hydrogen Inorganic materials 0.000 description 2
- 230000003463 hyperproliferative effect Effects 0.000 description 2
- 201000003535 hypohidrotic ectodermal dysplasia Diseases 0.000 description 2
- 208000035128 hypohidrotic/hair/tooth type autosomal recessive ectodermal dysplasia 10B Diseases 0.000 description 2
- 208000032771 hypohidrotic/hair/tooth type autosomal recessive ectodermal dysplasia 11B Diseases 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 208000015446 immunoglobulin a vasculitis Diseases 0.000 description 2
- 208000027866 inflammatory disease Diseases 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- PGLTVOMIXTUURA-UHFFFAOYSA-N iodoacetamide Chemical compound NC(=O)CI PGLTVOMIXTUURA-UHFFFAOYSA-N 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 208000017169 kidney disease Diseases 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 229940040129 luteinizing hormone Drugs 0.000 description 2
- 208000003747 lymphoid leukemia Diseases 0.000 description 2
- 201000000564 macroglobulinemia Diseases 0.000 description 2
- 208000020984 malignant renal pelvis neoplasm Diseases 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 2
- 201000008350 membranous glomerulonephritis Diseases 0.000 description 2
- 231100000855 membranous nephropathy Toxicity 0.000 description 2
- 150000002739 metals Chemical class 0.000 description 2
- 230000001394 metastastic effect Effects 0.000 description 2
- 206010061289 metastatic neoplasm Diseases 0.000 description 2
- 208000037970 metastatic squamous neck cancer Diseases 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 125000004573 morpholin-4-yl group Chemical group N1(CCOCC1)* 0.000 description 2
- 206010028417 myasthenia gravis Diseases 0.000 description 2
- 201000005962 mycosis fungoides Diseases 0.000 description 2
- 201000008026 nephroblastoma Diseases 0.000 description 2
- 208000002040 neurosyphilis Diseases 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 125000000449 nitro group Chemical group [O-][N+](*)=O 0.000 description 2
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 2
- BVJSUAQZOZWCKN-UHFFFAOYSA-N p-hydroxybenzyl alcohol Chemical compound OCC1=CC=C(O)C=C1 BVJSUAQZOZWCKN-UHFFFAOYSA-N 0.000 description 2
- 201000001976 pemphigus vulgaris Diseases 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N phenol group Chemical group C1(=CC=CC=C1)O ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- 230000001766 physiological effect Effects 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 201000006292 polyarteritis nodosa Diseases 0.000 description 2
- 208000037244 polycythemia vera Diseases 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 208000005987 polymyositis Diseases 0.000 description 2
- 208000016800 primary central nervous system lymphoma Diseases 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 210000002307 prostate Anatomy 0.000 description 2
- 108020001580 protein domains Proteins 0.000 description 2
- 208000005069 pulmonary fibrosis Diseases 0.000 description 2
- 230000005855 radiation Effects 0.000 description 2
- 201000008158 rapidly progressive glomerulonephritis Diseases 0.000 description 2
- 206010038038 rectal cancer Diseases 0.000 description 2
- 201000001275 rectum cancer Diseases 0.000 description 2
- 201000007444 renal pelvis carcinoma Diseases 0.000 description 2
- 201000003068 rheumatic fever Diseases 0.000 description 2
- 150000003839 salts Chemical group 0.000 description 2
- 229920006395 saturated elastomer Polymers 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- CXMXRPHRNRROMY-UHFFFAOYSA-N sebacic acid Chemical compound OC(=O)CCCCCCCCC(O)=O CXMXRPHRNRROMY-UHFFFAOYSA-N 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 2
- 208000017572 squamous cell neoplasm Diseases 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 125000001424 substituent group Chemical group 0.000 description 2
- 125000000547 substituted alkyl group Chemical group 0.000 description 2
- KZNICNPSHKQLFF-UHFFFAOYSA-N succinimide Chemical compound O=C1CCC(=O)N1 KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 description 2
- JJAHTWIKCUJRDK-UHFFFAOYSA-N succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate Chemical compound C1CC(CN2C(C=CC2=O)=O)CCC1C(=O)ON1C(=O)CCC1=O JJAHTWIKCUJRDK-UHFFFAOYSA-N 0.000 description 2
- 201000008205 supratentorial primitive neuroectodermal tumor Diseases 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 2
- 208000002025 tabes dorsalis Diseases 0.000 description 2
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 2
- BCNZYOJHNLTNEZ-UHFFFAOYSA-N tert-butyldimethylsilyl chloride Chemical compound CC(C)(C)[Si](C)(C)Cl BCNZYOJHNLTNEZ-UHFFFAOYSA-N 0.000 description 2
- 201000003120 testicular cancer Diseases 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 229940126585 therapeutic drug Drugs 0.000 description 2
- 206010043554 thrombocytopenia Diseases 0.000 description 2
- 210000001685 thyroid gland Anatomy 0.000 description 2
- 208000005057 thyrotoxicosis Diseases 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 230000001052 transient effect Effects 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- 229940096911 trichinella spiralis Drugs 0.000 description 2
- 239000013638 trimer Substances 0.000 description 2
- RIOQSEWOXXDEQQ-UHFFFAOYSA-N triphenylphosphine Chemical compound C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 RIOQSEWOXXDEQQ-UHFFFAOYSA-N 0.000 description 2
- 229940046728 tumor necrosis factor alpha inhibitor Drugs 0.000 description 2
- 239000002451 tumor necrosis factor inhibitor Substances 0.000 description 2
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 241000712461 unidentified influenza virus Species 0.000 description 2
- 241001515965 unidentified phage Species 0.000 description 2
- 201000011294 ureter cancer Diseases 0.000 description 2
- 201000005112 urinary bladder cancer Diseases 0.000 description 2
- 206010046766 uterine cancer Diseases 0.000 description 2
- GBABOYUKABKIAF-IELIFDKJSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-IELIFDKJSA-N 0.000 description 2
- 229960002066 vinorelbine Drugs 0.000 description 2
- 201000005102 vulva cancer Diseases 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 238000005303 weighing Methods 0.000 description 2
- FBDOJYYTMIHHDH-OZBJMMHXSA-N (19S)-19-ethyl-19-hydroxy-17-oxa-3,13-diazapentacyclo[11.8.0.02,11.04,9.015,20]henicosa-2,4,6,8,10,14,20-heptaen-18-one Chemical compound CC[C@@]1(O)C(=O)OCC2=CN3Cc4cc5ccccc5nc4C3C=C12 FBDOJYYTMIHHDH-OZBJMMHXSA-N 0.000 description 1
- PXOMSWXCVZBBIV-PQKSKRJKSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4S,6R)-4-amino-2-methyl-6-[[(1S,3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-2,4-dihydro-1H-tetracen-1-yl]oxy]oxan-3-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound C[C@H]1[C@@H]([C@H](C[C@@H](O1)O[C@H]2C[C@@](CC3=C2C(=C4C(=C3O)C(=O)C5=C(C4=O)C(=CC=C5)OC)O)(C(=O)CO)O)N)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)C(=O)O)O)O)O PXOMSWXCVZBBIV-PQKSKRJKSA-N 0.000 description 1
- AGGWFDNPHKLBBV-YUMQZZPRSA-N (2s)-2-[[(2s)-2-amino-3-methylbutanoyl]amino]-5-(carbamoylamino)pentanoic acid Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=O AGGWFDNPHKLBBV-YUMQZZPRSA-N 0.000 description 1
- APOKYMYZOKIMLM-LUMVZWMBSA-N (2s,3s,4s,5r,6s)-3,4,5-trihydroxy-6-[4-[[(2s,3s,4s,6r)-3-hydroxy-2-methyl-6-[[(1s,3s)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-2,4-dihydro-1h-tetracen-1-yl]oxy]oxan-4-yl]carbamoyloxymethyl]-2-nitrophenoxy]oxane-2-carboxylic acid Chemical compound N([C@H]1C[C@@H](O[C@@H](C)[C@H]1O)O[C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)C(=O)OCC(C=C1[N+]([O-])=O)=CC=C1O[C@@H]1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O APOKYMYZOKIMLM-LUMVZWMBSA-N 0.000 description 1
- URCVASXWNJQAEH-HDWVWLDDSA-N (2s,3s,4s,5r,6s)-6-[4-[(5s,5ar,8ar,9r)-5-[[(2r,4ar,6r,7r,8r,8as)-7,8-dihydroxy-2-methyl-4,4a,6,7,8,8a-hexahydropyrano[3,2-d][1,3]dioxin-6-yl]oxy]-8-oxo-5a,6,8a,9-tetrahydro-5h-[2]benzofuro[5,6-f][1,3]benzodioxol-9-yl]-2,6-dimethoxyphenoxy]-3,4,5-trihydrox Chemical compound COC1=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=CC(OC)=C1O[C@@H]1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O URCVASXWNJQAEH-HDWVWLDDSA-N 0.000 description 1
- NXLNNXIXOYSCMB-UHFFFAOYSA-N (4-nitrophenyl) carbonochloridate Chemical compound [O-][N+](=O)C1=CC=C(OC(Cl)=O)C=C1 NXLNNXIXOYSCMB-UHFFFAOYSA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- 125000000008 (C1-C10) alkyl group Chemical group 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- JBFGKSWEYQKTJI-UHFFFAOYSA-N 1-[2-[2-[2-[2-[2-(2-hydroxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]butan-2-ol Chemical compound C(C)C(COCCOCCOCCOCCOCCOCCO)O JBFGKSWEYQKTJI-UHFFFAOYSA-N 0.000 description 1
- 102100025573 1-alkyl-2-acetylglycerophosphocholine esterase Human genes 0.000 description 1
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical compound O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 1
- JHALWMSZGCVVEM-UHFFFAOYSA-N 2-[4,7-bis(carboxymethyl)-1,4,7-triazonan-1-yl]acetic acid Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CC1 JHALWMSZGCVVEM-UHFFFAOYSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- JUIKUQOUMZUFQT-UHFFFAOYSA-N 2-bromoacetamide Chemical compound NC(=O)CBr JUIKUQOUMZUFQT-UHFFFAOYSA-N 0.000 description 1
- FZZMTSNZRBFGGU-UHFFFAOYSA-N 2-chloro-7-fluoroquinazolin-4-amine Chemical compound FC1=CC=C2C(N)=NC(Cl)=NC2=C1 FZZMTSNZRBFGGU-UHFFFAOYSA-N 0.000 description 1
- SVTBMSDMJJWYQN-UHFFFAOYSA-N 2-methylpentane-2,4-diol Chemical compound CC(O)CC(C)(C)O SVTBMSDMJJWYQN-UHFFFAOYSA-N 0.000 description 1
- AUDYZXNUHIIGRB-UHFFFAOYSA-N 3-thiophen-2-ylpyrrole-2,5-dione Chemical compound O=C1NC(=O)C(C=2SC=CC=2)=C1 AUDYZXNUHIIGRB-UHFFFAOYSA-N 0.000 description 1
- IDPUKCWIGUEADI-UHFFFAOYSA-N 5-[bis(2-chloroethyl)amino]uracil Chemical compound ClCCN(CCCl)C1=CNC(=O)NC1=O IDPUKCWIGUEADI-UHFFFAOYSA-N 0.000 description 1
- WYWHKKSPHMUBEB-UHFFFAOYSA-N 6-Mercaptoguanine Natural products N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- 102100024049 A-kinase anchor protein 13 Human genes 0.000 description 1
- 208000002008 AIDS-Related Lymphoma Diseases 0.000 description 1
- 108010066676 Abrin Proteins 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 108010059616 Activins Proteins 0.000 description 1
- 102000005606 Activins Human genes 0.000 description 1
- 206010000830 Acute leukaemia Diseases 0.000 description 1
- 208000010507 Adenocarcinoma of Lung Diseases 0.000 description 1
- RDIKFPRVLJLMER-BQBZGAKWSA-N Ala-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C)N RDIKFPRVLJLMER-BQBZGAKWSA-N 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- 201000003076 Angiosarcoma Diseases 0.000 description 1
- 208000001454 Anhidrotic Ectodermal Dysplasia 1 Diseases 0.000 description 1
- 108010005853 Anti-Mullerian Hormone Proteins 0.000 description 1
- 208000007860 Anus Neoplasms Diseases 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- 206010060971 Astrocytoma malignant Diseases 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- 125000006847 BOC protecting group Chemical group 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 208000013165 Bowen disease Diseases 0.000 description 1
- 208000019337 Bowen disease of the skin Diseases 0.000 description 1
- 206010006143 Brain stem glioma Diseases 0.000 description 1
- 206010006237 Breast dysplasia Diseases 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 102100032912 CD44 antigen Human genes 0.000 description 1
- FVLVBPDQNARYJU-XAHDHGMMSA-N C[C@H]1CCC(CC1)NC(=O)N(CCCl)N=O Chemical compound C[C@H]1CCC(CC1)NC(=O)N(CCCl)N=O FVLVBPDQNARYJU-XAHDHGMMSA-N 0.000 description 1
- 101100217502 Caenorhabditis elegans lgg-3 gene Proteins 0.000 description 1
- 101100504320 Caenorhabditis elegans mcp-1 gene Proteins 0.000 description 1
- 208000013627 Camurati-Engelmann disease Diseases 0.000 description 1
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 1
- KXDHJXZQYSOELW-UHFFFAOYSA-N Carbamic acid Chemical group NC(O)=O KXDHJXZQYSOELW-UHFFFAOYSA-N 0.000 description 1
- 102100025466 Carcinoembryonic antigen-related cell adhesion molecule 3 Human genes 0.000 description 1
- 206010007279 Carcinoid tumour of the gastrointestinal tract Diseases 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 201000002929 Carnitine palmitoyltransferase II deficiency Diseases 0.000 description 1
- 102000005600 Cathepsins Human genes 0.000 description 1
- 108010084457 Cathepsins Proteins 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 206010008263 Cervical dysplasia Diseases 0.000 description 1
- 229940123150 Chelating agent Drugs 0.000 description 1
- JWBOIMRXGHLCPP-UHFFFAOYSA-N Chloditan Chemical compound C=1C=CC=C(Cl)C=1C(C(Cl)Cl)C1=CC=C(Cl)C=C1 JWBOIMRXGHLCPP-UHFFFAOYSA-N 0.000 description 1
- 206010008724 Chondroectodermal dysplasia Diseases 0.000 description 1
- 208000005243 Chondrosarcoma Diseases 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- 102100021809 Chorionic somatomammotropin hormone 1 Human genes 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 1
- 201000000304 Cleidocranial dysplasia Diseases 0.000 description 1
- 102100031162 Collagen alpha-1(XVIII) chain Human genes 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 208000009798 Craniopharyngioma Diseases 0.000 description 1
- 108010049894 Cyclic AMP-Dependent Protein Kinases Proteins 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- XUIIKFGFIJCVMT-GFCCVEGCSA-N D-thyroxine Chemical compound IC1=CC(C[C@@H](N)C(O)=O)=CC(I)=C1OC1=CC(I)=C(O)C(I)=C1 XUIIKFGFIJCVMT-GFCCVEGCSA-N 0.000 description 1
- 108010092160 Dactinomycin Proteins 0.000 description 1
- 208000005335 Dentin Dysplasia Diseases 0.000 description 1
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 1
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 1
- 208000002699 Digestive System Neoplasms Diseases 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 208000006586 Ectromelia Diseases 0.000 description 1
- 241000223932 Eimeria tenella Species 0.000 description 1
- 201000002650 Ellis-van Creveld syndrome Diseases 0.000 description 1
- 201000009051 Embryonal Carcinoma Diseases 0.000 description 1
- 102100027723 Endogenous retrovirus group K member 6 Rec protein Human genes 0.000 description 1
- 108010079505 Endostatins Proteins 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 101710181478 Envelope glycoprotein GP350 Proteins 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 208000031637 Erythroblastic Acute Leukemia Diseases 0.000 description 1
- 208000036566 Erythroleukaemia Diseases 0.000 description 1
- 208000017259 Extragonadal germ cell tumor Diseases 0.000 description 1
- 206010067141 Faciodigitogenital dysplasia Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 1
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 1
- 208000000571 Fibrocystic breast disease Diseases 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 206010053717 Fibrous histiocytoma Diseases 0.000 description 1
- 241000724791 Filamentous phage Species 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 206010073655 Freeman-Sheldon syndrome Diseases 0.000 description 1
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 1
- GYHNNYVSQQEPJS-UHFFFAOYSA-N Gallium Chemical compound [Ga] GYHNNYVSQQEPJS-UHFFFAOYSA-N 0.000 description 1
- 201000003741 Gastrointestinal carcinoma Diseases 0.000 description 1
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 1
- 206010051635 Gastrointestinal tract adenoma Diseases 0.000 description 1
- 208000015872 Gaucher disease Diseases 0.000 description 1
- JRZJKWGQFNTSRN-UHFFFAOYSA-N Geldanamycin Natural products C1C(C)CC(OC)C(O)C(C)C=C(C)C(OC(N)=O)C(OC)CCC=C(C)C(=O)NC2=CC(=O)C(OC)=C1C2=O JRZJKWGQFNTSRN-UHFFFAOYSA-N 0.000 description 1
- 108700004714 Gelonium multiflorum GEL Proteins 0.000 description 1
- 208000021309 Germ cell tumor Diseases 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 201000003200 Goldenhar Syndrome Diseases 0.000 description 1
- 102000006771 Gonadotropins Human genes 0.000 description 1
- 108010086677 Gonadotropins Proteins 0.000 description 1
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 206010061187 Haematopoietic neoplasm Diseases 0.000 description 1
- 208000001258 Hemangiosarcoma Diseases 0.000 description 1
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 1
- 206010050469 Holt-Oram syndrome Diseases 0.000 description 1
- 101000833679 Homo sapiens A-kinase anchor protein 13 Proteins 0.000 description 1
- 101000897480 Homo sapiens C-C motif chemokine 2 Proteins 0.000 description 1
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 1
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 1
- 101000875075 Homo sapiens Cannabinoid receptor 2 Proteins 0.000 description 1
- 101000914337 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 3 Proteins 0.000 description 1
- 101001116931 Homo sapiens Protocadherin alpha-6 Proteins 0.000 description 1
- 101001059454 Homo sapiens Serine/threonine-protein kinase MARK2 Proteins 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 1
- 208000019758 Hypergammaglobulinemia Diseases 0.000 description 1
- 206010020880 Hypertrophy Diseases 0.000 description 1
- 206010021042 Hypopharyngeal cancer Diseases 0.000 description 1
- 206010056305 Hypopharyngeal neoplasm Diseases 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 1
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 1
- 102100025947 Insulin-like growth factor II Human genes 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 208000005016 Intestinal Neoplasms Diseases 0.000 description 1
- 208000032177 Intestinal Polyps Diseases 0.000 description 1
- 206010061252 Intraocular melanoma Diseases 0.000 description 1
- 108010044467 Isoenzymes Proteins 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 208000001126 Keratosis Diseases 0.000 description 1
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 1
- 206010023825 Laryngeal cancer Diseases 0.000 description 1
- 102000016267 Leptin Human genes 0.000 description 1
- 108010092277 Leptin Proteins 0.000 description 1
- LSPYFSHXDAYVDI-SRVKXCTJSA-N Leu-Ala-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC(C)C LSPYFSHXDAYVDI-SRVKXCTJSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 206010024305 Leukaemia monocytic Diseases 0.000 description 1
- 206010024503 Limb reduction defect Diseases 0.000 description 1
- 208000005777 Lupus Nephritis Diseases 0.000 description 1
- 208000028018 Lymphocytic leukaemia Diseases 0.000 description 1
- 108010074338 Lymphokines Proteins 0.000 description 1
- 102000008072 Lymphokines Human genes 0.000 description 1
- 208000030289 Lymphoproliferative disease Diseases 0.000 description 1
- 208000004059 Male Breast Neoplasms Diseases 0.000 description 1
- 208000006644 Malignant Fibrous Histiocytoma Diseases 0.000 description 1
- 208000030070 Malignant epithelial tumor of ovary Diseases 0.000 description 1
- 206010025997 Malignant neoplasm of islets of Langerhans Diseases 0.000 description 1
- 208000032271 Malignant tumor of penis Diseases 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 208000007054 Medullary Carcinoma Diseases 0.000 description 1
- 208000009018 Medullary thyroid cancer Diseases 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 206010054949 Metaplasia Diseases 0.000 description 1
- 102000009664 Microtubule-Associated Proteins Human genes 0.000 description 1
- 108010020004 Microtubule-Associated Proteins Proteins 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 102000013967 Monokines Human genes 0.000 description 1
- 108010050619 Monokines Proteins 0.000 description 1
- 101100335081 Mus musculus Flt3 gene Proteins 0.000 description 1
- 241000186359 Mycobacterium Species 0.000 description 1
- 241000186362 Mycobacterium leprae Species 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 208000014767 Myeloproliferative disease Diseases 0.000 description 1
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 1
- 101150111783 NTRK1 gene Proteins 0.000 description 1
- 206010028767 Nasal sinus cancer Diseases 0.000 description 1
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 108010025020 Nerve Growth Factor Proteins 0.000 description 1
- 102000007072 Nerve Growth Factors Human genes 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 206010051934 Oculoauriculovertebral dysplasia Diseases 0.000 description 1
- 208000008909 Oculodentodigital dysplasia Diseases 0.000 description 1
- 208000004910 Odontodysplasia Diseases 0.000 description 1
- 206010050171 Oesophageal dysplasia Diseases 0.000 description 1
- 201000010133 Oligodendroglioma Diseases 0.000 description 1
- 206010031096 Oropharyngeal cancer Diseases 0.000 description 1
- 206010057444 Oropharyngeal neoplasm Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 101710160107 Outer membrane protein A Proteins 0.000 description 1
- 208000007571 Ovarian Epithelial Carcinoma Diseases 0.000 description 1
- 206010061328 Ovarian epithelial cancer Diseases 0.000 description 1
- 206010033268 Ovarian low malignant potential tumour Diseases 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 241000282520 Papio Species 0.000 description 1
- 208000003937 Paranasal Sinus Neoplasms Diseases 0.000 description 1
- 208000002774 Paraproteinemias Diseases 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 208000000821 Parathyroid Neoplasms Diseases 0.000 description 1
- 102000003982 Parathyroid hormone Human genes 0.000 description 1
- 108090000445 Parathyroid hormone Proteins 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 206010034299 Penile cancer Diseases 0.000 description 1
- 229940083963 Peptide antagonist Drugs 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- ABLZXFCXXLZCGV-UHFFFAOYSA-N Phosphorous acid Chemical group OP(O)=O ABLZXFCXXLZCGV-UHFFFAOYSA-N 0.000 description 1
- 208000007913 Pituitary Neoplasms Diseases 0.000 description 1
- 108010003044 Placental Lactogen Proteins 0.000 description 1
- 239000000381 Placental Lactogen Substances 0.000 description 1
- 231100000742 Plant toxin Toxicity 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 229920001054 Poly(ethylene‐co‐vinyl acetate) Polymers 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 108010076181 Proinsulin Proteins 0.000 description 1
- 102000003946 Prolactin Human genes 0.000 description 1
- 108010057464 Prolactin Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 102100024278 Protocadherin alpha-6 Human genes 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 108090000103 Relaxin Proteins 0.000 description 1
- 102000003743 Relaxin Human genes 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 208000004337 Salivary Gland Neoplasms Diseases 0.000 description 1
- 201000010208 Seminoma Diseases 0.000 description 1
- 206010040007 Sense of oppression Diseases 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- 102100028904 Serine/threonine-protein kinase MARK2 Human genes 0.000 description 1
- 208000009359 Sezary Syndrome Diseases 0.000 description 1
- 208000021388 Sezary disease Diseases 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 1
- 208000031673 T-Cell Cutaneous Lymphoma Diseases 0.000 description 1
- 206010042971 T-cell lymphoma Diseases 0.000 description 1
- 208000027585 T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- JVHROZDXPAUZFK-UHFFFAOYSA-N TETA Chemical compound OC(=O)CN1CCCN(CC(O)=O)CCN(CC(O)=O)CCCN(CC(O)=O)CC1 JVHROZDXPAUZFK-UHFFFAOYSA-N 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- WDLRUFUQRNWCPK-UHFFFAOYSA-N Tetraxetan Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC1 WDLRUFUQRNWCPK-UHFFFAOYSA-N 0.000 description 1
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 1
- 108060008245 Thrombospondin Proteins 0.000 description 1
- 102000002938 Thrombospondin Human genes 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 208000015778 Undifferentiated pleomorphic sarcoma Diseases 0.000 description 1
- 206010046431 Urethral cancer Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 201000005969 Uveal melanoma Diseases 0.000 description 1
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 1
- 206010047115 Vasculitis Diseases 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 208000014070 Vestibular schwannoma Diseases 0.000 description 1
- 229940122803 Vinca alkaloid Drugs 0.000 description 1
- 208000016025 Waldenstroem macroglobulinemia Diseases 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 208000004064 acoustic neuroma Diseases 0.000 description 1
- 208000009621 actinic keratosis Diseases 0.000 description 1
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 239000000488 activin Substances 0.000 description 1
- 208000021841 acute erythroid leukemia Diseases 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 208000020990 adrenal cortex carcinoma Diseases 0.000 description 1
- 208000007128 adrenocortical carcinoma Diseases 0.000 description 1
- 208000014619 adult acute lymphoblastic leukemia Diseases 0.000 description 1
- 201000011184 adult acute lymphocytic leukemia Diseases 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 229940045714 alkyl sulfonate alkylating agent Drugs 0.000 description 1
- 150000008052 alkyl sulfonates Chemical class 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 150000001414 amino alcohols Chemical class 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 201000007538 anal carcinoma Diseases 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 1
- 229960002932 anastrozole Drugs 0.000 description 1
- 238000004873 anchoring Methods 0.000 description 1
- 239000004037 angiogenesis inhibitor Substances 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 230000003527 anti-angiogenesis Effects 0.000 description 1
- 230000006909 anti-apoptosis Effects 0.000 description 1
- 230000000843 anti-fungal effect Effects 0.000 description 1
- 230000003141 anti-fusion Effects 0.000 description 1
- 230000002924 anti-infective effect Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000002001 anti-metastasis Effects 0.000 description 1
- 230000002927 anti-mitotic effect Effects 0.000 description 1
- 239000000868 anti-mullerian hormone Substances 0.000 description 1
- 230000002223 anti-pathogen Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 230000001147 anti-toxic effect Effects 0.000 description 1
- 238000009175 antibody therapy Methods 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- 102000025171 antigen binding proteins Human genes 0.000 description 1
- 108091000831 antigen binding proteins Proteins 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 229940045686 antimetabolites antineoplastic purine analogs Drugs 0.000 description 1
- 229940045687 antimetabolites folic acid analogs Drugs 0.000 description 1
- 239000003080 antimitotic agent Substances 0.000 description 1
- 229940045719 antineoplastic alkylating agent nitrosoureas Drugs 0.000 description 1
- 229940045688 antineoplastic antimetabolites pyrimidine analogues Drugs 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 201000011165 anus cancer Diseases 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000008135 aqueous vehicle Substances 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 229950010054 azaribine Drugs 0.000 description 1
- QQOBRRFOVWGIMD-OJAKKHQRSA-N azaribine Chemical compound CC(=O)O[C@@H]1[C@H](OC(C)=O)[C@@H](COC(=O)C)O[C@H]1N1C(=O)NC(=O)C=N1 QQOBRRFOVWGIMD-OJAKKHQRSA-N 0.000 description 1
- 125000000852 azido group Chemical group *N=[N+]=[N-] 0.000 description 1
- 229960002707 bendamustine Drugs 0.000 description 1
- YTKUWDBFDASYHO-UHFFFAOYSA-N bendamustine Chemical compound ClCCN(CCCl)C1=CC=C2N(C)C(CCCC(O)=O)=NC2=C1 YTKUWDBFDASYHO-UHFFFAOYSA-N 0.000 description 1
- 201000007180 bile duct carcinoma Diseases 0.000 description 1
- 229920000249 biocompatible polymer Polymers 0.000 description 1
- 238000007622 bioinformatic analysis Methods 0.000 description 1
- 201000001531 bladder carcinoma Diseases 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- 208000012172 borderline epithelial tumor of ovary Diseases 0.000 description 1
- 150000001639 boron compounds Chemical class 0.000 description 1
- 229960001467 bortezomib Drugs 0.000 description 1
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 1
- 108010006025 bovine growth hormone Proteins 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 208000003362 bronchogenic carcinoma Diseases 0.000 description 1
- 206010006475 bronchopulmonary dysplasia Diseases 0.000 description 1
- 229960005539 bryostatin 1 Drugs 0.000 description 1
- MJQUEDHRCUIRLF-TVIXENOKSA-N bryostatin 1 Chemical compound C([C@@H]1CC(/[C@@H]([C@@](C(C)(C)/C=C/2)(O)O1)OC(=O)/C=C/C=C/CCC)=C\C(=O)OC)[C@H]([C@@H](C)O)OC(=O)C[C@H](O)C[C@@H](O1)C[C@H](OC(C)=O)C(C)(C)[C@]1(O)C[C@@H]1C\C(=C\C(=O)OC)C[C@H]\2O1 MJQUEDHRCUIRLF-TVIXENOKSA-N 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- 229930195731 calicheamicin Natural products 0.000 description 1
- 229940112129 campath Drugs 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 230000000711 cancerogenic effect Effects 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 150000004649 carbonic acid derivatives Chemical class 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 238000007444 cell Immobilization Methods 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 201000007335 cerebellar astrocytoma Diseases 0.000 description 1
- 208000030239 cerebral astrocytoma Diseases 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 230000009920 chelation Effects 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 208000018805 childhood acute lymphoblastic leukemia Diseases 0.000 description 1
- 201000011633 childhood acute lymphocytic leukemia Diseases 0.000 description 1
- 201000002687 childhood acute myeloid leukemia Diseases 0.000 description 1
- 201000004018 childhood brain stem glioma Diseases 0.000 description 1
- 201000004677 childhood cerebellar astrocytic neoplasm Diseases 0.000 description 1
- 201000008522 childhood cerebral astrocytoma Diseases 0.000 description 1
- 201000005793 childhood medulloblastoma Diseases 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- AOGYCOYQMAVAFD-UHFFFAOYSA-N chlorocarbonic acid Chemical class OC(Cl)=O AOGYCOYQMAVAFD-UHFFFAOYSA-N 0.000 description 1
- 208000001020 chondrodysplasia punctata Diseases 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 208000024207 chronic leukemia Diseases 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000013256 coordination polymer Substances 0.000 description 1
- 239000006184 cosolvent Substances 0.000 description 1
- 201000010100 craniodiaphyseal dysplasia Diseases 0.000 description 1
- 201000010095 craniometaphyseal dysplasia Diseases 0.000 description 1
- 239000003431 cross linking reagent Substances 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 239000012043 crude product Substances 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 201000007241 cutaneous T cell lymphoma Diseases 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 208000002445 cystadenocarcinoma Diseases 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 210000004292 cytoskeleton Anatomy 0.000 description 1
- 239000002254 cytotoxic agent Substances 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 229960000640 dactinomycin Drugs 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 229940124447 delivery agent Drugs 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 210000003298 dental enamel Anatomy 0.000 description 1
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 150000004985 diamines Chemical class 0.000 description 1
- WGLUMOCWFMKWIL-UHFFFAOYSA-N dichloromethane;methanol Chemical compound OC.ClCCl WGLUMOCWFMKWIL-UHFFFAOYSA-N 0.000 description 1
- 208000015799 differentiated thyroid carcinoma Diseases 0.000 description 1
- 238000002050 diffraction method Methods 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- AFOSIXZFDONLBT-UHFFFAOYSA-N divinyl sulfone Chemical compound C=CS(=O)(=O)C=C AFOSIXZFDONLBT-UHFFFAOYSA-N 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 229940000406 drug candidate Drugs 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 238000002651 drug therapy Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 208000031068 ectodermal dysplasia syndrome Diseases 0.000 description 1
- 230000001516 effect on protein Effects 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 210000001671 embryonic stem cell Anatomy 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 230000002124 endocrine Effects 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 208000037828 epithelial carcinoma Diseases 0.000 description 1
- 229940082789 erbitux Drugs 0.000 description 1
- 229960001842 estramustine Drugs 0.000 description 1
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 1
- 102000015694 estrogen receptors Human genes 0.000 description 1
- 108010038795 estrogen receptors Proteins 0.000 description 1
- 150000002169 ethanolamines Chemical class 0.000 description 1
- 125000005912 ethyl carbonate group Chemical class 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960000752 etoposide phosphate Drugs 0.000 description 1
- LIQODXNTTZAGID-OCBXBXKTSA-N etoposide phosphate Chemical compound COC1=C(OP(O)(O)=O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 LIQODXNTTZAGID-OCBXBXKTSA-N 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 239000003777 experimental drug Substances 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 201000008819 extrahepatic bile duct carcinoma Diseases 0.000 description 1
- 208000024519 eye neoplasm Diseases 0.000 description 1
- 208000030503 familial ossifying fibroma Diseases 0.000 description 1
- 201000007741 female breast cancer Diseases 0.000 description 1
- 201000002276 female breast carcinoma Diseases 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 229940126864 fibroblast growth factor Drugs 0.000 description 1
- 208000008487 fibromuscular dysplasia Diseases 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 229960002074 flutamide Drugs 0.000 description 1
- MKXKFYHWDHIYRV-UHFFFAOYSA-N flutamide Chemical compound CC(C)C(=O)NC1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 MKXKFYHWDHIYRV-UHFFFAOYSA-N 0.000 description 1
- 150000002224 folic acids Chemical class 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 201000010175 gallbladder cancer Diseases 0.000 description 1
- 229910052733 gallium Inorganic materials 0.000 description 1
- QTQAWLPCGQOSGP-GBTDJJJQSA-N geldanamycin Chemical compound N1C(=O)\C(C)=C/C=C\[C@@H](OC)[C@H](OC(N)=O)\C(C)=C/[C@@H](C)[C@@H](O)[C@H](OC)C[C@@H](C)CC2=C(OC)C(=O)C=C1C2=O QTQAWLPCGQOSGP-GBTDJJJQSA-N 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- 229960003297 gemtuzumab ozogamicin Drugs 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 201000007116 gestational trophoblastic neoplasm Diseases 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 230000002518 glial effect Effects 0.000 description 1
- 150000002333 glycines Chemical class 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 239000002622 gonadotropin Substances 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 208000037824 growth disorder Diseases 0.000 description 1
- 239000000122 growth hormone Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 201000009277 hairy cell leukemia Diseases 0.000 description 1
- 210000003128 head Anatomy 0.000 description 1
- 201000000459 head and neck squamous cell carcinoma Diseases 0.000 description 1
- 208000029427 heart-hand syndrome Diseases 0.000 description 1
- 208000025750 heavy chain disease Diseases 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 208000014845 hemimelia Diseases 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 150000007857 hydrazones Chemical class 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000005661 hydrophobic surface Effects 0.000 description 1
- 150000002440 hydroxy compounds Chemical class 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 201000006866 hypopharynx cancer Diseases 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 1
- 229960001101 ifosfamide Drugs 0.000 description 1
- 230000008938 immune dysregulation Effects 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 230000003832 immune regulation Effects 0.000 description 1
- 208000026278 immune system disease Diseases 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 239000002596 immunotoxin Substances 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 239000000893 inhibin Substances 0.000 description 1
- ZPNFWUPYTFPOJU-LPYSRVMUSA-N iniprol Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@H]2CSSC[C@H]3C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC=4C=CC=CC=4)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=4C=CC=CC=4)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]2N(CCC2)C(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N2[C@@H](CCC2)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N2[C@@H](CCC2)C(=O)N3)C(=O)NCC(=O)NCC(=O)N[C@@H](C)C(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H](C(=O)N1)C(C)C)[C@@H](C)O)[C@@H](C)CC)=O)[C@@H](C)CC)C1=CC=C(O)C=C1 ZPNFWUPYTFPOJU-LPYSRVMUSA-N 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 201000002313 intestinal cancer Diseases 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 208000020082 intraepithelial neoplasia Diseases 0.000 description 1
- 238000003402 intramolecular cyclocondensation reaction Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 108010028930 invariant chain Proteins 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- 230000001788 irregular Effects 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 210000004153 islets of langerhan Anatomy 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 206010023841 laryngeal neoplasm Diseases 0.000 description 1
- 231100001231 less toxic Toxicity 0.000 description 1
- 229960003136 leucine Drugs 0.000 description 1
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 231100000897 loss of orientation Toxicity 0.000 description 1
- 201000005249 lung adenocarcinoma Diseases 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- 229950002654 lurtotecan Drugs 0.000 description 1
- RVFGKBWWUQOIOU-NDEPHWFRSA-N lurtotecan Chemical compound O=C([C@]1(O)CC)OCC(C(N2CC3=4)=O)=C1C=C2C3=NC1=CC=2OCCOC=2C=C1C=4CN1CCN(C)CC1 RVFGKBWWUQOIOU-NDEPHWFRSA-N 0.000 description 1
- 230000001926 lymphatic effect Effects 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 230000000329 lymphopenic effect Effects 0.000 description 1
- 230000002132 lysosomal effect Effects 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 201000003175 male breast cancer Diseases 0.000 description 1
- 208000010907 male breast carcinoma Diseases 0.000 description 1
- 208000030883 malignant astrocytoma Diseases 0.000 description 1
- 208000006178 malignant mesothelioma Diseases 0.000 description 1
- 208000026045 malignant tumor of parathyroid gland Diseases 0.000 description 1
- KJLLKLRVCJAFRY-UHFFFAOYSA-N mebutizide Chemical compound ClC1=C(S(N)(=O)=O)C=C2S(=O)(=O)NC(C(C)C(C)CC)NC2=C1 KJLLKLRVCJAFRY-UHFFFAOYSA-N 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 230000015689 metaplastic ossification Effects 0.000 description 1
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 1
- 210000003470 mitochondria Anatomy 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 229960000350 mitotane Drugs 0.000 description 1
- 229960001156 mitoxantrone Drugs 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 201000006894 monocytic leukemia Diseases 0.000 description 1
- 208000008084 monostotic fibrous dysplasia Diseases 0.000 description 1
- 229940051875 mucins Drugs 0.000 description 1
- 108091005763 multidomain proteins Proteins 0.000 description 1
- 206010028197 multiple epiphyseal dysplasia Diseases 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- KVKFRMCSXWQSNT-UHFFFAOYSA-N n,n'-dimethylethane-1,2-diamine Chemical compound CNCCNC KVKFRMCSXWQSNT-UHFFFAOYSA-N 0.000 description 1
- 208000025189 neoplasm of testis Diseases 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 210000005036 nerve Anatomy 0.000 description 1
- 201000011519 neuroendocrine tumor Diseases 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 238000001668 nucleic acid synthesis Methods 0.000 description 1
- 230000000269 nucleophilic effect Effects 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical class CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- 201000008106 ocular cancer Diseases 0.000 description 1
- 201000002575 ocular melanoma Diseases 0.000 description 1
- 208000017920 oculo-auriculo-vertebral spectrum Diseases 0.000 description 1
- 238000006384 oligomerization reaction Methods 0.000 description 1
- 210000004789 organ system Anatomy 0.000 description 1
- 201000006958 oropharynx cancer Diseases 0.000 description 1
- 230000002138 osteoinductive effect Effects 0.000 description 1
- 229940127084 other anti-cancer agent Drugs 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 208000021284 ovarian germ cell tumor Diseases 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 125000000636 p-nitrophenyl group Chemical group [H]C1=C([H])C(=C([H])C([H])=C1*)[N+]([O-])=O 0.000 description 1
- 201000002530 pancreatic endocrine carcinoma Diseases 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 201000010198 papillary carcinoma Diseases 0.000 description 1
- 201000007052 paranasal sinus cancer Diseases 0.000 description 1
- 239000000199 parathyroid hormone Substances 0.000 description 1
- 229960001319 parathyroid hormone Drugs 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 235000015927 pasta Nutrition 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 210000004197 pelvis Anatomy 0.000 description 1
- 208000030940 penile carcinoma Diseases 0.000 description 1
- 201000008174 penis carcinoma Diseases 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- 201000002628 peritoneum cancer Diseases 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- 208000028591 pheochromocytoma Diseases 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 150000004713 phosphodiesters Chemical class 0.000 description 1
- 239000000906 photoactive agent Substances 0.000 description 1
- 208000024724 pineal body neoplasm Diseases 0.000 description 1
- 201000004123 pineal gland cancer Diseases 0.000 description 1
- 201000003113 pineoblastoma Diseases 0.000 description 1
- 208000010916 pituitary tumor Diseases 0.000 description 1
- 239000003123 plant toxin Substances 0.000 description 1
- 208000010626 plasma cell neoplasm Diseases 0.000 description 1
- 210000004180 plasmocyte Anatomy 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 229960003171 plicamycin Drugs 0.000 description 1
- 229950008499 plitidepsin Drugs 0.000 description 1
- UUSZLLQJYRSZIS-LXNNNBEUSA-N plitidepsin Chemical compound CN([C@H](CC(C)C)C(=O)N[C@@H]1C(=O)N[C@@H]([C@H](CC(=O)O[C@H](C(=O)[C@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N2CCC[C@H]2C(=O)N(C)[C@@H](CC=2C=CC(OC)=CC=2)C(=O)O[C@@H]1C)C(C)C)O)[C@@H](C)CC)C(=O)[C@@H]1CCCN1C(=O)C(C)=O UUSZLLQJYRSZIS-LXNNNBEUSA-N 0.000 description 1
- 108010049948 plitidepsin Proteins 0.000 description 1
- 108700028325 pokeweed antiviral Proteins 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000570 polyether Polymers 0.000 description 1
- 229920002643 polyglutamic acid Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 208000001061 polyostotic fibrous dysplasia Diseases 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 230000001855 preneoplastic effect Effects 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 238000002203 pretreatment Methods 0.000 description 1
- 208000025638 primary cutaneous T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 230000000861 pro-apoptotic effect Effects 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- 229940097325 prolactin Drugs 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 125000002568 propynyl group Chemical group [*]C#CC([H])([H])[H] 0.000 description 1
- 108010087851 prorelaxin Proteins 0.000 description 1
- 150000003180 prostaglandins Chemical class 0.000 description 1
- 239000003528 protein farnesyltransferase inhibitor Substances 0.000 description 1
- 230000006916 protein interaction Effects 0.000 description 1
- 238000001814 protein method Methods 0.000 description 1
- 231100000654 protein toxin Toxicity 0.000 description 1
- 239000001990 protein-drug conjugate Substances 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 239000012264 purified product Substances 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 229940051022 radioimmunoconjugate Drugs 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- GZUITABIAKMVPG-UHFFFAOYSA-N raloxifene Chemical compound C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 GZUITABIAKMVPG-UHFFFAOYSA-N 0.000 description 1
- 229960004622 raloxifene Drugs 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 208000015347 renal cell adenocarcinoma Diseases 0.000 description 1
- 238000010405 reoxidation reaction Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 201000003804 salivary gland carcinoma Diseases 0.000 description 1
- 201000008407 sebaceous adenocarcinoma Diseases 0.000 description 1
- 208000011571 secondary malignant neoplasm Diseases 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 229960003440 semustine Drugs 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 208000002477 septooptic dysplasia Diseases 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 238000012868 site-directed mutagenesis technique Methods 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 210000002027 skeletal muscle Anatomy 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 201000008261 skin carcinoma Diseases 0.000 description 1
- 235000017557 sodium bicarbonate Nutrition 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 238000000638 solvent extraction Methods 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 206010062920 spondyloepiphyseal dysplasia Diseases 0.000 description 1
- 201000002962 spondyloepiphyseal dysplasia with congenital joint dislocations Diseases 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 125000005415 substituted alkoxy group Chemical group 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 229960002317 succinimide Drugs 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 201000010965 sweat gland carcinoma Diseases 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- ILMRJRBKQSSXGY-UHFFFAOYSA-N tert-butyl(dimethyl)silicon Chemical group C[Si](C)C(C)(C)C ILMRJRBKQSSXGY-UHFFFAOYSA-N 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 230000002381 testicular Effects 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 229960003433 thalidomide Drugs 0.000 description 1
- 238000006177 thiolation reaction Methods 0.000 description 1
- 229960001196 thiotepa Drugs 0.000 description 1
- 210000000115 thoracic cavity Anatomy 0.000 description 1
- 201000005990 thymic dysplasia Diseases 0.000 description 1
- 208000008732 thymoma Diseases 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 229940034208 thyroxine Drugs 0.000 description 1
- XUIIKFGFIJCVMT-UHFFFAOYSA-N thyroxine-binding globulin Natural products IC1=CC(CC([NH3+])C([O-])=O)=CC(I)=C1OC1=CC(I)=C(O)C(I)=C1 XUIIKFGFIJCVMT-UHFFFAOYSA-N 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- MNRILEROXIRVNJ-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=NC=N[C]21 MNRILEROXIRVNJ-UHFFFAOYSA-N 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000003151 transfection method Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 150000004654 triazenes Chemical class 0.000 description 1
- 150000003852 triazoles Chemical class 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 208000029387 trophoblastic neoplasm Diseases 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 229960001055 uracil mustard Drugs 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 208000010570 urinary bladder carcinoma Diseases 0.000 description 1
- 208000012991 uterine carcinoma Diseases 0.000 description 1
- 208000037965 uterine sarcoma Diseases 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 206010046885 vaginal cancer Diseases 0.000 description 1
- 208000013139 vaginal neoplasm Diseases 0.000 description 1
- 229910052720 vanadium Inorganic materials 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 229910052727 yttrium Inorganic materials 0.000 description 1
- VWQVUPCCIRVNHF-UHFFFAOYSA-N yttrium atom Chemical compound [Y] VWQVUPCCIRVNHF-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/47—Quinolines; Isoquinolines
- A61K31/4738—Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems
- A61K31/4745—Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems condensed with ring systems having nitrogen as a ring hetero atom, e.g. phenantrolines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68037—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a camptothecin [CPT] or derivatives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6839—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting material from viruses
- A61K47/6841—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting material from viruses the antibody targeting a RNA virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6853—Carcino-embryonic antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6855—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from breast cancer cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6857—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from lung cancer cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6859—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from liver or pancreas cancer cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6861—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from kidney or bladder cancer cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6889—Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/10—X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D491/00—Heterocyclic compounds containing in the condensed ring system both one or more rings having oxygen atoms as the only ring hetero atoms and one or more rings having nitrogen atoms as the only ring hetero atoms, not provided for by groups C07D451/00 - C07D459/00, C07D463/00, C07D477/00 or C07D489/00
- C07D491/22—Heterocyclic compounds containing in the condensed ring system both one or more rings having oxygen atoms as the only ring hetero atoms and one or more rings having nitrogen atoms as the only ring hetero atoms, not provided for by groups C07D451/00 - C07D459/00, C07D463/00, C07D477/00 or C07D489/00 in which the condensed system contains four or more hetero rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1036—Retroviridae, e.g. leukemia viruses
- C07K16/1045—Lentiviridae, e.g. HIV, FIV, SIV
- C07K16/1063—Lentiviridae, e.g. HIV, FIV, SIV env, e.g. gp41, gp110/120, gp160, V3, PND, CD4 binding site
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2833—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2887—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/303—Liver or Pancreas
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3046—Stomach, Intestines
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3076—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3076—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
- C07K16/3092—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated mucins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Cell Biology (AREA)
- Molecular Biology (AREA)
- Epidemiology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Oncology (AREA)
- Virology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Communicable Diseases (AREA)
- AIDS & HIV (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Gastroenterology & Hepatology (AREA)
- Radiology & Medical Imaging (AREA)
- Pathology (AREA)
- Urology & Nephrology (AREA)
- Pulmonology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Dermatology (AREA)
- Rheumatology (AREA)
- Pain & Pain Management (AREA)
- Transplantation (AREA)
- Medicinal Preparation (AREA)
Abstract
Bu buluş, bir hastalık tedavisinde kullanım için, MAb-CL2A-SN-38 yapısal formülüne sahip olan bir konjugat ile ilgilidir.
