USRE48751E1 - Immunoconjugates with an intracellularly-cleavable linkage - Google Patents
Immunoconjugates with an intracellularly-cleavable linkage Download PDFInfo
- Publication number
- USRE48751E1 USRE48751E1 US16/218,384 US201816218384A USRE48751E US RE48751 E1 USRE48751 E1 US RE48751E1 US 201816218384 A US201816218384 A US 201816218384A US RE48751 E USRE48751 E US RE48751E
- Authority
- US
- United States
- Prior art keywords
- mab
- antibody
- antibodies
- group
- cancer
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Lifetime, expires
Links
- 229940127121 immunoconjugate Drugs 0.000 title claims description 40
- 230000008685 targeting Effects 0.000 claims abstract description 67
- 239000000427 antigen Substances 0.000 claims description 87
- 108091007433 antigens Proteins 0.000 claims description 87
- 102000036639 antigens Human genes 0.000 claims description 87
- 206010028980 Neoplasm Diseases 0.000 claims description 84
- 230000027455 binding Effects 0.000 claims description 78
- 241000282414 Homo sapiens Species 0.000 claims description 74
- 210000004027 cell Anatomy 0.000 claims description 55
- -1 IGF-1R Proteins 0.000 claims description 54
- 201000011510 cancer Diseases 0.000 claims description 50
- FJHBVJOVLFPMQE-QFIPXVFZSA-N 7-Ethyl-10-Hydroxy-Camptothecin Chemical group C1=C(O)C=C2C(CC)=C(CN3C(C4=C([C@@](C(=O)OC4)(O)CC)C=C33)=O)C3=NC2=C1 FJHBVJOVLFPMQE-QFIPXVFZSA-N 0.000 claims description 44
- 235000001014 amino acid Nutrition 0.000 claims description 39
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 claims description 29
- 108060008682 Tumor Necrosis Factor Proteins 0.000 claims description 25
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 claims description 25
- 229940024606 amino acid Drugs 0.000 claims description 25
- 150000001413 amino acids Chemical class 0.000 claims description 25
- 239000012634 fragment Substances 0.000 claims description 22
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 claims description 20
- 150000008575 L-amino acids Chemical class 0.000 claims description 19
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 claims description 19
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 19
- 230000000295 complement effect Effects 0.000 claims description 19
- 125000003277 amino group Chemical group 0.000 claims description 18
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 claims description 17
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 claims description 17
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 claims description 17
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 claims description 17
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 claims description 16
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 claims description 16
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 claims description 15
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 claims description 15
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 claims description 15
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 claims description 14
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 claims description 14
- 239000004472 Lysine Substances 0.000 claims description 13
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 claims description 12
- 235000018977 lysine Nutrition 0.000 claims description 12
- 239000004471 Glycine Substances 0.000 claims description 11
- 102100037792 Interleukin-6 receptor subunit alpha Human genes 0.000 claims description 11
- 241001529936 Murinae Species 0.000 claims description 11
- 102000013529 alpha-Fetoproteins Human genes 0.000 claims description 11
- 108010026331 alpha-Fetoproteins Proteins 0.000 claims description 11
- 102100021943 C-C motif chemokine 2 Human genes 0.000 claims description 10
- 102100032367 C-C motif chemokine 5 Human genes 0.000 claims description 10
- 108010055166 Chemokine CCL5 Proteins 0.000 claims description 10
- 102100030595 HLA class II histocompatibility antigen gamma chain Human genes 0.000 claims description 10
- 101001082627 Homo sapiens HLA class II histocompatibility antigen gamma chain Proteins 0.000 claims description 10
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 claims description 10
- 108090001005 Interleukin-6 Proteins 0.000 claims description 10
- 102000004889 Interleukin-6 Human genes 0.000 claims description 10
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 claims description 10
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 10
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims description 10
- 102100038080 B-cell receptor CD22 Human genes 0.000 claims description 9
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 claims description 9
- 101710155857 C-C motif chemokine 2 Proteins 0.000 claims description 9
- 102100032937 CD40 ligand Human genes 0.000 claims description 9
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 claims description 9
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 claims description 9
- 101000961414 Homo sapiens Membrane cofactor protein Proteins 0.000 claims description 9
- 102000014429 Insulin-like growth factor Human genes 0.000 claims description 9
- 102100039373 Membrane cofactor protein Human genes 0.000 claims description 9
- 102100027212 Tumor-associated calcium signal transducer 2 Human genes 0.000 claims description 9
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 claims description 9
- 235000018417 cysteine Nutrition 0.000 claims description 9
- 239000000539 dimer Substances 0.000 claims description 9
- 239000004475 Arginine Substances 0.000 claims description 8
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 claims description 8
- 102100022002 CD59 glycoprotein Human genes 0.000 claims description 8
- 102100025680 Complement decay-accelerating factor Human genes 0.000 claims description 8
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 claims description 8
- 102000006354 HLA-DR Antigens Human genes 0.000 claims description 8
- 108010058597 HLA-DR Antigens Proteins 0.000 claims description 8