Description
TARIFNAME
INTRASELULER OLARAK AYRILABILEN BIR BAGA SAHIP
IMMUNOKONJUGATLAR
BULUSUN ALANI
Bu bulus, bir hastalik tedavisinde kullanim için, asagidaki formül ile gösterilen bir
yapi ile MAb-CL2A-SN-38 yapisal formülüne sahip olan bir konjugat ile ilgilidir:
NHgtaimin tiiizii olanak)
BULUSUN ARKAPLANI
Ozel hedefli ilaç terapisi alaninda çalisan bilim adamlari uzun yillardir monoklonal
antikorlari (Mab'lar), toksik ajanlarin insan kanserlerine spesifik tesliminde
kullanmayi amaçlamaktadir. Tümör ile iliskili MAb*Iar ve uygun toksik ajanlarin
konjugatlari gelistirilmistir ancak kanser terapisinde karma basariya sahip olmustur
ve enfeksiyonlu ve otoimmün hastaliklar gibi baska hastaliklarda ise neredeyse hiç
uygulanamamistir. Toksik ajan, en yaygin olarak kemoterapötik bir ilaçtir ancak
parça yayan radyonüklitler ya da bakteriyel veya bitkisel toksinler de özellikle
kanser terapisi için MAbtIara (Sharkey ve Goldenberg, CA Cancer J Clin. 2006 Jul-
Aug;56(4):226-243) ve daha yakin zamanda, belirli enfeksiyonlu hastaliklarin klinik
öncesi terapisi için radyoimmunokonjugatlara (Dadachova ve Casadevall, Q J Nucl
MAb-kemoterapötik ilaç konjugatlarini kullanmanin avantajlari (a) kemoterapbtik
ilacin kendisinin yapisal olarak iyi tanimlanmis olmasi; (b) kemoterapötik ilacin,
çogunlukla MAbtlarin antijen baglanma bölgelerinden uzaktaki spesifik alanlarda
çok iyi tanimlanmis konjugasyon kimyalari kullanilarak MAb proteinine
baglanmasi; (c) MAb-kemoterapötik ilaç konjugatlarinin, MAbtlar ve bakteriyel ya
da bitkisel toksinler içeren kimyasal konjugatlara göre daha tekrarlanabilir sekilde
yapilabilmesi ve bu nedenle ticari gelistirme ve ruhsatlandirma onayi için daha
uygun olmasi ve (d) MAb-kemoterapötik ilaç konjugatlarinin, radyonüklit MAb
konjugatlarindan sistematik olarak daha az toksik olmasidir.
Protein-ilaç konjugatlari ile ilgili önceki çalismalar, protein-kemoterapötik ilaç
konjugatinin faydali bir terapötik olmasi için, bir ilacin, bir hedef hücrede
içsellestirildigi zaman, tercihen kendi orijinal formunda salindigini göstermistir.
birakmak için Iizozomal olarak ayrilan hedef grup ve ilaç arasinda spesifik peptit
baglayicilar kullanmanin avantajini göstermistir. Ozellikle, tümörlerin içindeki pH
degerinin çogunlukla normal fizyolojik pH degerinden düsük oldugu gözlemine
dayanilarak, bir hidrazon içerenler gibi, hafif asit-ayrilabilir baglayicilar kullanilarak
hazirlanan MAb kemoterapötik ilaç konjugatlari gelistirilmistir (Willner v. d.,
onaylanan MAb-ilaç konjugati, Gemtuzumab Ozogamisin, bir anti-CD33 antikoru,
hümanize edilmis P67.6 ve etkili bir kalikeamisin türevi arasinda benzer bir asit-
kemoterapötik ilaç konjugatlari, kemoterapötik ilaçlar ve MAb arasinda indirgen bir
sekilde kararsiz engellenen disülfit baglar ile yapilmistir (Liu v. d., Proc Natl Acad
Baska bir ayrilabilir baglayici, Trouet v.d.'nin, ilaç ve dipeptit arasinda açilip
kapanabilir bir ara parçaya da sahip olan, bir ila dört amino asit içeren Iizozomal
olarak kararsiz peptit ara parçalarina benzeyen, Phe-Lys ya da Val-Cit gibi
katepsin B-kararsiz dipeptit ara parçalari içerir (Dubowchik, v. d., Bioconjugate
kamptotesin immunokonjugatinin hazirlanmasinda da kullanilmistir (Walker v. d.,
ise antikor ve kemoterapötik ilaç arasindaki baglayiciya eklenen bir ester bagidir.
Gillimard ve Saragovi, bir paklitaksel esterinin anti-siçan p75 MAb, MC192 ya da
anti-insan TrkA MAb, 5C3,e eklenmesi halinde konjugatin hedefe özgü toksisite
Bu bulusun konjugatlari, birçok durumda, konjuge olmayan ya da “çiplak”
antikorlardan veya antikor parçalarindan daha yüksek etkililige sahiptir; ancak bu
tür konjuge olmayan hedefleyici moleküller spesifik durumlarda faydalidir. Ornegin,
kanserde, çiplak antikorlar, Ienfomalar (CAMPATH® ve RlTUXAN®) tedavisinde,
kolorektal veya diger kanserler (ERBITUX® ve AVASTIN®), gögüs kanserinin
(HERECEPTlN®) tedavisinde ve su anda çok sayida klinik gelistirmede (ör.,
epratuzumab) önemli bir rol oynar hale gelmistir. Bu vakalarin çogunda, klinik
kullanim, bu çiplak veya konjuge olmayan antikorlarin kemoterapi ya da radyasyon
terapisi gibi baska terapiler ile birlestirilmesini içermistir.
Çesitli antikorlar, artiritte tümör nekroz faktörü (TNF) ve B hücresi antikorlari gibi
otoimmün ve diger immün düzensizlik (RlTUXAN®) hastaliklarinin tedavisinde
kullanima da yöneliktir ve B hücresi antikorlari, RlTUXAN® ve epratuzumab gibi
bu tür baska hastaliklarda, sistemik Iupus eritematoz ve Sjögren sendromunda ve
çocukluk diyabeti ve multipl skleroz hastaliklarinda arastirilmaktadir. Çiplak
antikorlar da sepsis ve septik sok, Alzheimer hastaligi ve enfeksiyonlu
hastaliklarda da arastirilmaktadir. Anti-infektif monoklonal antikorlarin gelisimi,
tarafindan incelenmistir ve antikor terapisi uygulanan öncelikli patojenler
özetlenmistir ve bu patojenlerden yalniz 2 tanesinin, bunlarla mücadele eden
antikorlarin Faz IIl klinik çalismalarinda oldugu ya da pazarlanmakta oldugu
(solunum sinsisyal virüs ve metisillin dirençli sinsisyal) ve diger 25 tanesinin ise
klinik çalismalarda oldugu ve 20 tanesinin klinik çalisma sirasinda birakildigi
ortaya çikarilmistir.
Daha etkili anti-patojen ya da anti-kanser antikorlari ve baska baglayici gruplar
gelistirilmesine ihtiyaç bulunmaktadir. Bu tür antikor aracili terapötikler, çiplak
(konjuge olmayan), radyo etiketli ya da ilaç/toksin konjugatlari olarak, bakteriler,
mantarlar, virüsler ve parazitler dahil olmak üzere birçok farkli patojenin tedavisi
için gelistirilebilir. Kanser, patojenler ve diger hastaliklarin tedavisinde kullanim
için, intraselüler olarak ayrilabilir baglayicilara sahip daha etkili antikor konjugatlari
gelistirilmesine de ihtiyaç vardir. Ilaç/toksin ya da radyonüklit konjugatlarinin
teslimi durumunda, bu, dogrudan antikor konjugasyonu ya da ön hedefleme olarak
anilan dolayli yöntemler ile gerçeklestirilebilir ve bu ön hedefleme yönteminde,
lezyonun hedef alinmasi için bispesifik bir antikor kullanilirken, terapötik ajan,
patojen, kanser ya da tedavi edilen lezyon bölgesinde lokalize olmus olan
bispesifik antikorun kollarindan birine baglanarak ikincil olarak hedef alinir
bir antikor ya da antikor parçasi, bir baglayici ve bir kamptotesin gibi bir hedef
grubunu içeren terapötik konjugatlar ile ilgilidir.
polimerlere eklenirken, terapötik ajanlarin hedef hücreler, dokular ve
organizmalara teslimine yönelik yöntem ve terkipler ile ilgilidir.
yönelik kanser terapisi için 7- etil-10-hidroksikomptotesin (SN-38) antikor
konjugatlarini raporlamaktadir.
terap'otik grubun bir asit ayrilabilir bag ile baglanirken, bir antikor ve bir terapötik
grup gibi hedefleyici bir grup içeren terapotik konjugatlar ile ilgilidir.
terap'otik ve/veya tanisal grup ve bir ya da daha fazla triazol içeren baglayici ile
birbirine baglanan bir ya da daha fazla fonksiyonel grup içeren bilesikler ile ilgilidir.
BULUSUN OZETI
Bu bulusa yol açan problem, ekli bagimsiz istemlerin konusu ile çözülmektedir.
Tercih edilen somut örnekler, ekli bagimli istemlerden alinabilir.
Daha 'özel olarak, bu bulusa yol açan problem, asagidaki formül ile gösterilen bir
yapi ile MAb-CL2A-SN-38 yapisal formülüne sahip olan bir konjugat ile
çözülmektedir:
NHz ::amin tuzu olarak;
ve kanser ya da bir habislik tedavisinde kullanima yöneliktir; burada, MAb, kanser
ya da habisligin habis bir hücresinde eksprese edilen bir epitop ya da bir antijeni
hedef alir ve kanser, hematopoietik tümör, karsinom, sarkoma, melanoma ve gliyal
tüm'or içeren grup içinden seçilir.
Bir somut örnekte, MAb ile hedef alinan antijen, CD74, CD22, EGP- 'I, musin,
CD66a-e, CEA, CEACAMS, CEACAMG, CSAp, alfa-fetoprotein, CC49, PSMA,
PSAM-dimer, karbonik anhidraz IX, tenassin ve HLA-DR arasindan seçilir.
Bir somut örnekte, kanser ya da habisligin habis bir hücresinde eksprese edilen
antijen, CD74, CD22, EGP- 1, musin, CD66a-e, CEA, CEACAM5, CEACAMG,
CSAp, alfa-fetoprotein, CC49, PSMA, PSAM-dimer, karbonik anhidraz IX, tenassin
ve HLA-DR arasindan seçilir.
Bir somut örnekte, MAb, bir mürin antikoru, bir kimerik antikor, primatize bir
antikor, hümanize edilmis bir antikor, bir insan antikoru, bir Fab antikor parçasi, bir
Fab' antikor parçasi, bir F(ab)2 antikor parçasi, bir F(ab')2 antikor parçasi ve bir
scFv antikor parçasi arasindan seçilir.
Bir somut örnekte, MAb, bir kimerik, primatize, hümanize edilmis ya da insan
monoklonal antikorudur ve söz konusu antikor, sabit alanlara ve bir insan IgG1 ya
da bir insan IgG4 antikorunun bir eklem alanina sahiptir.
Bir somut örnekte, MAb, sabit alanlara ve bir insan lgG4 antikorunun bir eklem
alanina sahiptir ve eklemin serin 228'i yerinde bir prolin bulunur.
Bir somut örnekte, antikor, sabit alanlara ve bir insan IgG1 antikorunun bir eklem
alanina sahiptir ve burada bir ya da daha fazla Fc amino asidi, antikorun kandaki
yari Ömrünü artirmak için mutasyona ugratilir ya da Fc*nin bir ya da daha fazla
grubu silinmistir ya da antikorun kandaki yari ömrünü artirmak için bir ya da daha
Bir somut örnekte, MAb, multispesifiktir ve hedef hücrede bulunan en az iki farkli
antijeni ya da epitopu hedef almak için birden çok baglanma koluna sahiptir ve bir
ya da daha fazla hedefleyici kol, CPTiye konjugedir.
Bir somut örnekte, multispesifik MAb, CD74, CD22, EGP- 1, musin, CD66a-e,
CEA, CEACAMS, CEACAMB, CSAp, alfa-fetoprotein, CC49, PSMA, PSAM-dimer,
karbonik anhidraz IX, tenassin ve HLA-DR arasindan seçilen bir antijeni hedef
alan bir ya da daha fazla antikor içeren bispesifik ve/veya bivalent bir antikor
yapisina sahiptir.
Bir somut örnekte, bir ya da daha fazla antikor; hLL1, hLL2, RFB4, hA19, hA20,
arasindan seçilir.
Bir somut örnekte, multispesifik antikor, karbonik anhidraz lX, B?, CCCL19,
fetoprotein (AFP), VEGF, ED-B fibronektin, EGP-1, EGP-2, EGF reseptör (ErbB1),
ErbBZ, ErbBß, Faktor H, FHL-1, Flt-3, folat reseptörü, Ga 733,GROB, HMGB-l,
hipoksi uyarma faktörü (HlF), HM1.24, HER-2/neu, insülin benzeri büyüme faktörü
gangliositler, HCG, HLA-DR, CD66a-d, MAGE, mCRP, MCP-1, MlP-1A, MlP-1B,
makrofaj göç inhibe etme faktörü (MlF), MUC1, MUCZ, MUCS, MUC4, MUCÖ,
plasenta büyüme faktörü (PIGF), PSA (prostat-spesifik antijen), PSMA, PSMA
dimer, PAM4 antijen, NCA-95, NCA-90, A3, A33, Ep-CAM, KS-l, Le(y), mesotelin,
8100, tenassin, TAC, Tn antijen, Thomas-Friedenreich antijenleri, tumor nekroz
antijenleri, tümor anjiyogenez antijenleri, TNF- d, TRAlL reseptörü (R1 ve R2),
VEGFR, RANTES, T101, kanser kök hücre antijenleri, tamamlayici faktörler C3,
C3a, C3b, C5a, C5 ve bir onkojen ürün arasindan seçilen iki ya da daha fazla
antijene baglanir.
Bu açiklama, ilaç baglayici grup konjugatlarinin hazirlanmasina yönelik gelismis
yöntemler ve terkipler saglayarak, teknikte süregelen ihtiyaci çözmektedir.
Açiklanan yöntemler ve terkipler, baska terapi sekillerine dirençli olan ya da az
yanit veren çesitli hastalik ve rahatsizliklarin tedavisinde kullanima yöneliktir ve
seçici hedefleme için uygun hedefleyici (baglayici) gruplar gelistirilebilen ya da
mevcut olan ya da bilinen hastaliklari kapsayabilir. Tercihen, hedefleyici grup bir
antikor, antikor parçasi, bispesifik ya da baska çok degerlikli antikor ya da baska
antikor bazli molekül ya da bilesiktir. Antikor, çesitli izotoplari seklinde, tercihen
lgG1, IgG2a, IgG3, lgG4 ya da lgA seklinde olabilir ve bir kimerik insan-fare, bir
kimerik insan-primati hümanize edilmis (insan çerçevesi ve mürin hiper degisken
(CDR) bölgeleri) ya da tamamen insan antikorlari ve van der Neut Kolfschoten ve
digerleri tarafindan tarif edilen sekilde yarim-lgG4 antikorlari (“monokoklar”)
aptamerler, avimerler ya da hedefleyici peptitler gibi teknikte bilinen baska
baglayici gruplar da kullanilabilir. Bu tür hedefleyici gruplarin ise yaradigi tercih
edilen hastaliklar ya da rahatsizliklar, örnegin, kanser, otoimmün hastaliklar ve
enflamatuvar hastaliklar dahil olmak üzere immün düzenleme rahatsizliklari ve
enfeksiyonlu organizmalardan kaynaklanan hastaliklardir.
Bu nedenle, açiklanan yöntemler ve terkipler, hedefleyici gruplarin sitotoksik
ajanlarin teslimi için faydali oldugu hastaliklar ve rahatsizliklarin tedavisi için
uygulanabilir. Bu tür hastaliklar ya da rahatsizliklar, kanserin ya da patojenik
organizmalar içeren enfeksiyonun immün terapisi gibi, konjuge olmayan ya da
çiplak hedefleyici gruplar kullanildigi zaman yeterince etkilenmeyen bir hedef
molekül ya da hedef hücre varligi ile karakterize edilir. (Hastalik terapilerinde
kullanim için izotoplar, ilaçlar ve toksinler ile antikorlarin immunokonjugatlarinin
yapilmasina yönelik yöntemler için örnegin bkz., ABD Patent No. 4,699,784;
Açiklama 0 kadar sinirli olmasa da kamptotesin (CPT) ve analoglari ve
türevlerinin, tercih edilen kemoterapötik gruplar oldugu açiklanmistir. Açiklama
kapsamina giren diger kemoterapötik gruplar söyledir: taksanlar (e.g, baksatin III,
taksol), epotilonlar, antrasiklin ilaçlar (e.g., doksorubisin (DOX), epirubisin,
morfolinodoksorubisin (morfolino-DOX), siyanomorfolino-doksorubisin
(siyanomorfolino-DOX) ve 2-pirr0linodoksorubisin (2-PDOX); bkz. Priebe W (ed),
ACS sempozyum dizileri 574, yayinci American Chemical Society, Washington
geldanamisin ile örneklenen benzokuinoid ansamisinler (DeBoer v. d., Journal of
ve benzerleri. Tercihen, istemlerde tanimlanan sekilde bu bulusun tercih edilen
somut örneklerinin immunokonjugatlarinda, antikor, en az bir kemoterapötik gruba,
tercihen 1 ila yaklasik 5 kemoterapötik gruba; en çok tercih edilen sekilde yaklasik
7 ila yaklasik 12 kemoterapötik gruba baglanir.
ilaçlarin CPT gruplari ile ilgili olarak, sulu tamponlarda çözünmeme sorunlari ve
bunlarin fizyolojik kosullar altinda yapilarinin E halkasinin ö-lakton grubunun
asillenmesi ve amino asidin a-amino grubunun poli-L-glutamik asidi ile
eslestirilmesi olmustur (Singer v. d., The Kampotesins: Unfolding Their Anticancer
Potential, Liehr J.G., Giovanella, B.C. ve Verschraegen (ed), NY Acad Sci., NY
difüzyonuna dayanir. Bu glisin konjugasyonu, suda çözünür bir CPT türevi
hazirlama yöntemi olarak (Vishnuvajjala v. d., U.S. Patent No. 4,943,579) ve PEG
türevli bir CPT hazirliginda da bildirilmistir (Greenwald, v. d. J. Med. Chem. 39:
formlari gelistirme baglaminda icat edilmistir ve CPTjnin in vivo yari ömrü
artirilmistir ve ilaç, in vivo dolasimdayken konjugatindan kademeli olarak
salinmistir. Suda çözünür bir CPT türevinin bir örnegi CPT-11'dir. CPT-11'in
farmakolojisi ve aktif SN-38,e in vivo dönüsümü ile ilgili olarak kapsamli klinik
veriler mevcuttur (Iyer ve Ratain, Cancer Chemother Pharmacol. 42:S31-43
daha etkilidir.
Ilaç konjugatlari, terapbtik ilacin bakteriler, virüsler, mantarlar ve parazitler gibi
patojenlere hedeflenmesi için kullanilabilir. Tercih edilen somut 'örneklerde, bu tür
ilaç konjugatlari, anti-fungal, antibiyotikler ve anti-viral ilaçlar ve/veya çiplak
antikorlar, immunomodülatorler (ön, interferonlar, interl'okinler ve/veya sitokinler)
gibi baska terapotik formlar ile kombinasyon halinde kullanilabilir. Enfeksiyonlu
organizmalarin tedavisi için radyoimmünoterapi kullanimi, örnegin 4,925,648;
sayili ABD Patent Basvurusu Yayinlari içinde açiklanmaktadir.
Kanser tedavisinde, bulusun istemlerde tanimlanan ilaç konjugatlari, ameliyat,
radyasyon terapisi, kemoterapi, çiplak antikorlar ile immünoterapi,
radyoimmünoterapi, immunomodülatörler, asilar ve benzerleri ile bir arada
kullanilabilir. Benzer kombinasyonlar, otoimmün hastaliklar gibi hedefleyici
gruplara uyumlu baska hastaliklarin tedavisi için tercih edilir. Ornegin, bulusun
istemlerde tanimlanan sekilde konjugatlari, TNF inhibitörleri, B hücresi antikorlari,
interferonlar, interl'okinler ve romatoid artrit, sistemik lupus eritematoz, Sj'orgen
sendromu, multipl skleroz, vaskülit ile tip l diyabet (gençlik diyabeti) gibi otoimmün
hastaliklarin tedavisi için etkili olan diger ajanlar ile birlestirilebilir. Bu kombinasyon
terapileri, bu tür kombinasyonlarda her bir terapötik ajanin daha düsük dozlarda
kullanilmasina izin verir, dolayisiyla bazi ciddi yan etkileri azaltir ve potansiyel
olarak gereken terapi seyirlerini azaltir. Viral hastaliklarda, ilaç
immunokonjugatlari, baska terapötik ilaçlar, immunomodülatorler, çiplak MAb'Iar
ya da asilar (br, hepatit, HlV ya da papilloma virüslerine karsi MAb'lar ya da bu
virüslerin immünojenlerine dayali asilar) ile birlestirilebilir. Bunlara ve baska viral
patojenlere karsi antikorlar ve antijen bazli asilar teknikte bilinmektedir ve bazi
durumlarda halihazirda ticari kullanimdadir.
Açiklama, ayni zamanda, konjugatlari hazirlama prosesi ile de ilgilidir ve bu
proseste, bir ilaç ilk önce birinci bir baglayici ile türevine dönüstürülür ve bu birinci
baglayici, ilaveten bir hedefleyici grup eslestirme grubu içeren ikinci bir baglayici
ile birlesebilen bir reaktif grup içerir; burada, birinci baglayici, ayni zamanda, suda
çözünürlük için tanimli bir polietilen glikol (PEG) grubuna ve istege bagli olarak
intraselüler peptidazlar ile ayrilabilen ya da endozomal ve lizozomal keseciklerin
düsük pH ortami ile ayrilabilen intraselüler olarak ayrilabilir bir gruba ve istege
bagli olarak ilaç ve birinci baglayici arasinda bir amino asit ara parçasina da
sahiptir; burada, ikinci baglayici, bakir (+1) iyonu ile katalize asetilen-azit
sikloadisyon reaksiyonu ile ilaç-(birinci baglayici) konjugat ile reaksiyona girebilen
bir reaktif grup içerir; bu da “klik kimyasi” olarak adlandirilir. Tercihen, tanimli PEG
grubu, asagida tartisilan sekilde tanimli sayida monomerik alt birimler ile düsük
molekül agirligina sahip bir PEGidir.
Açiklama, ayni zamanda, yukaridaki paragrafta tartisilan konjugatlari hazirlamaya
yönelik bir proses ile de ilgilidir; burada, ikinci baglayici, tek bir hedefleyici grup
eslestirme grubuna ancak ilaç-(birinci baglayici) konjugati ile reaksiyona girebilen
birkaç reaktif gruba sahiptir; dolayisiyla hedefleyici gruba konjuge olan ilaç
Açiklama, ayrica, konjugatlari hazirlama prosesi ile de ilgilidir; bu proseste,
baglayici, ilk önce bir ilaca konjuge olur, böylece bir ilaç-baglayici konjugati üretilir;
burada sözü edilen ilaç-baglayici konjugatinin hazirlanisi, birden çok fonksiyonel
grup içeren bir ilaçta daha reaktif bir grubun seçici olarak korumaya alinmasini ve
korumasinin kaldirilmasini içerir; burada soz konusu ilaç-baglayici konjugatii
müteakip olarak bir monoklonal antikora ya da parçaya konjuge edilir.
Ayni zamanda, bu belgede tarif edilen konjugatlar ile kanser (habislik), bir
otoimmün hastalik, bir enfeksiyon ya da enfeksiyonlu bir lezyonu tedavi etme
yöntemi de açiklanmaktadir. Ayrica, istemlerde anlatilan prosesler ve/veya
istemlerdeki prosesleri gerçeklestirme setleri ile üretilen ilaç-hedefleyici grup
konjugatlari da açiklanmaktadir.
Açiklama, ayrica, asagidakileri içeren bir immunokonjugat ile de ilgilidir:
(a) bir hedefleyici grup;
(b) bir kemoterap'otik grup; ve
(o) bir hedefleyici grup-baglayici grup araciligiyla hedefleyici gruba ve
intraselüler olarak ayrilabilir bir grup araciligiyla kemoterapötik gruba
kovalent olarak baglanan bir baglayici. Baska bir somut örnekte, bulus,
asagidakileri içeren bir immunokonjugat ile ilgilidir:
(a) bir hedefleyici grup;
(o) bir hedefleyici grup-baglayici grup araciligiyla hedefleyici gruba
ve intrasel'üler olarak ayrilabilir bir grup araciligiyla kemoterapötik
gruba kovalent olarak baglanan bir baglayici; burada sözü konusu
terapötik gruba baglayici eklenmesi, bir L-amino asit ya da dört
adede kadar L-amino asitten olusan bir polipeptit de içerir.
Bir `örnekte, intrasel'üler olarak ayrilabilir grup, kemoterapötik grubun ve sübstitüe
edilmis bir etanolamin grubunun ya da bir 4-aminobenzil alkolün etkinlestirilmis bir
hidroksil grubunu içeren bir karbonattir ve bunlardan sonuncusu, amino grubu
araciligiyla, hedefleyici grup-baglayici grup içinde sonlanan bir çapraz baglayiciya
eklenir ve burada, sübstit'ue edilmis etanolamin grubu, dogal bir L amino asidin
karboksilik asit grubunun bir hidroksimetil grubu ile degistirilmesi araciligiyla dogal
L amino asitten elde edilir ve 4-aminobenzil alkol, istege bagli olarak, benzilik
pozisyonda bir Ci-Cio alkil grubu ile s'übstitüe edilir.
Baska bir 'örnekte, intraselüler olarak ayrilabilir grup, kemoterap'otik grubun ve
sübstit'üe edilmis bir etanolamin grubunun etkinlestirilmis bir hidroksil grubunu
içeren bir karbonattir ve bunlardan sonuncusu, amino grubu araciligiyla, bir L
amino aside ya da dört adede kadar L amino asit grubu içeren bir polipeptide
eklenir; burada, N-terminali, hedefleyici grup-baglayici grup içinde sonlanan bir
çapraz baglayiciya eklenir ve burada, sübstitue edilmis etanolamin grubu, istege
bagli olarak, bir L amino asidin karboksilik asit grubunun bir hidroksimetil grubu ile
degistirilmesi araciligiyla L amino asitten elde edilir.
Baska bir 'örnekte, intraselüler olarak ayrilabilir grup, kemoterapötik grubun
etkinlestirilmis bir hidroksil grubunu ve bir 4-aminobenzil alkol ya da benzilik
pozisyonda bir C1-C10 alkil grubu ile sübstit'ue edilmis bir sübstitüe edilmis 4-
aminobenzil alkol içeren bir karbonattir ve bunlardan sonuncusu, amino grubu
araciligiyla, bir L amino aside ya da dört adede kadar L amino asit grubu içeren bir
polipeptide eklenir; burada, N-terminali, hedefleyici grup-baglayici grup içinde
sonlanan bir çapraz baglayiciya eklenir.
Belirli örneklerde, kemoterapötik grubun bir amino grubu, sübstit'ue edilmis ve
amin korumali bir etanolamin grubunun etkinlestirilmis bir hidroksil grubu ya da bir
4-amin0benzil alkol ile eslestirilir ve bunlardan sonuncusu, amino grubu
araciligiyla, bir L amino aside ya da dört adede kadar L amino asit grubu içeren bir
polipeptide eklenir; burada, N-terminali, hedefleyici grup-baglayici grup içinde
sonlanan bir çapraz baglayiciya eklenir; burada, söz konusu sübstit'ue edilmis
etanolamin grubu, istege bagli olarak, bir L amino asidin karboksilik asit grubunun
bir hidroksimetil grubu ile degistirilmesi araciligiyla L amino asitten elde edilir ve
burada, 4-aminobenzil alkol, istege bagli olarak, benzilik pozisyonda bir Ci-CiO
alkil grubu ile sübstit'üe edilir. Çift fonksiyonlu ilaç türevi, daha sonra, yukarida
anlatilan sekilde bir immunokonjugat elde edilmesi için bir hedefleyici gruba
konjuge edilir. Hastalik bölgesinin immunokonjugat ile hedef alinmasi üzerine,
immunokonjugat, ilaç-baglayici grubunu salmak 'üzere endositoza ugratilir ve
katabolize edilir; burada, sübstit'ue edilmis etanolamin grubunun serbest amino
grubu, karbamat grubunun karbonil grubunda nükleofilik saldiri ile serbest ilacin
SEKILLERIN KlSA TARIFNAMESI
SEKIL 1. MAb- CL2A-SN-38 konjugatlari ile Capan 1 insan pankreas karsinomu
tasiyan atimik çiplak farelerin klinik öncesi in vivo terapisi.
SEKIL 2. MAb- CL2A-SN-38 konjugatlari ile BxPC3 insan pankreas karsinomu
tasiyan atimik çiplak farelerin klinik oncesi in vivo terapisi.
SEKIL 3. HMN-14- CL2A-SN-38 konjugati ile LS174T insan kolon karsinomu
tasiyan atimik çiplak farelerin klinik öncesi in vivo terapisi.
BULUSUN AYRINTILI TARIFNAMESI
Tanimlar
Asagidaki tarifnamede, birtakim terimler kullanilmaktadir ve istemlerin konusunun
anlasilmasini kolaylastirmak için asagidaki tanimlar verilmektedir. Bu belgede açik
bir sekilde tanimlanmayan terimler, sade ve olagan anlamlarina göre
kullanilmaktadir.
Aksi belirtilmedigi takdirde, “bir” kelimesi, “bir ya da daha fazla” anlamina gelir.
Yaklasik terimi, bu belgede, bir degerin arti ya da eksi yüzde onu (% 10) anlamina
gelir. Ornegin, “yaklasik 100”, 90 ve 110 arasinda herhangi bir sayidir.
Bu belgede, hedefleyici terimi, bir hedef molekül, hücre, parçacik, doku ya da
agregaya spesifik ya da seçici olarak baglanan bir molekül, kompleks ya da
agrega anlamina gelir. Teknikte uzman kisiler, spesifik baglanma ifadesinin, belirli
bir hedefe, baska hedefler ile çapraz reaktiflik olmadan baglanma anlamina
geldigini ve seçici baglanmanin, belirli bir hedefe tercihen baglanma anlamina
geldigini anlayacaktir. Tercih edilen somut örneklerde, hedefleyici grup bir antikor,
antikor parçasi, bispesifik antikor ya da baska antikor bazli molekül ya da bilesiktir.
Ancak, hedefleyici gruplarin, aptamerler, avimerler, reseptör baglayici Iigandlar,
nükleik asitler, biyotin-avidin baglayici çiftler, baglayici peptitler ya da proteinler,
vb. gibi baska örnekleri teknikte bilinmektedir ve kullanilabilir. “Hedefleyici grup” ve
Bu belgede kullanildigi üzere, bir antikor, tam uzunluklu (yani, dogal yolla olusan
ya da normal immünoglobulin gen parçasi rekombinasyon prosesleri ile olusan) bir
immünoglobulin molekülünü (ör., bir IgG antikoru) ya da bir antikor parçasi gibi, bir
immünoglobulin molekülünün antijen baglayici bir parçasini ifade eder. Bir antikor
ya da antikor parçasi, istemlerin konusu kapsaminda konjuge edilebilir ya da
baska sekilde türevlendirilebilir. Bu tür antikorlar, sinirlama olmaksizin lgG1,
lgG2a, lgG3, lgG4 (ve lgG4 alt formlari) ile IgA izotiplerini kapsar.
Bir antikor parçasi, IgG47ün yukarida anilan yari molekülleri dahil olmak üzere,
F(ab')2, F(ab)2, Fab,, Fab, Fv, scFv (tek zincirli Fv), tek alani antikorlar (DAB7Iar ya
da VHH'Ier) ve benzerleri gibi bir antikor parçasidir (van der Neut Kolfschoten v. d.
yönelik bir antikor parçasi, intakt antikor tarafindan taninan ayni antijene baglanir.
antijene baglanarak bir antikor gibi hareket eden sentetik ya da genetik olarak
tasarlanmis proteinleri de içerir. Ornegin, antikor parçalari, degisken bölgelerden
olusan izole parçalari da içerir; Örnegin, agir ve hafif zincir degisken bölgelerinden
olusan “Fv” parçalari, hafif ve agir degisken bölgelerin bir peptit baglayici ile
baglandigi rekombinant tek zincirli polipeptit molekülleri (“scFv proteinler”) ve
CDR'Ier gibi, hiper degisken bölgeyi taklit eden amino asit rezidülerinden olusan
minimal tanima birimleri. Fv parçalari, çok degerlikli ve/veya multispesifik
baglanma formlari elde etmek için farkli sekillerde yapilandirilabilir. Çok degerlik
durumunda, bunlar, spesifik epitopa karsi birden fazla baglanma alanina sahip
olurken. multispesifik formlarda, birden fazla epitop (ayni antijenin epitopu ya da
bir antijene ve farkli bir antijene karsi bir epitop) baglanir. Bu belgede kullanildigi
üzere, antikor bileseni terimi, tam bir antikoru, bir füzyon proteinini ve bunlarin
parçalarini kapsar.
Bir çiplak antikor, genel olarak, terapotik bir ajana konjuge edilmemis bütün bir
antikordur. Bunun nedeni, antikor molekülünün Fc parçasinin, tamamlayici
sabitleme ve hücre Iizisine yol açabilecek mekanizmalari devreye sokan ADCC
(antikora bagimli hücre sitotoksisitesi) gibi efekt'or ya da immünolojik fonksiyonlari
saglamasidir. Ancak, Fc parçasi, antikorun terap'otik fonksiyonu için gerekli
olmayabilir; ancak, apoptoz, anti-anjiyogenez, anti-metastatik etkinlik, anti-
adezyon etkinligi, 'Örnegin heterotipik ya da homotipik adezyonun inhibisyonu ve
sinyalizasyon yollarina müdahale gibi baska mekanizmalar devreye girebilir ve
hastaligin ileremesine müdahalede bulunabilir. Çiplak antikorlar, hem poliklonal
hem de monoklonal antikorlari ve bunlarin mürin antikorlari içeren parçalarinin
yani sira, kimerik, hümanize edilmis ya da insan antikorlari gibi bazi rekombinant
antikorlari ve bunlarin parçalari içerir. Bu nedenle, bazi durumlarda, bir “çiplak
antikor”, bir “çiplak" antikor parçasini da ifade edebilir. Bu belgede tanimlandigi
üzere, “çiplak”, “konjuge olmayan” anlamina gelir ve terapötik bir ajana bagli ya da
konjuge olmamayi ifade eder.
Otoimmün Hastaliklar, vücudun, kendi dokularina karsi bir immün tepki
üretmesinden kaynaklanan bozukluklardir. Bunlara Örnek olarak, 1 Mart 2002
tarihinde verilmis olan, 60/360259 seri numarali ABD Geçici Basvurusunda
açiklanan sekilde sunlar verilebilir: Sinif III otoimmün hastaliklar; `Örnegin immün
aracili trombositopeniler, akut idiyopatik trombositopenik purpura ve kronik
idiyopatik trombositopenik purpura, dermatomiyosit, Sjögren sendromu, multipl
skleroz, Sydenham kore, miyasteni gravis, sistemik lupus eritematoz, lupus nefrit,
romatik ates, poliglandular sendromlar, bülloz pemfigoid, diabetes mellitus,
Henoch-Schonlein purpura, post-streptokokkal nefrit, eritema nodosum, Takayasu
artiriti, Addison hastaligi, romatoid artrit, sarkoyidoz, ülseratif kolit, eritema
multiform, lgA nefropati, poliarteritis nodosa, ankilozan spondilit, Goodpasture
sendromu, tromboangitis obliterans, Sjogren sendromu, primer biliyer siroz,
Hashimoto tiroidi, tirotoksikoz, skleroderma, kronik aktif hepatit, romatoid artrit,
polimiosit/dermatomiyosit, polikondrit, pemfigus vulgaris, Wegener granulomatozu,
membranöz nefropati, amiyotropik lateral skleroz, tabes dorsalis, dev hücreli
arterit/ polimiyalji, habis anemi, hizli ilerleyen glomerulonefrit ve fibrozan alveolit.
Bir kimerik antikor, tercihen bir kemirgen antikoru, daha çok tercih edilen sekilde
bir mürin antikoru olan bir türden elde edilen bir antikorun tamamlayicilik belirleme
bölgeleri (CDR°Ier) dahil olmak üzere hem agir hem de hafif antikor zincirlerinin
degisken alanlarini içeren bir rekombinant proteindir ve antikor molekülünün sabit
alanlari, bir insan antikorununkilerden elde edilir. Veterinerlik uygulamalari için,
kimerik antikorun sabit alanlari, bir primat, kedi ya da köpek gibi baska
türlerinkinden elde edilebilir.
Hümanize edilmis bir antikor, bir türden bir antikordan, ör., bir mürin antikorundan
CDRerrin, mürin antikorunun agir ve hafif degisken zincirlerinden, insan agir ve
hafif degisken alanlarina (çerçeve bölgeler) aktarildigi bir rekombinant proteindir.
Antikor molekülünün sabit alanlari, bir insan antikorundan elde edilir. Bazi
durumlarda, hümanize edilmis çerçeve bölgenin spesifik rezidüleri, özellikle de
CDR dizilimlerine dokunan ya da yakin olanlar, modifiye edilebilir; örnegin, orijinal
mürin, kemirgen, insan olmayan primat ya da baska antikordan ilgili rezidüler ile
degistirilebilir.
Bir insan antikoru, örnegin antijenik zorlamaya yanit olarak insan antikorlari
üretecek sekilde “tasarlanmis” olan transgenik farelerden elde edilen bir
antikordur. Bu teknikte, insan agir ve hafif zincir lokuslarinin elemanlari, endojen
agir zincir ve hafif zincir lokuslarinin hedefe yönelik bozulmalarini iceren
embriyonik kök hücre çizgilerinden elde edilen fare suslarina eklenir. Transgenik
fareler, çesitli antijenler için spesifik olan insan antikorlarini sentezleyebilir ve
fareler, insan antikoru salgilayan hibridomalar üretmek için kullanilabilir.