- 101000897400 Homo sapiens CD59 glycoprotein Proteins 0.000 claims description 8
- 101000856022 Homo sapiens Complement decay-accelerating factor Proteins 0.000 claims description 8
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 claims description 8
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 claims description 8
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 claims description 8
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 claims description 8
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 claims description 8
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 claims description 8
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 claims description 8
- 239000004473 Threonine Substances 0.000 claims description 8
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 claims description 8
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 claims description 8
- 235000009697 arginine Nutrition 0.000 claims description 8
- 235000009582 asparagine Nutrition 0.000 claims description 8
- 229960001230 asparagine Drugs 0.000 claims description 8
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 claims description 8
- 235000004554 glutamine Nutrition 0.000 claims description 8
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 claims description 8
- 229960000310 isoleucine Drugs 0.000 claims description 8
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 claims description 8
- 239000004474 valine Substances 0.000 claims description 8
- 125000000008 (C1-C10) alkyl group Chemical group 0.000 claims description 7
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 claims description 7
- 102100037086 Bone marrow stromal antigen 2 Human genes 0.000 claims description 7
- 102100031940 Epithelial cell adhesion molecule Human genes 0.000 claims description 7
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 claims description 7
- 108010002350 Interleukin-2 Proteins 0.000 claims description 7
- 102000000588 Interleukin-2 Human genes 0.000 claims description 7
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 claims description 7
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 claims description 7
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 claims description 7
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 claims description 7
- 235000004279 alanine Nutrition 0.000 claims description 7
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 7
- 108040006858 interleukin-6 receptor activity proteins Proteins 0.000 claims description 7
- 229930182817 methionine Natural products 0.000 claims description 7
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 claims description 7
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 claims description 7
- 102100024217 CAMPATH-1 antigen Human genes 0.000 claims description 6
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 claims description 6
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 claims description 6
- 108010029697 CD40 Ligand Proteins 0.000 claims description 6
- 108010065524 CD52 Antigen Proteins 0.000 claims description 6
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 claims description 6
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 claims description 6
- 101000595923 Homo sapiens Placenta growth factor Proteins 0.000 claims description 6
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 claims description 6
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 claims description 6
- 102100020793 Interleukin-13 receptor subunit alpha-2 Human genes 0.000 claims description 6
- 102100035194 Placenta growth factor Human genes 0.000 claims description 6
- 102000007066 Prostate-Specific Antigen Human genes 0.000 claims description 6
- 108010072866 Prostate-Specific Antigen Proteins 0.000 claims description 6
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 claims description 6
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 claims description 6
- 125000000217 alkyl group Chemical group 0.000 claims description 6
- 210000004369 blood Anatomy 0.000 claims description 6
- 239000008280 blood Substances 0.000 claims description 6
- 229910052739 hydrogen Inorganic materials 0.000 claims description 6
- 239000001257 hydrogen Substances 0.000 claims description 6
- 108040003607 interleukin-13 receptor activity proteins Proteins 0.000 claims description 6
- 108040002039 interleukin-15 receptor activity proteins Proteins 0.000 claims description 6
- 102000008616 interleukin-15 receptor activity proteins Human genes 0.000 claims description 6
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 claims description 5
- 101150013553 CD40 gene Proteins 0.000 claims description 5
- 102100032768 Complement receptor type 2 Human genes 0.000 claims description 5
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 claims description 5
- 101000941929 Homo sapiens Complement receptor type 2 Proteins 0.000 claims description 5
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 claims description 5
- 101000874179 Homo sapiens Syndecan-1 Proteins 0.000 claims description 5
- 108050003558 Interleukin-17 Proteins 0.000 claims description 5
- 102000013691 Interleukin-17 Human genes 0.000 claims description 5
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 claims description 5
- 108010048043 Macrophage Migration-Inhibitory Factors Proteins 0.000 claims description 5
- 102100037791 Macrophage migration inhibitory factor Human genes 0.000 claims description 5
- 102100035721 Syndecan-1 Human genes 0.000 claims description 5
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 claims description 5
- 235000003704 aspartic acid Nutrition 0.000 claims description 5
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 claims description 5
- 235000013922 glutamic acid Nutrition 0.000 claims description 5
- 239000004220 glutamic acid Substances 0.000 claims description 5
- 108040006849 interleukin-2 receptor activity proteins Proteins 0.000 claims description 5
- 229950003734 milatuzumab Drugs 0.000 claims description 5