Transgenik farelerden insan antikorlari elde etme yöntemleri Green v.d., Nature
lmmun. &579 (1994) çalismalarinda tarif edilmektedir. Bütünüyle insan antikoru,
ayni zamanda, genetik ya da kromozomal transfeksiyon yöntemleri ve faj
görüntüleme teknolojisi ile de yapilandirilabilir ve tüm bu yöntemler teknikte
bilinmektedir. Ornegin, immünize edilmemis donörlerden immünoglobulin degisken
alan geni repertuarlarindan, insan antikorlari ve bunlarin parçalarinin in vitro
degisken alan genleri, bir filamentöz bakteriyofajin majör ya da minör bir kaplama
protein genine çerçeve içinde klonlanir ve fazj parçaciginin yüzeyinde fonksiyonel
antikor parçalari olarak görüntülenir. Filamentöz parçacik, faj genomunun tek
sarmalli bir DNA kopyasini içerdigi için, antikorun fonksiyonel özelliklerine göre
seçimler, bu özellikleri sergileyen antikoru kodlayan genin seçimine de yol açar.
Bu sekilde, faj, B hücresinin bazi özelliklerini taklit eder. Faj görüntüsü, çesitli
formatlarda gerçeklestirilebilir; ör., bkz: Johnson and Chiswell, Current Opinion in
Bu belgede kullanildigi üzere, enfeksiyonlu hastaliklar, bakteri, rickettsia,
mikoplazma, protozoa, mantar, virüsler, parazitler ve diger mikrobiyal ajanlar gibi
patojenler tarafindan enfeksiyonu içeren hastaliklardir. Bunlara örnek olarak sunlar
verilebilir: AIDS hastaligina neden olan insan immün yetmezlik virüsü (HlV),
Mycobacterium tuberculosis, Streptococcus agalactiae, methicillin-resistant
Stafilococcus aureus, Legionella pneumophilia, Streptococcus pyogenes,
Escherichia coli, Neisseria gonorrhosae, Neisseria meningitidis, Pneumococcus,
Cryptococcus neoformans, Histoplasma capsulatum, Hemophilis influenzae B,
Treponema pallidum, Lyme disease spirochetes, Bati Nil virüsü, Pseudomonas
aeruginosa, Mycobacterium Ieprae, Brucella abortus, kuduz virüsü, grip virüsü,
sitomegalovirüs, herpes simplex virüsü I, herpes simplex virüsü ll, insan serum
parvo benzeri virüs, respiratuar sinsisyal virüs, varicella-zoster virüsü, hepatit B
virüsü, hepatit C virüsü, kizamik virüsü, adenovirüs, insan T hücresi lösemi
virüsleri, Epstein-Barr virüsü, mürin lösemi virüsü, kabakulak virüsü, veziküler
stomatit virüsü, sindbis virüsü, lenfositik koriyomenenjit virüsü, sigil virüsü, mavi dil
virüsü, Sendai virüsü, kedigiller lösemi virüsü, reo virüs, poIIo virüsü, simian virüsü
40, fare meme tümörü virüsü, denge virüsü, kizamikçik virüsü, Plasmodium
falciparum, Plasmodium vivax, Toxoplasma gondii, Trypanosoma rangeli,
Trypanosoma cruzi, Trypanosoma rhodesiensei, Trypanosoma brucei,
Schistosoma mansoni, Schistosoma japanicum, Babesia bovis, Elmeria tenella,
Onchocerca volvulus, Leishmania tropica, Trichinella spiralis, Theileria parva,
Taenia hydatigena, Taenia ovis, Taenia saginata, Echinococcus granulosus,
Mesocestoides corti, Mycoplasma arthritidis, M. hyorhinis, M. orale, M. arginini,
Acholeplasma laidlawii, M. salivarium ve M. pneumoniae. Enfeksiy'oz
organizmalara (antitoksin ve antiviral antikorlar) ile baska hedeflere karsi
Bir terap'otik ajan, bir baglanma grubu, ör., bir antikor ya da antikor parçasi ya da
bunlarin bir alt parçasi ile ayri olarak, birlikte veya art arda tatbik edilen bir molekül
ya da atomdur ve bir hastaligin tedavisinde faydalidir. Terapötik ajanlara örnek
olarak, sinirlama olmaksizin, antikorlar, antikor parçalari, konjugatlar, ilaçlar,
sitotoksik ajanlar, proapopoptotik ajanlar, toksinler, nükleazlar (DNAzIar ve
RNAzlar dahil olmak üzere), hormonlar, immunomodülatörler, selat ajanlari, bor
bilesikleri, fotoaktif ajanlar ya da boyalar, radyoizotoplar ya da radyonüklitler,
oligonükleotitler, interferans RNA, peptitler, anti-anjiyojenik ajanlar, kemoterapötik
ajanlar, sitokinler, kemokinler, ön ilaçlar, enzimler, baglayici proteinler ya da
peptitler ya da bunlarin kombinasyonlari verilebilir.
Bir konjugat, yukarida tarif edilenler gibi bir terap'otik ajana konjuge edilen bir
antikor bileseni ya da baska hedefleyici bir gruptur. Bu belgede kullanildigi üzere,
Bu belgede kullanildigi üzere, antikor füzyon proteini, rekombinant olarak üretilmis
antijen baglayici bir moleküldür ve bu molekülde, bir ya da daha fazla dogal
antikor, tek zincirli antikor ya da antikor parçasi, bir protein ya da peptit toksini,
sitokin, hormon, vb. gibi baska bir gruba baglanir (kaynastirilir). Tercih edilen bazi
somut örneklerde, füzyon proteini, ayni ya da farkli antikorlar, antikor parçalari ya
da birbirine kaynastirilmis tek zincirli antikorlardan ikisi ya da daha fazlasini
içerebilir ve bunlar, ayni epitopa, ayni antijen üzerindeki farkli epitoplara ya da
farkli antijenlere baglanabilir. Bir antikor füzyon proteini, en az bir antijen baglanma
alani içerir. Füzyon proteinlerinin valansi, füzyon proteininin antijen ya da epitopa
baglanma kollarinin ya da bölgelerinin toplam sayisini belirtir; ör., tek degerlikli, çift
degerlikli, üç degerlikli ya da çok degerlikli. Antikor füzyon proteininin çok degerlikli
olmasi, bir antijene baglanirken birden çok etkilesim avantajini saglar ve
dolayisiyla, antijene ya da farkli antijenlere baglanma gücünü artirir. Spesifiklik, bir
antikor füzyon proteininin kaç farkli antijene ya da epitopa baglanabildigini gösterir;
yani, monospesifik, bispesifik, tripesifik, multispesifik. Bu tanimlar kullanildiginda;
bir dogal antikor, br., bir IgG, çift degerliklidir çünkü iki baglanma koluna sahiptir
ancak monospesifiktir çünkü tek bir antijen ya da epitop türüne baglanir.
Monospesifik, çok degerlikli bir füzyon proteini, ayni antijen ya da epitop için birden
çok baglanma alanina sahiptir. Örnegin, bir monospesifik diabody, ayni antijen ile
reaktif olan iki baglanma alanina sahip bir füzyon proteinidir. Füzyon proteini, farkli
antikor bilesenlerinin çok degerlikli ya da multispesifik bir kombinasyonunu ya da
ayni antikor bileseninin birden çok kopyasini içerebilir. Füzyon proteini, ilaveten,
bir terapötik ajan da içerebilir.
Bir immunomodülatör, mevcut oldugu zaman, vücudun immün sistemini degistiren,
baskilayan ya da uyaran bir terapötik ajandir. Tipik olarak, kullanilan bir
immunomodülatör, makrofajlar, dendritik hücreler, B hücreleri ve/veya T hücreleri
gibi immün hücreleri uyararak, bir immün yanit kaskadinda çogalmalarini ya da
aktif hale gelmelerini saglar. Ancak, bazi durumlarda, bir immunomodülatör, bir
otoimmün hastaligin terap'otik tedavisinde oldugu gibi, immün hücrelerin
çogalmasini ya da etkinlesmesini baskilayabilir. Bu belgede tarif edilen sekilde, bir
immunomodülatör 'örnegi olarak, spesifik antijenler ile temas üzerine bir hücre
popülasyonundan (ör., astarli T Ienfositler) salinan ve hücreler arasinda bir
interselüler araci olarak çalisan yaklasik 5-20 kDa büyüklügünde çözünür bir
küçük protein olan sitokin verilebilir. Teknikte uzman kisilerin anlayacagi üzere,
sitokinlere örnek olarak lenfokinler, monokinler, interlökinler ve tümör nekroz
faktörü (TNF) ve interferonlar gibi birkaç ilgili sinyalizasyon molekülü verilebilir.
Kemokinler, sitokinlerin bir alt kümesidir. Bazi interl'okinler ve interferonlar, T
hücresi ya da diger immün hücre çogalmasini uyaran sitokinlerin örnekleridir.
CPT, kamptotesin kisaltmasidir ve bu basvuruda kullanildigi üzere, CPT,
kamptotesinrin kendisini ya da kamptotesin'in bir analog ya da türevini ifade eder.
Kamptotesin ve bazi analoglarinin yapilari, asagida Çizelge ildeki formül 1Ide,
gösterilen numaralandirma ve A-E harfleri ile etiketlenmis halkalar ile verilmistir.
Çizelge 1
81 ilk ?s IO-Hidroksi -CP'I': R; = OH; R2 = R3 "' H
1:^.~if..ly°ç_\0s, CPTII'RI &go-r( >. R2=Etilili=H
3952 SN-38: R, non; Rgz Etil;ls=H
(i) Topotekan : R - OH; R2 - H; R3 == CHz-N(CH3)2
Kamptotesin Konjugatlari
Bir antikor (MAb) gibi hedefleyici gruplar (TM) ile kemoterapötik ilaçlarin
konjugatlarini hazirlamak için asagidaki sekillerde yöntemler tasarlanmistir.
Açiklanan yöntemler, bulusun tercih edilen bir somut örnegini göstermektedir. (1)
Ilacin çözünürlügü, ilaç ve hedefleyici vektör arasina tanimli bir polietilenglikol
(PEG) grubu (yani, tanimli sayida monomerik birim içeren bir PEG) konularak
artirilir; burada, tanimli PEG, molekül agirligi düsük olan, tercihen 1-30 monomerik
birirn içeren, daha çok tercih edilen sekilde 1-12 monomerik birim içeren bir
PEG'dir; (2) birinci bir baglayici, ilaci bir uçta baglar ve diger uçta bir asetilen ya da
bir azit grubu ile sonlanir; bu birinci baglayici, bir uçta bir azit ya da asetilen grubu
ve diger uçta karboksilik asit ya da hidroksil grubu gibi farkli bir reaktif grup içeren
tanimli bir PEG grubu içerir ve söz konusu çift fonksiyonlu tanimli PEG, bir amino
alkolün amin grubuna aglanir ve bunun hidroksil grubu, bir karbonat seklinde ilacin
hidroksil rubuna eklenir; alternatif olarak, söz konusu tanimli çift fonksiyonlu
PEG'nin azit disi (ya da asetilen disi) grubu, istege bagli olarak, bir L-amino asit
ya da bir polipeptide eklenir ve C terminali ise amino alkolün amino grubuna
baglanir ve bu sonuncusunun hidroksi grubu, sirasiyla karbonat ya da karbamat
seklinde ilacin hidroksil grubuna eklenir; (3) bir hedefleyici grup-eslesme grubu ve
birinci baglayicinin azit (ya da asetilen) grubuna tamamlayici olan bir reaktif grup
içeren ikinci bir baglayici, yani asetilen (ya da azit), hastalik hedefleyici antikorlar
gibi hastalik hedefleyici gruplara konjugasyon için faydali olan nihai çift fonksiyonlu
müstahzari elde etmek için asetilen-azit sikloadisyon reaksiyonu araciligiyla ilaç-
(birinci baglayici) konjugati ile reaksiyona girer; (4) antikor-eslestirme grubu, bir
tiyol ya da bir tiyol-reaktif grup seklinde tasarlanir; (5) SN-38 gibi CPT analoglari
içeren ilaç-baglayici öncülünün preparatlarinda C-20 karbonat varliginda 10-
hidroksil grubunun seçici rejenerasyonu için yöntemler tasarlanir; (6) SN-38'de
fenolik hidroksil, örnegin t-bütildimetilsilyl or t-bütildifenilsilyl gibi, ilaçlardaki reaktif
hidroksil gruplar için diger koruyucu gruplar da kullanilir ve türevlenen ilacin, bir
hedefleyici-vektör-eslestirme grubuna baglanmasindan önce tetrab'utilamonyum
flor'ür ile bunlarin korumasi kaldirilir; ve (6) CPT analoglarinin 10-hidroksil grubu,
alternatif olarak, '800 disinda. bir ester ya da karbonat olarak korumaya alinir;
böylece, çift fonksiyonlu CPT, bu koruma grubunun korumasi kaldirilmadan Önce
bir hedefleyici gruba konjuge edilir ve koruyucu grup, biyokonjugat tatbik edildikten
sonra fizyolojik pH kosullari altinda kolayca kaldirilir. 'Klik kimyasi' olarak anilan
asetilen-azit eslestirmesinde, azit kismi L2 'üzerinde ve asetilen kismi L3 'üzerinde
olabilir. Alternatif olarak, L2, asetilen içerebilir ve L3 ise azit içerebilir. 'Klik
kimyasi,, bir asetilen grubu ve bir azit grubu arasinda bir bakir (+1)-katalize
sikloadisyon reaksiyonudur ve biyokonjugasyonlar alaninda nispeten yeni bir
kimyasi, neredeyse nötr pH kosullarinda sulu çözelti içinde gerçeklesir ve u
nedenle ilaç konjugasyonuna yatkindir. Klik kimyasinin avantaji, kemo-seçici
olmasi ve tiyol-maleimit reaksiyonu gibi iyi bilinen baska konjugasyon kimyalarini
tamamlamasidir. Asagidaki tartismada, bir konjugatin bir antikor ya da antikor
parçasi içermesi durumunda, bir aptamer, avimer ya da hedefleyici peptit gibi
baska tür bir baglayici grup sübstit'ue edilebilir.
Bir Örnek, bir ilaç türevinin bir konjugatina ve genel formül ?nin bir antikoruna
yöneliktir,
MAb-[L2]-[LI]-[AA]m-[A']-Ilaç (2)
burada, MAb, hastalik hedefleyici bir antikordur; L2, bir antikor eslestirme grubu ve
bir ya da daha fazla asetilen (ya da azit) grubu içeren bir çapraz baglayici
bilesenidir; L1, L2ideki asetilen (ya da azit) grubuna tamamlayici olarak bir uçta
azit (ya da asetilen) ile tanimli bir PEG ve diger uçta karboksilik asit ya da hidroksil
grubu gibi bir reaktif grup içerir; AA, bir L-amino asittir; m, degeri 0, 1, 2, 3 ya da 4
olan bir tamsayidir ve A,, etanolamin, 4-hidr0ksibenzil alkol, 4-amin0benzil alkol ya
da sübstit'ue edilmis ya da sübstit'ue edilmemis etilendiamin arasindan seçilen ek
bir ara parçadir.°AA' L amino asitleri, alanin, arginin, asparagi, aspartik asit, sistein,
glutamin, glutamik asit, glisini histidin, izolösin, Iösin, lizin, metiyonin, fenilalanin,
prolin, serin, treonin, triptofan, tirozin ve valin arasindan seçilir. A' grubunun
hidroksil içermesi halinde, bu grup, ilacin hidroksil grubuna ya da amino grubuna,
sirasiyla bir karbonat ya da karbamat seklinde baglanir.
Formül 2inin tercih edilen bir örneginde, A,, bir L-amino asitten elde edilen
sübstit'ue edilmis bir etanolaminrdir ve burada, amino asidin karboksilik asit grubu,
bir hidroksimetil grubu ile degistirilir. A,, asagidaki L-amino asitlerden herhangi
birinden elde edilebilir: alanin, arginin, asparagi, aspartik asit, sistein, glutamin,
glutamik asit, glisin, histidin, izolösin, lösin, Iizin, metiyonin, fenilalanin, prolin,
serin, treonin, triptofan, tirozin ve valin.
Formül 2'nin tercih edilen somut örneginin konjugatinin bir örneginde, m, O'dir; A,,
L-valinolrdür ve ilaç, SN-38 le örneklenir. Elde edilen yapi, formül Site
gösterilmektedir.
57”& m
.1 n "w-r*** 1% g
ss . 'î, as' % @Lirggî-gh'? gs`
...ß ..wmG-G&-Aw“yy“&G'M-WÃMa**GG<-›:›IGG“~«V=G“:.W” :: i: *2 .::î .
~ “4 ,ring-%2# ' ?525% GW'**
..41“3':
Formül 2'nin tercih edilen somut örneginin konjugatinin baska bir örneginde, m,
1'dir ve türevli bir L-lizin ile gösterilir; A', L-valinol*d`ür ve ilaç, SN-38 Ie örneklenir.
Yapi, formül 4ite gösterilmektedir.
3,,“ {: 3th::
Bu örnekte, ilk olarak, Iizin gibi bir amino grubunun karboksilik asidi ve valinol
amino grubu arasinda, lizin amino gruplari için ortogonal koruma gruplari
kullanilarak bir amit bagi olusturulur. Liziniin N terminalindeki koruma grubu
kaldirilir, Iizin yan zincirindeki koruma grubuna dokunulmaz ve N terminali, diger
uçta azit (ya da asetilen) ile tanimli PEG üzerinde karboksil grubu ile eslestirilir.
Daha sonra, valinol hidroksil grubu, 10-hidr0ksi-korumali SN-38'in 20-klor0format
türevine eklenir ve bu ara ürün, hedefleyici vekt'ore baglanan grup ile klik
sikloadisyon kimyasina dahil olan tamamlayici asetilen (ya da azit) tasiyan bir L2
bileseni ile eslestirilir. Son olarak, hem Iizin yan zincirinde hem de SN-389de
koruma gruplarinin kaldirilmasi, bu örnegin, formül 3'te gösterilen ürününü verir.
Teoriye bagli kalinmaksizin, küçük MW SN-38 ürünü, yani intraselüler proteolizis
sonrasinda olusan valinol-SN-38 karbonat, valinol amino grubunu ve karbonat'in
karbonilini içeren molekül içi siklizasyon yoluyla intakt SN-38iin serbest kalmasi
için ilave bir yol saglar.
Baska bir örnekte, genel formül ?den A', A-OH'dir; burada, A-OH, 4-aminobenzil
alkol ya da benzilik pozisyonda bir C1-C1O alkil grubu ile sübstitüe edilmis bir
sübstitüe 4-aminobenzil alkol gibi çikarilabilir bir gruptur ve bunlardan sonuncusu,
amino grubu araciligiyla, bir L amino aside ya da dört adede kadar L amino asit
grubu içeren bir polipeptide eklenir; burada, N-terminali, hedefleyici grup-baglayici
grup içinde sonlanan bir çapraz baglayiciya eklenir.
Asagida verilen `örnekte, genel formül (2)'deki A, için A-OH somut örnegi, sübstitüe
edilmis 4-aminobenzil alkolden elde edilir ve 'AA7, genel formül (2)'de m = 1 olmak
üzere tek bir L-amino asitten olusur ve ilaç, SN-38 ile orneklenir. Yapi, asagida
gösterilmistir (formül 5, MAb-CLX-SN-38 olarak anilmaktadir). Tek bir AA amino
asidi, asagidaki L-amino asitlerden herhangi biri olarak seçilebilir: alanin, arginini
asparagin, aspartik asit, sistein, glutamin, glutamik asit, glisin, histidin, izolösini
aminobenzil alkol grubu üzerindeki sübstitüen R (A' için A-OH somut örnegi),
hidrojen ya da C1-C1O alkil gruplarindan seçilen bir alkil grubudur.
2 ya!' 3,3_ Rus.“
Formül 5rten MAb-CLX-SN-38 somut 'örneginde, tek amino asit AA, L-lizin'dir ve R
= H'dir ve ilaç, SN-38 ile örneklenir (formül 6, MAb-CL2A-SN-38 olarak
anilmaktadir).
NHa (amin tuzu olarak)
SN-38 gibi, 10-hidr0ksi içeren kamptotesinler baglaminda baska somut örnekler
de mümkündür. Ilaç olarak SN-38 örneginde, ilacin daha reaktif 10-hidr0ksi grubu,
-hidroksil grubu etkilenmeden birakilarak türevlendirilir. Genel formül 2 içinde,
A', sübstitüe edilmis etilendiamin'dir. Bunun bir Örnegi, asagidaki formül '7' ile
gösterilmektedir ve bu formülde, SN-38 fenolik hidroksil grubu, sübstitüe edilmis
etilendiamin ile bir karbamat olarak türevlendirilir ve diamin'in diger amini, bir 4-
aminobenzil alkol ile bir karbamat olarak türevlendirilir ve bu alkolün amino grubu,
Phe-Lys dipeptide eklenir. Bu yapida (formül 7), R ve R,, birbirinden bagimsiz
olarak hidrojen ya da metil'dir. R = R' = metil oldugu zaman, MAb-CL17-SN-38 or
MAb-CL2E-SN-38 olarak anilir.
ofNÖ1î~^l°Wßgw°ßu 5%” @On RNJYO “:1 .Il-«J 53)?
NHz(amin tuzu olarak)
AA, intraselüler peptidaz ile ayrilabilen bir polipeptit grubu, tercihen bir di, tri ya da
tetrapeptit grubu içerebilir. Bunlara 'örnek olarak sunlar verilebilir: Ala-Leu, Leu-
Ala-Leu, and AIa-Leu-Ala-Leu (Trouet v.d., 1982).
Baska bir örnekte, konjugatin L1 bileseni, 1-30 tekrarlanan monomerik birime
sahip olan tanimli bir polietilenglikol (PEG) ara parçasi içerir. Baska bir örnekte,
PEG, 1-12 tekrarlanan monomerik birime sahip olan tanimli bir PEGadir. PEGinin
eklenmesi, piyasadan satin alinabilen heterobifonksiyonel PEG türevlerinin
kullanilmasini içerebilir. Heterobifonksiyonel PEG, bir azit ya da asetilen grubu
içerebilir. Asagidaki formül 8'de, 'NHS' süksinimidil iken, 8 tekrarlanan monomerik
birim içeren bir heterobifonksiyonel tanimli PEG 'örnegi gösterilmektedir.
*ise “M" ;3 ””âMWMWg'Ewß' ”kesme
Bir örnekte, L2, 2-40 arasinda, tercihen 2-20 arasinda ve daha çok tercih edilen
sekilde 2-5 arasinda degisen sayida asetilen (ya da azit) grubu ve tek bir
hedefleyici vektör-baglanma grubu içerir.
Birden çok ilaç molekülü ve tek bir hedefleyici vektör-baglanma grubu içeren bir
antikorun temsili bir SN-38 konjugati asagida gösterilmektedir. Bu yapinin 'L2'
bileseni, 2 asetilenik gruba eklenir ve u da iki azit bagli SN-38 molekülünün
baglanmasina yol açar. MAb'ye baglanma, bir süksinimit olarak gösterilmistir.
MAD-«g J" r 7 H E? R
R Rezidüsü asagidaki gibidir:
021:' `1 4,0
**ß-@Nvro/VNYO/Y t' u °w< 2 ~~; i.
Li 27A\7
NH; (Tut) `af-;1:
Tercih edilen örneklerde, çift fonksiyonlu ilaç, antikor baglayici grup olarak bir tiyol
reaktif grup içerir ve antikor üzerindeki tiyoller, bir tiyolasyon reaktifi kullanilarak
antikorun Iizin gruplari üzerinde olusturulur. MAb*nin Iizin gruplarinin
modifikasyonlari ile antikorlara tiyol grubu ekleme yöntemleri, teknikte iyi
bilinmektedir (Wong, Chemistry of protein conjugation and cross-Iinking, CRC
Press, Inc., Boca Raton, FL (1991), s. 20-22). Alternatif olarak, antikor üzerinde
zincirler arasi disülfit baglarin, ditiyotreitol (DTT) gibi indirgeyici ajanlar kullanilarak
üzerinde 7 ila 10 tiyol olusturabilir; bu durum, antijen baglanma bölgesinden
uzakta MAb'nin zincirler arasi bölgesine birden çok ilaç grubu eklenmesi
avantajina sahiptir.
Bir örnekte, kemoterapötik grup, doksorubisin (DOX), epirubisin,
morfolinodoksorubisin (morfolino-DOX), siyanomorfolino-doksorubisin
(siyanomorfolino-DOX), 2-pirrolinodoksorubisin (2-PDOX), CPT, 10-hidroksi
kampotesin, topotekan, lurtotekan, 9-aminokampotesin, 9-nitrokampotesin,
taksanlar, geldanamisin, ansamisinler ve epotilonlar arasindan seçilir. Istemlerde
tanimlanan bulusa göre, kemoterapötik grup SN-38'dir. Tercihen, tercih edilen
somut örneklerinin konjugatlarinda, antikor grubu, en az bir kemoterapötik gruba,
tercihen 1 ila yaklasik 12 kemoterapötik gruba; en çok tercih edilen sekilde
yaklasik 6 ila yaklasik 12 kemoterapötik gruba baglanir.
Ayrica, tercih edilen bir somut örnekte, baglayici bilesen 'L2,, söz konusu
hedefleyici grubun bir ya da daha fazla Iizin yan zincir amino grubuna eklenen bir
tiyoI-reaktif rezidü ile reaksiyona giren bir tiyol grubu içerir. Bu tür durumlarda,
antikor, teknikte iyi bilinen prosedürler ile bir maleimit, vinilsulfone, bromoasetamit
ya da iyodoasetamit gibi bir tiyol-reaktif grup ile ön türevlemeye tabi tutulur.
Bu somut örnekler baglaminda, CPTrnin ilaveten bir 10-hidroksil grubuna sahip
oldugunda CPT ilaç-baglayicilarin hazirlanabildigi bir proses sasirtici bir sekilde
kesfedilmistir. Bu proses, sinirlama olmaksizin, 10-hidroksil grubunun bir t-
bütiloksikarbonil (BOC) türevi olarak korunmasini ve ardindan ilaç-baglayici
konjugatinin sondan bir önceki ara maddesinin hazirlanmasini içerir. Genel olarak,
BOC grubunun çikarilmasi, trifloroasetik asit (TFA) gibi güçlü bir asit ile islem
gerektirir. Bu kosullar altinda, çikarilacak olan koruma gruplarini içeren CPT 20-O-
baglayici karbonat da ayrilmaya duyarlidir ve bu da modifiye edilmemis CPTiye
yol açar. Aslinda, teknikte bilinen sekilde, baglayici molekülün Iizin yan zinciri için
hafif çikarilabilir metoksitritil (MMT) koruma grubu kullanma gerekçesi, tam olarak
bu olasiligin Önlenmesi içindir (Walker v.d., 2002). Fenolik BOC koruma grubunun
seçici olarak çikarilmasinin, reaksiyonlarin kisa süreler, optimal olarak 3 ila 5
dakika boyunca gerçeklestirilmesi ile mümkün oldugu kesfedilmistir. Bu kosullar
altinda, baskin ürün, 10-hidr0ksil pozisyonunda “BOC, çikarilmis ve '20,
pozisyonunda karbonat intakt kalmis ürün olmustur.
Alternatif bir yaklasim, CPT analogunun 10-hidr0ksi pozisyonunun, 'BOC' disinda
bir grup ile korunmasini içerir ve bu durumda nihai ürün, 10-OH koruma grubunun
korumasini kaldirmaya ihtiyaç olmadan antikorlara konjugasyon için hazirdir. 10-
OH'yi bir fenolik karbonat ya da bir fenolik estere çeviren 10-hidroksi koruma
grubunun korumasi, fizyolojik pH kosullari ile ya da konjugatin in vivo tatbiki
sonrasinda esterazlar ile kolayca kaldirilir. 10 pozisyonunda bir fenolik karbonatin,
fizyolojik kosullar altinda 10-hidroksikampotesin'in 20 pozisyonunda tersiyer
karbonattan daha hizli çikarilmasi, He v.d. (He v.d., Bioorganic & Medicinal
-hidroksi koruma grubu 'COR' olabilir; burada, R, “'N(CH3)2-(CH2)n-” gibi
sübstitüe edilmis bir alkil olabilir ki burada n, 1-10 arasindadir ve terminal amino
grubu, istege bagli olarak, yüksek suda çözünürlük için bir kuaterner tuz
seklindedir ya da R, “CH3-(CH2)n-” gibi basit bir alkil rezidüsü olabilir ki burada ni
0-10 arasindadir ya da R, n degerinin 0-10 arasinda oldugu “CH3-(CH2)n-O-” gibi
bir alkoksi grubu olabilir ya da n degerinin 2-10 arasinda oldugu “N(CH3)2-(CH2)n-
O-” olabilir ya da “R10-(CH2-CH2-O)n-CH2-CH2-O-" olabilir ki burada R1, etil ya
da metil'dir ve n, 0-10 arasinda bir tamsayidir. Bu 10-hidr0ksi türevleri, nihai
türevin bir karbonat olmasi halinde seçilen reaktifin kloroformati ile islem yoluyla
kolayca hazirlanir. Tipik olarak, SN-38 gibi 10-hidroksi içeren kamptotesin, baz
olarak trietilamin kullanilarak dimetilformamit içinde kloroformat'in bir molar
esdegeri ile islenir. Bu kosullar altinda, 20-OH pozisyonu etkilenmez. 10-O-esterler
olusturmak için, seçilen reaktifin asit klorürü kullanilir.
Istatistiksel tanimlayicilar L2, L1, AA ve A-X'in Önceki bölümlerde tarif edilen
sekilde oldugu genel formül ?nin bir ilaç türevinin ve bir antikorunun konjugatinin
hazirlanmasinin örnek bir prosesinde, ilk olarak, çift fonksiyonlu ilaç grubu, [L2]-
ilaç grubunun konjugasyonu gerçeklestirilir.
Istatistiksel tanimlayicilar L2, L1, AA ve A-OHyin önceki bölümlerde tarif edilen
sekilde oldugu genel formül ?nin bir ilaç türevinin ve bir antikorunun konjugatinin
hazirlanmasinin örnek bir prosesinde, ilk olarak A-OH'nin bir amit bagi araciligiyla
AA'nin C terminaline baglanmasi yoluyla çift fonksiyonlu ilaç grubu hazirlanir ve
ardindan AA'nin amin ucu, L1*in bir karboksilik asit grubuna eslestirilir. AA'nin
mevcut olmamasi halinde (yani m :0), A-OH, bir amit bagi araciligiyla dogrudan
L1'e eklenir. Çapraz baglayici, [L1]-[AA]m-[A-OH], ilacin hidroksil ya da amino
grubuna eklenir ve bunun ardindan, klik kimyasi araciligiyla L1 ve L2'deki azit (ya
da asetilen) ve asetilen (ya da azit) gruplari arasinda reaksiyona basvurularak L1
grubuna ekleme gelir.
Hedefleyici grubun bir 'örneginde, TM, monoklonal bir antikordur (MAb). Baska bir
somut 'örnekte, hedefleyici grup, çok degerlikli ve/veya multispesifik bir MAb
olabilir. Hedefleyici grup, bir mürin, kimerik, hümanize edilmis ya da insan
monoklonal antikoru olabilir ve söz konusu antikor, intakt, parçali (Fab, Fab:
F(ab)2, F(ab,)2) ya da alt parçali (tek zincirli yapilar) seklinde ya da IgG1, lgGZa,
lgGS, lgG4, IgA izotipi ya da bunlarin alt molekülleri seklinde olabilir.
Baska bir örnekte, hedefleyici grup, bir kanser ya da habis hücre üzerinde
eksprese edilen bir antijen ya da bir antijen epitopu ile reaktif olan bir monoklonal
antikordur. Kanser hücresi, tercihen, bir hematopoietik tümör, karsinom, sarkoma,
melanoma ya da bir gliyal tümörden bir hücredir. Bu bulusa göre tedavi edilecek
olan tercih edilen bir habislik, habis bir kati tümör ya da hematopoietik
neoplazmdir.
Tercih edilen bir somut `örnekte, intraselüler olarak ayrilabilir grup, MAb-ilaç
konjugati ile bir reseptörüne baglanma ve özellikle esterazlar ve peptidazlar ile
ayrilma üzerine hücre içine yerlestikten sonra ayrilabilir.
Antikor, tamamen insan, insan disi, hümanize edilmis ya da kimerik bir antikor ya
da enzimatik olarak ya da rekombinant olarak üretilmis parçalar dahil olmak üzere
bir antikor parçasi ya da antikorlar ya da antikor parçalarindan dizilimler içeren
baglayici proteinler olabilir. Antikorlar, parçalar ve baglayici proteinler, yukarida
tanimlanan sekilde çok degerlikli ve multispesifik ya da çok degerlikli ve
monospesifik olabilir.
Genel Antikor Teknikleri
Neredeyse her türlü hedef antijene karsi monoklonal antikorlar hazirlama
teknikleri, teknikte iyi bilinmektedir. Ornegin, bkz. Kohler and Milstein, Nature 256:
495 (1975) ve Coligan v.d. (eds.), CURRENT PROTOCOLS IN IMMUNOLOGY,
CILT. 1, sayfa 2.5.1-2.. Kisacasi, monoklonal
antikorlar, farelere, bir antijen içeren bir terkip enjekte edilmesi, B-lenfositler elde
etmek için dalagin çikarilmasi, hibridomalar üretmek için B-lenfositlere miyelom
hücreleri kaynatilmasi, antijene karsi antikor üreten pozitif klonlarin seçilmesi,
antijene karsi antikor üreten klonlarin kültürünün hazirlanmasi ve hibridoma
kültürlerinden antikorlar izole edilmesi yoluyla elde edilebilir.
MAbilar, iyi bilinen çesitli tekniklerle hibridoma kültürlerinden izole edilebilir ve
saflastirilabilir. Bu tür izolasyon teknikleri, Protein-A ya da Protein-G Sepharose ile
afinite kromatografisini, boyut dislama kromatografisini ve iyon degisim
2.9.3. Ayrica, bkz. Baines v.d., “Purification of Immunoglobulin G (IgG),” METODS
lN MOLECULAR BIOLOGY, CILT. 10, sayfa 79-104 (The Humana Press, Inc.
1992).
Immünojene karsi antikorlarin ilk çikarilmasindan sonra, antikorlar sekanslanabilir
ve ardindan rekombinant teknikler ile hazirlanabilir. Mürin antikorlari ve antikor
parçalarinin hümanizasyonu ve kimerizasyonu, asagida anlatilan sekilde, teknikte
uzman kisiler tarafindan iyi bilinmektedir.
Teknikte uzman kisiler, istemlerde verilen yöntemler ve terkiplerin, teknikte bilinen
çok çesitli antikorlardan yararlanabilecegini fark edecektir. Kullanilabilecek
antikorlar, birçok bilinen kaynaktan satin alinabilir. Ornegin, hibridoma çizgilerini
salgilayan birçok antikor çesidi, Amerikan Tip Kültür Koleksiyonu'nda (ATCC,
Manassas, VA) bulunmaktadir. ATCC, tümör ile iliskili antijenler dahil olmak ancak
bunlarla sinirli olmamak üzere, çesitli hastalik hedeflerine karsi çok sayida antikor
bulundurmaktadir ve degisken bölge dizilimleri yayimlanmistir ve bunlar,
istemlerdeki yöntemler ve terkiplerde kullanim için uygundur. `Ornegin, bkz: ABD
Bunlar, yalniz ornek niteligindedir ve çok sayida baska antikor ve onlarin
hibridomalari da teknikte bilinmektedir. Teknikte uzman kisiler, neredeyse her türlü
hastalik ile iliskili antijene karsi antikor dizilimleri ya da antikor salgilayan
hibridomalarin, ATCC, NCBI ve/veya USPTO veri tabanlarinda, ilgilenilen bir
hastalik ile iliskili hedefe karsi antikorlar için basit bir arama yapilarak elde
edilebilecegini takdir edecektir. Klonlanan antikorlarin antijen baglayici alanlari,
artirilabilir, kesilip çikarilabilir, bir ekspresyon vektör'une baglanabilir, uyarlanan bir
konak hücreye transfekte edilebilir ve teknikte iyi bilinen standart teknikler
kullanilarak protein üretimi için kullanilabilir. Izole edilen antikorlar, bu belgede
açiklanan teknikler kullanilarak kamptotesin gibi terapötik ajanlara konjuge
edilebilir.
Kimerik ve Hümanize Edilmis Antikorlar
Bir kimerik antikor, bir insan antikorunun degisken bölgelerinin, örnegin bir fare
antikorunun, bu antikorun tamamlayicilik belirleme bölgeleri (CDR'ler) dahil olmak
üzere degisken bölgeleri ile degistirildigi bir rekombinant proteindir. Kimerik
antikorlar, bir denege tatbik edildikleri zaman düsük immünojenisite ve yüksek
stabilite sergiler. Kimerik antikorlar üretme yöntemleri teknikte bilinmektedir (ör.,
Leung v.d., 1994, Hybridoma 13:469).
Bir kimerik monoklonal antikor, fare immünoglobuliniin agir ve hafif degisken
zincirlerinden fare CDR'Ierinin, bir insan antikorunun onlara karsilik gelen degisken
alanlarina aktarilmasi yoluyla hümanize edilebilir. Kimerik monoklonal antikordaki
fare çerçeve bölgeleri (FR) de insan FR dizilimleri ile degistirilir. Hümanize edilmis
monoklonalin stabilite ve antijen spesifisitesini korumak için, bir ya da daha fazla
insan FR rezidüleri, fare emsal rezidüleri ile degistirilebilir. Hümanize edilmis
monoklonal antikorlar, deneklerin terapötik tedavisi için kullanilabilir. Hümanize
edilmis monoklonal antikorlarin üretimine yönelik teknikler, teknikte iyi
1502844.)
Diger somut örnekler, insan disi primat antikorlari ile ilgili olabilir. Babunlarda
terapötik olarak faydali antikorlar çikarmaya yönelik genel teknikler, örnegin su
lnt. J. Cancer 46: 310 (1990). Baska bir somut örnekte, bir antikor, bir insan
monoklonal antikoru olabilir. Bu tür antikorlar, yukarida anlatilan sekilde, antijenik
zorlamaya yanit olarak spesifik insan antikorlari üretecek sekilde “tasarlanmis”
olan transgenik farelerden elde edilen bir antikordur.
Insan Antikorlari
Birlesimli yaklasimlar ya da insan immünoglobulin lokuslari ile dönüstürülmüs
transgenik hayvanlar kullanilarak bütünüyle insan antikorlari üretmeye yönelik
yöntemler teknikte bilinmektedir (ör., Mancini v.d., 2004, New Microbiol. 27:315-
antikorlarinin, kimerik ya da hümanize edilmis antikorlardan bile daha az yan etki
göstermesi ve in vivo olarak esasen endojen insan antikorlari gibi çalismasi
beklenmektedir. Belirli somut örneklerde, istemlerin yöntemleri ve prosedürleri, bu
tür tekniklerle üretilmis insan antikorlari kullanabilir.
Bir alternatifte, insan antikorlari üretmek için faj görüntüleme teknigi kullanilabilir
normal insanlardan ya da kanser gibi belirli bir hastalik durumunu gösteren
insanlardan üretilebilir (Dantas-Barbosa v.d., 2005). Hastalikli bir bireyden insan
antikorlari üretmenin avantaji, dolasimdaki antikor repertuarinin, hastalik ile iliskili
antijenlere karsi antikorlara yönelik olabilmesidir.
Bu yöntemin sinirlayici olmayan bir örneginde, Dantas-Barbosa v.d. (2005),
osteosarkoma hastalarindan insan Fab antikor parçalarinin bir faj görüntüleme
kütüphanesini olusturmustur. Genel olarak, toplam RNA, dolasimdaki kan
lenfositlerinden elde edilmistir (yukarida belirtilen çalisma). Rekombinant Fab, |J, V
ve K zincir antikor repertuarlarindan klonlanmis ve bir faj görüntüleme
kütüphanesine eklenmistir (yukarida belirtilen çalisma). RNA'lar, cDNAiIara
dönüstürülmüs ve agir ve hafif Zincirli immünoglobulin dizilimlerine karsi spesifik
primerler kullanilarak Fab cDNA kütüphaneleri yapmak için kullanilmistir (Marks
göre yapilmistir: Andris-Widhopf v.d. (2000, in: Phage Display Laboratory Manual,
Barbas v.d. (ed.), 1. baski, Cold Spring Harbor Laboratory Press, Cold Spring
Harbor, NY 5. 9.1 ile 9.22). Son Fab parçalari, restriksiyon endonükleazlari ile
sindirilmis ve faj görüntüleme kütüphanesini olusturmak için bakteriyofaj
genomuna eklenmistir. Bu tür kütüphaneler, standart faj görüntüleme yöntemleri ile
taranabilir. Teknikte yetkin kisiler, bu teknigin, yalniz örnek niteliginde oldugunu ve
faj görüntüleme ile insan antikorlari ya da antikor parçalari üretmek ve taramak için
bilinen her türlü yöntemin kullanilabilecegini takdir edecektir.
Baska bir alternatifte, yukarida anlatilan sekilde standart immünizasyon
protokolleri kullanilarak esasen her türlü immünojenik hedefe karsi antikorlar
üretmek için, genetik olarak insan antikorlari üretmesi tasarlanmis olan transgenik
hayvanlar kullanilabilir. Transgenik farelerden insan antikorlari elde etme
yöntemleri su çalismalarda tarif edilmistir: Green v.d., Nature Genet. 7:13 (1994),
tür bir sistemin sinirlayici olmayan bir örnegi, XenoMouse®'tur (ör., Green v.d.,
benzer hayvanlarda, fare antikor genleri devre disi birakilmis ve fonksiyonel insan
antikor genleri ile degistirilmistir ve fare immün sisteminin kalani intakt
birakilmistir.
XenoMouse®, aksesuar genler ve düzenleyici dizilimler boyunca, degisken bölgeli
dizilimlerin çogunlugu dahil olmak üzere, insan lgH ve lg kappa lokus parçalarini
içeren germ hatti yapilandirilmis YACtler (maya yapay kromozomlari) ile
dönüstürülmüstür. Insan degisken bölge repertuari, bilinen teknikler ile
hibridomalar içine islenebilen, B hücreleri üreten antikor olusturmak için
kullanilabilir. Bir hedef antijen ile immünize edilmis bir XenoMouse®, normal
immün tepki ile insan antikorlari üretir ve bunlar, yukarida anlatilan standart
teknikler ile hasat edilebilir ve/veya üretilebilir. Çesitli XenoMouse® suslari
mevcuttur ve bunlarin her biri, farkli bir antikor sinifi üretebilmektedir. Transgenik
olarak üretilen insan antikorlarinin, terapötik potansiyele sahip oldugu ve normal
insan antikorlarinin farmakokinetik özelliklerini de korudugu gösterilmistir (Green
v.d., 1999). Teknikte yetkin kisiler, istemlerin terkipleri ve yöntemlerinin,
XenoMouse® sistemi ile sinirli olmadigini ve insan antikorlari üretecek sekilde
genetik olarak tasarlanmis her türlü transgenik hayvani kullanabilecegini takdir
edecektir.
Antikor Parçalarinin Uretimi
Istemlerin yöntemleri ve/veya terkiplerinin bazi somut örnekleri, antikor parçalari
ile ilgilidir. Bu tür antikor parçalari, örnegin, tam antikorlarin klasik yöntemler ile
pepsin ya da papain sindirimi ile elde edilebilir. Ornegin, antikor parçalari, F(ab')2
olarak gösterilen bir 58 parçasini saglamak için antikorlarin pepsin ile enzimatik
olarak ayrilmasi yoluyla üretilebilir. Bu parça, 3.58 Fab, tek degerlikli parçalarini
üretmek için, bir tiyol indirgeyici ajan ve istege bagli olarak, disülfit baglarin
ayrilmasindan kaynaklanan sülfhidril gruplari için bir bloklama grubu kullanilarak
da ayrilabilir. Alternatif olarak, pepsin kullanilarak enzimatik ayirma, iki tek
degerlikli Fab parçasi ve bir PC parçasi üretir. Antikor parçalari üretmek için örnek
yöntemler, su çalismalarda açiklanmistir: ABD Pat. No. 4,036,945; ABD Pat. No.
lMMUNOLOGY, (John Wiley & Sons).
Tek degerlikli hafif-agir zincir parçalar olusturmak için agir zincirlerin ayrilmasi,
parçalarin ilaveten ayrilmasi gibi antikorlari ayirmanin baska yöntemleri ve ya da
diger enzimatik, kimyasal ya da genetik teknikler, parçalarin intakt antikor
tarafindan taninan antijene baglanmasi sartiyla kullanilabilir. Ornegin, Fv parçalari,
VH ve VL zincirlerinin bir iliskisini içerir. Bu iliski, “Inbar v.d., 1972, Proc. Nat*l.
Acad. Sci. USA, 69:2659” çalismasinda tarif edilen sekilde, kovalent olmayabilir.
Alternatif olarak, degisken zincirler, moleküller arasi bir disülfit bag ile baglanabilir
ya da glutaraldehit gibi kimyasallar ile çapraz baglanabilir. Bkz. Sandhu, 1992,
Crit. Rev. Biotech., 12:437.
Tercihen, Fv parçalari, bir peptit baglayici ile baglanan VH ve VL zincirler içerir. Bu
tek zincirli antijen baglayici proteinler (scFv), bir oligonükleotit baglayici dizilim ile
baglanan, VH ve VL alanlarini kodlayan DNA dizilimlerini içeren yapisal bir gen
yapilandirilarak hazirlanir. Yapisal gen, bir ekspresyon vektörüne eklenir ve bu da
müteakip olarak E. coli gibi bir konak hücreye eklenir. Rekombinant konak
hücreler, iki V alani arasinda köprü kuran bir baglayici peptit içeren tek bir
polipeptit zinciri sentezler. ScFv'leri üretme yöntemleri teknikte bilinmektedir. Bkz.
Whitlow v.d., 1991, Metods: A Companion to Metods iri Enzymology 2:97; Bird
Bir antikor parçasinin baska bir formu, bazen tek zincirli antikor olarak da anilan
tek alanli antikordur (dAb). Tek alanli antikorlari üretme yöntemleri teknikte iyi
bilinmektedir (ör., bkz: Cossins v.d., Protein Expression and Purification, 2007,
tamamlayicilik belirleme bölgesi (CDR) içerebilir. CDR peptitleri (“minimal tanima
birimleri”), ilgili bir antikorun CDR”sini kodlayan genler yapilandirilarak elde
edilebilir. Bu tür genler, örnegin, antikor üreten hücrelerin RNA'sindan degisken
bölge sentezlemek için polimeraz zincir reaksiyonu kullanilarak hazirlanabilir. Bkz.
Larrick v.d., 1991, Metods: A Companion to Metods in Enzymology 22106; Ritter
v.d. (ed), 1995, MONOCLONAL ANTIBODIES: PRODUCTlON, ENGINEERING
AND CLlNlCAL APPLICATION, sayfa ;
Birch v.d., (ed), 1995, MONOCLONAL ANTIBODIES: PRINCIPLES AND
APPLICATIONS, sayfa
Antikor Varyasyonlari
Belirli somut örneklerde, antikorlarin dizilimleri, örnegin antikorlarin Fc kisimlari,
serum içindeki yari ömrü gibi, konjugatlarin fizyolojik özelliklerini optimize etmek
için çesitlendirilebilir. Proteinlerde amino asit dizilimlerini sübstitüe etme
yöntemleri, ör., alana yönelik mutagenez, teknikte yaygin olarak bilinmektedir (ör.,
Sambrook v.d., Molecular Cloning, A Iaboratory manual, 2. Baski, 1989). Tercih
edilen somut örneklerde, varyasyon, Fc diziliminde bir ya da daha fazla
glikosilasyon alaninin eklenmesini ya da çikarilmasini içerebilir (ör., ABD Patent
No. 6.254.868). Diger tercih edilen somut örneklerde, FC diziliminde spesifik amino
Bispesifik ve Multispesifik Antikorlar
Bispesifik antikorlar, çesitli biyo-medikal uygulamalarda faydalidir. Örnegin, bir
tümör hücresi yüzey antijeni için ve bir T hücresi yüzey reseptörü için baglanma
alanlarina sahip bir bispesifik antikor, T hücreleri ile spesifik tümör hücrelerinin
lizisini yönlendirebilir. T hücrelerindeki gliyomlari ve CD3 epitopunu taniyan
bispesifik antikorlar, insan hastalarda beyin tümörlerinin tedavi edilmesinde
somut örneklerde, bu belgede açiklanan terapötik ajan konjugasyonu için teknikler
ve terkipler, hedefleyici gruplar olarak bispesifik ya da multispesifik antikorlar ile
kullanilabilir.
Bispesifik ya da multispesifik antikorlar üretmeye yönelik çesitli yöntemler
bilinmektedir; örnegin, ABD Patent No. 7.405.320. Bispesifik antikorlar, kuadroma
yöntemi ile üretilebilir ve bu yöntem, her biri farkli bir antijenik alani taniyan bir
monoklonal antikor üreten iki farkli hibridomanin füzyonunu içerir (Milstein ve
Bispesifik antikorlar üretmeye yönelik baska bir yöntem, iki farkli monoklonal
antikoru kimyasal olarak baglamak için heterobifonksiyonel çapraz baglayicilar
316:354-356). Bispesifik antikorlar, ayni zamanda, iki ana monoklonal antikordan
her birinin ilgili yari moleküllerine indirgenmesi, ardindan bunlarin karistirilmasi ve
melez yapi elde etmek için yeniden oksitlenmesi ile de üretilebilir. Proc Natl Acad
iki ya da üç ayri olarak saflastirilmis Fabi parçasinin kimyasal olarak çapraz
baglanmasini içerir. (On, bkz: Avrupa Patent Basvurusu 0453082).
Diger yöntemler arasinda, retrovirüs türevli tasiyici vektörler araciligiyla ayri olarak
seçilebilir markerlerin, müteakip olarak kaynastirilan ilgili ana hibridomalara gen
transferi ile melez hibridomalar üretmenin verimliligini artirmayi (DeMonte, v.d.
hafif zincirli genlerini içeren ekspresyon plazmitlerine bir hibridoma hücre çizgisi
transfeksiyonunu içerir.
Akraba VH ve VL alanlari, baglayici etkinlige sahip tek zincirli bir Fv (scFv)
olusturmak için uygun terkibe ve uzunluga (genellikle 12rden fazla amino asit
rezidüsü içeren) sahip bir peptit baglayici ile birlestirilebilir. ScFvrleri üretme
açiklanmaktadir. Peptit baglayici uzunlugunun 127den az amino asit rezidüsüne
indirgenmesi, VH ve VL alanlarinin ayni zincir üzerinde eslesmesini önler ve VH ve
VL alanlarini diger zincirler üzerindeki tamamlayici alanlar ile eslesmeye zorlar,
böylece fonksiyonel multimerlerin olusumuna yol açar. 3 ve 12 amino asit rezidüsü
arasinda baglayici ile birlestirilen VH ve VL alanlarinin polipeptit zincirleri, agirlikli
olarak dimerler (diabody'ler olarak adlandirilir) olusturur. 0 ve 2 amino asit
rezidüsü arasinda baglayiciyla, trimerler (tribody'ler olarak adlandirilir) ve
tetramerler (tetrabody'ler olarak adlandirilir) öne çikar ancak oligomerizasyonun
kesin örüntüleri, baglayici uzunluguna ek olarak, V alanlarinin (VH-baglayici ya da
VL-baglayici-VH) terkibine ve yönelimine bagli görünmektedir.
multispesifik ya da bispesifik antikorlari üretmeye yönelik bu teknikler, düsük
verim, saflastirma geregi, düsük stabilite ya da teknigin emek yogunlugu
bakimindan çesitli zorluklar göstermektedir. Daha yakin tarihte, neredeyse istenen
her türlü antikor, antikor parçasi ve diger efektör molekülün kombinasyonlarinin
üretilmesi için “kenetleme ve kilitleme” (dock and lock, DLA) olarak bilinen bir
. Bu teknik, birbirine baglanan ve dimerler,
trimerler, tetramerler, kuintamerler ve hekzamerlere kadar kompleks yapilarin
düzenlenmesine imkan saglayan ankraj alanlari (AD) ve dimerizasyon ve
kenetlenme alanlari (DDD) olarak adlandirilan tamamlayici protein baglanma
alanlarindan yararlanmaktadir. Bunlar, kapsamli saflastirmaya gerek olmadan
yüksek verimlerle kararli kompleksler olusturmaktadir. DNL teknigi, monospesifik,
bispesifik ya da multispesifik antikorlarin düzenlenmesine imkan saglamaktadir.
Bu belgede istemlerin yöntemlerinin uygulamasinda, bispesifik ya da multispesifik
antikorlarlar üretmek için teknikte bilinen yöntemlerden herhangi biri kullanilabilir.
Çesitli somut örneklerde, bu belgede açiklanan sekilde bir konjugat, kompozit,
multispesifik bir antikorun bir parçasi olabilir. Bu tür antikorlar, spesifisiteleri
farklilik gösteren iki ya da daha fazla farkli antijen baglanma alani içerebilir.
Multispesifik kompozit, ayni antijenin farkli epitoplarina baglanabilir ya da alternatif
olarak iki farkli antijene baglanabilir. Daha çok tercih edilen hedef
kombinasyonlarin bazilari, Tablo 1'de siralananlari içerir. Bu, tercih edilen
kombinasyonlarin örneklerinin bir listesidir ancak kapsamli degildir.
Tablo 1. Multispesifik antikorlarin bazi örnekleri.
Birinci hedef Ikinci hedef
MIF Ikinci bir proinflamatuar efektör sitokin, özellikle HMGB-1,
TNF-d, IL-1 ya da IL-6
MIF Proinflamatuar efektör kemokin, özellikle MCP-1, RANTES,
MlP-1A ya da MIP-1B
MIF Proinflamatuar efektör reseptör, özellikle lL-6R, lL-13R ve lL-
MIF Koagülasyon faktörü, özellikle TF ya da trombin
MIF Tamamlayici faktör, özellikle C3, CS, CSa ya da CSa
MIF Tamamlayici düzenleyici protein, özellikle CD46, CD55,
CD59 ve mCRP
MIF Kanser ile iliskili antijen ya da reseptör
HMGB-1 Ikinci bir proinflamatuar efektör sitokin, özellikle MIF, TNF-oi,
lL-1 ya da IL-6
HMGB-1 Proinflamatuar efektör kemokin, özellikle MCP-1, RANTES,
MlP-1A ya da MIP-1 B
HMGB-1 Proinflamatuar efektör reseptör özellikle MCP-1, RANTES,
MIP-1A ya da MIP-1 B
HMGB-1 Koagülasyon faktörü, özellikle TF ya da trombin
HMGB-1 Tamamlayici faktör, özellikle CS, C5, Cßa ya da CSa
HMGB-1 Tamamlayici düzenleyici protein, özellikle CD46, CD55, CD59
ve mCRP
HMGB-1 Kanser ile iliskili antijen ya da reseptör
TNF-oi Ikinci bir proinflamatuar efektör sitokin, özellikle MIF, HMGB-
1, TNF-oi, IL-1 ya da IL-6
TNF-oi Proinflamatuar efektör kemokin, özellikle MCP-1, RANTES,
MlP-1A ya da MIP-1 B
TNF-a Proinflamatuar efektör reseptör, özellikle IL-6R, IL-13R ve IL-
TNF-oi Koagülasyon faktörü, özellikle TF ya da trombin
TNF-oi Tamamlayici faktör, özellikle C3, C5, Cßa ya da CSa
TNF-oi Tamamlayici düzenleyici protein, özellikle CD46, CD55, CD59
ve mCRP
TNF-d Kanser ile iliskili antijen ya da reseptör
LPS Proinflamatuar efektör sitokin, özellikle MIF, HMGB-1, TNF-oii
lL-1 ya da IL-6
LPS Proinflamatuar efektör kemokin, özellikle MCP-1, RANTES,
MlP-1A ya da MIP-1 B
LPS Proinflamatuar efektör reseptör, özellikle IL-GR, IL-13R ve IL-
LPS Koagülasyon faktörü, özellikle TF ya da trombin
LPS Tamamlayici faktör, özellikle CS, C5, CSa ya da C5a
LPS Tamamlayici düzenleyici protein, özellikle CD46, CD55, CD59
ve mCRP
TF ya da trombin
Proinflamatuar efektör sitokin, özellikle MIF, HMGB-1, TNF-oi,
lL-1 ya da IL-6
TF ya da trombin
Proinflamatuar efektör kemokin, özellikle MCP-1, RANTES,
MlP-1A ya da MlP-1 B
TF ya da trombin
Proinflamatuar efektör reseptör, özellikle IL-6R, IL-13R ve IL-
TF ya da trombin
Tamamlayici faktör, özellikle CS, C5, C3a ya da CSa
TF ya da trombin
Tamamlayici düzenleyici protein, özellikle CD46, CD55, CD59
ve mCRP
TF ya da trombin Kanser ile iliskili antijen ya da reseptör
Kanser terapileri için tercih edilenler gibi, baska kombinasyonlar sunlari içerir:
CEACAM5 (CEA) + CEACAM6 (NCA) antikorlari, insülin benzeri büyüme faktörü
(ILGF) + CEACAM5 antikorlari, EGP-1 (ön, RS-7) + lLGF antikorlari, CEACAM5 +
antikorlar, kombinasyon halinde kullanilmanin yani sira, IgG, Fab, scFv ve
benzerleri gibi çesitli füzyon proteini formlari olarak birlestirilebilir.
Hedef Antijenler ve Ornek Antikorlar
Tercih edilen bir somut örnekte, hedef hücrelerde yüksek seviyelerde eksprese
edilen ve normal dokulara göre agirlikli olarak ya da yalnizca hastalikli hücrelerde
eksprese edilen markerler ya da tümör ile iliskili antijenleri taniyan ya da onlara
baglanan antikorlar kullanilir. Bu bulus kapsaminda faydali olan antikorlar,
yukarida tarif edilen özelliklere sahip olan (ve hücrelere ve mikroorganizmalara
farkli seviyelerde yerlesme konusunda ayirt edici özellikler sergileyen) MAbtlari
içerir ve kanserde, asagidaki MAb=Iarin kullanimini tasarlar: LL1 (anti-CD74), LL2
ve RFB4 (anti-CD22), RS7 (anti-epitel glikoprotein-1 (EGP-1)), PAM4 ve KC4 (her
iki anti-musin), MN-14 (anti-karsinoembriyonik antijen (CEA, ayni zamanda CD66e
olarak da bilinir), Mu-9 (anti-kolon-spesifik antijen-p), Immu 31 (anti-alfa-
spesifik membran antijen)), AB-PG1-XG, D2/B (anti-
PSMA), G. Bu tür
Kullanilabilecek bilinen spesifik antikorlar sunlari içerir: hPAM4 (US. Patent No.
Tarif edilen konjugatlar kullanilarak hedef alinabilecek diger yararli antijenler
sunlari içerir: karbonk anhidraz IX, B7, CCCL19, CCCL21, CSAp, HER-2/neu,
fetoprotein (AFP), VEGF (e.g., AVASTIN®, fibronektin birlesme yeri varyanti), ED-
B fibronektin (e.g., L19), EGP-1, EGP-2 (e.g., (e.g.,
ERBlTUX®), ErbB2, ErbB3, Faktör H, FHL-1, Fit-3, folat reseptörü, Ga
benzeri büyüme faktörü (lLGF), IFN-y, IFN-d, lFN-ß, lL-2R, lL-4R, IL-6R, IL-13R,
lGF-1R, la, HM1.24, gangliyositler, HCG, L243 baglanan HLA-DR antijeni, CD66
antijenleri, yani, CD66a-d ya da bunlarin bir kombinasyonu, MAGE, mCRP, MCP-
1, MIP-1A, MlP-1B, makrofaj göç inhibe etme faktörü (MlF), MUC1, MUC2, MUCS,
MUC4, MUCS, plasental büyüme faktörü (PIGF), PSA (prostat-spesifik antijen),
PSMA, PAM4 antijen, NCA-95, NCA-90, A3, A33, Ep-CAM, KS- 1, Le(y),
mesotelin, 8100, tenassin, TAC, Tn antijeni, Thomas-Friedenreich antijenleri,
tümor nekroz antijenleri, tümor anjiyogenez antijenleri, TNF-a, TRAlL reseptörü
(R1 ve R2), VEGFR, RANTES, T101 ile kanser kök hücre antijenleri, tamamlama
faktörleri 03, C3a, Cßb, C5a, C5 ve bir onkojen ürünü.
CD66 antijenleri, sirasiyla BCG, CGMG, NCA, CGM1 ve CEA olmak üzere,
karsinoembriyonik antijen (CEA) gen ailesi üyeleri tarafindan kodlanan, benzer
yapilara sahip (CDööa-e) bes farkli glikoproteinden olusur. Bu CD66 antijenleri
(ön, CEACAM6) temel olarak granülositlerde, sindirim yolunun normal epitel
hücrelerinde ve çesitli dokularin tümör hücrelerinde eksprese edilir. Kanserler için
uygun hedefler olarak, NY-ESO-1 gibi kanser testis antijenleri (Theurillat v.d., Int.
CD79a da yer alir. Yukarida belirtilen antijenlerin bazilari, 15 Kasim 2002 tarihinde
yapilan ESC/426.379 sayili ve “Use of Multispecific, Non-kovalent Complexes for
Targeted Delivery of Therapeutics” balikli ABD Geçici Basvurusunda
açiklanmaktadir. Terapiye daha dirençli habis hücre popülasyonlari olarak atifta
bulunulan kanser kök hücreleri (Gan, J Cell Mol. Med. 5 Aralik 2007 [Epub yayin
kanserinde CD133 (Maitland v.d., Ernst Schering Found. Sympos. Proc. 2006;
:155-79), küçük hücreli akciger kanseri (Donnenberg v.d., J. Control Release
) ve kolorektal kanserde CD44 (Dalerba v.d., Proc. Natl. Acad. Sci. USA 2007;
bas ve boyun skuamöz hücreli karsinom (Prince v.d., Proc. Natl. Acad. Sci. USA
sahiptir.
Akis sitometrisi ile gösterildigi üzere ve ilaç-konjugat immünoterapisi için uygun
antikorlari seçmek için bir rehber olarak, hematopoietik habis hücrelerdeki uygun
antijen (Küme Belirtimi ya da CD) hedefleri ile ilgili yeni bir kapsamli analiz, “Craig
ve Foon, Blood, 15 Ocak 2008 tarihinde online olarak yeniden yayimlanmistir;
Baska bir tercih edilen somut örnekte, antikorlar, hizli bir sekilde içsellesen ve
ardindan yeniden eksprese edilen, islenen ve hücre yüzeylerinde sunulan ve
dolasimdaki konjugatin hücre tarafindan sürekli alimini ve biriktirilmesini saglayan
antikorlar kullanilmaktadir. En çok tercih edilen antikor/antijen çiftine 'örnek olarak
LL1, bir anti-CD74 MAb (degismez zincir, sinif II-spesifik saperon, li) ('or., bkz:
melanomalar, kolon, akciger ve böbrek kanserleri, gliyoblastomalar ve belirli baska
hastaliklarda yüksek oranda eksprese edilir. Kanserde CD74 antikorlarinin
Tercihen anti-CD74 antikorlari ile tedavi edilen hastaliklar arasinda, sinirlama
olmaksizin, non-Hodgkin lenfoma, Hodgkin hastaligi, melanoma, akciger, böbrek,
kolon kanserleri, gliyoblastom multiform, histiyositomalar, miyeoid I'osemiler ve
multipl miyelom yer alir. Hedef hücrelerin yüzeyinde kisa süreler için CD74
antijeninin sürekli ekspresyonu ve ardindan antijenin içsellesmesi ve antijenin
yeniden ekspresyonu, hedefleyici LL1 antikorunun, tasidigi her türlü kemoterapotik
grup ile uyumlu olarak içsellesmesini saglar. Bu, bu tür hücreler içinde, yüksek ve
terap'otik bir LL1- kemoterapötik ilaç konjugati konsantrasyonunun birikmesini
saglar. Içsellesen LL1-kemoterapötik ilaç konjugatlari, Iizozomlar ve
endozomlardan dolasir ve kemoterapötik grup, hedef hücreler içinde aktif bir
formda salinir.
Kenetleme ve Kilitleme (DNL)
Belirli somut Örneklerde, kenetleme ve kilitleme (dock-and-lock) teknolojisi
kullanilarak bispesifik ya da multispesifik antikorlar üretilebilir (ön, bkz: ABD Patent
alt birimleri ve A-kinaz ankraj proteinleri (AKAPrlar) arasinda meydana gelen
spesifik protein/protein etkilesimlerinden yararlanir (Baillie v.d., FEBS Letters.
mesajci cAMP1nin R alt birimlerine baglanmasi ile tetiklenen, üzerinde en çok
çalisilan sinyal transdüksiyon yollarindan birinde merkezi bir rol oynayan PKA, ilk
olarak 1968 yilinda tavsan iskelet kasindan izole edilmistir (Walsh v.d., J. Biol.
izozimleri, iki tür R alt birimi (RI ve RII) olarak bulunur ve her bir tür 0( ve [3
izoformlara sahiptir (Scott, Pharmacol. Ther. 1991;50:123). R alt birimleri, yalniz
kararli dimerler olarak izole edilmistir ve dimerizasyon alaninin, ilk 44 amino
terminal rezidüsünden olustugu gösterilmistir (Newlon v.d., Nat. Struct. Biol. 1999;
6222). CAMP'nin R alt birimlerine baglanmasi, PKA'nin AKAP'lar ile kenetlenmesi
araciligiyla bölümlendirilmesi yoluyla seçilen substratlara dogru yönelen
serin/treonin kinaz etkinliklerinin genis bir spektrumu için aktif katalitik alt birimlerin
Birinci AKAP, mikrotübül ile iliskili protein-2 ilk olarak 1984 yilinda karakterize
membrani, aktin sitoiskelet, nükleus, mitokondri ve endoplazmik retikulum dahil
olmak üzere çesitli alt hücre alanlarina lokalize olan 50'den fazla AKAP, mayadan
insanlara kadar birçok türde çesitli yapilarda tanimlanistir (Wong ve Scott, Nat.
asit dizilimleri, münferit AKAP'Iar arasinda oldukça çesitlilik gösterir ve Rll
dimerleri için baglanma afinitelerinin 2 ila 90 nM arasinda degistigi bildirilmistir
yalniz dimerik R alt birimlerine baglanacaktir. Insan Rlloi için, AD, 23 amino-
terminal rezidüsü tarafindan olusturulan bir hidrofobik yüzeye baglanir (Colledge
ve Scott, Trends Cell Biol. 1999; 62216). Bu nedenle, insan Rlloi için dimerizasyon
alani ve AKAP baglanma alani, ayni N-terminal 44 amino asit dizilimi içinde
konumlanir (Newlon v.d., Nat. Struct. Biol. 1999;6:222; Newlon v.d., EMBO J.
Bundan sonra A ve B olarak adlandirilacak olan ve disülfit baglarin olusumunu
kolaylastirmak için stratejik pozisyonlarda hem DDD hem de AD'ye sistein
rezidüleri eklenmesi yoluyla kararli bir sekilde baglanmis bir yapiya da
kilitlenebilen herhangi iki varligin kovalent olmayan bir komplekse kenetlenmesi
için mükemmel bir baglayici modülü çifti olarak belirli bir amino asit diziliminin
AD'si ve insan Rlloi DDD'sinden faydalanan bir platform teknolojisi gelistirdik.
varligi, bir A öncülüne bir DDD dizilimi baglanmasi yoluyla yapilandirilir ve bundan
sonra a olarak anilacak olan birinci bir bilesen ortaya çikar. DDD dizilimi, bir
dimerin spontan olusumunu gerçeklestirecegi için, A, a21den olusacaktir. B varligi,
bir B öncülüne bir AD dizilimi baglanmasi yoluyla yapilandirilir ve bundan sonra b
olarak anilacak olan ikinci bir bilesen ortaya çikar. a2 içinde yer alan DDD*nin
dimerik motifi, b içinde yer alan AD dizilimine baglanma için bir kenetlenme bölgesi
olusturacaktir ve böylece a2b*den olusan ikili, trimerik bir kompleks olusturmak için
32 ve b'nin kolayca birlesmesini kolaylastiracaktir. Bu baglanma olayi, disülfit
köprüler araciligiyla iki varligin kovalent olarak sabitlenmesi için müteakip bir
reaksiyon ile geri çevrilemez hale getirilir ve baslangiçtaki baglanma etkilesimleri,
hem DDD hem de AD üzerine yerlestirilen reaktif tiyol gruplarini bölgeye özgü
baglanma için yakina getirmesi gerektigi için, bu baglanma olayi etkili lokal
konsantrasyon ilkesine göre çok verimli bir sekilde gerçeklesir (Chimura v.d., Proc.
DDD ve AD, iki öncülün fonksiyonel gruplarindan uzaga eklenerek, bu bölgeye
özgü baglanmalarin, iki öncülün orijinal etkinliklerini korumasi da beklenir. Bu
yaklasim, niteligi itibariyle modülerdir ve potansiyel olarak, peptitler, proteinler,
antikorlar, antikor parçalari ve çok genis bir etkinlik araligina sahip baska efektör
gruplar dahil olmak üzere, çok çesitli maddelere bölgeye özgü ve kovalent olarak
baglanma için uygulanabilir. AD ve DDD konjuge efektörleri yapilandirmaya
yönelik füzyon proteini yöntemi kullanilarak, bir DNL yapisina neredeyse her türlü
protein ya da peptit eklenebilir. Ancak, bu teknik, sinirlayici degildir ve baska
konjugasyon yöntemleri de kullanilabilir.
Füzyon proteinleri üretmek için, nükleik asit sentezi, melezleme ve/veya ilgili bir
füzyon proteinini kodlayan sentetik çift sarmalli bir nükleik asit üretmek için
amplifikasyon dahil olmak üzere çesitli yöntemler bilinmektedir. Bu tür çift sarmalli
nükleik asitler, standart moleküler biyoloji teknikleri ile füzyon proteini üretimi için
ekspresyon vektörlerine eklenebilir (ör., bkz: Sambrook v.d., Molecular Cloning, A
ve/veya DDD grubu, bir antikor ya da parçasi gibi bir efektör protein ya da peptidin
N-terminal ya da C-terminal ucuna eklenebilir. Ancak, teknikte yetkin kisiler, bir AD
ya da DDD grubunun bir efektör grubuna baglanma bölgesinin, efektör grubunun
kimyasal niteligine ve fizyolojik etkinligine dahil olan efektör grubunun parça(lar)ina
bagli olarak degisiklik gösterebilecegini takdir edecektir. Çesitli efektör gruplarinin
bölgeye özgü baglanmasi, çift degerlikli çapraz baglanma reaktifleri ve/veya baska
kimyasal konjugasyon teknikleri gibi, teknikte bilinen yöntemler kullanilarak
gerçeklestirilebilir.
Tercih edilen bir somut örnekte, füzyon proteinleri, örnegin asagidaki çalismalarda
açiklanan kenetleme ve kilitleme (DNL) teknikleri ile düzenlenebilir: Rossi EA, v.d.,
Sentetik kompleksler olusturmak için DNL yönteminde kullanilabilen örnek DDD ve
AD dizilimleri asagida açiklanmistir.
SHIQlPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA (SEQ lD No:1)
CGHlQlPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA (SEQ ID No:2)
QIEYLAKQIVDNAIQQA (SEO ID No:3)
CGQlEYLAKQIVDNAlQQAGC (SEQ lD No:4)
DNL Dizilim Varyantlari
Alternatif somut örneklerde, AD ve/veya DDD gruplarinin dizilim varyantlari, DNL
komplekslerinin yapisinda kullanilabilir. AD ve DDD alanlarinin yapi-fonksiyon
iliskileri, arastirma konusu olmustur. (Or., bkz: Burns-Hamuro v.d., 2005, Protein
Ornegin, Kinderman v.d. (2006), AD-DDD baglanma etkilesiminin kristal yapisini
incelemis ve insan DDD diziliminin, asagida SEQ lD NO: 1'de alti çizilen, dimer
olusumu ya da AKAP baglanmasinda önemli olan birtakim korunmus amino asit
rezid'uleri içerdigi sonucuna varmistir. (Bkz. Sekil 1, Kinderman v.d., 2006.)
Teknikte yetkin kisiler, DDD diziliminin dizilim varyantlarinin tasariminda, alti çizili
rezid'ulerden herhangi birinin degistirilmesinden kaçinilirken, dimerizasyon ve
AKAP baglanmasi için daha az kritik olan reziduler için konservatif amino asit
sübstitüsyonlari yapilabilecegini takdir edecektir.
Protein kinaz A'dan insan DDD dizilimi
SHIQlPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA (SEO lD NO:1)
Alto v.d. (
olarak adlandirilan bir RII seçici AD dizilimi tasarlamak için çesitli AKAP
proteinlerinin AD diziliminin biyoinformatik bir analizini yapmistir. AKAPIS dizilimi.
PKA'ya AKAP baglanmasinin bir peptit antagonisti olarak tasarlanmistir. AKAP-IS
diziliminde, sübstitüsyonlarin DDDiye baglanmayi azaltma egiliminde oldugu
rezid'uler, SEQ lD NO:3”te alti çizilerek vurgulanmistir.
AKAP-IS DIZILIMI
QlEYLAKQIVDNAIQQA (SEQ ID No:3)
Benzer sekilde, Gold (2006), Rl izoformuna kiyasla PKA'nin Rll izoformu için bes
kat daha yüksek seçicilik gösteren bir Süper AKAP-IS dizilimi (SEQ ID NO: 5)
gelistirmek için kristalografi ve peptit taramasi kullanmistir. Alti çizili rezidüler,
AKAP-IS dizilimine göre, Rlloi'nin DDD grubuna baglanmasini artiran amino asit
sübstit'üsyonlarinin pozisyonlarini göstermektedir. Bu dizilimde, N-terminal Q
rezid'usü, rezid'u numarasi 4 olarak ve C-terminal A rezid'üs'ü ise rezid'ü numarasi
olarak numaralandirilmistir. Rlloi için afiniteyi etkilemek için sübstit'usyon
2006). Belirli alternatif somut örneklerde, Süper AKAP-IS diziliminin, DNL yapilari
hazirlamak için AKAP-IS AD grubu için sübstitüe edilebilecegi düsünülmektedir.
AKAP-IS AD için sübstitüe edilebilen baska alternatif dizilimler, SEQ ID NO: 6-8'de
gösterilmektedir. AKAP-lS dizilimine göre s'übstitüsyonlarin alti çizilmistir. AKAP-IS
diziliminde (SEQ ID NO: 3) oldugu gibi, AD grubunun, SEQ ID NO: 4'te gösterildigi
sistein de içrebilecegi tahmin edilmektedir.
SüperAKAP-IS
QlEYVAKQIVDYAIHQA (SEQ ID No:5)
Alternatif AKAP dizilimleri
QlEYKAKQIVDHAlHQA (SEQ ID No:6)
QlEYHAKQlVDHAlHQA (SEQ ID No:7)
QlEYVAKQIVDHAlHQA (SEQ ID No:8)
Stokka v.d. (2006), SEQ ID NO: 9-11'de gösterilen PKA'ya AKAP baglanmasinin
peptit rakiplerini de gelistirmistir. Peptit antagonistleri, as Ht31 (SEQ ID No:9),
RIAD (SEQ ID NO:10) ve PV-38 (SEQ ID NO:11) olarak tasarlanmistir. Ht-31
peptit, PKA'nin RII izoformu için daha büyük afinite gösterirken, RIAD ve PV-38, Rl
için daha yüksek afinite göstermistir.
DLlEEAASRIVDAVlEQVKAAGAY (SEQ ID No:9)
LEQYANQLADQIlKEATE (SEQ ID NO:10)
FEELAWKIAKMlWSDVFQQC (SEQ ID NO:11)
Hundsrucker v.d. (2006), PKAiya AKAP baglanmasi için, PKA'nin RII formunun
DDDisine 0,4 nM kadar düsük bir baglanma sabitine sahip baska peptit rakipleri
gelistirmistir. Çesitli AKAP antagonistik peptitlerinin dizilimleri, Hundsrucker v.d.
çalismasinda Tablo 1rde verilmistir. Farkli AKAP proteinlerinin AD alanlari
arasinda yüksek oranda korunan rezid'üler, asagida AKAP IS dizilimine atifla alti
çizilerek gösterilmistir. Bu rezid'uler, C-terminal alanin rezid'üs'u ilavesiyle, Alto v.d.
(2003) tarafindan gözlemlenenlerle aynidir. (Bkz: SEKIL 4, Hundsrucker v.d.
(2006)). RII DDD dizilimi için özellikle yüksek afinitelere sahip olan peptit
antagonistlerinin dizilimleri, SEO ID NO: 12-14ite gösterilmistir.
QlEYLAKQIVDNAlQQA (SEO ID No:3)
AKAP7ö-wt-pep
PEDAELVRLSKRLVENAVLKAVQQY (SEO ID NO:12)
AKAP7ö-L304T-pep
PEDAELVRTSKRLVENAVLKAVQQY (SEQ ID NO:13)
AKAP7ö-L308D-pep
PEDAELVRLSKRDVENAVLKAVQQY (SEQ ID NO:14)
Carr v.d. (2001), insan ve insan disi proteinlerden farkli AKAP-baglanma DDD
dizilimleri arasindaki dizilim benzerligi derecesini incelemis ve DDD dizilimlerinde,
farkli DDD gruplari arasinda en yüksek oranda korunmus görünen rezid'uleri
belirlemistir. Bunlar, asagida, SEQ ID NO: 1'in insan PKA Rlloi DDD dizilimine
atifla alti çizilerek gösterilmistir. Ozellikle korunan reziduler. ayrica italik olarak
gösterilmistir. Rezid'uler, Kinderman v.d. (2006) tarafindan AKAP proteinlerine
baglanma için önemli oldugu belirtilenler ile örtüsmektedir ancak onlarla ayni
degildir.
SHIQlPPGLTELLOGYTVEVLRQQPPDLVEFAVEYFTRLREARA (SEQ lD No:1)
Teknikte yetkin kisiler, genel olarak, farkli proteinlerden DDD ve AD dizilimlerinde
yüksek oranda korunan amino asit dizilimlerinin, amino asit s'übstitüsyonlari
yaparken sabit kalmasi tercih edilebilecek olanlar oldugunu ve daha az korumali
rezidülerin ise bu belgede tarif edilen AD ve/veya DDD dizilimlerinin dizilim
varyantlarini 'üretmek için daha kolay bir sekilde çesitlendirilebilecegini takdir
edecektir.
Amino Asit S'übstitüsyonlari
Alternatif somut örneklerde, açiklanan yöntemler ve terkipler, bir ya da daha fazla
sübstitüe edilmis amino asit rezidüsüne sahip olan proteinler ya da peptitlerin
üretimini ve kullanimini içerebilir. Ornegin, DNL yapilari olusturmak için kullanilan
DDD ve/veya AD dizilimleri, yukarida anlatilan sekilde modifiye edilebilir.
Teknikte yetkin kisiler, genel olarak, amino asit sübstitüsyonlarinin tipik olarak, bir
amino asidin, nispeten benzer &özelliklere sahip olan baska bir amino asit ile
degistirilmesini içerdigini takdir edecektir (yani, konservatif amino asit
sübstitüsyonlari). Çesitli amino asitlerin özellikleri ve amino asit sübstit'üsyonunun
protein yapisi ve fonksiyonu 'üzerindeki etkisi, teknikte kapsamli çalismalar ve
bilgilerin konusu olmustur.
Ornegin, amino asitlerin hidropatik indeksi dikkate alinabilir (Kyte & Doolittle, 1982,
proteinin ikincil yapisina katkida bulunur ve bu da proteinin baska moleküller ile
etkilesimini tanimlar. Her bir amino aside, hidrofobikligi ve yük özelliklerine bagli
olarak bir hidropatik indeks atanir (Kyte & Doolittle, 1982); bunlar söyledir: izolbsin
asparajin (-3,5); Iizin (-3,9) ve arjinin (-4,5). Konservatif sübstit'üsyonlar yapilirken,
hidropatik indeksleri ± 2 dahilinde olan amino asitlerin kullanimi tercih edilir, ±
dahilinde olanlar daha çok tercih edilir ve ± 0,5 dahilinde olanlar daha da çok tercih
Amino asit sübstitüsyonu, amino asit rezidüsünün hidrofilisitesini de dikkate alabilir
(ön, ABD Pat. No. 4,554,101). Amino asit rezidi'ilerine hidrofilisite degerleri
atanmistir: arjinin (+3,0); Iizin (+3.,0); aspartat (+3,0); glutamat (+3,0); serin (+O,3);
(-1,8); tirozin (-2,3); fenilalanin (-2,5); triptofan (-3,4). Amino asitlerin benzer
hidrofilisiteye sahip baskalari ile degistirilmesi tercih edilir.
Diger hususlar, amino asit yan zincirinin boyutunu içerir. Örnegin, bir amino asidin,
glisin ya da serin gibi kompakt bir yan zincire sahip bir amino asit ile ya da ör.,
triptofan a da tirozin gibi yigin bir yan zincire sahip bir amino asit ile degistirilmesi
genel olarak tercih edilmez. Çesitli amino asit rezidülerinin protein ikincil yapisi
rezidülerinin, protein alanlarinin alfa-sarmal, beta-katman ya da ters dönüslü ikincil
yapiyi benimseme egilimi üzerindeki etkisi belirlenmistir ve teknikte bilinmektedir
Bu tür hususlara ve kapsamli ampirik çalismaya göre, konservatif amino asit
sübstitüsyonlarinin tablolari olusturulmustur ve teknikte bilinmektedir. Ornegin:
arginin ve Iizin; glutamat ve aspartat; serin ve treonin; glutamin ve asparagin; ve
valin, Iösin ve izol'osin. Alternatif olarak: Ala (A) Ieu; ile, val; Arg (R) gln, asn, Iys;
Asn (N) his, asp, Iys, arg, gln; Asp (D) asn, glu; Cys (C) ala, ser; Gin (Q) glu, asn;
Glu (E) gln, asp; Gly (G) ala; His (H) asn, gln, Iys, arg; Ile (I) val, met, ala, phe, leu;
Leu (L) val, met, ala, phe, ile; Lys (K) gln, asn, arg; Met (M) phe, ile, Ieu; Phe (F)
trp, phe, thr, ser; Val (V) ile, leu, met, phe, ala.
Amino asit sübstitüsyonlari için diger hususlar, rezidünün bir proteininin içinde
konumlaniyor olup olmadigi ya da çözücüye maruz birakip birakilmadigidir. Dahili
rezidüler için, konservatif sübstitüsyonlar asagidakileri içerecektir: Asp ve Asn; Ser
ve Thr; Ser ve Ala; Thr ve Ala; Ala ve Gly; Ile ve Val; Val ve Leu; Leu ve Ile; Leu
ve Met; Phe ve Tyr; Tyr ve Trp. (Or., bkz: rockefelleredu adresinde PROWL web
sitesi) Çözücüye maruz birakilmis rezidüler için, konservatif sübstitüsyon sunlari
içerecektir: Asp ve Asn; Asp ve Glu; Glu ve Gln; Glu ve Ala; Gly ve Asn; Ala ve
Pro; Ala ve Gly; Ala ve Ser; Ala ve Lys; Ser ve Thr; Lys ve Arg; Val ve Leu; Leu ve
ile; ile ve Val; Phe ve Tyr. (Yukarida belirtilen çalisma) Amino asit
sübstitüsyonlarinin seçimine yardim etmek için, PAM25O puanlama matrisi,
Dayhoff matrisi, Grantham matrisi, McLachlan matrisi, Doolittle matrisi, Henikoff
matrisi, Miyata matrisi, Fitch matrisi, Jones matrisi, Rao matrisi, Levin matrisi ve
Risler matrisi gibi çesitli matrisler yapilandirilmistir (Yukarida belirtilen çalisma).
Amino asit sübstitüsyonlari belirlenirken, pozitif yüklü rezidüler (ör, His, Arg, Lys)
ve negatif yüklü rezidüler ('or., Asp, Glu) arasinda iyonik baglar (tuz köprüleri)
olusumu ya da yakin sistein rezidüleri arasinda disülfit baglarin olusumu gibi
moleküller arasi ya da molekül içi baglarin varligi da dikkate alinabilir.
kodlanmis bir protein diziliminde herhangi bir amino asidi, herhangi bir baska
amino asit için sübstitüe etme yöntemleri teknikte bilinmektedir ve yetkin kisiler
için, örnegin bölgeye yönelik mutagenez teknigi ile ya da bir amino asit
sübstitüsyonu kodlayan ve bir ekspresyon vektörü yapisinda birlestiren
oligonükleotitlerin sentezi ve düzenlenmesi ile rutin bir deney konusudur.
Avimerler
Belirli somut örneklerde, bu belgede tarif edilen baglanma gruplari, bir ya da daha
fazla avimer dizilimi içerebilir. Avimerler, afiniteleri ve çesitli hedef moleküller için
spesifisiteleri bakimindan antikorlara benzeyen bir baglanma proteini sinifidir.
Bunlar, in vitro ekson karistirma ve faj görüntüleme ile insan ekstraselüler reseptör
Silverman v.d., 2006, Nat. Biotechnol. 24:220.) Ortaya çikan çok alanli proteinler,
tek epitoplu baglanma proteinlerine göre gelismis afinite (bazi durumlarda sub-
nanomolar) ve spesifisite sergileyebilen birden çok bagimsiz baglanma alani
içerebilir. (Yukarida belirtilen çalisma) Çesitli somut örneklerde, avimerler, örnegin,
istemlerin yöntemleri ve terkiplerinde kullanim için DDD ve/veya AD dizilimlerine
eklenebilir. Avimerleri yapilandirma ve kullanma yöntemleri ile ilgili ilave ayrintilar
Faj Görüntüleme
istemlerin terkipleri ve/veya yöntemlerinin belirli somut örnekleri, çesitli hedef
moleküller, hücreler ya da dokularin baglayici peptitleri ve/veya peptit mimetikleri
ile ilgili olabilir. Baglayici peptitler, sinirlama olmaksizin faj görüntüleme teknigi
dahil olmak üzere teknikte bilinen herhangi bir yöntem ile belirlenebilir. Çesitli faj
görüntüleme yöntemleri ve çesitli peptit popülasyonlarini üretme teknikleri, teknikte
kütüphanesi hazirlama yöntemlerini açiklamaktadir. Faj görüntüleme teknigi,
bakteriyofajin genetik olarak manipüle edilmesini, böylece küçük peptitlerin,
bunlarin yüzeylerinde eksprese edilebilmesinin saglanmasini içerir (Smith and
21:228-257). Peptitlere ek olarak, tek zincirli antikorlar gibi büyük protein alanlari
da faj parçaciklarinin yüzeyinde görüntülenebilir (Arap v.d., 1998, Science
279z377-380).