- 102100035248 Alpha-(1,3)-fucosyltransferase 4 Human genes 0.000 claims description 4
- 102100032912 CD44 antigen Human genes 0.000 claims description 4
- 102100024423 Carbonic anhydrase 9 Human genes 0.000 claims description 4
- 102100037362 Fibronectin Human genes 0.000 claims description 4
- 108010067306 Fibronectins Proteins 0.000 claims description 4
- 101001022185 Homo sapiens Alpha-(1,3)-fucosyltransferase 4 Proteins 0.000 claims description 4
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 claims description 4
- 101000920667 Homo sapiens Epithelial cell adhesion molecule Proteins 0.000 claims description 4
- 101000599852 Homo sapiens Intercellular adhesion molecule 1 Proteins 0.000 claims description 4
- 101000853002 Homo sapiens Interleukin-25 Proteins 0.000 claims description 4
- 101000599048 Homo sapiens Interleukin-6 receptor subunit alpha Proteins 0.000 claims description 4
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 claims description 4
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 claims description 4
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 claims description 4
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 claims description 4
- 101001128431 Homo sapiens Myeloid-derived growth factor Proteins 0.000 claims description 4
- 101000610551 Homo sapiens Prominin-1 Proteins 0.000 claims description 4
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 claims description 4
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 claims description 4
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 claims description 4
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 claims description 4
- 108010065805 Interleukin-12 Proteins 0.000 claims description 4
- 102000013462 Interleukin-12 Human genes 0.000 claims description 4
- 108090000172 Interleukin-15 Proteins 0.000 claims description 4
- 102000003812 Interleukin-15 Human genes 0.000 claims description 4
- 102000003810 Interleukin-18 Human genes 0.000 claims description 4
- 108090000171 Interleukin-18 Proteins 0.000 claims description 4
- 108090001007 Interleukin-8 Proteins 0.000 claims description 4
- 102000004890 Interleukin-8 Human genes 0.000 claims description 4
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 claims description 4
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 claims description 4
- 102100034256 Mucin-1 Human genes 0.000 claims description 4
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 claims description 4
- 102100031789 Myeloid-derived growth factor Human genes 0.000 claims description 4
- 102100040120 Prominin-1 Human genes 0.000 claims description 4
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 claims description 4
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 claims description 4
- 102100038126 Tenascin Human genes 0.000 claims description 4
- 108010008125 Tenascin Proteins 0.000 claims description 4
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims description 4
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims description 4
- 210000000130 stem cell Anatomy 0.000 claims description 4
- 102100032412 Basigin Human genes 0.000 claims description 3
- 102100025248 C-X-C motif chemokine 10 Human genes 0.000 claims description 3
- 101710098275 C-X-C motif chemokine 10 Proteins 0.000 claims description 3
- 102100039398 C-X-C motif chemokine 2 Human genes 0.000 claims description 3
- 108700012439 CA9 Proteins 0.000 claims description 3
- 102100025221 CD70 antigen Human genes 0.000 claims description 3
- 102100035793 CD83 antigen Human genes 0.000 claims description 3
- 108010053085 Complement Factor H Proteins 0.000 claims description 3
- 102000016550 Complement Factor H Human genes 0.000 claims description 3
- 102000001301 EGF receptor Human genes 0.000 claims description 3
- 108060006698 EGF receptor Proteins 0.000 claims description 3
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 claims description 3
- 102100038651 Four and a half LIM domains protein 1 Human genes 0.000 claims description 3
- 101710127220 Four and a half LIM domains protein 1 Proteins 0.000 claims description 3
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 claims description 3
- 101000798441 Homo sapiens Basigin Proteins 0.000 claims description 3
- 101000868215 Homo sapiens CD40 ligand Proteins 0.000 claims description 3
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 claims description 3
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 claims description 3
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 claims description 3
- 101001046683 Homo sapiens Integrin alpha-L Proteins 0.000 claims description 3
- 101000935043 Homo sapiens Integrin beta-1 Proteins 0.000 claims description 3
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 claims description 3
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 claims description 3
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 claims description 3
- 101001133081 Homo sapiens Mucin-2 Proteins 0.000 claims description 3
- 101000972284 Homo sapiens Mucin-3A Proteins 0.000 claims description 3
- 101000972286 Homo sapiens Mucin-4 Proteins 0.000 claims description 3
- 101000972282 Homo sapiens Mucin-5AC Proteins 0.000 claims description 3
- 101000972276 Homo sapiens Mucin-5B Proteins 0.000 claims description 3
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 claims description 3
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 claims description 3
- 101000611023 Homo sapiens Tumor necrosis factor receptor superfamily member 6 Proteins 0.000 claims description 3
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 claims description 3
- 206010021143 Hypoxia Diseases 0.000 claims description 3
- 102100022339 Integrin alpha-L Human genes 0.000 claims description 3
- 102100025304 Integrin beta-1 Human genes 0.000 claims description 3
- 102100025390 Integrin beta-2 Human genes 0.000 claims description 3
- 102000006992 Interferon-alpha Human genes 0.000 claims description 3
- 108010047761 Interferon-alpha Proteins 0.000 claims description 3
- 108090000467 Interferon-beta Proteins 0.000 claims description 3