Belirli bir organ, doku, hücre tipi ya da hedef molekül için seçici olan hedefleyici
amino asit dizilimleri, kaydirma yoluyla izole edilebilir (Pasqualini ve Ruoslahti,
162). Kisacasi, varsayilan hedefleyici peptitleri içeren bir faj kütüphanesi, intakt bir
organizmaya ya da izole edilmis organlara, dokulara, hücre tiplerine ya da hedef
moleküllere uygulanir ve bagli faji içeren örnekler toplanir. Bir hedefe baglanan faj,
bir hedef organ, doku, hücre tipi ya da hedef molekülden ayrilabilir ve ardindan
konak bakteride büyütülerek amplifiye edilebilir.
Bazi somut örneklerde, faj, kaydirma turlari arasinda konak bakterilerde
çogaltilabilir. Bakteriler, faj tarafindan parçalanmak yerine, belirli bir eki gösteren
birden çok faj kopyasi salgilayabilir. istenirse, amplifiye edilen faj, hedef organlar,
dokular, hücre tipleri ya da hedef moleküle tekrar maruz birakilabilir ve ilave
kaydirma turlari için toplanabilir. Bir seçici ya da spesifik baglayicilar popülasyonu
elde edilene kadar birden çok kaydirma turu gerçeklestirilebilir. Peptitlerin amino
asit dizilimi, faj genomunda hedefleyici peptit ekine karsilik gelen DNA'nin
sekanslanmasi yoluyla belirlenebilir. Belirlenen hedefleyici peptit, daha sonra,
standart protein kimyasi teknikleri ile sentetik bir peptit olarak üretilebilir (Arap v.d.,
1998, Smith v.d., 1985).
Bazi somut örneklerde, arka plan faj baglanmasini daha da azaltmak için bir
çikarma protokolü kullanilabilir. Çikarmanin amaci, Ilgilenilen hedef disinda
hedeflere baglanan fajin kütüphaneden çikarilmasidir. Alternatif somut örneklerde,
faj kütüphanesi, bir kontrol hücresi, dokusu ya da organi için önden taranabilir.
Ornegin, tümör baglayici peptitler, bir kütüphanenin bir kontrol normal hücre çizgisi
için önden taranmasi sonrasinda belirlenebilir. Çikarma isleminden sonra,
kütüphane, ilgili molekül, hücre, doku ya da organ için taranabilir. Ornegin ABD
çikarma protokollerinin baska yöntemleri de bilinmektedir ve bu yöntemler,
istemlerin yöntemlerinin uygulamasinda kullanilabilir.
Aptamerler
Belirli somut örneklerde, kullanilabilecek bir hedefleyici grup, bir aptamer olabilir.
Aptamerlerin baglanma özelliklerini yapilandirma ve belirleme yöntemleri teknikte
ABD Patent dokümanlarinda tarif edilmektedir. Ilgili özel hedeflere baglanan
aptamerleri hazirlama ve tarama yöntemleri iyi bilinmektedir; Örnegin ABD Pat. No.
Aptamerler, sentetik, rekombinant ve saflastirma yöntemleri dahil olmak üzere
bilinen herhangi bir yöntemle hazirlanabilir ve tek baslarina ya da ayni hedefe
özgü baska ligandlar ile birlikte kullanilabilir. Genel olarak, spesifik baglanmayi
gerçeklestirmek için yaklasik 3 nükleotit, tercihen en az 5 nükleotit gerekir. 10
bazdan kisa dizilimli aptamerler elverisli olabilir ama yine de 10, 20, 30 ya da 40
n'ukleotitli aptamerler tercih edilir.
Aptamerler, klasik DNA ya da RNA molekülleri gibi izole edilebilir, sekanslanabilir
ve/veya amplifiye edilebilir. Alternatif olarak, ilgili aptamerler, modifiye edilmis
oligomerler içerebilir. Aptamerlerde normal olarak bulunan hidroksil gruplarindan
herhangi biri, fosfonat gruplari, fosfat gruplari ile degistirilebilir, standart bir koruma
grubu ile korunabilir ya da baska nükleotitlere ilave baglantilar hazirlamak için
etkinlestirilebilir ya da kati desteklere konjuge edilebilir. Bir ya da daha fazla
fosfodiester baglantisi, P(O)S, P(O)NR2, P(O)R, P(O)OR', CO ya da CNR2 ile
degistirilmis P(O)O gibi alternatif baglanti gruplari ile degistirilebilir, ki burada R, H
araciligiyla komsu nükleotitlere baglanabilir. Bir oligomerdeki t'um baglantilar ayni
olmak zorunda degildir.
Konjugasyon Protokolleri
Tercih edilen konjugasyon protokolü, nötr ya da asidik pH degerinde kolay olan bir
tiyoI-maleimide, bir tiyoI-vinilsulfone, bir tiyoI-bromoasetamit ya da bir tiyol-
iyodoasetamit reaksiyonuna dayanir. Bu, konjugasyon için, örnegin aktif esterler
kullanilirken gereken yüksek pH kosullarina olan ihtiyaci ortadan kaldirir. Ayrica,
örnek konjugasyon protokollerinin ayrintilari, asagida Ornekler kisminda tarif
edilmistir.
Terapötik Tedavi
Baska bir yönde, bulus, istemlerde tanimlanan bulusun konjugati ile ilgili olup, bu
konjugat, terapötik konjugatin terapötik olarak etkili bir miktarinin bir denege tatbik
edilmesini içeren, bir denegi tedavi etme yönteminde kullanima yöneliktir. Bu
belgede tarif edilen terapötik konjugatlar ile tedavi edilebilecek hastaliklar
arasinda, sinirlama olmaksizin, B hücresi habislikleri (örnegin non-Hodgkin
Patent No. 6.183.744), endodermal türevli sindirim sistemi epiteli
adenokarsinomalari, gögüs kanseri, küçük hücreli olmayan akciger kanseri gibi
kanserler ve diger karsinomlar, sarkomalar, gliyal tümörler, miyeloid lösemiler, etc.
yer alir. Ozellikle, ör., bir gastrointestinal, akciger, gögüs, prostat, yumurtalik,
testis, beyin ya da Ienfatik tümör, bir sarkoma ya da bir melanoma gibi habis bir
kati tümör ya da hematopoietik neoplazm tarafindan üretilen ya da onunla iliskili
olan, ör., bir onkofetal antijen gibi bir antijene karsi antikorlar avantajli bir sekilde
kullanilir. Bu tür terapötikler, hastalik durumuna ve konjugatin tolere edilebilirligine
bagli olarak bir kez ya da tekrarli olarak verilebilir ve ayni zamanda, ameliyat,
harici radyasyon, radyoimmünoterapi, immünoterapi, kemoterapi, antisens terapi,
interferans RNA terapisi, gen terapisi ve benzerleri gibi baska terapötik modeller
ile birlikte de optimal bir sekilde kullanilabilir. Her bir kombinasyon, tümör tipi,
safhasi, hastanin durumu ve önceki tedavisi ve hekim tarafindan degerlendirilen
baska faktörlere uyarlanacaktir.
Bu belgede kullanildigi üzere, “denek” terimi, insanlar dahil olmak üzere,
memeliler dahil her türlü hayvani (yani, omurgalilar ve omurgasizlar) ifade eder.
Terimin belirli bir yas ya da cinsiyetle sinirlanmasi amaçlanmamaktadir. Bu
nedenle, erkek ya da disi eriskin ve yeni dogmus denekler ile fetüsler, terimin
kapsaminda girmektedir.
Tercih edilen bir somut örnekte, Mu-9 MAb içeren terapötik konjugatlar, 6.962.702
ve 7.387.772 sayili ABD patent dokümanlarinda açiklanan sekilde kolorektal
kanser ve pankreas ve yumurtalik kanserlerinin tedavi edilmesi için kullanilabilir.
sayili ABD patent dokümanlarinda açiklanan pankreas kanserinin tedavi edilmesi
için kullanilabilir.
Baska bir tercih edilen somut örnekte, RS7 MAb içeren terapötik konjugatlar (epitel
glikoprotein-1 [EGP-1] antijen), 7.238.785 sayili ABD Patent dokümaninda
açiklanan sekilde, akciger, mide, idrar kesesi, gögüs, yumurtalik, rahim ve prostat
karsinomlari gibi karsinomlari tedavi etmek için kullanilabilir.
Tercih edilen baska bir somut örnekte, anti-AFP MAb içeren terapötik konjugatlar,
hepatoselüler karsinom, germ hücresi tümörleri ve diger AFP üreten tümörleri,
7.300.655 sayili ABD Patent dokümaninda açiklanan sekilde hümanize edilmis,
kimerik ve insan antikor formlari kullanarak tedavi etmek için kullanilabilir.
Tercih edilen baska bir somut örnekte, anti-tenassin antikorlari içeren terapötik
konjugatlar, hematopoietik ve kati tümörleri tedavi etmek için kullanilabilir ve
tenassin'e karsi antikorlar içeren konjugatlar, kati tümörleri, tercihen
gliyoblastomlar gibi beyin kanserlerini tedavi etmek için kullanilabilir.
Tercih edilen bir somut örnekte, insan hastaliginin tedavisinde kullanilan
antikorlar, antikorlarin insan ya da hümanize edilmis (CDR greftli) versiyonlaridir;
ama antikorlarin mürin ve kimerik versiyonlari da kullanilabilir. Immün tepkileri en
aza indirmek için teslim ajanlari olarak en çok ayni tür IgG molekülleri tercih edilir.
Bu, tekrarli tedaviler düsünüldügünde özellikle önemlidir. Insanlar için, bir insan ya
da hümanize edilmis lgG antikorunun, hastalarda bir anti-lgG immün tepkisi
olusturma ihtimali düsüktür. hLL1 ve hLL2 gibi antikorlar, hedef hücreler üzerinde
içsellesen antijene baglanma sonrasinda hizli bir sekilde içsellesir ki bu da
kemoterapötik ilacin, hücrelerde de hizli içsellestigi anlamina gelir. Bununla
birlikte, seçici terapiyi gerçeklestirmek için daha yavas içsellesme oranlarina sahip
olan antikorlar da kullanilabilir.
Patojenlere karsi antikorlar bilindigi için, terapötik konjugatlarin patojenlere karsi
kullanilabilecegi açiklanmistir. Ornegin, bakteri, rickettsia, mikoplazma, protozoa,
mantar ve virüsler gibi patojenlerin neden oldugu viral, bakteriyel, fungal ve
parazitik enfeksiyonlar dahil olmak üzere enfeksiyonlu lezyonlar ve antijenler ve bu
tür mikroorganizmalar ile iliskili ürünler tarafindan üretilen ya da bunlarla iliskili
olan markerleri spesifik olarak baglayan antikorlar ve antikor parçalari, diger
çalismalarin yani sira, su çalismalarda açiklanmistir: Hansen v.d., ABD Pat. No.
anilan çalisma. Tercih edilen bir somut örnekte, yukaridaki patojenler
asagidakilerden olusan grup içinden seçilir: 6.440.416 sayili ABD Patent
dokümaninda açiklandigi üzere; HlV virüsü, Mycobacterium tuberculosis,
Streptococcus agalactiae, methicillin-resistant Stafilococcus aureus, Legionella
pneumophilia, Streptococcus pyogenes, Esoherichia coli, Neisseria gonorrhosae,
Neisseria meningitidis, Pneumococous, Cryptococcus neoformans, Histoplasma
capsulatum, Hemophilis influenzae B, Treponema pallidum, Lyme disease
spirochetes, Pseudomonas aeruginosa, Mycobacterium leprae, Brucella abortus,
kuduz virüsü, grip virüsü, sitomegalovirüs, herpes simplex virüsü I, herpes simplex
virüsü ll, insan serum parvo benzeri virüs, respiratuar sinsisyal virüs, varicella-
zoster virüsü, hepatit B virüsü, hepatit C virüsü, kizamik virüsü, adenovirüs, insan
T hücresi lösemi virüsleri, Epstein-Barr virüsü, mürin lösemi virüsü, kabakulak
virüsü, veziküler stomatit virüsü, sindbis virüsü, Ienfositik koriyomenenjit virüsü,
sigil virüsü, mavi dil virüsü, Sendai virüsü, kedigiller lösemi virüsü, reo virüs, polio
virüsü, simian virüsü 40, fare meme tümörü virüsü, denge virüsü, kizamikçik
virüsü, Bati Nil virüsü, Plasmodium falciparum, Plasmodium vivax, Toxoplasma
gondii, Trypanosoma rangeli, Trypanosoma cruzi, Trypanosoma rhodesiensei,
Trypanosoma brucei, Schistosoma mansoni, Schistosoma japanicum, Babesia
bovis, Eimeria tenella, Onchocerca volvulus, Leishmania tropica, Trichinella
spiralis, Theileria parva, Taenia hydatigena, Taenia ovis, Taenia saginata,
Echinococcus granulosus, Mesocestoides corti, Mycoplasma arthritidis, M.
hyorhinis, M. orale, M. arginini, Acholeplasma laidlawii, M. salivarium ve M.
pneumoniae.
Bu belgede açiklanan sekilde, anti-gp120 ve bu tür baska anti-HIV antikorlari
içeren ilaç konjugatlarinin, AIDS hastalarinda HlV için terapötik olarak
kullanilabilecegi ve Mycobacterium tuberculosis antikorlarinin ilaç konjugatlarinin,
ilaçla kirilan tüberküloz için terapötik olarak faydali oldugu açiklanmistir. Anti-
gp ve Pseudomonas ekzootoksin gibi bir toksinin füzyon
proteinleri, antiviral özellikleri bakimindan incelenmistir (Van Oigen v.d., J Drug
Target, 5:75-91, 1998) AIDS hastalarinda HIV enfeksiyonunu tedavi etme
denemeleri, muhtemelen yetersiz etkililik ya da kabul edilemez konak toksisitesi
nedeniyle basarisiz olmustur. Bu bulusun ilaç konjugatlari, avantajli bir sekilde
protein toksinlerin bu tür toksik yan etkilerini göstermemektedir ve bu nedenle
AlDS hastalarinda HlV enfeksiyonunun tedavi edilmesinde avantajli bir sekilde
kullanilmaktadir. Bu ilaç konjugatlari, tek baslarina ya da bu tür hastalara tek
basina verildiklerinde etkili olan baska antibiyotikler ya da terapötik ajanlar ile
birlikte verilebilir. Aday anti-HIV antikorlari, Johansson v.d. (AIDS. 3 Ekim
(Viyana, Avusturya) tarafindan tarif edilen ve satilan ve ayni zamanda 5.831.034
1773-9) tarafindan tarif edilen anti-HIV antikorlarini kapsar. HIV için tercih edilen
bir hedefleyici ajan, direncin üstesinden gelmek için bu antikorlarin çesitli
kombinasyonlaridir.
Bu bulusun tercih edilen somut örneklerinin terapötik konjugatlari kullanilarak
tedavi edilebilecek diger hastaliklara örnek olarak, asagidakiler dahil olmak üzere
immün bozukluk hastaligi ve ilgili otoimmün hastaliklar verilebilir: 1 Mart 2002
tarihinde verilmis olan (süresi dolmustur), 60/360.259 seri numarali ABD Geçici
Basvurusunda açiklanan sekilde; Sinif III otoimmün hastaliklar; örnegin immün
aracili trombositopeniler, örnegin akut idiyopatik trombositopenik purpura ve kronik
idiyopatik trombositopenik purpura, dermatomiyosit, Sjögren sendromu, multipl
skleroz, Sydenham kore, miyasteni gravis, sistemik Iupus eritematoz, Iupus nefrit,
romatik ates, poliglandular sendromlar, bülloz pemfigoid, diabetes mellitus,
Henoch-Schonlein purpura, post-streptokokkal nefrit, eritema nodosum, Takayasu
artiriti, Addison hastaligi, romatoid artrit, sarkoyidoz, ülseratif kolit, eritema
multiform, lgA nefropati, poliarteritis nodosa, ankilozan spondilit, Goodpasture
sendromu, tromboangitis obliterans, Sjogren sendromu, primer biliyer siroz,
Hashimoto tiroidi, tirotoksikoz, skleroderma, kronik aktif hepatit, romatoid artrit,
polimiosit/dermatomiyosit, polikondrit, pemfigus vulgaris, Wegener granulomatozu,
membranöz nefropati, amiyotropik lateral skleroz, tabes dorsalis, dev hücreli
arterit/ polimiyalji, habis anemi, hizli ilerleyen glomerulonefrit ve fibrozan alveolit ve
ayni zamanda gençlik diyabeti. Bu hastaliklarda faydali olan tipik antikorlara örnek
olarak, sinirlama olmaksizin, HLA-DR antijenleri, B hücresi ve plazma hücresi
MUC1, la, HM, lL-6, lL-17. Bu otoimmün hastaliklarin çogu,
anormal B hücresi popülasyonlari tarafindan olusturulan oto-antikorlar tarafindan
gerçeklestirildigi için, bu B hücrelerinin, bu belgede tarif edilen antikor-terapötik
ajan konjugatlarini içeren terapötik konjugatlar tarafindan tüketilmesi, özellikle de
B hücresi antikorlarinin belirli durumlarda HLA-DR antikorlari ve/veya T hücresi
antikorlari (anti-TAC antikoru gibi, bir antijen olarak IL-2Jyi hedef alanlar dahil
olmak üzere) ile birlestirilmesi durumunda otoimmün hastalik terapisinin tercih
edilen bir y'ontemidir. Tercih edilen bir somut 'örnekte, anti-B hücresi, anti-T hücresi
ya da anti-makrofaj ya da otoimmün hastaliklari olan hastalarin tedavisinde
kullanilabilen bu tür baska antikorlar da söz konusu otoimmün hastaliklara dahil
olan konak tepkilerini kontrol altina almak için daha etkili terap'otiklere yol açacak
sekilde konjuge edilebilir ve tek baslarina ya da TNF inhibitörleri ya da TNF
antikorlari, konjuge olmayan B ya da T hücresi antikorlari ve benzerleri gibi baska
terapötik ajanlar ile birlikte verilebilir.
Tercih edilen bir somut örnekte, çok degerlikli, multispesifik ya da çok degerlikli,
monospesifik antikorlar kullanilarak hücrelere ve patojenlere daha etkili eklenme
saglanabilir. Bu tür çift degerlikli ve bispesifik antikorlarin örnekleri, 7.387.772,
Bu çok degerlikli ya da multispesifik antikorlar, birden çok antijen hedefi ve hatta
ayni antijen hedefinin birden çok epitopunu eksprese eden ancak çogunlukla
hücrede ya da patojende tek bir antijen hedefinin yetersiz ekspresyonu ya da
mevcudiyeti nedeniyle antikor hedeflemesinden ve immünoterapi için yeterli
baglanmadan kaçan kanserler ve enfeksiyonlu organizmalarin (patojenlerin)
hedeflenmesinde `özellikle tercih edilir. Söz konusu antikorlar, birden çok antijen ya
da epitopu hedefleyerek, hedef üzerinde daha yüksek baglanma ve kalma süresi
gösterir, böylece bu bulusta hedeflenen ilaç ile daha yüksek Çözünme saglar.
Tercih edilen baska bir somut örnekte, bu bulusun kamptotesin konjugati ile birlikte
kullanilan bir terapötik ajan, bir ya da daha fazla izotop içerebilir. Hastalikli dokuyu
tedavi etmek için faydali olan radyoaktif izotoplar, sinirlama olmaksizin sunlari
211Pb. Terap'otik radyonüklit, bir Auger yayici için tercihen, 20 ila 6.000 kEV
keV araliginda ve alfa yayici için 4.000 ila 6.000 keV araliginda bir bozunma
enerjisine sahiptir. Faydali beta parçacigi yayan nüklitlerin maksimum bozunma
enerjileri tercihen 20 ila 5.000 keV arasinda, daha çok tercih edilen sekilde 100 ila
Ayni zamanda, Auger yayan parçaciklar ile büyük oranda bozunan radyon'uklitler
nüklitlerin bozunma enerjileri tercihen <1.000 keV, daha çok tercih edilen sekilde
<100 keV ve en çok tercih edilen sekilde <70 keV'dir. Ayni zamanda, alfa
parçaciklari olusumu ile büyük oranda bozunan radyonüklitler de tercih edilir. Bu
tür radyonuklitler, sinirlama olmaksizin sunlari içerir: Dy-152, At-21 1, Bi-212, Ra-
alfa parçacigi yayan radyonüklitlerin bozunma enerjileri tercihen 2.000 ila 10.000
keV arasinda, daha çok tercih edilen sekilde 3.000 ila 8.000 keV arasinda ve en
çok tercih edilen sekilde 4.000 ila 7.000 keV arasindadir. Kullanilan ilave
Radyon'üklitler ve diger metaller, örnegin bir antikor ya da konjugata bagli selasyon
gruplari kullanilarak teslim edilebilir. NOTA, DOTA ve TETA gibi makrosiklik
selatlar, çesitli metaller ve radyometaller, özellikle de sirasiyla galyum, itriyum ve
bakir radyonüklitleri ile faydalidir. Bu tür metal-selat kompleksleri, halka boyutunun
ilgili metale ayarlanmasi ile çok kararli hale getirilebilir. 223Ra kompleksi için
makrosiklik polieterler gibi baska halka tipi selatlar kullanilabilir.
Bu belgede tarif edilen kamptotesin konjugatlari ile birlikte kullanilan terapötik
ajanlar, örnegin, vinka alkaloidler, antrasiklinler, epidofillotoksinler, taksanlar,
antimetabolitler, alkilasyon ajanlari, antibiyotikler, Cox-2 inhibitörleri, antimitotikler,
antianiyogenikler ve proapoptik ajanlar, özellikle de doksorubisin, metotreksat,
taksol, diger kamptotesinler ve bu ve baska anti-kanser ajanlarindan digerleri ve
bunlarin benzerlerini gibi kemoterapötik ilaçlari da içerir. Diger kanser
kemoterapötik ilaçlari arasinda azot hardallari, alkil sülfonatlar, nitrosoüreler,
triazenler, folik asit analoglari, pirimidin analoglari, pürin analoglari, platin
koordinasyon kompleksleri, hormonlar ve benzerleri sayilabilir. Uygun
kemoterapötik ajanlar, “REMINGTONG PHARMACEUTICAL SClENCES, 19.
Baski. (Mack Publishing Co. 1995)” ve “GOODMAN AND GILMAN'S THE
PHARMACOLOGICAL BASIS OF THERAPEUTICS, 7. Baski. (Mac- Millan
Publishing Co. 1985)” ve bu yayinlarin revize edilmis baskilarinda tarif
edilmektedir. Deneysel ilaçlar gibi baska uygun kemoterapötik ajanlar, bu teknikte
uzman kisiler tarafindan bilinmektedir.
Kullanilabilen ilaçlarin örnekleri; 5-floroürasil, aplidin, azaribin, anastrozol,
anthrasiklinler, bendamustin, bleomisin, bortezomib, briyostatin-l, busülfan,
kalikeamisin, kampotesin, karboplatin, 10-hidroksikamp0tesin, karmustin,
selebreks, klorambusil, sisplatin (CDDP), Cox-2 inhibitörleri, irinotekan (CPT-11),
SN-38, karboplatin, kladribin, kamptotekanlar, siklofosfamit, sitarabin, dakarbazin,
dosetaksel, daktinomisin, daunorubisin, doksorubisin, 2- pirrolinodoksorubisin (2P-
DOX), siyano-morfolino doksorubisin, doksorubisin glukuronit, epirubisin
glukuronit, estramustin, epidofillotoksin, östrojen reseptör baglanma ajanlari,
etoposit (VP16), etoposit glukuronit, etoposit fosfat, floxuridine (FUdR), 335,-0-
dioleoyiI-FudR (FUdR-dO), fludarabin, flutamit, farnesiI-protein transferaz
inhibitörleri, gemsitabin, hidroksi'L'ire, idarubisin, ifosfamit, L-asparaginaz,
merkaptop'ürin, metotreksat, mitoksantron, mithramisin, mitomisin, mitotan,
navelbin, nitros'üre, plikomisin, prokarbazin, paklitaksel, pentostatin, PSI-341,
raloksifen, semustin, streptozosin, tamoksifen, taksol, temazolomit (sulu bir DTlC
formu), transplatinyum, talidomit, tiyoguanin, tiyotepa, teniposide, topotekan, 'ürasil
hardali, vinorelbin, bu belgede tarif edilen konjugatlari içerir ya da bunlar, alternatif
olarak, konjugat öncesinde, es zamanli olarak ya da sonrasinda, tarif edilen
konjugatlar ile birlikte tatbik edilebilir. Alternatif olarak, teknikte bilinen bir ya da
daha fazla terapötik çiplak antikor, tarif edilen konjugatlar ile birlikte kullanilabilir.
Terapötik çiplak antikorlarin örnekleri önceki bölümde tarif edilmistir.
Kamptotesin konjugatlari ile uyum içinde kullanilabilen terapötik ajanlar, ayni
zamanda, hedefleyici gruplara konjuge edilen toksinleri de içerebilir. Bu baglamda
kullanilabilen toksinler arasinda ricin, abrin, ribonükleaz (RNaz), DNaz I,
Stafilococcal enterotoksin-A, pokeweed antiviral protein, gelonin, diterin toksin,
Pseudomonas ekzotoksin ve Pseudomonas endotoksin yer alir. (On, bkz: Pastan.
v.d., Cell (1986), 47:641 ve Sharkey ve Goldenberg, CA Cancer J Clin. Tem-Agu
kisiler tarafindan bilinmektedir ve 6.077.499 sayili ABD Patentinde
açiklanmaktadir.
Terapötik ajanin baska bir sinifi, bir ya da daha fazla immunomodülatör içerebilir.
Kullanilan immunomodülatörler, bir sitokin, bir kök hücre büyüme faktörü, bir
(IFN), eritropoietin, trombopoietin ve bunlarin bir kombinasyonu arasindan
seçilebilir. Özel olarak faydali olanlar, tümör nekroz faktörü (TNF) gibi
faktör (G-CSF) ya da granülosit makrofaj-koloni uyarici faktör (GM-GSF) gibi
koloni uyarici faktörler, interferonlar -G, -B ya da -y gibi interferonlar ve “81 faktörü”
olarak belirtilen gibi kök hücre büyüme faktörüdür. Sitokinler arasinda sunlar yer
alir: insan büyüme hormonu, N-metionil insan büyüme hormonu ve bovin büyüme
hormonu gibi büyüme hormonlari; paratiroid hormonu; tiroksin; insülin; proinsülin;
relaksin; prorelaksin; glikoprotein hormonlari, örnegin folikül uyarici hormon (FSH),
tiroid uyarici hormon (TSH) ve Iüteinizasyon hormonu (LH); hepatik büyüme
faktörü; prostaglandin, fibroblast büyüme faktörü; prolaktin; plasental laktogen, OB
protein; tümor nekroz faktörü-a ve - ß; mullerian-inhibe edici madde; fare
gonadotropin ile iliskili peptit; inhibin; aktivin; vasküler endoteli büyüme faktörü;
integrin; trombopoietin (TPO); sinir büyüme faktörleri, örnegin NGF-ß; platelet
büyüme faktörü; dönüstürücü büyüme faktörleri (TGFiIer), örnegin TGF- 0( ve TGF-
ß; insülin benzeri büyüme faktörü-I ve -ll; eritropoietin (EPO); osteoindüktif
faktörler; interferonlar örnegin interferon-or, -B ve -v; koloni uyarici faktörler
(CSF'Ier), örnegin makrofaj-CSF (MCSF); interlökinler (IL'Ier), örnegin lL-1, lL-1oi,
trombospondin, endostatin, tümör nekroz faktörü ve LT. Bu belgede kullanildigi
üzere, sitokin terimi, dogal kaynaklardan ya da rekombinant hücre kültüründen
proteinleri ve natif dizilimli sitokinlerin biyolojik olarak aktif esdegerlerini kapsar.
Kullanilan kemokinler arasinda RANTES, MCAF, MlP1-alfa, MIP1-Beta ve IP-10
yer alir.
Formülasyon ve Tatbik
Konjugatlari tatbik etmek için uygun yollar arasinda, sinirlama olmaksizin, oral,
parenteral, rektal, transmukozal, intestinal tatbik, intramusküler, subkütanöz,
intramedüller, intratekal, dogrudan intravertiküler, intravenöz, intravitreal,
intraperitoneal, intranazal ya da intraoküler enjeksiyonlar yer alir. Tercih edilen
tatbik yolu, parenteral tatbiktir. Alternatif olarak, bilesik, sistemik degil lokal bir
sekilde, örnegin bilesigin dogrudan kati bir tümöre enjeksiyonu ile tatbik edilebilir.
Immunokonjugatlar, farmasötik olarak faydali terkipler hazirlamak için bilinen
yöntemlere göre formüle edilebilir ve immunokonjugat, farmasötik olarak uygun bir
yardimci madde ile bir karisim haline getirilir. Steril fosfat tamponlu salin,
farmasötik olarak uygun bir yardimci madde örnegidir. Baska uygun yardimci
maddeler teknikte iyi bilinmektedir. Ornegin, bkz: Ansel v.d., PHARMACEUTlCAL
DOSAGE FORMS AND DRUG DELIVERY SYSTEMS, 5. Baski (Lea & Febiger
1990) ve Gennaro (ed.), REMINGTONiS PHARMACEUTlCAL SCIENCES, 18.
Baski (Mack Publishing Company 1990) ve bunlarin revize edilmis baskilari.
Immunokonjugat, örnegin bolus enjeksiyon ya da sürekli enjeksiyon yoluyla
intravenöz tatbik için formüle edilebilir. Tercihen, bu bulusun antikoru, yaklasik 4
saatten kisa bir sürede infüze edilir ve daha çok tercih edilen sekilde, yaklasik 3
saat kisa bir sürede infüze edilir. Ornegin, birinci 25-50 mg, 30 dakika içinde,
tercihen 15 dakika içinde infüze edilebilir ve kalan miktar izleyen 2-3 saat içinde
infüze edilir. Enjeksiyon için formülasyonlar, birim dozaj formunda, örnegin
ampuller içinde ya da çok dozlu konteynirlar içinde, ilave koruyucu ile birlikte
sunulabilir. Terkipler, yagli ya da sulu araçlar içinde süspansiyonlar, çözeltiler ya
da emülsiyonlar seklini alabilir ve askida tutucu, kararlilastirici ve/veya dagitici
ajanlar gibi formüle edici ajanlar içerebilir. Alternatif olarak, etkin bilesen,
kullanimdan önce uygun bir araç, örnegin steril pirojensiz su ile yapilandirma için
toz seklinde olabilir.
Terapötik konjugatin etki süresini kontrol etmek için ilave farmasötik yöntemler
kullanilabilir. Kontrollü salimli preparatlar, immunokonjugati komplekse almak ya
da adsorbe etmek için polimerler kullanilarak hazirlanabilir. Ornegin, biyouyumlu
polimerler arasinda poli(etilen-ko-vinil asetat) matrisleri ve bir stearik asit dimeri ve
sebasik asit polianhidrür kopolimerinin matrisleri yer alir. Sherwood v.d.,
orani, immunokonjugatin molekül agirligina, immunokonjugatin matris içindeki
miktarina ve dagilan parçaciklarin boyutuna baglidir. Saltzman v.d., Biophys. J.
55: 163 (1989); Sherwood v.d., yukarida geçen çalisma. Diger kati dozaj formlari
su çalismalarda tarif edilmistir: Ansel v.d., PHARMACEUTICAL DOSAGE FORMS
AND DRUG DELlVERY SYSTEMS, 5. Baski (Lea & Febiger 1990) ve Gennaro
(ed), REMINGTON'S PHARMACEUTlCAL SCIENCES, 18. Baski (Mack
Publishing Company 1990) ve bunlarin revize edilmis baskilari.
Genel olarak, insanlar için tatbik edilen bir immunokonjugatin dozaji, hastanin
yasi, agirligi, boyu, cinsiyeti, genel tibbi durumu ve tibbi geçmisi gibi faktörlere
bagli olarak degisiklik gösterecektir. Aliciya, tek bir intravenöz infüzyon olarak
yaklasik mg/kg ila 25 mg/kg arasinda bir immunokonjugat dozaji verilmesi
istenebilir ancak kosullarin gereklerine göre daha düsük ya da daha yüksek dozaj
da uygulanabilir. 70 kg agirliginda bir hasta için 1-20 mg/kg'lik bir dozaj, örnegin,
gerektigi ölçüde tekrar edilebilir; Örnegin, 4-10 hafta boyunca haftada bir, 8 hafta
boyunca haftada bir ya da 4 hafta boyunca haftada bir olabilir. Sürdürme
terapisinde gerektigi sekilde, daha uzun araliklarla da verilebilir; 'örnegin birkaç ay
boyunca iki haftada bir ya da birkaç ay boyunca ayda bir ya da üç ayda bir olabilir.
Alternatif olarak, bir immunokonjugat, toplamda en az 3 dozaj tekrar edilmek
üzere, her 2 ya da 3 haftada bir dozaj olarak tatbik edilebilir. 4-6 hafta boyunca
haftada iki kez de tekrarlanabilir. Dozajin yaklasik 200-300 mg/mz'ye (1,7 m
boyunda bir hasta için dozaj basina 340 mg ya da 70 kg agirliginda bir hasta için
4,9 mg/kg) indirilmesi halinde, ilaç 4 ila 10 hafta boyunca haftada bir ya da hatta iki
kez tatbik edilebilir. Alternatif olarak, dozaj takvimi, 2-3 ay boyunca 2 ya da 3
haftada bir sefere düsürülebilir. Bununla birlikte, haftada bir kez 20 mg/kg ya da
her 2-3 haftada bir gibi daha da yüksek dozlarin, tekrarlanan doz döngüleri
boyunca, yavas i.v. infüzyon ile tatbik edilebildigi belirlenmistir. Doz takvimi, istege
bagli olarak, baska zaman araliklarinda tekrarlanabilir ve dozaj, doz ve takvimin
uygun sekilde ayarlanmasiyla çesitli parenteral yollardan verilebilir.
Istemlerde tanimlanan bulusa göre, immunokonjugatlar, kanser tedavisinde
kullanima yöneliktir. Kanserlere Örnek olarak, sinirlama olmaksizin, karsinom,
habislikler verilebilir. Daha özel olarak, bu tür kanserlerin belirli örnekleri asagida
verilmistir: skuamöz cell kanser (ör., epitel skuamöz hücre kanseri), Ewing
sarkomu, Wilms tümörü, astrositomlar, küçük hücreli akciger kanseri, küçük hücreli
olmayan akciger kanseri gibi akciger kanseri, akciger adenokarsinomu ve akciger
skuamöz karsinomu, periton kanseri, hepatoselüler kanser, gastrointestinal
kanser, dahil olmak üzere gastrik ya da mide kanseri, pankreatik kanser,
gliyoblastoma multiform, servikal kanser, yumurtalik kanseri, karaciger kanseri,
mesane kanseri, hepatoma, hepatoselüler karsinom, nöroendokrin tümörleri,
medüller tiroid kanseri, farklilasmis tiroid karsinomu, gögüs kanseri, yumurtalik
kanseri, kolon kanser, rektal kanser, endometriyal kanser ya da rahim karsinomu,
tükrük bezi karsinomu, böbrek ya da renal kanser, prostat kanseri, vulvar kanser,
anal karsinom, penil karsinom ve bas ve boyun kanseri. “Kanser” terimi, birincil
habis hücreler ya da tümörleri (ör., hücreleri, denegin vücudunda orijinal habislik
ya da tümörün alanindan baska alanlara göç etmemis olanlar) ve ikincil habis
hücreler ya da tümörleri (ör., habis hücrelerin ya da tümörlerin, orijinal tümör
alanindan farkli ikincil alanlara göçü olan metastazdan kaynaklananlar) kapsar.
Diger kanser ya da habislik örnekleri söyledir: Akut Çocukluk Lenfoblastik Lösemi,
Akut Lenfoblastik Lösemi, Akut Lenfositik Lösemi, Akut Miyeloid Lösemi,
Adrenokortikal Karsinom, Eriskin (Birincil) Hepatoselüler Kanser, Eriskin (Birincil)
Karaciger Kanseri, Eriskin Akut Lenfositik Lösemi, Eriskin Akut Miyeloid Lösemi,
Eriskin Hodgkin Lenfoma, Eriskin Lenfositik Lösemi, Eriskin Non-Hodgkin
Lenfoma, Eriskin Birincil Karaciger Kanseri, Eriskin Yumusak Doku Sarkomu,
AlDS Ile Iliskili Lenfoma, AlDS Ile Iliskili Habislikler, Anal Kanser, Astrositom, Safra
Kanali Kanseri, Mesane Kanseri, Kemik Kanseri, Beyin Kökü Gliyom, Beyin
Tümörleri, Gögüs Kanseri, Kanser of te Renal Pelvis ve Ureter, Merkezi Sinir
Sistemi (Birincil) Lenfomu, Merkezi Sinir Sistemi Lenfomu, Serebellar Astrositom,
Serebral Astrositom, Servikal Kanser, Çocukluk (Birincil) Hepatoselüler Kanseri,
Çocukluk (Birincil) Karaciger Kanseri, Çocukluk Akut Lenfoblastik Lösemisi,
Çocukluk Akut Miyeloid Lösemisi, Çocukluk Beyin Kökü Gliyomu, Çocukluk
Serebellar Astrositomu, Çocukluk Serebral Astrositomu, Çocukluk Ekstrakraniyal
Germ Hücresi Tümörleri, Çocukluk Hodgkin Hastaligi, Çocukluk Hodgkin Lenfomu,
Çocukluk Hipotalamik ve Görme Yolu Gliyomu, Çocukluk Lenfoblastik Lösemisi,
Çocukluk Medulloblastomu, Çocukluk Non-Hodgkin Lenfomu, Çocukluk Pineal ve
Supratentoriyal Primitif Nöroectodermal Tümörleri, Çocukluk Birincil Karaciger
Kanseri, Çocukluk Rabdomyosarkomu, Çocukluk Yumusak Doku Sarkomu,
Çocukluk Görme Yolu ve Hipotalamik Gliyom, Kronik Lenfositik Lösemisi, Kronik
Miyelogenöz Lösemi, Kolon Kanseri, Kutanöz T Hücresi Lenfomu, Endokrin
Pankreas Adacik Hücre Karsinomu, Endometrial Kanser, Ependimoma, Epitelyal
Kanser, Osofageal Kanser, Ewing Sarkomu ve Ilgili Tümörleri, Eksocrine
Pankreatik Kanser, Ekstrakraniyal Germ Hücresi Tümörü, Ekstragonadal Germ
Hücresi Tümörü, Ekstrahepatik Safra Kanali Kanseri, Göz Kanser, Disi Gögüs
Kanseri, Gaucher Hastaligi, Safra Kesesi Kanseri, Gastrik Kanser,
Gastrointestinal Karsinoid Tümörü, GastroIntestinal Tümörleri, Germ Hücresi
Tümörleri, Gestational Trofoblastik Tümörü, Tüylü Hücreli Lösemi, Bas ve Boyun
Kanser, Hepatoselüler Kanser, Hodgkin Lenfoma, Hipergammaglobulinemi,
Hipofaringeal Kanser, Intestinal Kanserler, Intraoküler Melanoma, Adacik Hücre
Karsinomu, Adacik Hücre Pankreatik Kanseri, Kaposi Sarkomu, Böbrek Kanseri,
Laringeal Kanser, Dudak ve Agiz Boslugu Kanseri, Karaciger Kanseri, Akciger
Kanseri, Lenfoproliferatif Bozukluklar, Makroglobulinemi, Erkek Gögüs Kanseri,
Habis Mezoteliyom, Habis Tiymom, Medulloblastom, Melanom, Mezotelyiom,
Metastatik Gizli Birincil Skuamöz Boyun Kanseri, Metastatik Birincil Skuamöz
Boyun Kanseri, Metastatik Skuamöz Boyun Kanseri, Multipl Miyelom, Multipl
Miyelom/Plazma Hücre Neoplazmi, Miyelodisplastik Sendrom, Miyelogenöz
Lösemi, Miyeloid Lösemi, Miyeloproliferatif Bozukluklar, Burun Bslugu ve
Paranazal Sinüs Kanseri, Nazofaringeal Kanser, Nöroblastom, Non-Hodgkin
Lenfoma, Nonmelanoma Cilt Kanseri, Küçük Hücreli Olmayan Akciger Kanseri,
Gizli Birincil Metastatik Skuamöz Boyun Kanseri, Orofaringeal Kanser, Osteo-
/Habis Fibröz Sarkoma, OsteoSarkoma/Habis Fibröz Histiyositom,
Osteosarkom/Habis Fibröz Emi Histiositomu, Yumurtalik Epitelyal Kanseri,
Yumurtalik Germ Hücresi Tümörü, Yumurtalik Düsük Habis Potansiyelli Tümörü,
Pankreatik Kanser, Paraproteinemi, Polisitemi vera, Paratiroid Kanseri, Penil
Kanser, Feokromositom, Hipofiz Tümörü, Birincil Merkezi Sinir Sistemi Lenfoma,
Birincil Karaciger Kanseri, Prostat Kanser, Rektal Kanser, Renal Hücre Kanseri,
Renal Pelvis ve Ureter Kanser, Retinoblastom, Rabdomiyosarkom, Tükürük Bezi
Kanseri, Sarkoidoz Sarkomlar, Sezary Sendromu, Cilt Kanseri, Küçük Hücreli
Akciger Kanseri, Küçük Bagirsak Kanseri, Yumusak Doku Sarkomu, Skuamöz
Boyun Kanseri, Mide Kanser, Supratentoriyal Primitif Nöroektodermal ve Pineal
Tümörleri, T Hücresi Lenfomu, Testiküler Kanser, Timom, Tiroid Kanseri, Renal
Pelvis ve Ureterde Geçici Hücreli Kanser, Geçici Renal Pelvis ve Ureter Kanseri,
Trofoblastik Tümörleri, Ureter ve Renal Pelvis Hücre Kanseri, Uretral Kanser,
Rahim Kanseri, Rahim Sarkomu, Vajinal Kanser, Görme Yolu ve Hipotalamik
Gliyom, Vulvar Kanser, Waldenstrom Makroglobulinemi, Wilms Tümörü ve
yukarida siralanan bir organ sisteminde bulunan neoplazi'nin yani sira her türlü
baska Hiperproliferatif Hastalik.
Bu belgede açiklanan yöntemler ve terkipler, habis ya da pre-habis rahatsizliklari
tedavi etmek için ve sinirlama olmaksizin yukarida tarif edilen bozukluklar dahil
olmak üzere neoplastik ya da habis bir duruma ilerlemeyi önlemek için
kullanilabilir. Bu tür kullanimlar, neoplazi ya da kansere ilerlemis oldugu bilinen ya
da süphesi bulunan durumlarda, özellikle de hiperplazi, metaplazi ya da daha özel
olarak displaziden olusan non-neoplastik hücre büyümesi gerçeklesen durumlarda
endikedir (bu tür anormal büyüme rahatsizliklarinin incelemesi için bkz: Robbins
ve Angell, Basic Pathology, 2. Baski., W. B. Saunders Co., Philadelphia, s. 68-79
(1976)).
Displazi, bir kanser habercisidir ve genel olarak epitelyum da bulunur. Non-
neoplastik hücre büyümesinin, münferit hücre bütünlügünde ve hücrelerin mimari
yöneliminde kayip içeren en düzensiz formudur. Dizplazi, karakteristik olaraki
kronik iritasyon ya da enflamasyon bulunan durumlarda meydana gelir. Tedavi
edilebilen displastik bozukluklar, sinirlama olmaksizin sunlari içerir: anhidrotik
ektodermal displazi, anterofasiyal displazi, bogucu torasik displazi, atriyodijital
displazi, bronkopulmoner displazi, serebral displazi, servikal displazi,
kondroektodermal displazi, kleidokraniyal displazi, kongenital ektodermal displazi,
kraniyodiafisiyal displazi, kraniyocarpotarsal displazi, kraniyometafisiyal displazi,
dentin displazi, diafisiyal displazi, ektodermal displazi, enamel displazi, ensefalo-
oftalmik displazi, displazi epifisiyalis hemimelia, displazi epifisiyalis multipleks,
displazi epifisiyalis punktata, epitelial displazi, fasiyodigitogenital displazi, ailesel
fibröz çene displazisi, ailesel beyaz katli displazi, fibromusküler displazi, fibröz
kemik displazisi, florür kemik displazisi, kalitsal renal-retinal displazi, hidrotik
ektodermal displazi, hipohidrotik ektodermal displazi, Ienfopenik timik displazi,
meme displazisi, mandibulofasiyal displazi, metafisiyal displazi, Mondini displazi,
monostotik fibröz displazi, mukoepitelial displazi, multipl epifisiyal displazi,
okuloaurikulovertebral displazi, okulodentodijital displazi, okulovertebral displazi,
odontogenik displazi, optalmomandibulomelik displazi, periapikal semental
displazi, poliostotik fibröz displazi, psödoakondroplastik spondiloepifisiyal displazi,
retinal displazi, septo-optik displazi, spondiloepifisiyal displazi ve ventrikuloradial
displazi.
Tedavi edilebilen baska pre-neoplastik bozukluklar, sinirlama olmaksizin sunlari
içerir: iyi huylu disproliferatif bozukluklar (ör., iyi huylu tümörler, fibrosistik
rahatsizliklar, doku hipertropisi, bagirsak polipleri ya da adenomlari ve özofageal
displazi), Iökoplasi, keratozlar, Bowen hastaligi, Farmer hastaligi, Cilt, solar siliti ve
solar keratoz.
Mevcut açiklamaya göre, bulusun yöntemi, yukarida sayilanlar basta olmak üzere,
kanserlerin büyümesini, ilerlemesini ve/veya metastazini inhibe etmek için
kullanilir.
Ilave hiperproliferatif hastaliklar, bozukluklar ve/veya rahatsizliklar, sinirlama
olmaksizin asagidakiler gibi habislikler ve ilgili bozukluklarin ilerlemesi ve/veya
metastazini kapsar: lösemi (including akut lösemiler (ör., akut Ienfositik lösemi,
akut miyelositik lösemi (including miyeloblastik, promiyelositik, miyelomonositik,
monositik ve eritrolösemi)) ve kronik Iösemiler (ör., kronik miyelositik (granulositik)
lösemi ve kronik lenfositik Iösemi)), polisitemi vera, Ienfomalar (ör., Hodgkin
hastaligi ve non-Hodgkin hastaligi), multipl miyelom, Waldenstrom
makroglobulinemi, agir zincir hastaligi ve sarkomlar ve karsinomlar dahil olmak
üzere kati tümörler, örnegin fibrosarkom, miyksosarkom, Iiposarkom,
kondrosarkom, osteogenik sarkom, kordoma, anjiyosarkom, endoteliyosarkom,
tümörü, Ieyomiyosarkom, rabdomiyosarkom, kolon karsinomu, pankreatik kanser,
gögüs kanseri, yumurtalik kanseri, prostat kanseri, skuamöz hücreli karsinom,
bazal hücreli karsinom, adenokarsinom, ter bezi karsinomi, yag bezi karsinomu,
papiller karsinom, papiller adenokarsinomlar, sistadenokarsinom, medüller
karsinom, bronkogenik karsinom, renal hücre karsinomu, hepatom, safra kanali
karsinomu, koryokarsinom, seminom, embriyonal karsinom, Wilm tümörü, servikal
kanser, testiküler tümörü, akciger karsinom, küçük hücreli akciger karsinomu,
mesane karsinomu, epitelyal karsinom, gliyom, astrositom, medulloblastom,
kraniyofarinjiyom, ependimom, pinealom, emanjiyoblastom, akustik nöroma,
oligodendrogliyom, meninjiyom, melanom, nöroblastom ve retinoblastoma.
Kitler
Ayni zamanda, bir hastada hastalikli dokunun tedavi edilmesi için uygun olan
bilesenler içeren setler de açiklanmaktadir. Ornek setler, en az bir konjuge antikor
ya da bu belgede tarif edilen sekilde baska hedefleyici grubu içerebilir. Tatbike
yönelik bilesenler içeren terkibin, sindirim yolundan teslim, Örnegin oral teslim için
formüle edilmis olmamasi halinde, set bilesenlerini baska yollardan teslim edebilen
bir cihaz dahil edilebilir. Parenteral teslim gibi uygulamalar için bir cihaz türü,
terkibin bir denegin vücuduna enjekte edilmesi için kullanilan bir enjektördür.
Inhalasyon cihazlari da kullanilabilir.
Set bilesenleri, bir arada paketlenebilir ya da iki ya da daha fazla konteynere
ayrilabilir. Bazi somut örneklerde, konteynerler, yeniden yapilandirma için uygun
olan birterkibin steril, Iiyofilize edilmis formülasyonlarini içeren flakonlar olabilir. Bir
set, ayni zamanda, baska reaktiflerin yeniden yapilandirilmasi ve/veya dilüsyonu
için uygun olan bir ya da daha fazla tampon da içerebilir. Kullanilabileoek diger
konteynerler, sinirlama olmaksizin, kese, tepsi, kutu, tüp ya da benzerlerini içerir.
Set bilesenleri, konteynerler içinde steril olarak paketlenebilir ve saklanabilir.
Eklenebilecek baska bir bilesen, bir seti kullanacak olan kisi için talimatlardir.
Bu bulusun çesitli somut örnekleri, asagidaki örnekler ile tarif edilmektedir.
Asagida kullanilan kisaltmalar s'oyledir: DCC, disiklohekzilkarbodiimit; NHS, N-
hidroksisüksinimit, DMAP, 4-dimetilaminopiridin; EEDQ, 2-et0ksi-1-etoksikarbonil-
1,2-dihidrokuinolin; MMT, monometoksitritil; PABOH, p-aminobenzil alkol; PEG,
polietilen glikol; SMCC, süksinimidil 4-(N-maleimidometil)sikl0hekzan-1-
karboksilat; TBAF, tetrabütilamonyum florür; TBDMS, tert-bütildimetilsilyl kloride.
Asagidaki örneklerdeki hidroksi bilesiklerinin kloroformatlari, Moon v.d. (J.
trifosgen ve DMAP kullanilarak hazirlanmistir. Ekstrate edici hazirlik, kloroform,
diklorometan ya da etil asetat ile ekstraksiyon ve istege bagli olarak doymus
bikarbonat, su ve doymus sodyum klorür ile yikamayi ifade eder. Flas
kromatografisi, aksi belirtilmedigi takdirde, %15 h/h oranina kadar metanol-
diklorometan kullanilarak, 230-400 gözenekli silika jel ve metanoldiklorometan
gradyani kullanilarak yapilmistir. Ters fazli HPLC, bir ön kolon filtresi takili olan,
dakika içinde % 100 çözücü A ila % 100 çözücü B çözücü gradyani kullanilarak ve
ya da 10 dakika boyunca dakikada 4,5 ml akis hizinda % 100 çözücü B orani
korunarak A Yöntemi ile ya da bir ön kolon filtresi takili olan, 4,6330 mm Xbridge
C18, 2,5 mm kolon kullanilarak ve 4 dakika boyunca dakikada 1,5 ml akis hizinda
boyunca dakikada 2 ml akis hizinda % 100 çözücü B orani korunarak B Yöntemi
ile yapilmistir. Çözücü A, pH degeri 4,46 olan % 0,3 sulu amonyum asetat iken,
çözücü B, pH degeri 4,46 olan 921 oraninda asetonitril-sulu amonyum asetat (%
0,3) olmustur. HPLC, 360 nm ve 254 nm olarak ayarlanan bir çiftli hat içi emilim
detektörü ile izlenmistir.
CL6-SN-38, Çizelge 1'de gösterilmektedir. Piyasadan satin alinabilen O-(2-
azidoetil)-O,-(N-diglikoliI-2-aminoetil) heptaetilenglikol ('PEG-NB'; 227 mg), 10
dakika boyunca DCC ( ve 10 ml diklorometan içinde
katalitik miktarda DMAP ile etkinlestirilmistir. Bu karisima, L-valinol (46,3 mg)
eklenmis ve reaksiyon karisimi, 1 saat boyunca ortam sicakliginda karistirilmistir.
Filtreleme, ardindan çözücüyü uzaklastirma ve flas kromatografisi, 214 mg berrak
yagli materyal vermistir. Bu ara madde (160 mg), 10-O-BOC-SN-38-20-O-
kloroformat bilesigi ile reaksiyona sokulmustur ve söz konusu bilesik, trifosgen ve
DMAP kullanilarak 10-O-BOC-SN-38'den (123 mg) elde edilmistir. Eslestirme
reaksiyonu, 10 dakika boyunca 4 ml diklorometan içinde yapilmis ve reaksiyon
karisimi, flas kromatografi ile saflastirilarak, köpüklü malzeme seklinde 130 mg (%
45 verim) ürün elde edilmistir. HPLC: tR 11,80 dak.; elektrosprey kütle spektrumu:
Maleimid içeren asetilenik reaktif, yani klik sikloadisyonu için gereken 4-(N-
maleimidometil)-N-(2-propinil)sikl0hekzan-1- karboksamit, 1,1 esd.
9; 1,01 esd.) diklorometan içinde reaksiyona sokulmasi yoluyla hazirlanmistir. 1
saat sonra, çözücü uzaklastirilmis ve ürün flas kromatografi ile saflastirilarak, 83
mg ürün (renksiz toz) elde edilmistir. ElektrOSprey kütle Spektrumu, m/e
degerinde pikler ve pozitif iyon modunda m/e 192 degerinde bir baz pik
göstermistir ve bu da C15H18N203 için hesaplanan yapi ile uyumludur: .
Yukarida tarif edilen azido ara maddesi (
içinde çözülmüs ve 60 mg 4-(N-maleimidometil)-N-(2-propinil)siklohekzan-1-
karboksamit ve 15 mg bakir bromür ile reaksiyona sokulmus ve 30 dakika boyunca
ortam sicakliginda karistirilmistir. Reaksiyon karisiminin hazirlanmasindan sonra,
flas kromatografisi, 116 mg (% 75 verim) sikloadisyon ürünü vermistir. HPLC: tR
11,20 dak.; elektrosprey kütle spektrumu: M+H ve M+Na, sirasiyla m/z 1433 ve
su (0,05 ml) karisimi ile korumanin kaldirilmasi, ardindan eter ile ç'oktürme ve
müteakip olarak flas kromatografisi, yapiskan bir materyal seklinde CL6-SN-38
ürününü vermistir. HPLC: tR 9,98 dak.; elektrosprey kütle spektrumu: M+H ve M-H
(negatif iyon mod), sirasiyla m/z 1333 ve 1356 degerlerinde.
N'wO'YnY`O/YOM 1 MIO" W:: _ *wc/"Af “rw/I&
trifosgen :Ç _s/ -Hv
woman-si . -
3:.. l 1 !my/x& %nLm/îgoi i, :-
CL6-SN-38 Öncülü
Sentez, Çizelge 2'de sematik olarak verilmistir. L-Valinol (40 mg), 3 saat boyunca,
argon altinda, ortam sicakliginda 10 ml susuz diklorometan için piyasada satilan
Fmoc-Lys(MMT)-OH ( ile reaksiyona sokulmustur.
Ekstraksiyon hazirligi ve ardindan flas kromatografisi, Fmoc-Lys(MMT)-valin0l
ürününü soluk sari renkli bir sivi seklinde vermistir (200 mg; ~ % 70 verim). HPLC:
mg) korumasi, dietilamin (10 ml) kullanilarak kaldirilmis ve ürün (135 mg), flas
kromatografisi sonrasinda ~% 90 verimle elde edilmistir. HPLC: tR 10,91 dak.;
elektrosprey kütle spektrumu: M+Na, m/z 527 degerinde. Bu ürün (135 mg), 10 ml
diklorometan içinde EEDQ (72 mg, 1,1 esd.) varliginda, piyasada satilan O-(2-
azidoetil)-O,-(N-diglikoliI-2-aminoetil)heptaetilenglik0l ('PEG-NS'; 150 mg, 1,1 esd.)
ile eslestirilmis ve gece boyunca ortam sicakliginda karistirilmistir. Ham malzeme
flas kromatografisi ile saflastirilarak, açik sari renkli bir yag seklinde 240 mg
saflastirilmis ürün elde edilmistir (~% 87 verim). HPLC: tR 11,55 dak.; elektrosprey
kütle spektrumu: M+H ve M+Na, sirasiyla m/z 1041 ve 1063 degerlerinde.
Bu ara madde (240 mg), 10-O-TBDMS-SN-38-20-O-kloroformat bilesigi ile
reaksiyona sokulmustur ve söz konusu bilesik, trifosgen ve DMAP kullanilarak 10-
O-TBDMS-SN-Ssiden (122 mg) elde edilmistir. Eslestirme reaksiyonu, 10 dakika
boyunca 5 ml diklorometan içinde yapilmis ve reaksiyon karisimi, flas kromatografi
ile saflastirilarak, soluk sari köpük seklinde 327 mg ürün elde edilmistir.
Elektrosprey kütle spektrumu: M+H, m/z 1574 degerinde. Ürünün tamami, 5
dakika boyunca 10 ml diklorometan içinde 0,25 mmol TBAF ile reaksiyona
sokulmus ve reaksiyon karisimi, 100 ml'ye seyreltilmis ve tuzlu su ile yikanmistir.
Ham ürün ( içinde çözülmüs ve 114 mg 4-(N-
maleimidometil)- N-(2-pr0pinil)siklohekzan-1-karboksamit (Ornek 1ide tarif edilen
sekilde hazirlanan) ve 30 mg bakir bromür ile reaksiyona sokulmus ve ortam
sicakliginda 1 saat boyunca karistirilmistir. Flas kromatografisi, sondan bir önceki
ara maddeden 150 mg saglamistir. Son olarak, diklorometan (5 ml) içinde TFA
(0,5 ml) ve anisol (0,05 ml) karisimi ile 3 dakika boyunca MMT grubunun
korumasinin kaldirilmasi, ardindan flas kromatografisi ile saflastirma, yapiskan bir
materyal seklinde 69 mg CL7-SN-38 ürününü vermistir. HPLC: tR 9,60 dak.;
elektrosprey kütle spektrumu: M+H ve M-H (negatif iyon modu), sirasiyla m/z 1461
ve 1459 degerlerinde.
n n 4 1 OH . i ' 100W.
MW- rw: ' n “* .:10 ' Ana;
*WNHN `g u °1° .w 2, icin& w
g &www `Amnr`oz`g'v _ ' N tango _ 1.
SÄWÜNVRN'NrG/In ; E 'Izi/01° E ' b' '
Ornek 1'deki CL6-SN-38 (55,4 mg), diklorometan (5 ml) içinde çözülmüs ve
reaksiyona sokulmus ve argon altinda 20 dakika boyunca karistirilmistir.
Reaksiyon karisimi, 100 ml diklorometan ile seyreltilmis ve her biri, sodyum
bikarbonat ve tuzlu su ile yari doygun 100 ml 0,1 M HCI ile yikanmis ve
kurutulmustur. Çözücünün uzaklastirilmasindan sonra, flas kromatografisi, baslik
ürününden 59 mg vermistir. HPLC: tR 10,74 dak.; tam kütle: hesaplanan.
Ornek 2ideki CL7-SN-38 Öncülü (80 mg), Ornek 3'te tarif edilen prosedür ve
saflastirma kullanilarak 10-O-kloroformatra dönüstürülmüstür. Verim: 60 mg.
HPLC: tR 12,32 dak.; elektrosprey kütle spektrumu: M+H ve M-H (negatif iyon
modu), sirasiyla m/z 1806 ve 1804 degerlerinde. Dikloroasetik asit ve
diklorometan içinde anisol kullanilarak bu materyalin korumasinin kaldirilmasi
baslik ürününü vermistir. HPLC: tR 10,37 dak.; elektrosprey kütle spektrumu:
M+H, m/z 1534 degerinde.
Bu Ornek, SN-38'in 10-OH grubunun 'BOC' yerinde bir karbonat ya da bir ester
olarak korundugunu göstermektedir; bu sayede, nihai ürün, 10-OH koruma
grubunun korumasini kaldirmaya ihtiyaç olmadan antikorlara konjugasyon için
hazirdir. Bu grubun korumasi, protein konjugatinin in vivo tatbiki sonrasinda
fizyolojik pH kosullari altinda kolayca kaldirilir. Bu konjugatlarda, 'Rr, n degeri 2-10
arasinda olan (CH2)n-N(CH3)2 gibi sübstitüe edilmis bir alkil ya da n degeri 0-10
arasinda olan (CH2)n-CH3 gibi bir basit alkil olabilir ya da n degeri 0-10 arasinda
olan “CH3-(CH2)n-O-” gibi bir alkoksi grubu ya da n degeri 2-10 arasinda olan 0-
(CH2)n-N(CH3)2 gibi sübstitüe edilmis bir alkoksi grubu olabilir ve burada, terminal
amino grubu, istege bagli olarak, yüksek suda çözünürlük için kuaterner bir tuz ya
da “R1O-(CH2-CH2-0)n-CH2-CH2-O-” seklindedir ve bu formülde R1, etil ya da
metil'dir ve n, 0-10 arasinda bir tamsayidir. Son kategorinin en basit versiyonunda,
R = “- O-(CH2)2-OCH3” seklindedir. Bu 10-hidroksi türevleri, nihai türevin bir
karbonat olmasi halinde seçilen reaktifin kloroformati ile islem yoluyla kolayca
hazirlanir. Tipik olarak, SN-38 gibi 10-hidr0ksi içeren kamptotesin, baz olarak
trietilamin kullanilarak dimetilformamit içinde kloroformat'in bir molar esdegeri ile
islenir. Bu kosullar altinda, 20-OH pozisyonu etkilenmez. 10-O-esterler olusturmak
için, seçilen reaktifin asit klorürü kullanilir. Bu tür türevler, Ornekler 3 ve 45teki basit
etil karbonatlar için gösterilen gelismis ara maddeler kullanilarak uygun sekilde
gerçeklestirilebilir.
Valinol, `Ornek 1'de tarif edilen prosedüre göre, Çizelge 1rdeki 'PEG-NS, ile
eslestirilir. Urün, diklorometan içinde 0,4 mol esdegeri trifosgen, 3,1 mol esdegeri
DMAP ile reaksiyona sokulur. 5 dakika sonra, bu sekilde olusan kloroformat, ortam
sicakliginda 15 dakika boyunca esit mol miktarinda paklitaksel ile reaksiyona
sokulur. Paklitaksel'in reaktif 2'-hidroksil grubu (yan zincir ikincil hidroksil grubu),
çapraz baglayicinin kloroformati ile reaksiyona girer. Urün, flas kromatografisi ile
izole edilir. Bu ara madde ( içinde
çözülmüs ve 60 mg 4-(N-maleimidometiI)-N-(2-propinil)siklohekzan-1-karboksamit
(Ornek 1rde tarif edilen sekilde hazirlanan) ve 15 mg bakir bromür ile reaksiyona
sokulmus ve 30 dakika boyunca ortam sicakliginda karistirilmistir. Reaksiyon
karisiminin hazirlanmasindan sonra, flas kromatografisi, çift fonksiyonlu
paklitaksel, yani CL6-paklitaksel verir.
L-Valinol (40 mg), piyasada satilan Fmoc-Lys(MMT)-OH ile reaksiyona sokulur ve
ürün, bunun ardindan, Ornek 2'de tarif edilen sekilde, O-(2-azidoetiI)-O,-(N-
diglikoIiI-2-aminoetiI)heptaetilenglikol ('PEG-N3*) ile reaksiyona sokulur. Bu türevin
kloroformati, Ornek 6'nin yöntemi ile olusturulur ve esdeger mol miktarinda
paklitaksel ile reaksiyona sokulur. Paklitaksel'in reaktif 2'-hidr0ksil grubu (yan
zincir ikincil hidroksil grubu), çapraz baglayicinin kloroformati ile reaksiyona girer.
Daha sonra, 4-(N-maleimidometiI)-N-(2-pr0pinil)sikl0hekzan-1-karboksamit (Ornek
1*de tarif edilen sekilde hazirlanan) kullanilarak, Ornek Gida tarif edilene benzer
sekilde kIik sikloadisyonu yapilir ve ürün, son olarak, dikloroasetik asit ve anisol ile
islenerek, ilimli kosullar altinda 'MMT' grubunun uzaklastirilmasi gerçeklestirilir. Bu
proses, CL7-paklitaksel saglar.
Valinol, Ornek 1'de tarif edilen prosedüre göre, Çizelge 17deki 'PEG-N3, ile
eslestirilir. Urün, diklorometan içinde 0,4 mol esdegeri trifosgen, 3,1 mol esdegeri
DMAP ile reaksiyona sokulur. 5 dakika sonra, bu sekilde olusan kloroformat, ortam
sicakliginda 15 dakika boyunca esit mol miktarinda morfolino doksorubisin ile
reaksiyona sokulur. Morfolino doksorubisin'in birincil hidroksil grubu, çapraz
baglayicinin kloroformati ile reaksiyona girer. Urün, flas kromatografisi ile izole
edilir. Bu ara madde ( içinde çözülmüs ve
60 mg 4-(N-maleimidometil)-N-(2-propinil)siklohekzan-1-karboksamit (Ornek 1'de
tarif edilen sekilde hazirlanan) ve 15 mg bakir bromür ile reaksiyona sokulmus ve
dakika boyunca ortam sicakliginda karistirilmistir. Reaksiyon karisiminin
hazirlanmasindan sonra, flas kromatografisi, çift fonksiyonlu paklitaksel, yani CL6-
Ornek 9: CL7-[morfolino doksorubisin] Hazirlanisi
L-Valinol (40 mg), piyasada satilan Fmoc-Lys(MMT)-OH ile reaksiyona sokulur ve
ürün. bunun ardindan, Ornek 2'de tarif edilen sekilde, O-(2-azid0etil)-Or-(N-
diglikoliI-2-amin0etil)heptaetiIenglikol (:PEG-Nsl) ile reaksiyona sokulur. Bu türevin
kloroformati, Ornek 6'nin yöntemi ile olusturulur ve esdeger mol miktarinda
morfolino doksorubisin ile reaksiyona sokulur. Morfolino doksorubisinrin birincil
hidroksil grubu, çapraz baglayicinin kloroformati ile reaksiyona girer. Daha sonra,
4-(N-maleimid0metil)-N-(2-pr0pinil)sikl0hekzan-1-karboksamit (Ornek 1*de tarif
edilen sekilde hazirlanan) kullanilarak, Ornek 6'da tarif edilene benzer sekilde klik
sikloadisyonu yapilir ve ürün, son olarak, dikloroasetik asit ve anisol ile islenerek,
iIimIi kosullar altinda “MMT' grubunun uzaklastirilmasi gerçeklestirilir. Bu proses,
CL7-[m0rfolino doksorubisin] saglar.
Metilen klorür (10 ml) içinde piyasada satilan Fmoc-Lys(MMT)-OH (0,943 9), p-
aminobenzil alkol ( eklenmis
ve 4 saat boyunca karistirilmistir. Ekstraksiyon hazirligi ve ardindan flas
kromatografisi, beyaz köpük seklinde 1,051 9 materyal vermistir. Tüm HPLC
analizleri, 0148 bölümünde 'Genel' altinda belirtilen Yöntem B ile
gerçeklestirilmistir. HPLC tut. süresi: 3,53 dak. Elektrosprey kütle spektrumui
yapiyla uyumlu bir sekilde, m/e degerlerinde
pikler göstermistir. Bu ara madde (0,93), dietilamin (10 ml) içinde çözülmüs ve 2
saat boyunca karistirilmistir. Çözücünün uzaklastirilmasindan sonra, kalinti,
hekzan içinde yikamis ve renksiz bir çökelti seklinde 0,6 9 ara madde (Çizelge 3'te
(2)) elde edilmistir. HPLC tut. süresi: 2,06 dak. Elektrosprey kütle spektrumu, m/e
degerlerinde pikler
göstermistir.
Bu ham ara madde (0,565 9), metilen klorür (10 ml) içinde EEDQ kullanilarak,
piyasada satilan O-(2-azidoetil)-O'-(N-diglik0lil-2- amin0etil)heptaetilenglikol
('PEG-NS', 0,627 9) ile eslestirilmistir. Çözücünün uzaklastirilmasi ve flas
kromatografisi, 0,99 9 ürün saglamistir (Çizelge &te (3); açik sari yag; % 85
verim). HPLC tut. süresi: 2,45 dak. Elektrosprey kütle spektrumu, m/e degerlerinde pikler göstermistir.
Bu ara madde (0,92 9), argon altinda 10 dakika boyunca metilen klor`ur içinde 10-
O-TBDMS-SN-38-20-O-kloroformat (Çizelge 39te (5)) ile reaksiyona sokulmustur.
Karisim, flas kromatografisi ile saflastirilmis ve açik sari yag seklinde 0.944 9 elde
edilmistir (Çizelge 3*te (6); verim = % 68). HPLC tut. süresi: 4,18 dakika. Metilen
klor'ur (10 ml) içinde bu ara maddeye (0,94 9), metilen klor'ur (3 ml) içinde TBAF
boyunca karistirilmistir. Karisim, metilen klorür (100 ml) ile seyreltilmis ve 0,25 M
sodyum sitrat ve tuzlu su ile yikanmistir. Çözücünün uzaklastirilmasi, 0,835 9 sari
yag ürünü vermistir. HPLC tut. süresi: 2,80 dakika; (% 99 saflik). Elektrosprey
k'utle spektrumu, yapiyla uyumlu bir sekilde, m/e ,
m/e degerlerinde pikler göstermistir.
4-(N-maleimidometil)-N-(2-pr0pinil)siklohekzan- 1-karboksamit (0,233 9) ile
reaksiyona sokulmustur. ile yikama dahil olmak 'üzere,
ekstraksiyon hazirligi ve flas kromatografisi, sari köpük seklinde 0,891 9
saglamistir. (verim = % 93), HPLC tut. süresi: 2,60 dak. Elektrosprey kütle
spektrumu, yapiyla uyumlu bir sekilde, m/e ,
degerlerinde pikler göstermistir. Son olarak, sondan bir önceki
ara maddenin (0,22 g) korumasinin, metilen klor'ür (3 ml) içinde dikloroasetik asit
(0,3 ml) ve anisol (0,03 ml) karisimi ile kaldirilmasi, ardindan eter ile çöktürme,
saglamistir. HPLC tut. süresi: 1,88 dak. Elektrosprey kütle spektrumu, yapiyla
uyumlu bir sekilde, m/e degerlerinde pikler
göstermistir.
Çizelge 3: CL2A-SN-38 Hazirlanisi
Fm' /M women M L
trifosgen ` o `,
uzatmanin www::.. ***gg ~,°"; ' HL , _A_ ;3 "-0^1--n ° nitro”
*53 i ' o›
N, 2 n 9 ,CB/`”55 " N 2.
Vfoag Y`°^ ' I: I i
araci; * mt“, ` im”
(Klik Sikloadisyonl
mr, DCNanisol
m N ` ”Âs aga-«(4 H 1
CLIA- SN-JI 1 t
Nida (amin tuzu olarak›
Metilen klorür (50 ml) içinde N,N'-dimetiletilendiamin (3 ml), monometoksitritil
kloride (1,7 9) ile reaksiyona sokulmustur. 1 saat karistirma sonrasinda, çözücü,
düsük basinç,` altinda uzaklastirilmis ve ham 'ürün, ekstraksiyon hazirlama ile geri
kazanilmistir (sari yag; 2,13 9). Tüm HPLC analizleri, 0148 bölümünde 'Genel,
altinda belirtilen Yöntem B ile gerçeklestirilmistir. HPLC tut. süresi: 2,28 dakika. Bu
ara madde (Çizelge 4*te (1), 0,93 9), bulundugu yerde, etkinlestirilmis SN-38 içine
eklenmis ve söz konusu 'ürün (Çizelge 4'te (2)), SN-38'in (0,3 9) 1 saat boyunca
DMF içinde p-nitrofenilkloroformat ( ile reaksiyona
sokulmasi yoluyla hazirlanmistir. Çözücün'ün uzaklastirilmasindan sonra, kalinti,
deaktif silika jel `üzerinde saflastirilmis ve beyaz kati seklinde 0,442 9 'ürün elde
edilmistir.
Bu ara maddenin (0,442 9) korumasi, metilen klorür (5 ml) içinde bir trifloroasetik
asit (1 ml) ve anisol (0,1 ml) karisimi ile kaldirilmis, ardindan eter ile çöktürme
yapilmis ve beyaz kati seklinde 0,197 9 ürün (Çizelge 4'te (3)) elde edilmistir. Bu
ara madde ((3); 0,197 9), aktive edilmis azit içeren dipeptit eklenmis PEG
baglayici (Çizelge 4'te (5) ile eslestirilmistir) ve söz konusu aktivasyon, PEG
baglayicinin (Çizelge Me (4); 0,203 9), metilen klorür (8 ml) içinde bis(4- nitrofenil)
karbonat ( ile reaksiyona sokulmasi yoluyla
yapilmistir. Flas kromatografisi, oamsi kati seklinde 0,2 9 azit türevli SN-38 ara
ürününü (Çizelge Me (6)) vermistir. HPLC tut. süresi: 2,8 dak. Elektrosprey kütle
spektrumu, yapiyla uyumlu bir sekilde, mle ,
m/e degerlerinde pikler göstermistir. Bu ara madde (Çizelge 4'te
(6); and trifenilfosfin
(0,012 9) varliginda, metilen klorür içinde 4-(N-maleimidometiI)-N-(2-
propinil)sikl0hekzan-1-karboksamit (0,067 9) ile kIik sikloadisyonuna tabi
tutulmustur. Reaksiyon karisiminin, 0,1 M EDTA ile islem içeren hazirligi,
ardindan flas kromatografisi, sondan bir önceki ara maddeyi 0,08 9 açik sari köpük
seklinde vermistir. HPLC : tR = 2,63 dak. Elektrosprey kütle spektrumu, yapiyla
uyumlu bir sekilde, m/e degerlerinde pikler
göstermistir. Son olarak, bu ara maddenin (0,08 9) korumasinin metilen klorür (2
ml) içinde bir trifloroasetik asit (0,2 ml), anisole (0,12 mi) ve su (0,06 ml) karisimi
ile kaldirilmasi, ardindan eter ile çöktürme, açik sari toz seklinde 0,051 9 ürün,
CL17-SN-38 (CL2E-SN-38 olarak da anilir) vermistir (verim = % 69). HPLC tut.
süresi: 1,95 dakika; ~% 99 saflik. Elektrosprey kütle spektrumu, yapiyla uyumlu bir
sekilde, m/e degerlerinde pikler göstermistir.
izel e 4: CL2E-SN-38 Hazirlani i
..1 n) "i/ww# LÜ)
M Üûßîoûuçß” , PEO biglapci
i.. t N M“âubfrs::
qqnwüîooßvni Sîûgfjf ,, “`
konjugasyonu
Bu çalismalarda, anti-CEACAMS hümanize edilmis MAb, hMN-14, anti-CD22
hümanize edilmis MAb, hLL2, anti-CD2O hümanize edilmis MAb, hA20, anti-EGP-
1 hümanize edilmis MAb, hR87 ve anti-musin hümanize edilmis MAb, hPAM4
kullanilmistir. Her bir antikor, 45 dakika boyunca, 37 “C sica kIikta (banyo), 5,4 mM
EDTA içeren, pH degeri 7,4 olan, 40 mM PBS içinde, 50 ila 70 kat mol fazlasiyla
kullanilan ditiyotreitol (DTT) ile indirgenmistir. Indirgenmis `ürün, boyut dislama
kromatografisi ve/veya diafiltrasyon ile saflastirilmis ve pH degeri 6,5 olan uygun
bir tampon içine tampon degisimi yapilmistir. Tiyol içerigi, Ellman tayini ile
belirlenmistir ve 6,5 ila 8,5 SH/lgG araliginda olmustur. Alternatif olarak, antikorlar,
pH degeri 5-7 araliginda olan fosfat tamponu içinde Tris (2-karboksietil) fosfin
(TCEP) ile indirgenmis ve ardindan yerinde konjugasyona tabi tutulmustur.
Indirgenen MAb, es çözücü olarak % 7-15 h/h oraninda DMSO kullanilarak, Ornek
1tdeki 'CL6-SN-38' ya da Ornek 2rdeki 'CL7-SN-38' ya da Ornek Siteki 'CL6- SN-
sokulmus ve ortam sicakliginda 20 dakika boyunca ink'übe edilmistir. Konjugat,
santrifüjlenmis SEC, hidrofobik bir kolondan pasaj ve son olarak ultrafiltrasyon-
diafiltrasyon ile saflastirilmistir. Urün, standart degerler ile iliskilendirilerek 366 nm
emilim ile SN-38 için analiz edilmistir ve protein konsantrasyonu, 280 nm'de
emilimden çikarilmis ve bu dalga boyunca SN-38 emiliminin saçilmasi için
düzeltilmistir. Bu sekilde, SN-38/MAb sübstit'üsyon oranlari belirlenmistir.
Saflastirilan konjugatlar, cam flakonlar içinde Iiyofilize formülasyonlar olarak
saklanmis ve bu flakonlar, vakum altinda kapatilmis ve -20 CC dondurucuya
konulmustur. Bu konjugatlardan bazilari için elde edilen ve tipik olarak 5 ila 7
arasinda olan SN-38 molar sübstit'üsyon oranlari (MSR), Tablo 2'de gösterilmistir.
Tablo 2: Bazi konjugatlarda SN-38/MAb Molar sübstit'i'isyon oranlari (MSR)
MAb Konjugat MSR
hMN-14-[CL2A-SN-38], Ornek loidaki ilaç-baglayici 6 1
kullanilarak ,
hMN-14-[CL6-SN-381, Ornek 1'deki ilaç-baglayici 6 8
kullanilarak ,
hMN- 14-[CL7-SN-381, Ornek 2*deki ilaç-baglayici 5 9
kullanilarak '
baglayici kullanilarak '
hMN-14-[CL2E-SN-38], Ornek 11tdeki ilaç-baglayici 5 9
kullanilarak ,
hRS7-CL2A-SN-38, Ornek 10'daki ilaç-baglayici 5 8
kullanilarak ,
hRSY-CLT-SN-38, Ornek 2tdeki ilaç-baglayici
kullanilarak
hRS7-CL7-SN-38 (Et), Ornek 4*teki ilaç-baglayici 6 1
kullanilarak ,
hA20-CL2A-SN-38, Ornek 10'daki ilaç-baglayici
hA20 5,8
kullanilarak
hLL2-CL2A-SN-38, Ornek 10'daki ilaç-baglayici
kullanilarak
hPAM4-CL2A-SN-38, Ornek 10tdaki ilaç-baglayici
kullanilarak
modellerinde in vivo terapötik etkililikler
Subkütanöz insan pankreas ya da kolon tümörü ksenogreftleri tasiyan bagisikligi
zayif atimik çiplak fareler (disi), ya CL2A-SN-38 konjugati veya kontrol konjugati
ile tedavi edilmis ya da tedavi edilmeden birakilmistir. Spesifik konjugatlarin
terapötik etkililikleri gözlenmistir. Sekil 1, bir Capan 1 pankreas tümör modeli
göstermektedir ve bu modelde, hR87 (anti-EGP-1), hPAM4 (anti-musin) ve hMN-
14 (anti-CEACAMS) antikorlarinin spesifik CL2A-SN-38 konjugatlari, hA20-CL2A-
SN-38 kontrol konjugatindan (anti-CDZO) ve tedavi edilmemis kontrolden daha iyi
etkililikler göstermistir. Benzer sekilde, bir BXPCS insan pankreas kanseri
modelinde, spesifik hRST-CL2A-SN-38, kontrol tedavilerinden daha iyi terapötik
etkililik göstermistir (Sekil 2). Benzer sekilde, insan kolon karsinomunun agresif bir
L8174T modelinde, spesifik hMN-14-CL2A-SN-38 ile tedavi, tedavi edilmeyenlere
göre daha etkili olmustur (Sekil 3).
Ornek 16: Bir anti-gp120 MAb'in bir SN-38 konjugati ile tedavi yoluyla HIV
enfeksiyonunun eliminasyonu
HIV kilif proteini gp120rye hedeflenen bir MAb, P4/D10 gibi anti-gp120 antikoru.
Ornek 7'de tarif edilen kosullar kullanilarak indirgenmistir ve indirgene MAb, Ornek
2rde tarif edilen sekilde olan, ilac baglayici CL7-SN-38'in 20 kat molar fazlasiyla
reaksiyona sokulmustur. Antikor basina ~8 ilaç molekülünün bir sübstitüsyonu ile
bir anti-gp120-SN-38 konjugati elde edilmistir. Sözü edilen konjugat ile bir in vitro
HIV inhibisyon tayini, enfekte olmayan Jurkat T hücreleri ve tamamen HIV ile
enfekte Jurkat T hücrelerinin çesitli karisimlari kullanilarak (99,802 ila 95:5
oranlarinda) ve konjugat, spesifik olmayan hRS7-CL7-SN38 konjugat kontrolü,
çiplak antikor ve HlV negatif serumun 100 ila 0,00001 mg/ml arasinda degisen seri
dilüsyonlari ile islenerek yapilmistir. Bu sekilde islenen hücreler, yedi gün boyunca
37 °C sicaklikta RPMI 1640 kültür ortaminda inkübe edilmis ve ardindan ELISA
testi ile HIV inhibisyonu bakimindan analiz edilmistir. Bu deney, spesifik ilaç
konjugati ile HIV virüsünün hücre içinde yayilmasinin güçlü ve spesifik bir sekilde
inhibe edildigini göstermektedir. Farelere, izolog HIV ile enfekte hücreler ile birlikte
spesifik ve spesifik olmayan SN-38 konjugatlari tatbik edilerek in vivo etkililik test
edilmistir. Bunun için, HIV-1/MuLV psodotip virüsü ile enfekte primer mürin
splenositleri, fare gruplarina immunokonjugat tatbiki ile es zamanli olarak
intraperitoneal yoldan transfer edilmistir. Peritoneal hücreler, 10 gün sonra hasat
edilmistir. Kontrol farelerinde enfeksiyonlu HIV varligi görülürken, 100 ug ya da
daha az anti-gp120-SN-38 konjugat ile tedavi edilen farelerde enfeksiyonlu HlV
tespit edilmemistir. Kontrol konjugatlari ile tedavi edilen farelerde koruma
görülmemistir.
Claims (1)
- ISTEMLER Asagidaki formül ile gösterilen bir yapiya sahip olan, MAb-CL2A-SN-38 yapisal formülüne sahip olan bir konjugat olup: mâ“.wnvgümwnrwgu ,. NHz &gm -° tozu :lara-c; özelligi; kanser ya da bir habislik tedavisinde kullanima yönelik olmasi ve MAbrnin, kanser ya da habisligin habis bir hücresinde eksprese edilen bir epitop ya da bir antijeni hedef almasi ve kanserin, hematopoietik tümör, karsinom, sarkoma, melanoma ve gliyal tümör içeren grup içinden seçilmesidir. Istem 1'dki gibi kullanima yönelik konjugat olup, özelligi; MAb ile hedef alinan antijenin, CD74, CD22, EGP-1, musin, CDBöa-e, CEA, CEACAMS, CEACAM6, CSAp, alfa-fetoprotein, CC49, PSMA, PSAM-dimer, karbonik anhidraz IX, tenassin ve HLA-DR arasindan seçilmesidir. Istem 1 ya da 2*den herhangi birindeki gibi, tercihen Istem ?deki gibi kullanima yönelik konjugat olup, özelligi; kanser ya da habisligin habis bir hücresinde eksprese edilen antijenin, CD74, CD22, EGP- 1, musin, CDööa- e, CEA, CEACAMS, CEACAMG, CSAp, alfa-fetoprotein, C049, PSMA, PSAM-dimer, karbonik anhidraz IX, tenassin ve HLA-DR arasindan seçilmesidir. Istem 17deki gibi kullanima yönelik konjugat olup, özelligi; MAb'in, bir mürin antikoru, bir kimerik antikor, primatize bir antikor, hümanize edilmis bir antikor, bir insan antikoru, bir Fab antikor parçasi, bir Fab* antikor parçasi, bir F(ab)2 antikor parçasi, bir F(ab')2 antikor parçasi ve bir scFv antikor parçasi arasindan seçilmesidir. Istem 1'deki gibi kullanima yönelik konjugat olup, özelligi; MAb'in, bir kimerik, primatize, hümanize edilmis ya da insan monoklonal antikoru olmasi ve söz konusu antikorun, sabit alanlara ve bir insan IgG1 ya da bir insan lgG4 antikorunun bir eklem alanina sahip olmasidir. Istem 5'teki gibi kullanima yönelik konjugat olup, özelligi; MAb'in, sabit alanlara ve bir insan lgG4 antikorunun bir eklem alanina sahip olmasi ve eklemin serin 2284 yerinde bir prolin bulunmasidir. Istem Siteki gibi kullanima yönelik konjugat olup, özelligi; antikorun, sabit alanlara ve bir insan lgG1 antikorunun bir eklem alanina sahip olmasi ve bir ya da daha fazla Fc amino asidinin, antikorun kandaki yari ömrünü artirmak için mutasyona ugratilmasi ya da Fc*nin bir ya da daha fazla grubunun silinmis olmasi ya da antikorun kandaki yari ömrünü artirmak için bir ya da daha fazla seker grubu eklenmis olmasidir. Istem 3*deki gibi kullanima yönelik konjugat olup, özelligi; MAb'in; hLL1, CC49, hL243, D2/B ve hlmmu-31 arasindan seçilmesidir. Istem 1ideki gibi kullanima yönelik konjugat olup, özelligi; MAb'in, multispesifik olmasi ve hedef hücrede bulunan en az iki farkli antijeni ya da epitopu hedef almak için birden çok baglanma koluna sahip olmasi ve bir ya da daha fazla hedefleyici kolun, CPT'ye konjuge olmasidir. Istem 9*daki gibi kullanima yönelik konjugat olup, özelligi; multispesifik MAb*in, CD74, CD22, EGP- 1, musin, CD66a-e, CEA, CEACAM5, CEACAMö, CSAp, alfa-fetoprotein, CC49, PSMA, PSAM-dimer, karbonik anhidraz lX, tenassin ve HLA-DR arasindan seçilen bir antijeni hedef alan bir ya da daha fazla antikor içeren bispesifik ve/veya bivalent bir antikor yapisina sahip olmasidir. Istem 10'daki gibi kullanima yönelik konjugat olup, özelligi; bir ya da daha fazla antikorun; hLL1, hLL2, RFB4, hA19, hA20, hRS?, hPAM4, hMN-3, seçilmesidir. Istem 9 ila 11 arasindaki istemlerden herhangi birindeki gibi kullanima yönelik konjugat olup, özelligi; söz konusu multispesifik antikorun, karbonik anhidraz CD, VEGF, ED-B fibronektin, EGP-1, EGP-2, EGF reseptör (ErbBl), ErbBZ, ErbBS, Faktor H, FHL-1, Fit-3, folat reseptörü, Ga 733,GROB, HMGB-l, hipoksi uyarma faktörü (HIF), HM, gangliositler, HCG, HLA-DR, CDGöa-d, MAGE, mCRP, MCP-1, MIP-1A, MIP- 1B, makrofaj göç inhibe etme faktörü (MIF), MUC1, MUC2, MUC3, MUC4, MUC5, plasenta büyüme faktörü (PlGF), PSA (prostat-spesifik antijen), PSMA, PSMA dimer, PAM4 antijen, NCA-95, MCA-90, A3, A33, Ep-CAM. KS-1. Le(y), mesotelin, 8100, tenassin, TAC, Tn antijen, Thomas- Friedenreich antijenleri, tümor nekroz antijenleri, tümor anjiyogenez antijenleri, TNF- or, TRAIL reseptörü (R1 ve R2), VEGFR, RANTES, T101, kanser kök hücre antijenleri, tamamlayici faktörler C3, C3a, Cßb, C5a, CS ve bir onkojen ürün arasindan seçilen iki ya da daha fazla antijene baglanmasidir.