- 108010074328 Interferon-gamma Proteins 0.000 claims description 3
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 claims description 3
- 102100034263 Mucin-2 Human genes 0.000 claims description 3
- 102100022497 Mucin-3A Human genes 0.000 claims description 3
- 102100022693 Mucin-4 Human genes 0.000 claims description 3
- 102100022494 Mucin-5B Human genes 0.000 claims description 3
- 101100335081 Mus musculus Flt3 gene Proteins 0.000 claims description 3
- KUIFHYPNNRVEKZ-VIJRYAKMSA-N O-(N-acetyl-alpha-D-galactosaminyl)-L-threonine Chemical compound OC(=O)[C@@H](N)[C@@H](C)O[C@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1NC(C)=O KUIFHYPNNRVEKZ-VIJRYAKMSA-N 0.000 claims description 3
- 108700020796 Oncogene Proteins 0.000 claims description 3
- 102000043276 Oncogene Human genes 0.000 claims description 3
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 claims description 3
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 claims description 3
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 claims description 3
- 108010000449 TNF-Related Apoptosis-Inducing Ligand Receptors Proteins 0.000 claims description 3
- 102000002259 TNF-Related Apoptosis-Inducing Ligand Receptors Human genes 0.000 claims description 3
- 102100040403 Tumor necrosis factor receptor superfamily member 6 Human genes 0.000 claims description 3
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 claims description 3
- 206010054094 Tumour necrosis Diseases 0.000 claims description 3
- 108091008605 VEGF receptors Proteins 0.000 claims description 3
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 claims description 3
- 125000003545 alkoxy group Chemical group 0.000 claims description 3
- SRHNADOZAAWYLV-XLMUYGLTSA-N alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc Chemical compound O[C@H]1[C@H](O)[C@H](O)[C@H](C)O[C@H]1O[C@H]1[C@H](O[C@H]2[C@@H]([C@@H](NC(C)=O)[C@H](O)O[C@@H]2CO)O[C@H]2[C@H]([C@H](O)[C@H](O)[C@H](C)O2)O)O[C@H](CO)[C@H](O)[C@@H]1O SRHNADOZAAWYLV-XLMUYGLTSA-N 0.000 claims description 3
- 101150061829 bre-3 gene Proteins 0.000 claims description 3
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 claims description 3
- 102000006815 folate receptor Human genes 0.000 claims description 3
- 108020005243 folate receptor Proteins 0.000 claims description 3
- 150000002270 gangliosides Chemical class 0.000 claims description 3
- 230000007954 hypoxia Effects 0.000 claims description 3
- 230000001939 inductive effect Effects 0.000 claims description 3
- 108040001304 interleukin-17 receptor activity proteins Proteins 0.000 claims description 3
- 102000053460 interleukin-17 receptor activity proteins Human genes 0.000 claims description 3
- 108040002014 interleukin-18 receptor activity proteins Proteins 0.000 claims description 3
- 102000008625 interleukin-18 receptor activity proteins Human genes 0.000 claims description 3
- 108040006852 interleukin-4 receptor activity proteins Proteins 0.000 claims description 3
- 238000012737 microarray-based gene expression Methods 0.000 claims description 3
- 238000012243 multiplex automated genomic engineering Methods 0.000 claims description 3
- 150000003839 salts Chemical group 0.000 claims description 3
- 125000000547 substituted alkyl group Chemical group 0.000 claims description 3
- 230000005747 tumor angiogenesis Effects 0.000 claims description 3
- 101100061856 Homo sapiens CXCL2 gene Proteins 0.000 claims description 2
- 102100026720 Interferon beta Human genes 0.000 claims description 2
- 102100037850 Interferon gamma Human genes 0.000 claims description 2
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 claims description 2
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 claims 4
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 claims 2
- 102000003735 Mesothelin Human genes 0.000 claims 2
- 108090000015 Mesothelin Proteins 0.000 claims 2
- 125000004435 hydrogen atom Chemical group [H]* 0.000 claims 2
- 101001069913 Bos taurus Growth-regulated protein homolog beta Proteins 0.000 claims 1
- 102100036842 C-C motif chemokine 19 Human genes 0.000 claims 1
- 102100036846 C-C motif chemokine 21 Human genes 0.000 claims 1
- 101000713106 Homo sapiens C-C motif chemokine 19 Proteins 0.000 claims 1
- 101000713085 Homo sapiens C-C motif chemokine 21 Proteins 0.000 claims 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 claims 1
- 238000000034 method Methods 0.000 abstract description 120
- 230000001225 therapeutic effect Effects 0.000 abstract description 34
- 108010021625 Immunoglobulin Fragments Proteins 0.000 abstract description 33
- 102000008394 Immunoglobulin Fragments Human genes 0.000 abstract description 33
- 230000008569 process Effects 0.000 abstract description 13
- 230000001976 improved effect Effects 0.000 abstract description 4
- 239000000562 conjugate Substances 0.000 description 106
- 239000003814 drug Substances 0.000 description 84
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 81
- 229940079593 drug Drugs 0.000 description 60
- 108090000765 processed proteins & peptides Proteins 0.000 description 48
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 40
- 108090000623 proteins and genes Proteins 0.000 description 40
- 125000005647 linker group Chemical group 0.000 description 38
- 239000000203 mixture Substances 0.000 description 36
- 201000010099 disease Diseases 0.000 description 33
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical group C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 31
- 239000000047 product Substances 0.000 description 31
- 102000004169 proteins and genes Human genes 0.000 description 27
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 26
- 238000004128 high performance liquid chromatography Methods 0.000 description 26
- 102000004196 processed proteins & peptides Human genes 0.000 description 26
- 235000018102 proteins Nutrition 0.000 description 25
- 238000011282 treatment Methods 0.000 description 25
- 206010058314 Dysplasia Diseases 0.000 description 24
- 239000002202 Polyethylene glycol Substances 0.000 description 24