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US20789009P | 2009-02-13 | 2009-02-13 |
Publications (1)
Publication Number | Publication Date |
---|---|
TR201910848T4 true TR201910848T4 (tr) | 2019-08-21 |
Family
ID=42562013
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
TR2019/10848T TR201910848T4 (tr) | 2009-02-13 | 2009-12-02 | İntraselüler olarak ayrilabi̇len bi̇r bağa sahi̇p i̇mmunokonjugatlar |
Country Status (18)
Country | Link |
---|---|
US (21) | US7999083B2 (tr) |
EP (6) | EP3912643B8 (tr) |
CN (1) | CN102448494B (tr) |
CA (2) | CA2749501C (tr) |
CY (1) | CY1125700T1 (tr) |
DK (3) | DK3912643T3 (tr) |
ES (4) | ES2931923T3 (tr) |
FI (2) | FI3903829T3 (tr) |
FR (1) | FR22C1009I2 (tr) |
HR (2) | HRP20230487T1 (tr) |
HU (3) | HUE060624T2 (tr) |
LT (3) | LT3912643T (tr) |
NL (1) | NL301164I2 (tr) |
PL (3) | PL3903829T3 (tr) |
PT (2) | PT3903829T (tr) |
SI (1) | SI3903829T1 (tr) |
TR (1) | TR201910848T4 (tr) |
WO (1) | WO2010093395A1 (tr) |
Families Citing this family (196)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7591994B2 (en) | 2002-12-13 | 2009-09-22 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
US8877901B2 (en) * | 2002-12-13 | 2014-11-04 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
US9770517B2 (en) | 2002-03-01 | 2017-09-26 | Immunomedics, Inc. | Anti-Trop-2 antibody-drug conjugates and uses thereof |
US8420086B2 (en) | 2002-12-13 | 2013-04-16 | Immunomedics, Inc. | Camptothecin conjugates of anti-CD22 antibodies for treatment of B cell diseases |
EP1572242B1 (en) * | 2002-12-13 | 2014-04-16 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
AU2005313971B2 (en) * | 2004-12-08 | 2011-10-13 | Immunomedics, Inc. | Methods and compositions for immunotherapy and detection of inflammatory and immune-dysregulatory disease, infectious disease, pathologic angiogenesis and cancer |
US10058621B2 (en) | 2015-06-25 | 2018-08-28 | Immunomedics, Inc. | Combination therapy with anti-HLA-DR antibodies and kinase inhibitors in hematopoietic cancers |
US9707302B2 (en) * | 2013-07-23 | 2017-07-18 | Immunomedics, Inc. | Combining anti-HLA-DR or anti-Trop-2 antibodies with microtubule inhibitors, PARP inhibitors, bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
US8481041B2 (en) | 2005-04-06 | 2013-07-09 | Ibc Pharmaceuticals, Inc. | Dock-and-lock (DNL) constructs for human immunodeficiency virus (HIV) therapy |
US8475794B2 (en) | 2005-04-06 | 2013-07-02 | Ibc Pharmaceuticals, Inc. | Combination therapy with anti-CD74 antibodies provides enhanced toxicity to malignancies, Autoimmune disease and other diseases |
US20100226884A1 (en) * | 2009-01-20 | 2010-09-09 | Immunomedics, Inc. | Novel Class of Monospecific and Bispecific Humanized Antibodies that Target the Insulin-like Growth Factor Type I Receptor (IGF-1R) |
AU2011292178B8 (en) * | 2006-12-05 | 2016-01-21 | Ibc Pharmaceuticals, Inc. | Compositions and methods of use comprising combinations of anti-CD74 antibodies with a therapeutic agent. the therapeutic agent may be attached to the anti-CD74 antibody or may be separately administered, either before, simultaneously with or after the anti-CD74 antibody |
US8398956B2 (en) | 2007-01-11 | 2013-03-19 | Immunomedics, Inc. | In vivo copper-free click chemistry for delivery of therapeutic and/or diagnostic agents |
EP3543256A1 (en) | 2009-01-12 | 2019-09-25 | Cytomx Therapeutics Inc. | Modified antibody compositions, methods of making and using thereof |
CN102448494B (zh) | 2009-02-13 | 2016-02-03 | 免疫医疗公司 | 具有胞内可裂解的键的免疫共轭物 |
AU2010215936B2 (en) | 2009-02-21 | 2015-03-05 | Covidien Lp | Medical devices having activated surfaces |
US8969473B2 (en) | 2009-02-21 | 2015-03-03 | Sofradim Production | Compounds and medical devices activated with solvophobic linkers |
AU2010215931A1 (en) | 2009-02-21 | 2011-10-13 | Covidien Lp | Medical devices having activated surfaces |
WO2010095053A2 (en) | 2009-02-21 | 2010-08-26 | Sofradim Production | Apparatus and method of reaching polymers by exposure to uv radiation to produce injectable medical devices |
US9273191B2 (en) | 2009-02-21 | 2016-03-01 | Sofradim Production | Medical devices with an activated coating |
AU2010215194A1 (en) | 2009-02-21 | 2011-10-13 | Sofradim Production | Apparatus and method of reacting polymers passing through metal ion chelated resin matrix to produce injectable medical devices |
WO2010095045A1 (en) | 2009-02-21 | 2010-08-26 | Sofradim Production | Amphiphilic compounds and self-assembling compositions made therefrom |
EP2398943B1 (en) | 2009-02-21 | 2013-04-17 | Sofradim Production | Crosslinked fibers and method of making same using uv radiation |
AU2010215196B2 (en) | 2009-02-21 | 2015-04-16 | Covidien Lp | Crosslinked fibers and method of making same by extrusion |
US8535477B2 (en) | 2009-02-21 | 2013-09-17 | Sofradim Production | Medical devices incorporating functional adhesives |
EP2550031B1 (en) | 2010-03-25 | 2015-08-19 | Sofradim Production | Medical devices incorporating functional adhesives |
US9272074B2 (en) * | 2010-03-25 | 2016-03-01 | Sofradim Production | Surgical fasteners and methods for sealing wounds |
US9247931B2 (en) | 2010-06-29 | 2016-02-02 | Covidien Lp | Microwave-powered reactor and method for in situ forming implants |
CA2804251A1 (en) | 2010-07-01 | 2012-01-05 | Sofradim Production | Medical device with predefined activated cellular integration |
AU2011284449B2 (en) | 2010-07-27 | 2015-07-23 | Sofradim Production | Polymeric fibers having tissue reactive members |
TW201302793A (zh) | 2010-09-03 | 2013-01-16 | Glaxo Group Ltd | 新穎之抗原結合蛋白 |
CA2812442A1 (en) * | 2010-11-03 | 2012-05-10 | Ibc Pharmaceuticals, Inc. | Dock-and-lock (dnl) constructs for human immunodeficiency virus (hiv) therapy |
WO2012075361A2 (en) * | 2010-12-02 | 2012-06-07 | Immunomedics, Inc. | In vivo copper-free click chemistry for delivery of therapeutic and/or diagnostic agents |
CA2827170A1 (en) | 2011-02-11 | 2012-08-16 | David M. Hilbert | Monovalent and multivalent multispecific complexes and uses thereof |
AU2012245260B2 (en) | 2011-04-22 | 2016-09-08 | Aptevo Research And Development Llc | Prostate-specific membrane antigen binding proteins and related compositions and methods |
US9150504B2 (en) * | 2011-04-29 | 2015-10-06 | Catabasis Pharmaceuticals, Inc. | Fatty acid guanidine and salicylate guanidine derivatives and their uses |
WO2012162561A2 (en) | 2011-05-24 | 2012-11-29 | Zyngenia, Inc. | Multivalent and monovalent multispecific complexes and their uses |
KR101955054B1 (ko) * | 2011-05-27 | 2019-03-07 | 아미쿠스 세라퓨틱스, 인코포레이티드 | 리소좀 축적증의 개선된 치료를 위해 재조합 리소좀 효소상에 표적화 펩티드를 커플링시키는 방법 |
US9244074B2 (en) | 2011-06-07 | 2016-01-26 | University Of Hawaii | Biomarker of asbestos exposure and mesothelioma |
WO2012170742A2 (en) | 2011-06-07 | 2012-12-13 | University Of Hawaii | Treatment and prevention of cancer with hmgb1 antagonists |
US9757458B2 (en) | 2011-12-05 | 2017-09-12 | Immunomedics, Inc. | Crosslinking of CD22 by epratuzumab triggers BCR signaling and caspase-dependent apoptosis in hematopoietic cancer cells |
US20140050720A1 (en) | 2012-01-09 | 2014-02-20 | The Scripps Research Institute | Ultralong complementarity determining regions and uses thereof |
US20150011431A1 (en) | 2012-01-09 | 2015-01-08 | The Scripps Research Institute | Humanized antibodies |
GB201202268D0 (en) * | 2012-02-09 | 2012-03-28 | Medical Res Council | Intracellular immunity |
JP6423340B2 (ja) * | 2012-05-15 | 2018-11-14 | シアトル ジェネティクス,インコーポレイティド | 自己安定化リンカー結合体 |
US9504756B2 (en) | 2012-05-15 | 2016-11-29 | Seattle Genetics, Inc. | Self-stabilizing linker conjugates |
US9382329B2 (en) | 2012-08-14 | 2016-07-05 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to Trop-2 expressing cells |
KR101974583B1 (ko) | 2012-08-29 | 2019-05-02 | 삼성전자주식회사 | 링커 폴리펩티드 및 이를 이용한 표적 물질 분석 방법 |
KR102584005B1 (ko) | 2012-10-11 | 2023-09-27 | 다이이찌 산쿄 가부시키가이샤 | 글리신아미드 화합물의 제조 방법 |
JP6272230B2 (ja) | 2012-10-19 | 2018-01-31 | 第一三共株式会社 | 親水性構造を含むリンカーで結合させた抗体−薬物コンジュゲート |
AU2012395148B2 (en) | 2012-11-24 | 2016-10-27 | Hangzhou Dac Biotech Co., Ltd. | Hydrophilic linkers and their uses for conjugation of drugs to cell binding molecules |
US10413539B2 (en) | 2012-12-13 | 2019-09-17 | Immunomedics, Inc. | Therapy for metastatic urothelial cancer with the antibody-drug conjugate, sacituzumab govitecan (IMMU-132) |
US10137196B2 (en) | 2012-12-13 | 2018-11-27 | Immunomedics, Inc. | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
US9931417B2 (en) | 2012-12-13 | 2018-04-03 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
US9492566B2 (en) | 2012-12-13 | 2016-11-15 | Immunomedics, Inc. | Antibody-drug conjugates and uses thereof |
CA2884313C (en) | 2012-12-13 | 2023-01-03 | Immunomedics, Inc. | Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity |
US10744129B2 (en) | 2012-12-13 | 2020-08-18 | Immunomedics, Inc. | Therapy of small-cell lung cancer (SCLC) with a topoisomerase-I inhibiting antibody-drug conjugate (ADC) targeting Trop-2 |
ES2819573T3 (es) | 2012-12-13 | 2021-04-16 | Immunomedics Inc | Método para producir inmunoconjugados de anticuerpo-SN-38 con un enlazador CL2A |
US10206918B2 (en) | 2012-12-13 | 2019-02-19 | Immunomedics, Inc. | Efficacy of anti-HLA-DR antiboddy drug conjugate IMMU-140 (hL243-CL2A-SN-38) in HLA-DR positive cancers |
US9644021B2 (en) * | 2013-01-11 | 2017-05-09 | The California Institute For Biomedical Research | Bovine fusion antibodies |
JP6602746B2 (ja) | 2013-03-15 | 2019-11-06 | カポン、ダニエル・ジェイ. | 非ペプチジル結合を含むハイブリッド免疫グロブリン |
US9775928B2 (en) | 2013-06-18 | 2017-10-03 | Covidien Lp | Adhesive barbed filament |
WO2015010100A2 (en) | 2013-07-18 | 2015-01-22 | Fabrus, Inc. | Humanized antibodies with ultralong complementarity determining regions |
US11253606B2 (en) | 2013-07-23 | 2022-02-22 | Immunomedics, Inc. | Combining anti-HLA-DR or anti-Trop-2 antibodies with microtubule inhibitors, PARP inhibitors, Bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
AU2014293670B2 (en) * | 2013-07-23 | 2019-08-01 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
CA2918795A1 (en) | 2013-07-25 | 2015-01-29 | Cytomx Therapeutics, Inc. | Multispecific antibodies, multispecific activatable antibodies and methods of using the same |
CA2922698C (en) * | 2013-08-29 | 2023-01-03 | City Of Hope | Cell penetrating conjugates comprising non-cell penetrating antibodies covalently attached to one or more phosphorothioate nucleic acids |
CA2920192A1 (en) * | 2013-09-27 | 2015-04-02 | Immunomedics, Inc. | Anti-trop-2 antibody-drug conjugates and uses thereof |
RS65324B1 (sr) | 2013-10-18 | 2024-04-30 | Novartis Ag | Obeleženi inhibitori membranskog antigena specifičnog za prostatu (psma), njihova upotreba kao agenasa za snimanje i farmaceutskih agenasa za lečenje karcinoma prostate |
US20150125386A1 (en) * | 2013-11-05 | 2015-05-07 | Immunomedics, Inc. | Humanized anti-ceacam5 antibody and uses thereof |
RU2743077C2 (ru) | 2013-12-25 | 2021-02-15 | Дайити Санкио Компани, Лимитед | Конъюгат анти-trop2 антитело-лекарственное средство |
CN105829346B (zh) | 2014-01-31 | 2019-08-23 | 第一三共株式会社 | 抗her2抗体-药物偶联物 |
US9119832B2 (en) | 2014-02-05 | 2015-09-01 | The Regents Of The University Of California | Methods of treating mild brain injury |
CN106132436B (zh) | 2014-02-21 | 2021-06-15 | Ibc药品公司 | 通过诱导对trop-2表达细胞的免疫应答的疾病疗法 |
CN106029098A (zh) | 2014-02-25 | 2016-10-12 | 免疫医疗公司 | 人源化rfb4抗cd22抗体 |
WO2015127685A1 (en) | 2014-02-28 | 2015-09-03 | Hangzhou Dac Biotech Co., Ltd | Charged linkers and their uses for conjugation |
US11299528B2 (en) | 2014-03-11 | 2022-04-12 | D&D Pharmatech Inc. | Long acting TRAIL receptor agonists for treatment of autoimmune diseases |
DK3116486T3 (da) * | 2014-03-14 | 2020-03-09 | Biomolecular Holdings Llc | Hybrid immunoglobulin indeholdende ikke-peptidylbinding |
JP6787789B2 (ja) * | 2014-04-04 | 2020-11-18 | プレジデント アンド フェローズ オブ ハーバード カレッジ | 詰め替え可能な薬物送達デバイスおよびその使用方法 |
NZ724710A (en) | 2014-04-07 | 2024-02-23 | Chugai Pharmaceutical Co Ltd | Immunoactivating antigen-binding molecule |
ES2859648T3 (es) | 2014-04-10 | 2021-10-04 | Daiichi Sankyo Co Ltd | Conjugado anticuerpo-fármaco anti-HER3 |
WO2015155976A1 (ja) | 2014-04-10 | 2015-10-15 | 第一三共株式会社 | 抗her2抗体-薬物コンジュゲート |
BR112016026299A2 (pt) | 2014-05-13 | 2018-02-20 | Chugai Seiyaku Kabushiki Kaisha | molécula de ligação ao antígeno redirecionado à célula t para células tendo função de imunossupressão |
GB201412658D0 (en) | 2014-07-16 | 2014-08-27 | Ucb Biopharma Sprl | Molecules |
CN107108738A (zh) | 2014-07-25 | 2017-08-29 | 西托姆克斯治疗公司 | 抗cd3抗体、可活化抗cd3抗体、多特异性抗cd3抗体、多特异性可活化抗cd3抗体及其使用方法 |
GB201416960D0 (en) | 2014-09-25 | 2014-11-12 | Antikor Biopharma Ltd | Biological materials and uses thereof |
US10668165B2 (en) * | 2015-01-16 | 2020-06-02 | Immunwork Inc. | Molecular constructs for treating tumors |
CA2976005A1 (en) * | 2015-02-06 | 2016-08-11 | Cell Idx, Inc. | Antigen-coupled immunoreagents |
US11000548B2 (en) | 2015-02-18 | 2021-05-11 | Enlivex Therapeutics Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
US11304976B2 (en) | 2015-02-18 | 2022-04-19 | Enlivex Therapeutics Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
US11318163B2 (en) | 2015-02-18 | 2022-05-03 | Enlivex Therapeutics Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
US11512289B2 (en) | 2015-02-18 | 2022-11-29 | Enlivex Therapeutics Rdo Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
US11497767B2 (en) | 2015-02-18 | 2022-11-15 | Enlivex Therapeutics R&D Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
US11596652B2 (en) | 2015-02-18 | 2023-03-07 | Enlivex Therapeutics R&D Ltd | Early apoptotic cells for use in treating sepsis |
CA3016686A1 (en) * | 2015-03-09 | 2016-09-15 | Oxeia Biopharmaceuticals, Inc. | Methods of treating cognitive impairments or dysfunction |
EP3280454A1 (en) | 2015-04-07 | 2018-02-14 | Memorial Sloan Kettering Cancer Center | Nanoparticle immunoconjugates |
RU2717829C2 (ru) | 2015-04-20 | 2020-03-26 | Толеро Фармасьютикалз, Инк. | Прогнозирование ответа на альвоцидиб с помощью анализа профиля митохондрий |
JP6803339B2 (ja) | 2015-04-21 | 2020-12-23 | エンリヴェックス セラピューティクス リミテッド | 治療用のプールされた血液アポトーシス細胞調製物及びそれらの使用 |
EP3286224A4 (en) | 2015-04-22 | 2018-11-14 | Immunomedics, Inc. | Isolation, detection, diagnosis and/or characterization of circulating trop-2-positive cancer cells |
ES2739749T3 (es) | 2015-05-18 | 2020-02-03 | Tolero Pharmaceuticals Inc | Profármacos de alvocidib que tienen biodisponibilidad aumentada |
CN107847588B (zh) * | 2015-05-20 | 2021-12-28 | 免疫功坊股份有限公司 | 具有靶向部分及效应部分的分子构建体及其应用 |
BR112017025562A2 (pt) * | 2015-05-29 | 2018-08-07 | Merck Sharp & Dohme Corp. | métodos para tratar câncer em um indivíduo e para tratar um indivíduo humano diagnosticado com câncer |
JP6980980B2 (ja) | 2015-06-25 | 2021-12-15 | イミューノメディクス、インコーポレイテッドImmunomedics, Inc. | 抗hla‐drまたは抗trop‐2抗体と微小管阻害剤、parp阻害剤、ブルトンキナーゼ阻害剤またはホスホイノシチド3‐キナーゼ阻害剤との併用は癌の治療効果を有意に改善する |
US10195175B2 (en) | 2015-06-25 | 2019-02-05 | Immunomedics, Inc. | Synergistic effect of anti-Trop-2 antibody-drug conjugate in combination therapy for triple-negative breast cancer when used with microtubule inhibitors or PARP inhibitors |
ES2938186T3 (es) | 2015-06-29 | 2023-04-05 | Daiichi Sankyo Co Ltd | Procedimiento de fabricación selectiva de un conjugado anticuerpo-fármaco |
EP3316885B1 (en) * | 2015-07-01 | 2021-06-23 | Immunomedics, Inc. | Antibody-sn-38 immunoconjugates with a cl2a linker |
GB201601077D0 (en) | 2016-01-20 | 2016-03-02 | Ucb Biopharma Sprl | Antibody molecule |
GB201601073D0 (en) | 2016-01-20 | 2016-03-02 | Ucb Biopharma Sprl | Antibodies |
CN106344930B (zh) * | 2015-07-16 | 2021-08-17 | 亚飞(上海)生物医药科技有限公司 | 分子定点靶向和激活的短肽阿霉素的制备和用途 |
GB201601075D0 (en) | 2016-01-20 | 2016-03-02 | Ucb Biopharma Sprl | Antibodies molecules |
WO2017024073A1 (en) | 2015-08-03 | 2017-02-09 | Tolero Pharmaceuticals, Inc. | Combination therapies for treatment of cancer |
EA038329B1 (ru) | 2015-08-28 | 2021-08-10 | Амьюникс Фармасьютикалз, Инк. | Химерный полипептидный комплекс и способы его получения и применения |
CA2996652A1 (en) * | 2015-09-01 | 2017-03-09 | Immunwork Inc. | Molecular constructs for preventing the formation of blood clot and/or treating thrombosis |
JP6990650B2 (ja) * | 2015-09-17 | 2022-03-04 | ザ スクリプス リサーチ インスティテュート | 二重可変ドメインイムノコンジュゲートおよびその用途 |
US11352426B2 (en) | 2015-09-21 | 2022-06-07 | Aptevo Research And Development Llc | CD3 binding polypeptides |
WO2017086367A1 (ja) | 2015-11-18 | 2017-05-26 | 中外製薬株式会社 | 免疫抑制機能を有する細胞に対するt細胞リダイレクト抗原結合分子を用いた併用療法 |
EP3378488A4 (en) | 2015-11-18 | 2019-10-30 | Chugai Seiyaku Kabushiki Kaisha | METHOD FOR ENHANCING THE HUMORAL IMMUNE RESPONSE |
EP3387019B1 (en) | 2015-12-09 | 2021-10-20 | The Scripps Research Institute | Relaxin immunoglobulin fusion proteins and methods of use |
CA3008392C (en) | 2015-12-17 | 2021-11-09 | The Johns Hopkins University | Ameliorating systemic sclerosis with death receptor agonists |
CN115969970A (zh) | 2016-02-10 | 2023-04-18 | 免疫医疗公司 | Abcg2抑制剂与sacituzumab govitecan的组合 |
CN109069539A (zh) | 2016-02-18 | 2018-12-21 | 恩立夫克治疗有限责任公司 | 用于癌症治疗的联合免疫疗法和细胞因子控制疗法 |
WO2017147542A2 (en) | 2016-02-26 | 2017-08-31 | Regeneron Pharmaceuticals, Inc. | Optimized transglutaminase site-specific antibody conjugation |
CA3020339C (en) | 2016-04-07 | 2022-05-03 | The Johns Hopkins University | Compositions and methods for treating pancreatitis and pain with death receptor agonists |
KR102514317B1 (ko) | 2016-04-15 | 2023-03-27 | 마크로제닉스, 인크. | 신규 b7-h3-결합 분자, 그것의 항체 약물 콘쥬게이트 및 그것의 사용 방법 |
CN109310385A (zh) | 2016-04-27 | 2019-02-05 | 免疫医疗公司 | 抗trop-2-sn-38抗体药物缀合物用于检查点抑制剂复发/难治的肿瘤的疗法的功效 |
TW201808343A (zh) | 2016-08-09 | 2018-03-16 | 美商西雅圖遺傳學公司 | 具有改善之生理化學性質之具自我穩定連接子之藥物結合物 |
EP3525828A1 (en) * | 2016-10-17 | 2019-08-21 | Pfizer Inc | Anti-edb antibodies and antibody-drug conjugates |
CN108066772B (zh) * | 2016-11-14 | 2021-07-13 | 中国科学院上海药物研究所 | 靶向tacstd2的抗体与药物偶联体(adc)分子 |
WO2018094275A1 (en) | 2016-11-18 | 2018-05-24 | Tolero Pharmaceuticals, Inc. | Alvocidib prodrugs and their use as protein kinase inhibitors |
CA3046293A1 (en) | 2016-12-12 | 2018-06-21 | Daiichi Sankyo Company, Limited | Combination of antibody-drug conjugate and immune checkpoint inhibitor |
MX2019007332A (es) | 2016-12-19 | 2019-11-18 | Tolero Pharmaceuticals Inc | Péptidos indicadores y métodos para caracterizar sensibilidad. |
CA3048211A1 (en) * | 2016-12-23 | 2018-06-28 | Macrogenics, Inc. | Adam9-binding molecules, and methods of use thereof |
EP3572428A4 (en) | 2017-01-17 | 2020-12-30 | Daiichi Sankyo Company, Limited | ANTI-GPR20 ANTIBODY AND ANTI-GPR20 ANTIBODY MEDICINAL CONJUGATE |
TW201834696A (zh) | 2017-02-28 | 2018-10-01 | 學校法人近畿大學 | 藉由投予抗her3抗體-藥物複合體之egfr-tki抗性之非小細胞肺癌的治療方法 |
CN108727208B (zh) * | 2017-03-07 | 2020-06-30 | 天津键凯科技有限公司 | 一种连接子化合物、聚乙二醇-连接子结合物及其衍生物和聚乙二醇-连接子-药物结合物 |
US10918734B2 (en) | 2017-03-27 | 2021-02-16 | Immunomedics, Inc. | Treatment of high Trop-2 expressing triple negative breast cancer (TNBC) with sacituzumab govitecan (IMMU-132) overcomes homologous recombination repair (HRR) rescue mediated by Rad51 |
WO2018187074A1 (en) * | 2017-04-03 | 2018-10-11 | Immunomedics, Inc. | Subcutaneous administration of antibody-drug conjugates for cancer therapy |
KR101957563B1 (ko) | 2017-04-07 | 2019-03-12 | 영남대학교 산학협력단 | 나노 그래핀 산화물의 제조장치, 나노 그래핀 산화물을 포함하는 나노 복합체 및 이의 제조장치 |
TW202330036A (zh) | 2017-05-15 | 2023-08-01 | 日商第一三共股份有限公司 | 抗體-藥物結合物之製造方法 |
US11471490B2 (en) | 2017-07-03 | 2022-10-18 | Torque Therapeutics, Inc. | T cells surface-loaded with immunostimulatory fusion molecules and uses thereof |
CN109106951A (zh) * | 2017-08-18 | 2019-01-01 | 四川百利药业有限责任公司 | 一种喜树碱-抗体偶联物 |
WO2019034175A1 (zh) * | 2017-08-18 | 2019-02-21 | 四川百利药业有限责任公司 | 一种非天然鹅膏毒肽类抗体偶联物 |
WO2019044947A1 (ja) | 2017-08-31 | 2019-03-07 | 第一三共株式会社 | 抗体-薬物コンジュゲートの改良製造方法 |
CN117838881A (zh) | 2017-08-31 | 2024-04-09 | 第一三共株式会社 | 制备抗体-药物缀合物的新方法 |
JP7196160B2 (ja) | 2017-09-12 | 2022-12-26 | スミトモ ファーマ オンコロジー, インコーポレイテッド | Mcl-1阻害剤アルボシジブを用いた、bcl-2阻害剤に対して非感受性である癌の治療レジメン |
WO2019067682A1 (en) * | 2017-09-29 | 2019-04-04 | Regeneron Pharmaceuticals, Inc. | BISPECIFIC ANTIGEN-BINDING MOLECULES BINDING TO TARGET STAPHYLOCOCCUS ANTIGEN AND COMPONENT COMPONENT, AND USES THEREOF |
CN109589415B (zh) | 2017-09-30 | 2022-02-18 | 天津键凯科技有限公司 | 一种聚乙二醇-多肽和蛋白类药物的结合物 |
CN114668852A (zh) * | 2017-09-30 | 2022-06-28 | 天津键凯科技有限公司 | 一种聚乙二醇-多肽和蛋白类药物的结合物 |
CN111542324B (zh) * | 2018-02-11 | 2023-09-12 | 四川科伦博泰生物医药股份有限公司 | 细胞毒性剂及其偶联物、其制备方法及用途 |
AU2019261982A1 (en) | 2018-04-30 | 2020-10-15 | Amicus Therapeutics, Inc. | Gene therapy constructs and methods of use |
EP4257611A3 (en) | 2018-05-18 | 2024-03-06 | Glycotope GmbH | Anti-muc1 antibody |
EP3842546A4 (en) | 2018-08-23 | 2022-06-29 | Daiichi Sankyo Company, Limited | Sensitivity marker for antibody-drug conjugate |
KR20210062005A (ko) | 2018-09-20 | 2021-05-28 | 다이이찌 산쿄 가부시키가이샤 | 항 her3 항체-약물 콘쥬게이트 투여에 의한 her3 변이암의 치료 |
BR112021006829A2 (pt) | 2018-10-10 | 2021-07-20 | Amicus Therapeutics, Inc. | composições de polipeptídeos estabilizados com ligações dissulfeto e métodos de uso |
EP3890749A4 (en) | 2018-12-04 | 2022-08-03 | Sumitomo Dainippon Pharma Oncology, Inc. | CDK9 INHIBITORS AND POLYMORPHS THEREOF FOR USE AS CANCER TREATMENT AGENT |
US20220106566A1 (en) * | 2019-01-22 | 2022-04-07 | The Brigham And Women`S Hospital, Inc. | Antigen-Presenting Neutrophil-Derived Dendritic Cells and Methods of Use Thereof |
US11793802B2 (en) | 2019-03-20 | 2023-10-24 | Sumitomo Pharma Oncology, Inc. | Treatment of acute myeloid leukemia (AML) with venetoclax failure |
WO2020191344A1 (en) | 2019-03-20 | 2020-09-24 | The Regents Of The University Of California | Claudin-6 bispecific antibodies |
CA3134055A1 (en) | 2019-03-20 | 2020-09-24 | The Regents Of The University Of California | Claudin-6 antibodies and drug conjugates |
AU2020285681A1 (en) | 2019-05-29 | 2022-01-27 | Daiichi Sankyo Company, Limited | Dosage of an antibody-drug conjugate |
CN112138171A (zh) * | 2019-06-28 | 2020-12-29 | 上海复旦张江生物医药股份有限公司 | 抗体偶联药物、其中间体、制备方法及应用 |
CN114341141A (zh) | 2019-07-11 | 2022-04-12 | 太阳医药高级研究有限公司 | 具有二硫部分和哌嗪部分的喜树碱衍生物 |
CN115398010A (zh) | 2020-03-20 | 2022-11-25 | 免疫医疗公司 | 用于戈沙妥珠单抗疗法的生物标志物 |
CA3176626A1 (en) | 2020-05-08 | 2021-11-11 | David Dornan | Elastase-substrate, peptide linker immunoconjugates, and uses thereof |
US11767353B2 (en) | 2020-06-05 | 2023-09-26 | Theraly Fibrosis, Inc. | Trail compositions with reduced immunogenicity |
CN115515644A (zh) * | 2020-06-28 | 2022-12-23 | 昆山新蕴达生物科技有限公司 | 一种抗体-药物偶联物,其制备方法及应用 |
KR20230041023A (ko) | 2020-07-17 | 2023-03-23 | 다이이찌 산쿄 가부시키가이샤 | 항체-약물 콘주게이트의 제조 방법 |
GB202011993D0 (en) | 2020-07-31 | 2020-09-16 | Adc Therapeutics Sa | ANTI-IL 13Ra2 antibodies |
CN116234586A (zh) | 2020-08-13 | 2023-06-06 | 博尔特生物治疗药物有限公司 | 吡唑并氮呯免疫缀合物及其用途 |
TW202300175A (zh) | 2021-03-26 | 2023-01-01 | 美商博特生物治療公司 | 2-胺基-4-羧醯胺-苯并氮呯免疫結合物及其用途 |
CN117769439A (zh) | 2021-03-26 | 2024-03-26 | 博尔特生物治疗药物有限公司 | 2-氨基-4-甲酰胺-苯并氮杂卓免疫缀合物及其用途 |
CA3215049A1 (en) | 2021-04-10 | 2022-10-13 | Baiteng ZHAO | Folr1 binding agents, conjugates thereof and methods of using the same |
TW202308699A (zh) | 2021-04-23 | 2023-03-01 | 美商普方生物製藥美國公司 | Cd70結合劑、其結合物及其使用方法 |
WO2022245671A1 (en) | 2021-05-18 | 2022-11-24 | Gilead Sciences, Inc. | Methods of using flt3l-fc fusion proteins |
US11931424B2 (en) | 2021-06-11 | 2024-03-19 | Gilead Sciences, Inc. | Combination MCL-1 inhibitors with anti-body drug conjugates |
KR20240019283A (ko) | 2021-06-11 | 2024-02-14 | 길리애드 사이언시즈, 인코포레이티드 | Mcl-1 저해제와 항암제의 병용 |
WO2023076983A1 (en) | 2021-10-28 | 2023-05-04 | Gilead Sciences, Inc. | Pyridizin-3(2h)-one derivatives |
CA3234604A1 (en) | 2021-10-29 | 2023-05-04 | Shelley Erin ACKERMAN | Tlr agonist immunoconjugates with cysteine-mutant antibodies, and uses thereof |
CA3235986A1 (en) | 2021-10-29 | 2023-05-04 | Gilead Science, Inc. | Cd73 compounds |
WO2023078230A1 (zh) | 2021-11-02 | 2023-05-11 | 烟台迈百瑞国际生物医药股份有限公司 | 一种包含sn38的抗体药物偶联物中间体及其制备方法 |
CA3238167A1 (en) | 2021-11-19 | 2023-05-25 | Maria Leia Smith | Gpc3 binding agents, conjugates thereof and methods of using the same |
TW202334238A (zh) | 2021-11-30 | 2023-09-01 | 日商第一三共股份有限公司 | 蛋白酶分解性遮蔽抗體 |
AU2022417491A1 (en) | 2021-12-22 | 2024-05-23 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
AU2022419982A1 (en) | 2021-12-22 | 2024-06-06 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
CN115594766A (zh) * | 2021-12-30 | 2023-01-13 | 辽宁键凯科技有限公司(Cn) | 一种缀合物及用其制备的抗体偶联药物 |
TW202340168A (zh) | 2022-01-28 | 2023-10-16 | 美商基利科學股份有限公司 | Parp7抑制劑 |
WO2023151679A1 (en) * | 2022-02-11 | 2023-08-17 | Shenzhen Enduring Biotech , Ltd. | Pegylated antibody hydroxyl-bearing drug conjugate |
TW202346277A (zh) | 2022-03-17 | 2023-12-01 | 美商基利科學股份有限公司 | Ikaros鋅指家族降解劑及其用途 |
US20230355796A1 (en) | 2022-03-24 | 2023-11-09 | Gilead Sciences, Inc. | Combination therapy for treating trop-2 expressing cancers |
WO2023201268A1 (en) | 2022-04-13 | 2023-10-19 | Gilead Sciences, Inc. | Combination therapy for treating tumor antigen expressing cancers |
WO2023201267A1 (en) | 2022-04-13 | 2023-10-19 | Gilead Sciences, Inc. | Combination therapy for treating trop-2 expressing cancers |
TW202400138A (zh) | 2022-04-21 | 2024-01-01 | 美商基利科學股份有限公司 | Kras g12d調節化合物 |
WO2024006929A1 (en) | 2022-07-01 | 2024-01-04 | Gilead Sciences, Inc. | Cd73 compounds |
WO2024081372A1 (en) | 2022-10-14 | 2024-04-18 | Gilead Sciences, Inc. | Processes for the preparation of the agent-linker conjugate cl2a-sn-38 and the immunoconjugates sacituzumab govitecan and labetuzumab govetican |
WO2024097812A1 (en) | 2022-11-04 | 2024-05-10 | Gilead Sciences, Inc. | Therapy for treating bladder cancer |
WO2024116094A1 (en) | 2022-11-30 | 2024-06-06 | Daiichi Sankyo Company, Limited | Combination of antibody-drug conjugates and dnmt inhibitors |
Family Cites Families (273)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US672015A (en) | 1900-10-05 | 1901-04-16 | Alfred Schlatter | Automatic switch for groups of transformers. |
US2676403A (en) | 1951-10-10 | 1954-04-27 | Gray Rosa | Hand-held motor-driven shear |
US3927193A (en) | 1973-05-18 | 1975-12-16 | Hoffmann La Roche | Localization of tumors by radiolabelled antibodies |
US4036945A (en) | 1976-05-03 | 1977-07-19 | The Massachusetts General Hospital | Composition and method for determining the size and location of myocardial infarcts |
US4303004A (en) | 1978-05-31 | 1981-12-01 | Karl Eickmann | Snap ring assembly for two bodies |
US4348376A (en) | 1980-03-03 | 1982-09-07 | Goldenberg Milton David | Tumor localization and therapy with labeled anti-CEA antibody |
US4361544A (en) | 1980-03-03 | 1982-11-30 | Goldenberg Milton David | Tumor localization and therapy with labeled antibodies specific to intracellular tumor-associated markers |
US4444744A (en) | 1980-03-03 | 1984-04-24 | Goldenberg Milton David | Tumor localization and therapy with labeled antibodies to cell surface antigens |
US4331647A (en) | 1980-03-03 | 1982-05-25 | Goldenberg Milton David | Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers |
US4359457A (en) | 1980-09-30 | 1982-11-16 | Neville Jr David M | Anti Thy 1.2 monoclonal antibody-ricin hybrid utilized as a tumor suppressant |
US4554101A (en) | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
US4468457A (en) | 1981-06-01 | 1984-08-28 | David M. Goldenberg | Method for producing a CSAp tryptic peptide and anti-CSAp antibodies |
US4818709A (en) | 1983-01-21 | 1989-04-04 | Primus Frederick J | CEA-family antigens, Anti-CEA antibodies and CEA immunoassay |
US4624846A (en) | 1983-07-29 | 1986-11-25 | Immunomedics, Inc. | Method for enhancing target specificity of antibody localization and clearance of non-target diagnostic and therapeutic principles |
US4824659A (en) | 1985-06-07 | 1989-04-25 | Immunomedics, Inc. | Antibody conjugates |
US5776093A (en) | 1985-07-05 | 1998-07-07 | Immunomedics, Inc. | Method for imaging and treating organs and tissues |
US5525338A (en) | 1992-08-21 | 1996-06-11 | Immunomedics, Inc. | Detection and therapy of lesions with biotin/avidin conjugates |
US4699784A (en) | 1986-02-25 | 1987-10-13 | Center For Molecular Medicine & Immunology | Tumoricidal methotrexate-antibody conjugate |
US6861511B1 (en) | 1986-06-04 | 2005-03-01 | Bayer Corporation | Detection and quantification of neu related proteins in the biological fluids of humans |
US4997913A (en) | 1986-06-30 | 1991-03-05 | Oncogen | pH-sensitive immunoconjugates and methods for their use in tumor therapy |
US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
US6893625B1 (en) | 1986-10-27 | 2005-05-17 | Royalty Pharma Finance Trust | Chimeric antibody with specificity to human B cell surface antigen |
IL85035A0 (en) | 1987-01-08 | 1988-06-30 | Int Genetic Eng | Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same |
US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
US4981979A (en) | 1987-09-10 | 1991-01-01 | Neorx Corporation | Immunoconjugates joined by thioether bonds having reduced toxicity and improved selectivity |
US4943579A (en) | 1987-10-06 | 1990-07-24 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Water soluble prodrugs of camptothecin |
US5831034A (en) | 1987-11-13 | 1998-11-03 | Hermann Katinger | Human monoclonal anti-HIV-I-antibodies |
US6511665B1 (en) | 1987-11-25 | 2003-01-28 | Immunex Corporation | Antibodies to interleukin-1 receptors |
US5112954A (en) | 1988-02-26 | 1992-05-12 | Neorx Corporation | Method of enhancing the effect of cytotoxic agents |
US5120525A (en) | 1988-03-29 | 1992-06-09 | Immunomedics, Inc. | Radiolabeled antibody cytotoxic therapy of cancer |
US5612016A (en) | 1988-04-01 | 1997-03-18 | Immunomedics, Inc. | Conjugates of antibodies and bifunctional ligands |
US5541297A (en) | 1988-04-01 | 1996-07-30 | Immunomedics, Inc. | Therapeutic conjugates of toxins and drugs |
US20030068322A1 (en) | 1988-04-18 | 2003-04-10 | Immunomedics, Inc. | Methods of antibody-directed enzyme-prodrug therapy |
US4925648A (en) | 1988-07-29 | 1990-05-15 | Immunomedics, Inc. | Detection and treatment of infectious and inflammatory lesions |
US5439665A (en) | 1988-07-29 | 1995-08-08 | Immunomedics | Detection and treatment of infectious and inflammatory lesions |
US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
US6362325B1 (en) | 1988-11-07 | 2002-03-26 | Advanced Research And Technology Institute, Inc. | Murine 4-1BB gene |
US6352694B1 (en) | 1994-06-03 | 2002-03-05 | Genetics Institute, Inc. | Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells |
US5571714A (en) | 1988-12-22 | 1996-11-05 | Celtrix Pharmaceuticals, Inc. | Monoclonal antibodies which bind both transforming growth factors β1 and β2 and methods of use |
US6432402B1 (en) | 1989-05-25 | 2002-08-13 | Sloan-Kettering Institute For Cancer Research | Anti-idiotypic antibody which induces an immune response against a glycosphingolipid and use thereof |
EP0432249B1 (en) | 1989-06-02 | 1996-09-25 | The Johns Hopkins University School Of Medicine | Monoclonal antibodies against leukocyte adhesion receptor beta-chain, methods of producing these antibodies and use therefore |
US5332567A (en) | 1989-08-24 | 1994-07-26 | Immunomedics | Detection and treatment of infections with immunoconjugates |
KR0162259B1 (ko) | 1989-12-05 | 1998-12-01 | 아미 펙터 | 감염성 병변 및 염증성 병변을 검출 및 치료하기 위한 키메라 항체 |
SG46445A1 (en) | 1990-01-26 | 1998-02-20 | Immunomedics Inc | Vaccines against cancer and infectious diseases |
IL97459A0 (en) | 1990-03-09 | 1992-06-21 | Hybritech Inc | Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent |
US7041293B1 (en) | 1990-04-03 | 2006-05-09 | Genentech, Inc. | HIV env antibodies |
US5229275A (en) | 1990-04-26 | 1993-07-20 | Akzo N.V. | In-vitro method for producing antigen-specific human monoclonal antibodies |
US5252296A (en) | 1990-05-15 | 1993-10-12 | Chiron Corporation | Method and apparatus for biopolymer synthesis |
US5496938A (en) | 1990-06-11 | 1996-03-05 | Nexstar Pharmaceuticals, Inc. | Nucleic acid ligands to HIV-RT and HIV-1 rev |
US5270163A (en) | 1990-06-11 | 1993-12-14 | University Research Corporation | Methods for identifying nucleic acid ligands |
KR970002255B1 (ko) | 1990-06-11 | 1997-02-26 | 넥스스타 파아마슈티컬드, 인크. | 핵산 리간드 |
US5637459A (en) | 1990-06-11 | 1997-06-10 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: chimeric selex |
US5582981A (en) | 1991-08-14 | 1996-12-10 | Gilead Sciences, Inc. | Method for identifying an oligonucleotide aptamer specific for a target |
US6764681B2 (en) | 1991-10-07 | 2004-07-20 | Biogen, Inc. | Method of prophylaxis or treatment of antigen presenting cell driven skin conditions using inhibitors of the CD2/LFA-3 interaction |
US5854416A (en) | 1991-11-14 | 1998-12-29 | The United States Of America As Represented By The Department Of Health And Human Services | Streptococcus pneumoniae 37-KDA surface adhesin a protein and nucleic acids coding therefor |
US5474771A (en) | 1991-11-15 | 1995-12-12 | The Trustees Of Columbia University In The City Of New York | Murine monoclonal antibody (5c8) recognizes a human glycoprotein on the surface of T-lymphocytes, compositions containing same |
US5622929A (en) | 1992-01-23 | 1997-04-22 | Bristol-Myers Squibb Company | Thioether conjugates |
AU3657693A (en) | 1992-01-29 | 1993-09-01 | Regents Of The University Of California, The | Carcinoma associated antigen (SK1) monoclonal antibodies against SK1, methods of producing these antibodies and use therfor |