- 239000012636 effector Substances 0.000 description 24
- 229920001223 polyethylene glycol Polymers 0.000 description 24
- 238000006467 substitution reaction Methods 0.000 description 24
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 23
- 229940127093 camptothecin Drugs 0.000 description 23
- 239000000543 intermediate Substances 0.000 description 23
- 238000003818 flash chromatography Methods 0.000 description 22
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 22
- 238000002360 preparation method Methods 0.000 description 22
- 239000002246 antineoplastic agent Substances 0.000 description 21
- 230000000973 chemotherapeutic effect Effects 0.000 description 20
- 238000001819 mass spectrum Methods 0.000 description 20
- 239000002904 solvent Substances 0.000 description 20
- 125000003275 alpha amino acid group Chemical group 0.000 description 19
- 108020001507 fusion proteins Proteins 0.000 description 19
- 102000037865 fusion proteins Human genes 0.000 description 19
- 230000021615 conjugation Effects 0.000 description 18
- 238000002560 therapeutic procedure Methods 0.000 description 18
- QTBSBXVTEAMEQO-UHFFFAOYSA-N acetic acid Substances CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 17
- 229940044683 chemotherapy drug Drugs 0.000 description 17
- 125000002534 ethynyl group Chemical group [H]C#C* 0.000 description 17
- 229940124597 therapeutic agent Drugs 0.000 description 17
- VHYFNPMBLIVWCW-UHFFFAOYSA-N 4-Dimethylaminopyridine Chemical compound CN(C)C1=CC=NC=C1 VHYFNPMBLIVWCW-UHFFFAOYSA-N 0.000 description 16
- 208000023275 Autoimmune disease Diseases 0.000 description 16
- RDOXTESZEPMUJZ-UHFFFAOYSA-N anisole Chemical compound COC1=CC=CC=C1 RDOXTESZEPMUJZ-UHFFFAOYSA-N 0.000 description 16
- 244000052769 pathogen Species 0.000 description 16
- AXKGIPZJYUNAIW-UHFFFAOYSA-N (4-aminophenyl)methanol Chemical compound NC1=CC=C(CO)C=C1 AXKGIPZJYUNAIW-UHFFFAOYSA-N 0.000 description 15
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 15
- 102000004127 Cytokines Human genes 0.000 description 15
- 108090000695 Cytokines Proteins 0.000 description 15
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 15
- 230000000694 effects Effects 0.000 description 15
- 229960001592 paclitaxel Drugs 0.000 description 15
- 101150044980 Akap1 gene Proteins 0.000 description 14
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 14
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 14
- 210000003719 b-lymphocyte Anatomy 0.000 description 14
- 210000004408 hybridoma Anatomy 0.000 description 14
- 239000011159 matrix material Substances 0.000 description 14
- 238000002823 phage display Methods 0.000 description 14
- 125000006239 protecting group Chemical group 0.000 description 14
- 210000001519 tissue Anatomy 0.000 description 14
- 108091023037 Aptamer Proteins 0.000 description 13
- 102000005962 receptors Human genes 0.000 description 13
- 108020003175 receptors Proteins 0.000 description 13
- INAUWOVKEZHHDM-PEDBPRJASA-N (7s,9s)-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-7-[(2r,4s,5s,6s)-5-hydroxy-6-methyl-4-morpholin-4-yloxan-2-yl]oxy-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound Cl.N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1 INAUWOVKEZHHDM-PEDBPRJASA-N 0.000 description 12
- 239000004971 Cross linker Substances 0.000 description 12
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 12
- 102000001253 Protein Kinase Human genes 0.000 description 12
- 241000700605 Viruses Species 0.000 description 12
- 230000001588 bifunctional effect Effects 0.000 description 12
- FZFAMSAMCHXGEF-UHFFFAOYSA-N chloro formate Chemical compound ClOC=O FZFAMSAMCHXGEF-UHFFFAOYSA-N 0.000 description 12
- 208000015181 infectious disease Diseases 0.000 description 12
- 230000000770 proinflammatory effect Effects 0.000 description 12
- 108060006633 protein kinase Proteins 0.000 description 12
- 229930012538 Paclitaxel Natural products 0.000 description 11
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 11
- HSFWRNGVRCDJHI-UHFFFAOYSA-N alpha-acetylene Natural products C#C HSFWRNGVRCDJHI-UHFFFAOYSA-N 0.000 description 11
- 125000000539 amino acid group Chemical group 0.000 description 11
- 238000001727 in vivo Methods 0.000 description 11
- 208000008443 pancreatic carcinoma Diseases 0.000 description 11
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 11
- 0 *.B.C.C.CN(C)C.O=C(O)N1CCC(N2CCCCC2)CC1.[1*]C1=C([3*])/C2=C(\C=C/1)\N=C1\C3=CC4=C(COC(=O)C4(O)CC)C(=O)N3C\C1=C\2[2*].[2HH] Chemical compound *.B.C.C.CN(C)C.O=C(O)N1CCC(N2CCCCC2)CC1.[1*]C1=C([3*])/C2=C(\C=C/1)\N=C1\C3=CC4=C(COC(=O)C4(O)CC)C(=O)N3C\C1=C\2[2*].[2HH] 0.000 description 10
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical group NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 10
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 10
- 241000725303 Human immunodeficiency virus Species 0.000 description 10
- 206010039491 Sarcoma Diseases 0.000 description 10
- 108090000190 Thrombin Proteins 0.000 description 10
- 150000001540 azides Chemical class 0.000 description 10
- 238000005859 coupling reaction Methods 0.000 description 10
- 239000002955 immunomodulating agent Substances 0.000 description 10
- 229940121354 immunomodulator Drugs 0.000 description 10
- 201000002528 pancreatic cancer Diseases 0.000 description 10
- 229920001184 polypeptide Polymers 0.000 description 10
- 239000011734 sodium Substances 0.000 description 10
- FPGGTKZVZWFYPV-UHFFFAOYSA-M tetrabutylammonium fluoride Chemical compound [F-].CCCC[N+](CCCC)(CCCC)CCCC FPGGTKZVZWFYPV-UHFFFAOYSA-M 0.000 description 10
- 229960004072 thrombin Drugs 0.000 description 10
- 108700012359 toxins Proteins 0.000 description 10
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 9
- 241000699666 Mus <mouse, genus> Species 0.000 description 9
- 210000001744 T-lymphocyte Anatomy 0.000 description 9
- 230000008901 benefit Effects 0.000 description 9
- 238000006352 cycloaddition reaction Methods 0.000 description 9
- PNZXMIKHJXIPEK-UHFFFAOYSA-N cyclohexanecarboxamide Chemical compound NC(=O)C1CCCCC1 PNZXMIKHJXIPEK-UHFFFAOYSA-N 0.000 description 9