ATE255902T1 (de) | 1992-03-09 | 2003-12-15 | San Diego Regional Cancer Ct | Ein anti-idiotypischer antikörper und seine verwendung in der diagnose und therapie von hiv- verwandten krankheiten |
US6129914A (en) | 1992-03-27 | 2000-10-10 | Protein Design Labs, Inc. | Bispecific antibody effective to treat B-cell lymphoma and cell line |
US5578704A (en) | 1992-04-03 | 1996-11-26 | Genentech, Inc. | Antibody to osteoclast alphavbeta3 ntegrin |
US6096289A (en) | 1992-05-06 | 2000-08-01 | Immunomedics, Inc. | Intraoperative, intravascular, and endoscopic tumor and lesion detection, biopsy and therapy |
CA2133580A1 (en) | 1992-05-06 | 1993-11-11 | David M. Goldenberg | Intraoperative, intravascular and endoscopic tumor and lesion detection and therapy |
WO1993023556A1 (en) | 1992-05-08 | 1993-11-25 | Genentech, Inc. | Antibodies to leukemia inhibitory factor |
US5686072A (en) | 1992-06-17 | 1997-11-11 | Board Of Regents, The University Of Texas | Epitope-specific monoclonal antibodies and immunotoxins and uses thereof |
US5397703A (en) | 1992-07-09 | 1995-03-14 | Cetus Oncology Corporation | Method for generation of antibodies to cell surface molecules |
EP0752248B1 (en) | 1992-11-13 | 2000-09-27 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma |
US6214345B1 (en) * | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
US6120768A (en) | 1993-05-17 | 2000-09-19 | Immunomedics, Inc. | Dota-biotin derivatives |
WO1994026297A1 (en) | 1993-05-17 | 1994-11-24 | Immunomedics, Inc. | Improved detection and therapy of lesions with biotin/avidin-metal chelating protein conjugates |
WO1994028025A1 (en) | 1993-05-28 | 1994-12-08 | The Scripps Research Institute | Methods and compositions for inhibiting cd14 mediated cell activation |
US6084067A (en) | 1993-07-26 | 2000-07-04 | Dana-Farber Cancer Institute | CTLA4/CD28 ligands and uses therefor |
UA40577C2 (uk) | 1993-08-02 | 2001-08-15 | Мерк Патент Гмбх | Біспецифічна молекула, що використовується для лізису пухлинних клітин, спосіб її одержання, моноклональне антитіло (варіанти), фармацевтичний препарат, фармацевтичний набір (варіанти), спосіб видалення пухлинних клітин |
US6468531B1 (en) | 1993-09-09 | 2002-10-22 | Duke University | Method of promoting cellular function |
US5824701A (en) | 1993-10-20 | 1998-10-20 | Enzon, Inc. | Taxane-based prodrugs |
WO1995014040A1 (en) | 1993-11-19 | 1995-05-26 | Baylor College Of Medicine | Monoclonal antibodies specific for human interleukin-5 |
US5492807A (en) | 1993-11-19 | 1996-02-20 | Santi; Daniel V. | Method of obtaining diagnostic reagents, assays and therapeutics based on clinical manifestations of a disease |
US5443953A (en) | 1993-12-08 | 1995-08-22 | Immunomedics, Inc. | Preparation and use of immunoconjugates |
US6432404B1 (en) | 1993-12-23 | 2002-08-13 | Icos Corporation | Methods of inhibiting locomotor damage following spinal cord injury with α D-specific antibodies |
US5922572A (en) | 1994-01-25 | 1999-07-13 | Human Genome Sciences, Inc. | Polynucleotides encoding haemopoietic maturation factor |
US6074642A (en) | 1994-05-02 | 2000-06-13 | Alexion Pharmaceuticals, Inc. | Use of antibodies specific to human complement component C5 for the treatment of glomerulonephritis |
US6100389A (en) | 1995-04-21 | 2000-08-08 | Human Genome Sciences, Inc. | Polynucleotides encoding a human chemotactic protein |
US5798100A (en) | 1994-07-06 | 1998-08-25 | Immunomedics, Inc. | Multi-stage cascade boosting vaccine |
US6303769B1 (en) | 1994-07-08 | 2001-10-16 | Immunex Corporation | Lerk-5 dna |
CA2195557C (en) | 1994-08-12 | 2006-10-17 | Shui-On Leung | Immunoconjugates and humanized antibodies specific for b-cell lymphoma and leukemia cells |
US5587459A (en) | 1994-08-19 | 1996-12-24 | Regents Of The University Of Minnesota | Immunoconjugates comprising tyrosine kinase inhibitors |
US6174995B1 (en) | 1994-08-23 | 2001-01-16 | Haodong Li | Human chemokines, CKβ4 and CKβ10/MCP-4 |
US6458349B1 (en) | 1995-06-02 | 2002-10-01 | Human Genome Sciences, Inc. | Chemokine β-4 polypeptides |
US6709653B1 (en) | 1994-09-16 | 2004-03-23 | Human Genome Sciences, Inc. | Antibodies specific for human inositol monophosphatase H1 |
US5874540A (en) | 1994-10-05 | 1999-02-23 | Immunomedics, Inc. | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies |
US5750370A (en) | 1995-06-06 | 1998-05-12 | Human Genome Sciences, Inc. | Nucleic acid encoding human endothlein-bombesin receptor and method of producing the receptor |
US6538121B1 (en) | 1994-11-01 | 2003-03-25 | Human Genome Sciences, Inc. | Interleukin-1 β converting enzyme like apoptosis protease-3 and 4 |
US5677136A (en) | 1994-11-14 | 1997-10-14 | Systemix, Inc. | Methods of obtaining compositions enriched for hematopoietic stem cells, compositions derived therefrom and methods of use thereof |
US6521227B1 (en) | 1999-11-18 | 2003-02-18 | Peter L. Hudson | Polynucleotides encoding prostatic growth factor and process for producing prostatic growth factor polypeptides |
US6537764B1 (en) | 1995-01-19 | 2003-03-25 | Children's Medical Center Corporation | Method of identifying inhibitors of C—C chemokine receptor 3 |
US5786204A (en) | 1995-01-20 | 1998-07-28 | Human Genome Sciences, Inc. | Human prostatic specific reductase |
US6312691B1 (en) | 1996-01-26 | 2001-11-06 | Jeffrey L. Browning | Lymphotoxin-α/β complexes and anti-lympotoxin-β receptor antibodies as anti-tumor agents |
US6949244B1 (en) | 1995-12-20 | 2005-09-27 | The Board Of Trustees Of The University Of Kentucky | Murine monoclonal anti-idiotype antibody 11D10 and methods of use thereof |
US5783404A (en) | 1995-04-13 | 1998-07-21 | Amgen Inc. | Methods and compositions for determining HER-2/neu expression using monoclonal antibodies |
DE69527089T2 (de) | 1995-04-19 | 2003-01-02 | Polymun Scient Immunbio Forsch | Monoklonale antikörper gegen hiv-1 und davon hergestellte impfstoffe |
US5686292A (en) | 1995-06-02 | 1997-11-11 | Genentech, Inc. | Hepatocyte growth factor receptor antagonist antibodies and uses thereof |
US5773252A (en) | 1995-06-05 | 1998-06-30 | Human Genome Sciences, Inc. | Fibroblast growth factor 15 |
US5773292A (en) | 1995-06-05 | 1998-06-30 | Cornell University | Antibodies binding portions, and probes recognizing an antigen of prostate epithelial cells but not antigens circulating in the blood |
US6605441B1 (en) | 1995-06-05 | 2003-08-12 | Human Genome Sciences, Inc. | Antibodies against fibroblast growth factor 11 |
WO1996040875A1 (en) | 1995-06-07 | 1996-12-19 | Novartis Ag | Methods for obtaining compositions enriched for hematopoietic stem cells and antibodies for use therein |
US5622699A (en) | 1995-09-11 | 1997-04-22 | La Jolla Cancer Research Foundation | Method of identifying molecules that home to a selected organ in vivo |
US6068829A (en) | 1995-09-11 | 2000-05-30 | The Burnham Institute | Method of identifying molecules that home to a selected organ in vivo |
US6340459B1 (en) | 1995-12-01 | 2002-01-22 | The Trustees Of Columbia University In The City Of New York | Therapeutic applications for the anti-T-BAM (CD40-L) monoclonal antibody 5C8 in the treatment of reperfusion injury in non-transplant recipients |
US5783186A (en) | 1995-12-05 | 1998-07-21 | Amgen Inc. | Antibody-induced apoptosis |
US6441025B2 (en) | 1996-03-12 | 2002-08-27 | Pg-Txl Company, L.P. | Water soluble paclitaxel derivatives |
US5945309A (en) | 1996-03-19 | 1999-08-31 | Human Genome Sciences, Inc. | Cytostatin III nucleic acids encoding |
US6730300B2 (en) | 1996-03-20 | 2004-05-04 | Immunomedics, Inc. | Humanization of an anti-carcinoembryonic antigen anti-idiotype antibody and use as a tumor vaccine and for targeting applications |
EP0888125B1 (en) | 1996-03-20 | 2004-05-26 | Immunomedics, Inc. | GLYCOSYLATED IgG ANTIBODIES |
US6174992B1 (en) | 1997-03-21 | 2001-01-16 | Human Genome Sciences, Inc. | Human endometrial specific steroid-binding factor I, II and III |
FR2746398B1 (fr) | 1996-03-21 | 1998-04-30 | Bio Merieux | Anticorps specifique de staphylococcus aureaus, et utilisations |
US6962981B1 (en) | 1996-03-25 | 2005-11-08 | Medarex, Inc. | Monoclonal antibodies specific for the extracellular domain of prostate-specific membrane antigen |
US6004780A (en) | 1996-03-26 | 1999-12-21 | Human Genome Sciences, Inc. | Growth factor HTTER36 |
US6110463A (en) | 1996-03-29 | 2000-08-29 | North Carolina State University | Anti-Cryptosporidium parvum preparations |
US6066617A (en) | 1996-04-03 | 2000-05-23 | Human Genome Sciences, Inc. | Human cystatin F |
WO1997041898A1 (en) | 1996-05-03 | 1997-11-13 | Immunomedics, Inc. | Targeted combination immunotherapy of cancer |
US6136311A (en) | 1996-05-06 | 2000-10-24 | Cornell Research Foundation, Inc. | Treatment and diagnosis of cancer |
US6107090A (en) | 1996-05-06 | 2000-08-22 | Cornell Research Foundation, Inc. | Treatment and diagnosis of prostate cancer with antibodies to extracellur PSMA domains |
US6558669B1 (en) | 1996-08-28 | 2003-05-06 | Immunomedics, Inc. | Stable radioiodine conjugates and methods for their synthesis |
US6764688B2 (en) | 1996-09-03 | 2004-07-20 | Kaneka Corporation | Method for inducing immunosuppressive cells and a culture device to be used therefor |
DE19640207A1 (de) * | 1996-09-30 | 1998-04-02 | Bayer Ag | Glycokonjugate von modifizierten Camptothecin-Derivaten (A- oder B-Ring-Verknüpfung) |
AU744637B2 (en) | 1996-10-09 | 2002-02-28 | Corporation Of The Trustees Of The Order Of The Sisters Of Mercy In Queensland, The | Dendritic cell-specific antibodies |
US6395276B1 (en) | 1997-05-02 | 2002-05-28 | Immunomedics, Inc. | Immunotoxins directed against malignant cells |
AU729515B2 (en) | 1996-10-17 | 2001-02-01 | Immunomedics Inc. | Non-antigenic toxin-conjugate and fusion protein of internalizing receptor system |
US6653104B2 (en) | 1996-10-17 | 2003-11-25 | Immunomedics, Inc. | Immunotoxins, comprising an internalizing antibody, directed against malignant and normal cells |
US6812327B1 (en) | 1996-10-25 | 2004-11-02 | Human Genome Sciences, Inc. | Neutrokine-alpha polypeptides |
US6528625B1 (en) | 1996-10-28 | 2003-03-04 | Millennium Pharmaceuticals, Inc. | Anti-CCR5 antibodies and kits comprising same |
WO1998021334A2 (en) | 1996-11-13 | 1998-05-22 | Morphogenesis, Inc. | Antibody mg1 recognizing a small subset of human hematopoietic cells |
US6455040B1 (en) | 1997-01-14 | 2002-09-24 | Human Genome Sciences, Inc. | Tumor necrosis factor receptor 5 |
US6605699B1 (en) | 1997-01-21 | 2003-08-12 | Human Genome Sciences, Inc. | Galectin-11 polypeptides |
AU6241698A (en) | 1997-01-21 | 1998-08-07 | Human Genome Sciences, Inc. | Tace-like and matrilysin-like polypeptides |
ATE362982T1 (de) | 1997-01-28 | 2007-06-15 | Human Genome Sciences Inc | ßDEATH-DOMAINß-ENTHALTENDER REZEPTOR 4 (DR4), EIN MITGLIED DER TNF-REZEPTOR SUPERFAMILIE, WELCHER AN TRAIL (APO-2L) BINDET |
US7122636B1 (en) | 1997-02-21 | 2006-10-17 | Genentech, Inc. | Antibody fragment-polymer conjugates and uses of same |
JP2001523956A (ja) | 1997-03-03 | 2001-11-27 | ブリストル−マイヤーズ・スクイブ・カンパニー | ヒトcd6に対するモノクローナル抗体 |
US6951924B2 (en) | 1997-03-14 | 2005-10-04 | Human Genome Sciences, Inc. | Antibodies against secreted protein HTEBYII |
US6919433B2 (en) | 1997-03-14 | 2005-07-19 | Human Genome Sciences, Inc. | Antibodies to protein HPMBQ91 |
US6872568B1 (en) | 1997-03-17 | 2005-03-29 | Human Genome Sciences, Inc. | Death domain containing receptor 5 antibodies |
US6183744B1 (en) | 1997-03-24 | 2001-02-06 | Immunomedics, Inc. | Immunotherapy of B-cell malignancies using anti-CD22 antibodies |
US6306393B1 (en) | 1997-03-24 | 2001-10-23 | Immunomedics, Inc. | Immunotherapy of B-cell malignancies using anti-CD22 antibodies |
US6284474B1 (en) | 1998-04-23 | 2001-09-04 | The Regents Of The University Of California | Detection and diagnosis of conditions associated with lung injury |
US6372217B1 (en) | 1997-06-03 | 2002-04-16 | Regents Of The University Of Minnesota | Methods for the treatment of CD7+ viral infection with TXU-7-PAP |
US6545130B2 (en) | 1997-06-04 | 2003-04-08 | Albert Einstein College Of Medicine Of Yeshiva University | Monoclonal antibodies to mycobacterium tuberculosis and a modified ELISA assay |
US6358508B1 (en) | 1997-06-11 | 2002-03-19 | Human Genome Sciences, Inc. | Antibodies to human tumor necrosis factor receptor TR9 |
WO1999011590A1 (en) | 1997-09-03 | 1999-03-11 | Immunomedics, Inc. | Fluorination of proteins and peptides for f-18 positron emission tomography |
IL134578A0 (en) | 1997-09-18 | 2001-04-30 | Genentech Inc | DcR3 POLYPEPTIDE, A TNFR HOMOLOG |
US6689607B2 (en) | 1997-10-21 | 2004-02-10 | Human Genome Sciences, Inc. | Human tumor, necrosis factor receptor-like proteins TR11, TR11SV1 and TR11SV2 |
US6355244B1 (en) | 1997-11-17 | 2002-03-12 | University Of Kentucky Research Foundation | Methods and compositions for the treatment of psoriasis |
US6610833B1 (en) | 1997-11-24 | 2003-08-26 | The Institute For Human Genetics And Biochemistry | Monoclonal human natural antibodies |
US6562618B1 (en) | 1997-12-25 | 2003-05-13 | Japan Tobacco, Inc. | Monoclonal antibody against connective tissue growth factor and medicinal uses thereof |
DE19801437A1 (de) | 1998-01-16 | 1999-07-22 | Basf Ag | Verfahren zur Herstellung von Aldehyden |
US6956107B2 (en) | 1998-02-20 | 2005-10-18 | Tanox, Inc. | Inhibitors of complement activation |
US6861227B2 (en) | 1998-03-19 | 2005-03-01 | Human Genome Sciences, Inc. | Antibodies to cytokine receptor common gamma chain like |
US6200765B1 (en) | 1998-05-04 | 2001-03-13 | Pacific Northwest Cancer Foundation | Non-invasive methods to detect prostate cancer |
US6071490A (en) | 1998-05-07 | 2000-06-06 | Immunomedics, Inc. | Position emission tomography using gallium-68 chelates |
EP1079862B1 (en) | 1998-05-20 | 2010-07-07 | Immunomedics, Inc. | Therapeutics using a bispecific anti-hla class ii invariant chain x anti-pathogen antibody |
EP1085905B1 (en) | 1998-06-15 | 2010-09-08 | Quest Pharmatech Inc. | Immunotherapeutic composition and method for the treatment of prostate cancer |
US6528269B1 (en) | 1998-06-22 | 2003-03-04 | Case Western Reserve University | Immunological agents specific for prion protein (PRP) |
US7387772B1 (en) | 1999-06-22 | 2008-06-17 | Immunimedics, Inc. | Chimeric, human and humanized anti-CSAP monoclonal antibodies |
US7405320B2 (en) | 1998-06-22 | 2008-07-29 | Immunomedics, Inc. | Therapeutic and diagnostic conjugates for use with multispecific antibodies |
US6962702B2 (en) | 1998-06-22 | 2005-11-08 | Immunomedics Inc. | Production and use of novel peptide-based agents for use with bi-specific antibodies |
US7138103B2 (en) | 1998-06-22 | 2006-11-21 | Immunomedics, Inc. | Use of bi-specific antibodies for pre-targeting diagnosis and therapy |
US6312689B1 (en) | 1998-07-23 | 2001-11-06 | Millennium Pharmaceuticals, Inc. | Anti-CCR2 antibodies and methods of use therefor |
US6572856B1 (en) | 1998-09-10 | 2003-06-03 | The University Of Virginia Patent Foundation | Methods for the prevention and treatment of cancer using anti-C3b(i) antibodies |
US6818749B1 (en) | 1998-10-31 | 2004-11-16 | The United States Of America As Represented By The Department Of Health And Human Services | Variants of humanized anti carcinoma monoclonal antibody cc49 |
US6692908B1 (en) | 1998-11-05 | 2004-02-17 | Stanford University | Prevention and treatment of HCV infection employing antibodies that inhibit the interaction of HCV virions with their receptor |
PT1140175E (pt) | 1998-12-21 | 2006-06-30 | Ludwig Inst Cancer Res | Anticorpos para o vegf-d truncado e suas utilizacoes |
EE05627B1 (et) | 1998-12-23 | 2013-02-15 | Pfizer Inc. | CTLA-4 vastased inimese monoklonaalsed antikehad |
AU3128000A (en) | 1998-12-23 | 2000-07-31 | Human Genome Sciences, Inc. | Peptidoglycan recognition proteins |
US6488930B1 (en) | 1999-01-15 | 2002-12-03 | Millennium Pharmaceuticals, Inc. | Anti-CCR4 antibodies and methods of use therefor |
KR100816572B1 (ko) | 1999-04-28 | 2008-03-24 | 보드 오브 리전츠, 더 유니버시티 오브 텍사스 시스템 | 항-vegf 항체 및 이를 포함하는 약제학적 조성물 |
US7074403B1 (en) | 1999-06-09 | 2006-07-11 | Immunomedics, Inc. | Immunotherapy of autoimmune disorders using antibodies which target B-cells |
US7829064B2 (en) | 1999-05-10 | 2010-11-09 | Immunomedics, Inc. | Anti-CD74 immunoconjugates and methods |
US7534866B2 (en) | 2005-10-19 | 2009-05-19 | Ibc Pharmaceuticals, Inc. | Methods and compositions for generating bioactive assemblies of increased complexity and uses |
US7527787B2 (en) | 2005-10-19 | 2009-05-05 | Ibc Pharmaceuticals, Inc. | Multivalent immunoglobulin-based bioactive assemblies |
US7550143B2 (en) | 2005-04-06 | 2009-06-23 | Ibc Pharmaceuticals, Inc. | Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses |
US6946129B1 (en) | 1999-06-08 | 2005-09-20 | Seattle Genetics, Inc. | Recombinant anti-CD40 antibody and uses thereof |
DE19926154A1 (de) | 1999-06-09 | 2000-12-14 | Ktb Tumorforschungs Gmbh | Verfahren zur Herstellung einer injizierbaren Arzneimittelzubereitung |
US20020002270A1 (en) | 1999-06-16 | 2002-01-03 | Raymond P. Zinkowski | Purified antigen for alzheimer's disease, and methods of obtaining and using same |
US6355481B1 (en) | 1999-06-18 | 2002-03-12 | Emory University | Hybridoma cell line and monoclonal antibody for huntingtin protein |
AU784045B2 (en) | 1999-06-25 | 2006-01-19 | Genentech Inc. | Humanized anti-ErbB2 antibodies and treatment with anti-ErbB2 antibodies |
US6964854B1 (en) | 1999-07-13 | 2005-11-15 | Science & Technology Corporation | Compositions and methods useful for the diagnosis and treatment of heparin induced thrombocytopenia/thrombosis |
US6693176B1 (en) | 1999-07-23 | 2004-02-17 | University Of Massachusetts | Antitumor antibodies, proteins, and uses thereof |
US6376654B1 (en) | 1999-08-13 | 2002-04-23 | Molecular Discoveries, Llc | Myeloma cell and ovarian cancer cell surface glycoproteins, antibodies thereto, and uses thereof |
US6716966B1 (en) | 1999-08-18 | 2004-04-06 | Altarex Corp. | Therapeutic binding agents against MUC-1 antigen and methods for their use |
AU7089600A (en) | 1999-08-30 | 2001-03-26 | U.S. Army Medical Research Institute Of Infectious Diseases | Monoclonal antibodies and vaccines against epitopes on the ebola virus glycoprotein |
EP2289549A3 (en) | 1999-10-01 | 2011-06-15 | Immunogen, Inc. | Immunoconjugates for treating cancer |
US6824780B1 (en) | 1999-10-29 | 2004-11-30 | Genentech, Inc. | Anti-tumor antibody compositions and methods of use |
US6832203B1 (en) | 1999-11-05 | 2004-12-14 | Cim, Ltd. | Skills based contact routing |
US6835370B2 (en) | 1999-11-08 | 2004-12-28 | Rhode Island Hospital | Diagnosis and treatment of malignant neoplasms |
US20030031670A1 (en) | 1999-11-08 | 2003-02-13 | Jack R. Wands | Diagnosis and treatment of malignant neoplasms |
US6994852B1 (en) | 1999-11-12 | 2006-02-07 | Temple University-Of The Commonwealth System Of Higher Education | Inhibition of angiogenesis by antibodies against high molecular weight kininogen domain 5 |
US6994976B1 (en) | 1999-11-19 | 2006-02-07 | Tittle Thomas V | Tr3-specific binding agents and methods for their use |
US6319675B1 (en) | 1999-11-24 | 2001-11-20 | Millennium Pharmaceuticals, Inc. | Methods for detecting and/or identifying agents which bind and/or modulate function of “bonzo” chemokine receptor |
US6835549B2 (en) | 2000-02-24 | 2004-12-28 | University Of Medicine & Dentistry Of New Jersey | Immunoassay method for the diagnosis of gastric intestinal metaplasia associated with gastric carcinoma |
WO2001070818A1 (en) | 2000-03-23 | 2001-09-27 | Tanox, Inc. | Anti-c2/c2a inhibitors of complement activation |
US6629995B1 (en) | 2000-03-31 | 2003-10-07 | Super Gen, Inc. | Camptothecin conjugates |
IL152748A0 (en) | 2000-05-11 | 2003-06-24 | Altarex Inc | Therapeutic method and composition utilizing antigen-antibody complexation and presentation by dendritic cells |
US6965018B2 (en) | 2000-06-06 | 2005-11-15 | Bristol-Myers Squibb Company | Antibodies directed to B7-related polypeptide, BSL-2 |
US6939547B2 (en) | 2000-07-31 | 2005-09-06 | The United States Of America As Represented By The Department Of Health And Human Services | Specific binding agents for KSHV vIL-6 that neutralize a biological activity |
US7060802B1 (en) | 2000-09-18 | 2006-06-13 | The Trustees Of Columbia University In The City Of New York | Tumor-associated marker |
US6989241B2 (en) | 2000-10-02 | 2006-01-24 | Oklahoma Medical Research Foundation | Assay for rapid detection of human activated protein C and highly specific monoclonal antibody therefor |
EP2113516B1 (en) | 2000-10-10 | 2014-05-21 | Genentech, Inc. | Antibodies against C5 inhibiting type II endothelial cell activation |
US20030133972A1 (en) | 2000-10-11 | 2003-07-17 | Targesome, Inc. | Targeted multivalent macromolecules |
DZ3494A1 (fr) | 2001-01-05 | 2002-07-11 | Pfizer | Anticorps anti-recepteur du facteur de croissance i analogue a l'insuline |
JP4676617B2 (ja) | 2001-01-18 | 2011-04-27 | 高砂香料工業株式会社 | イソプレゴールの製造方法 |
US6743898B2 (en) | 2001-03-15 | 2004-06-01 | Ochsner Clinic Foundation | Monoclonal antibodies that suppress B cell growth and/or differentiation |
DE60213771T2 (de) | 2001-03-30 | 2007-08-16 | The University of Massachusetts, Worcester | Morpholinobildgebung und therapie |
US6824778B2 (en) | 2001-04-23 | 2004-11-30 | The United States Of America As Represented By The Secretary Of The Army | Prophylactic and therapeutic monoclonal antibodies |
US20050048512A1 (en) | 2001-04-26 | 2005-03-03 | Avidia Research Institute | Combinatorial libraries of monomer domains |
US20030082630A1 (en) | 2001-04-26 | 2003-05-01 | Maxygen, Inc. | Combinatorial libraries of monomer domains |
US20040175756A1 (en) | 2001-04-26 | 2004-09-09 | Avidia Research Institute | Methods for using combinatorial libraries of monomer domains |
US20050089932A1 (en) | 2001-04-26 | 2005-04-28 | Avidia Research Institute | Novel proteins with targeted binding |
US20050053973A1 (en) | 2001-04-26 | 2005-03-10 | Avidia Research Institute | Novel proteins with targeted binding |
AU2002303832A1 (en) | 2001-05-21 | 2002-12-03 | Beth Israel Deaconess Medical Center, Inc. | P.aeruginosa mucoid exopolysaccharide specific binding peptides |
US20030026764A1 (en) | 2001-07-31 | 2003-02-06 | Immunomedics, Inc. | Polymeric delivery systems |
US20040043030A1 (en) | 2001-07-31 | 2004-03-04 | Immunomedics, Inc. | Polymeric delivery systems |
NZ513418A (en) | 2001-08-07 | 2004-04-30 | Univ Massey | Vaccine comprising proteins from mycobacterium paratuberculosis |
US6720150B2 (en) | 2001-08-27 | 2004-04-13 | University Of New Hampshire | Method for identifying fast - growing fish |
KR20050036875A (ko) * | 2001-10-15 | 2005-04-20 | 이뮤노메딕스, 인코오포레이티드 | 직접 표적형의 결합 단백질 |
US7049060B2 (en) | 2001-11-05 | 2006-05-23 | Ortho-Clinical Diagnostics, Inc. | HCV anti-core monoclonal antibodies |
US6716821B2 (en) * | 2001-12-21 | 2004-04-06 | Immunogen Inc. | Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same |
EP1519959B1 (en) | 2002-02-14 | 2014-04-02 | Immunomedics, Inc. | Anti-cd20 antibodies and fusion proteins thereof and methods of use |
US8877901B2 (en) * | 2002-12-13 | 2014-11-04 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
US7591994B2 (en) | 2002-12-13 | 2009-09-22 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
DE60325184D1 (de) | 2002-03-01 | 2009-01-22 | Immunomedics Inc | Rs7 antikörper |
CN102174108B (zh) | 2002-03-01 | 2016-06-29 | 免疫医疗公司 | 内在化抗-cd74抗体和使用方法 |
US6593334B1 (en) * | 2002-05-02 | 2003-07-15 | The University Of North Carolina At Chapel Hill | Camptothecin-taxoid conjugates as antimitotic and antitumor agents |
MXPA04012656A (es) | 2002-06-14 | 2005-08-15 | Immunomedics Inc | Anticuerpo hpam4 monoclonal humanizado. |
US7238786B2 (en) | 2002-06-14 | 2007-07-03 | Immunomedics, Inc. | Monoclonal antibody cPAM4 |
CA2494310A1 (en) | 2002-08-01 | 2004-02-12 | Immunomedics, Inc. | Alpha-fetoprotein immu31 antibodies and fusion proteins and methods of use thereof |
US7541440B2 (en) | 2002-09-30 | 2009-06-02 | Immunomedics, Inc. | Chimeric, human and humanized anti-granulocyte antibodies and methods of use |
US7217797B2 (en) | 2002-10-15 | 2007-05-15 | Pdl Biopharma, Inc. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
CA2505717A1 (en) | 2002-11-15 | 2004-06-03 | Immunomedics, Inc. | Use of multi-specific, non-covalent complexes for targeted delivery of therapeutics |
EP1572242B1 (en) | 2002-12-13 | 2014-04-16 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US7534427B2 (en) | 2002-12-31 | 2009-05-19 | Immunomedics, Inc. | Immunotherapy of B cell malignancies and autoimmune diseases using unconjugated antibodies and conjugated antibodies and antibody combinations and fusion proteins |
US20040202666A1 (en) | 2003-01-24 | 2004-10-14 | Immunomedics, Inc. | Anti-cancer anthracycline drug-antibody conjugates |
US6875580B2 (en) | 2003-01-28 | 2005-04-05 | Schering Corporation | Antibodies specific for plasmacytoid dendritic cells |
CA2529027C (en) | 2003-06-13 | 2013-09-10 | Immunomedics, Inc. | D-amino acid peptides |
JP2007524649A (ja) | 2003-07-29 | 2007-08-30 | イミューノメディクス、インコーポレイテッド | フッ素化炭水化物複合体 |
US7109304B2 (en) | 2003-07-31 | 2006-09-19 | Immunomedics, Inc. | Humanized anti-CD19 antibodies |
JP4818917B2 (ja) | 2003-08-08 | 2011-11-16 | イミューノメディクス、インコーポレイテッド | 腫瘍および罹患細胞のアポトーシスを誘発するための二重特異性抗体 |
CA2543127A1 (en) | 2003-10-31 | 2005-05-12 | The Regents Of The University Of California | Primate prokineticin and prokineticin receptor polypeptides, related compositions and methods |
CA2555661C (en) | 2004-02-13 | 2017-11-21 | Immunomedics, Inc. | Fusion proteins containing recombinant cytotoxic rnases |
US20060074265A1 (en) | 2004-09-24 | 2006-04-06 | Julian Vaughan-Spickers | Asymmetric catalytic systems |
US7612153B2 (en) * | 2004-10-25 | 2009-11-03 | Intezyne Technologies, Inc. | Heterobifunctional poly(ethylene glycol) and uses thereof |
US7251164B2 (en) | 2004-11-10 | 2007-07-31 | Innovative Silicon S.A. | Circuitry for and method of improving statistical distribution of integrated circuits |
DE102004063003A1 (de) | 2004-12-22 | 2006-07-13 | Basf Ag | Verfahren zur Herstellung von Isopulegol |
US10058621B2 (en) * | 2015-06-25 | 2018-08-28 | Immunomedics, Inc. | Combination therapy with anti-HLA-DR antibodies and kinase inhibitors in hematopoietic cancers |
BRPI0607486B8 (pt) | 2005-03-03 | 2021-05-25 | Immunomedics Inc | anticorpo humanizado l243 contra hla-dr presente nas células hladr+,composição farmacêutica, kit e uso dos referidos anticorpos. |
US9707302B2 (en) * | 2013-07-23 | 2017-07-18 | Immunomedics, Inc. | Combining anti-HLA-DR or anti-Trop-2 antibodies with microtubule inhibitors, PARP inhibitors, bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
CA2604032C (en) | 2005-04-06 | 2017-08-22 | Ibc Pharmaceuticals, Inc. | Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses |
US20080171067A1 (en) * | 2007-01-17 | 2008-07-17 | Immunomedics, Inc. | Polymeric Carriers of Therapeutic Agents and Recognition Moieties for Antibody-Based Targeting of Disease Sites |
US8158590B2 (en) * | 2005-08-05 | 2012-04-17 | Syntarga B.V. | Triazole-containing releasable linkers, conjugates thereof, and methods of preparation |
BRPI0617546A2 (pt) | 2005-09-26 | 2011-07-26 | Medarex Inc | conjugado de fÁrmaco-anticorpo, formulaÇço farmacÊutica, mÉtodo para matar uma cÉlula de tumor, mÉtodo para retardar ou interromper o crescimento de um tumor em um sujeito mamÍfero e composto |
CN101534865A (zh) | 2005-10-19 | 2009-09-16 | Ibc药品公司 | 生物活性装配体的制备方法及其用途 |
ITTO20080313A1 (it) | 2008-04-22 | 2009-10-23 | Marco Colombatti | Anticorpo monoclonale isolato o suo frammento legante l'antigene specifico di membrana della prostata, suoi coniugati e suoi usi |
CN102448494B (zh) * | 2009-02-13 | 2016-02-03 | 免疫医疗公司 | 具有胞内可裂解的键的免疫共轭物 |
US9382329B2 (en) | 2012-08-14 | 2016-07-05 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to Trop-2 expressing cells |
US10206918B2 (en) * | 2012-12-13 | 2019-02-19 | Immunomedics, Inc. | Efficacy of anti-HLA-DR antiboddy drug conjugate IMMU-140 (hL243-CL2A-SN-38) in HLA-DR positive cancers |
US9492566B2 (en) * | 2012-12-13 | 2016-11-15 | Immunomedics, Inc. | Antibody-drug conjugates and uses thereof |
US10413539B2 (en) * | 2012-12-13 | 2019-09-17 | Immunomedics, Inc. | Therapy for metastatic urothelial cancer with the antibody-drug conjugate, sacituzumab govitecan (IMMU-132) |
US10137196B2 (en) * | 2012-12-13 | 2018-11-27 | Immunomedics, Inc. | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
US9931417B2 (en) * | 2012-12-13 | 2018-04-03 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
US10744129B2 (en) * | 2012-12-13 | 2020-08-18 | Immunomedics, Inc. | Therapy of small-cell lung cancer (SCLC) with a topoisomerase-I inhibiting antibody-drug conjugate (ADC) targeting Trop-2 |
CA2884313C (en) * | 2012-12-13 | 2023-01-03 | Immunomedics, Inc. | Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity |
ES2819573T3 (es) * | 2012-12-13 | 2021-04-16 | Immunomedics Inc | Método para producir inmunoconjugados de anticuerpo-SN-38 con un enlazador CL2A |
CN109310385A (zh) * | 2016-04-27 | 2019-02-05 | 免疫医疗公司 | 抗trop-2-sn-38抗体药物缀合物用于检查点抑制剂复发/难治的肿瘤的疗法的功效 |
WO2018187074A1 (en) * | 2017-04-03 | 2018-10-11 | Immunomedics, Inc. | Subcutaneous administration of antibody-drug conjugates for cancer therapy |
-
2009
- 2009-12-02 CN CN200980156218.3A patent/CN102448494B/zh active Active
- 2009-12-02 EP EP21176545.8A patent/EP3912643B8/en active Active
- 2009-12-02 EP EP21178798.1A patent/EP3903829B1/en active Active
- 2009-12-02 HR HRP20230487TT patent/HRP20230487T1/hr unknown
- 2009-12-02 PL PL21178798.1T patent/PL3903829T3/pl unknown
- 2009-12-02 PL PL09840166T patent/PL2396036T3/pl unknown
- 2009-12-02 PT PT211787981T patent/PT3903829T/pt unknown
- 2009-12-02 HU HUE21176545A patent/HUE060624T2/hu unknown
- 2009-12-02 SI SI200932183T patent/SI3903829T1/sl unknown
- 2009-12-02 EP EP18200201.4A patent/EP3470087A1/en active Pending
- 2009-12-02 EP EP17178086.9A patent/EP3243527B1/en active Active
- 2009-12-02 DK DK21176545.8T patent/DK3912643T3/da active
- 2009-12-02 DK DK21178798.1T patent/DK3903829T3/da active
- 2009-12-02 FI FIEP21178798.1T patent/FI3903829T3/fi active
- 2009-12-02 DK DK09840166.4T patent/DK2396036T3/en active
- 2009-12-02 ES ES21176545T patent/ES2931923T3/es active Active
- 2009-12-02 LT LTEP21176545.8T patent/LT3912643T/lt unknown
- 2009-12-02 PL PL21176545.8T patent/PL3912643T3/pl unknown
- 2009-12-02 ES ES09840166.4T patent/ES2640013T3/es active Active
- 2009-12-02 WO PCT/US2009/066371 patent/WO2010093395A1/en active Application Filing
- 2009-12-02 TR TR2019/10848T patent/TR201910848T4/tr unknown
- 2009-12-02 HU HUE21178798A patent/HUE062339T2/hu unknown
- 2009-12-02 CA CA2749501A patent/CA2749501C/en active Active
- 2009-12-02 ES ES17178086T patent/ES2738700T3/es active Active
- 2009-12-02 US US12/629,404 patent/US7999083B2/en active Active
- 2009-12-02 HR HRP20221259TT patent/HRP20221259T1/hr unknown
- 2009-12-02 EP EP09840166.4A patent/EP2396036B1/en active Active
- 2009-12-02 PT PT211765458T patent/PT3912643T/pt unknown
- 2009-12-02 CA CA2948693A patent/CA2948693C/en active Active
- 2009-12-02 LT LTEP21178798.1T patent/LT3903829T/lt unknown
- 2009-12-02 ES ES21178798T patent/ES2945533T3/es active Active
- 2009-12-02 EP EP21189065.2A patent/EP3939617A1/en active Pending
-
2011
- 2011-06-20 US US13/164,275 patent/US8080250B1/en not_active Expired - Lifetime
- 2011-11-08 US US13/291,238 patent/US8741300B2/en not_active Expired - Lifetime
-
2012
- 2012-12-05 US US13/705,756 patent/US8759496B2/en not_active Ceased
-
2013
- 2013-10-08 US US14/048,222 patent/US9102735B2/en active Active
-
2014
- 2014-04-22 US US14/258,228 patent/US9138485B2/en not_active Expired - Lifetime
- 2014-06-03 US US14/294,651 patent/US8999344B2/en active Active
-
2015
- 2015-03-02 US US14/635,530 patent/US9198978B2/en active Active
- 2015-03-03 US US14/636,790 patent/US9345783B2/en active Active
- 2015-03-17 US US14/660,310 patent/US9233172B2/en not_active Expired - Lifetime
- 2015-12-02 US US14/956,769 patent/US9700634B2/en not_active Expired - Lifetime
-
2016
- 2016-04-20 US US15/133,675 patent/US9480756B2/en active Active
- 2016-09-16 US US15/267,910 patent/US9675706B2/en active Active
-
2017
- 2017-05-05 US US15/587,526 patent/US10064957B2/en active Active
- 2017-06-02 US US15/612,672 patent/US10561738B2/en not_active Expired - Lifetime
-
2018
- 2018-07-25 US US16/045,400 patent/US10265414B2/en active Active
- 2018-12-12 US US16/218,384 patent/USRE48751E1/en not_active Expired - Lifetime
-
2019
- 2019-02-14 US US16/276,173 patent/US10322193B1/en active Active
-
2020
- 2020-01-03 US US16/733,816 patent/US11077201B2/en not_active Expired - Lifetime
- 2020-04-06 US US16/841,345 patent/US11020489B2/en not_active Expired - Lifetime
-
2021
- 2021-04-21 US US17/236,709 patent/US20210346511A1/en not_active Abandoned
-
2022
- 2022-03-07 NL NL301164C patent/NL301164I2/nl unknown
- 2022-03-07 FR FR22C1009C patent/FR22C1009I2/fr active Active
- 2022-12-05 CY CY20221100764T patent/CY1125700T1/el unknown
-
2023
- 2023-02-09 FI FIC20230010C patent/FIC20230010I1/fi unknown
- 2023-02-13 LT LTPA2023506C patent/LTPA2023506I1/lt unknown
- 2023-02-21 HU HUS2300010C patent/HUS2300010I1/hu unknown
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11077201B2 (en) | Immunoconjugates with an intracellularly-cleavable linkage |