- 230000002458 infectious effect Effects 0.000 description 9
- 230000003211 malignant effect Effects 0.000 description 9
- 239000003053 toxin Substances 0.000 description 9
- 231100000765 toxin Toxicity 0.000 description 9
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 9
- 238000010626 work up procedure Methods 0.000 description 9
- 201000009030 Carcinoma Diseases 0.000 description 8
- 102000019034 Chemokines Human genes 0.000 description 8
- 108010012236 Chemokines Proteins 0.000 description 8
- 206010009944 Colon cancer Diseases 0.000 description 8
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 8
- 102000014150 Interferons Human genes 0.000 description 8
- 108010050904 Interferons Proteins 0.000 description 8
- 102000015696 Interleukins Human genes 0.000 description 8
- 108010063738 Interleukins Proteins 0.000 description 8
- 241000699670 Mus sp. Species 0.000 description 8
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 8
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 8
- 206010035226 Plasma cell myeloma Diseases 0.000 description 8
- 238000013459 approach Methods 0.000 description 8
- IVRMZWNICZWHMI-UHFFFAOYSA-N azide group Chemical group [N-]=[N+]=[N-] IVRMZWNICZWHMI-UHFFFAOYSA-N 0.000 description 8
- 238000010168 coupling process Methods 0.000 description 8
- JXTHNDFMNIQAHM-UHFFFAOYSA-N dichloroacetic acid Chemical compound OC(=O)C(Cl)Cl JXTHNDFMNIQAHM-UHFFFAOYSA-N 0.000 description 8
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 8
- 229940027941 immunoglobulin g Drugs 0.000 description 8
- 208000014018 liver neoplasm Diseases 0.000 description 8
- 230000036210 malignancy Effects 0.000 description 8
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 8
- 238000004519 manufacturing process Methods 0.000 description 8
- UZKWTJUDCOPSNM-UHFFFAOYSA-N methoxybenzene Substances CCCCOC=C UZKWTJUDCOPSNM-UHFFFAOYSA-N 0.000 description 8
- 239000011541 reaction mixture Substances 0.000 description 8
- 230000002829 reductive effect Effects 0.000 description 8
- 229960000549 4-dimethylaminophenol Drugs 0.000 description 7
- 108010011122 A Kinase Anchor Proteins Proteins 0.000 description 7
- 102000014022 A Kinase Anchor Proteins Human genes 0.000 description 7
- 208000030507 AIDS Diseases 0.000 description 7
- 241000894006 Bacteria Species 0.000 description 7
- 208000017604 Hodgkin disease Diseases 0.000 description 7
- 230000015572 biosynthetic process Effects 0.000 description 7
- 238000006243 chemical reaction Methods 0.000 description 7
- 239000003153 chemical reaction reagent Substances 0.000 description 7
- 239000003795 chemical substances by application Substances 0.000 description 7
- 238000010511 deprotection reaction Methods 0.000 description 7
- 208000035475 disorder Diseases 0.000 description 7
- 239000002158 endotoxin Substances 0.000 description 7
- 201000007270 liver cancer Diseases 0.000 description 7
- 201000001441 melanoma Diseases 0.000 description 7
- 239000002245 particle Substances 0.000 description 7
- 239000002243 precursor Substances 0.000 description 7
- 238000000746 purification Methods 0.000 description 7
- 239000000126 substance Substances 0.000 description 7
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 6
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 6
- 229910021589 Copper(I) bromide Inorganic materials 0.000 description 6
- GKQLYSROISKDLL-UHFFFAOYSA-N EEDQ Chemical compound C1=CC=C2N(C(=O)OCC)C(OCC)C=CC2=C1 GKQLYSROISKDLL-UHFFFAOYSA-N 0.000 description 6
- 206010018338 Glioma Diseases 0.000 description 6
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 6
- 241000282412 Homo Species 0.000 description 6
- 108060003951 Immunoglobulin Proteins 0.000 description 6
- 108010002352 Interleukin-1 Proteins 0.000 description 6
- 102000000589 Interleukin-1 Human genes 0.000 description 6
- ODKSFYDXXFIFQN-BYPYZUCNSA-N L-arginine Chemical compound OC(=O)[C@@H](N)CCCN=C(N)N ODKSFYDXXFIFQN-BYPYZUCNSA-N 0.000 description 6
- 208000034578 Multiple myelomas Diseases 0.000 description 6
- CMVRBCDBISKHME-URBSQPMJSA-N N([C@@H](CCCCN)C(=O)NC1=CC=C(C=C1)COC(=O)O[C@]1(CC)C(=O)OCC2=C1C=C1N(C2=O)CC2=C(C3=CC(O)=CC=C3N=C21)CC)C(=O)COCC(=O)NCCOCCOCCOCCOCCOCCOCCOCCOCCN(N=N1)C=C1CNC(=O)C(CC1)CCC1CN1C(=O)C=CC1=O Chemical compound N([C@@H](CCCCN)C(=O)NC1=CC=C(C=C1)COC(=O)O[C@]1(CC)C(=O)OCC2=C1C=C1N(C2=O)CC2=C(C3=CC(O)=CC=C3N=C21)CC)C(=O)COCC(=O)NCCOCCOCCOCCOCCOCCOCCOCCOCCN(N=N1)C=C1CNC(=O)C(CC1)CCC1CN1C(=O)C=CC1=O CMVRBCDBISKHME-URBSQPMJSA-N 0.000 description 6
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 6
- 208000021386 Sjogren Syndrome Diseases 0.000 description 6
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 6
- 238000012452 Xenomouse strains Methods 0.000 description 6
- 229960004679 doxorubicin Drugs 0.000 description 6
- 102000018358 immunoglobulin Human genes 0.000 description 6
- 229940047122 interleukins Drugs 0.000 description 6
- NWYYWIJOWOLJNR-RXMQYKEDSA-N l-valinol Chemical compound CC(C)[C@H](N)CO NWYYWIJOWOLJNR-RXMQYKEDSA-N 0.000 description 6
- 239000000463 material Substances 0.000 description 6
- 210000000056 organ Anatomy 0.000 description 6
- BEVWMRQFVUOPJT-UHFFFAOYSA-N 2,4-dimethyl-1,3-thiazole-5-carboxamide Chemical compound CC1=NC(C)=C(C(N)=O)S1 BEVWMRQFVUOPJT-UHFFFAOYSA-N 0.000 description 5
- NWYYWIJOWOLJNR-UHFFFAOYSA-N 2-Amino-3-methyl-1-butanol Chemical compound CC(C)C(N)CO NWYYWIJOWOLJNR-UHFFFAOYSA-N 0.000 description 5
- 206010003571 Astrocytoma Diseases 0.000 description 5
- 206010006187 Breast cancer Diseases 0.000 description 5
- 208000026310 Breast neoplasm Diseases 0.000 description 5
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 5
- 102000014914 Carrier Proteins Human genes 0.000 description 5
- 108010071942 Colony-Stimulating Factors Proteins 0.000 description 5
- 208000035473 Communicable disease Diseases 0.000 description 5
- 208000032612 Glial tumor Diseases 0.000 description 5
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 5
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 241000699660 Mus musculus Species 0.000 description 5
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 5
- 108091008324 binding proteins Proteins 0.000 description 5
- 125000002843 carboxylic acid group Chemical group 0.000 description 5
- 238000003776 cleavage reaction Methods 0.000 description 5
- 208000029742 colonic neoplasm Diseases 0.000 description 5
- 229940127089 cytotoxic agent Drugs 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 150000002148 esters Chemical class 0.000 description 5
- 102000034356 gene-regulatory proteins Human genes 0.000 description 5
- 108091006104 gene-regulatory proteins Proteins 0.000 description 5
- 208000005017 glioblastoma Diseases 0.000 description 5
- 239000010931 gold Substances 0.000 description 5
- 230000028993 immune response Effects 0.000 description 5
- 238000009169 immunotherapy Methods 0.000 description 5
- 229940047124 interferons Drugs 0.000 description 5
- 230000000670 limiting effect Effects 0.000 description 5
- 210000004072 lung Anatomy 0.000 description 5
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 5
- 208000025113 myeloid leukemia Diseases 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 206010039073 rheumatoid arthritis Diseases 0.000 description 5
- 230000007017 scission Effects 0.000 description 5
- 125000006850 spacer group Chemical group 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 150000003573 thiols Chemical class 0.000 description 5
- 238000011830 transgenic mouse model Methods 0.000 description 5
- UCPYLLCMEDAXFR-UHFFFAOYSA-N triphosgene Chemical compound ClC(Cl)(Cl)OC(=O)OC(Cl)(Cl)Cl UCPYLLCMEDAXFR-UHFFFAOYSA-N 0.000 description 5
- CTYHQVFFQRDJSN-LHEWISCISA-N (2s)-2-(9h-fluoren-9-ylmethoxycarbonylamino)-6-[[(4-methoxyphenyl)-diphenylmethyl]amino]hexanoic acid Chemical compound C1=CC(OC)=CC=C1C(C=1C=CC=CC=1)(C=1C=CC=CC=1)NCCCC[C@@H](C(O)=O)NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C21 CTYHQVFFQRDJSN-LHEWISCISA-N 0.000 description 4
- NOPNWHSMQOXAEI-PUCKCBAPSA-N (7s,9s)-7-[(2r,4s,5s,6s)-4-(2,3-dihydropyrrol-1-yl)-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione Chemical compound N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCC=C1 NOPNWHSMQOXAEI-PUCKCBAPSA-N 0.000 description 4
- 108010039209 Blood Coagulation Factors Proteins 0.000 description 4
- 102000015081 Blood Coagulation Factors Human genes 0.000 description 4
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical compound NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 4
- 102100025473 Carcinoembryonic antigen-related cell adhesion molecule 6 Human genes 0.000 description 4
- 241000233866 Fungi Species 0.000 description 4
- 101000914326 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 6 Proteins 0.000 description 4
- 206010021245 Idiopathic thrombocytopenic purpura Diseases 0.000 description 4
- 208000008839 Kidney Neoplasms Diseases 0.000 description 4
- 206010025323 Lymphomas Diseases 0.000 description 4
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 4
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 description 4
- 206010061535 Ovarian neoplasm Diseases 0.000 description 4
- 206010060862 Prostate cancer Diseases 0.000 description 4
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 4
- 102100024952 Protein CBFA2T1 Human genes 0.000 description 4
- 108010029485 Protein Isoforms Proteins 0.000 description 4
- 102000001708 Protein Isoforms Human genes 0.000 description 4
- 208000005718 Stomach Neoplasms Diseases 0.000 description 4
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 description 4
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 4
- 238000002835 absorbance Methods 0.000 description 4
- 239000003242 anti bacterial agent Substances 0.000 description 4
- 230000036436 anti-hiv Effects 0.000 description 4
- 229940088710 antibiotic agent Drugs 0.000 description 4
- 238000011717 athymic nude mouse Methods 0.000 description 4
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 description 4
- 125000001743 benzylic group Chemical group 0.000 description 4
- 239000003114 blood coagulation factor Substances 0.000 description 4
- 230000001684 chronic effect Effects 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- NKNDPYCGAZPOFS-UHFFFAOYSA-M copper(i) bromide Chemical compound Br[Cu] NKNDPYCGAZPOFS-UHFFFAOYSA-M 0.000 description 4
- 201000001981 dermatomyositis Diseases 0.000 description 4
- 229960005215 dichloroacetic acid Drugs 0.000 description 4
- 238000006471 dimerization reaction Methods 0.000 description 4
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 4
- 239000003118 drug derivative Substances 0.000 description 4
- 208000002169 ectodermal dysplasia Diseases 0.000 description 4
- 239000013604 expression vector Substances 0.000 description 4
- 239000006260 foam Substances 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 206010017758 gastric cancer Diseases 0.000 description 4
- 230000003394 haemopoietic effect Effects 0.000 description 4
- 229940088597 hormone Drugs 0.000 description 4
- 239000005556 hormone Substances 0.000 description 4
- 125000004029 hydroxymethyl group Chemical group [H]OC([H])([H])* 0.000 description 4
- 230000002584 immunomodulator Effects 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 150000002500 ions Chemical class 0.000 description 4
- 210000000244 kidney pelvis Anatomy 0.000 description 4
- 230000003902 lesion Effects 0.000 description 4
- 208000032839 leukemia Diseases 0.000 description 4
- 238000003032 molecular docking Methods 0.000 description 4
- 201000006417 multiple sclerosis Diseases 0.000 description 4
- 230000009826 neoplastic cell growth Effects 0.000 description 4
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 4
- 238000004091 panning Methods 0.000 description 4
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N phenol group Chemical group C1(=CC=CC=C1)O ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 4
- 239000000843 powder Substances 0.000 description 4
- 238000001556 precipitation Methods 0.000 description 4
- 238000012552 review Methods 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 239000007787 solid Substances 0.000 description 4
- 206010041823 squamous cell carcinoma Diseases 0.000 description 4
- 201000011549 stomach cancer Diseases 0.000 description 4
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 4
- 125000003396 thiol group Chemical group [H]S* 0.000 description 4
- RIOQSEWOXXDEQQ-UHFFFAOYSA-N triphenylphosphine Chemical compound C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 RIOQSEWOXXDEQQ-UHFFFAOYSA-N 0.000 description 4
- 210000004881 tumor cell Anatomy 0.000 description 4
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 4
- 229960005486 vaccine Drugs 0.000 description 4
- 239000013598 vector Substances 0.000 description 4
- HAWSQZCWOQZXHI-FQEVSTJZSA-N 10-Hydroxycamptothecin Chemical compound C1=C(O)C=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 HAWSQZCWOQZXHI-FQEVSTJZSA-N 0.000 description 3
- YIMDLWDNDGKDTJ-QLKYHASDSA-N 3'-deamino-3'-(3-cyanomorpholin-4-yl)doxorubicin Chemical compound N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1C#N YIMDLWDNDGKDTJ-QLKYHASDSA-N 0.000 description 3
- 125000004042 4-aminobutyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])N([H])[H] 0.000 description 3
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 3
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 3
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 3
- 241000024188 Andala Species 0.000 description 3
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 3
- 206010004593 Bile duct cancer Diseases 0.000 description 3
- 206010005003 Bladder cancer Diseases 0.000 description 3
- 208000003174 Brain Neoplasms Diseases 0.000 description 3
- 108010062802 CD66 antigens Proteins 0.000 description 3
- HAWSQZCWOQZXHI-UHFFFAOYSA-N CPT-OH Natural products C1=C(O)C=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 HAWSQZCWOQZXHI-UHFFFAOYSA-N 0.000 description 3
- 206010008342 Cervix carcinoma Diseases 0.000 description 3
- 206010010452 Congenital ectodermal dysplasia Diseases 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- QOSSAOTZNIDXMA-UHFFFAOYSA-N Dicylcohexylcarbodiimide Chemical compound C1CCCCC1N=C=NC1CCCCC1 QOSSAOTZNIDXMA-UHFFFAOYSA-N 0.000 description 3
- 108010016626 Dipeptides Proteins 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- 102000003951 Erythropoietin Human genes 0.000 description 3
- 108090000394 Erythropoietin Proteins 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 3
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical class NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 3
- 208000006168 Ewing Sarcoma Diseases 0.000 description 3
- 208000031886 HIV Infections Diseases 0.000 description 3
- 208000037357 HIV infectious disease Diseases 0.000 description 3
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 3
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 3
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 3
- 208000000172 Medulloblastoma Diseases 0.000 description 3
- 206010027476 Metastases Diseases 0.000 description 3
- RJQXTJLFIWVMTO-TYNCELHUSA-N Methicillin Chemical compound COC1=CC=CC(OC)=C1C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 RJQXTJLFIWVMTO-TYNCELHUSA-N 0.000 description 3
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 3
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 206010033128 Ovarian cancer Diseases 0.000 description 3
- 102000057297 Pepsin A Human genes 0.000 description 3
- 108090000284 Pepsin A Proteins 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 206010038389 Renal cancer Diseases 0.000 description 3
- 241000725643 Respiratory syncytial virus Species 0.000 description 3
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 3
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 3
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 3
- 241000191967 Staphylococcus aureus Species 0.000 description 3
- 229940123237 Taxane Drugs 0.000 description 3
- 102000036693 Thrombopoietin Human genes 0.000 description 3
- 108010041111 Thrombopoietin Proteins 0.000 description 3
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 3
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 3
- 208000008383 Wilms tumor Diseases 0.000 description 3
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 3
- PPZYBFUYKJPWBY-UHFFFAOYSA-N acetylene azide Chemical compound C#C.[N-]=[N+]=[N-] PPZYBFUYKJPWBY-UHFFFAOYSA-N 0.000 description 3
- 208000009956 adenocarcinoma Diseases 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 229940045799 anthracyclines and related substance Drugs 0.000 description 3
- 230000000890 antigenic effect Effects 0.000 description 3
- 229910052786 argon Inorganic materials 0.000 description 3
- 229940009098 aspartate Drugs 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 239000012267 brine Substances 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 3
- 230000003197 catalytic effect Effects 0.000 description 3
- 201000010881 cervical cancer Diseases 0.000 description 3
- 238000002512 chemotherapy Methods 0.000 description 3
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- 239000010949 copper Substances 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 239000002552 dosage form Substances 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 229940105423 erythropoietin Drugs 0.000 description 3
- 208000021045 exocrine pancreatic carcinoma Diseases 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 229940049906 glutamate Drugs 0.000 description 3
- 229930195712 glutamate Natural products 0.000 description 3
- 229960002989 glutamic acid Drugs 0.000 description 3
- 201000005787 hematologic cancer Diseases 0.000 description 3
- 208000019691 hematopoietic and lymphoid cell neoplasm Diseases 0.000 description 3
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 3
- 230000002267 hypothalamic effect Effects 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 238000001802 infusion Methods 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 229940079322 interferon Drugs 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 108010028930 invariant chain Proteins 0.000 description 3
- 201000010982 kidney cancer Diseases 0.000 description 3
- 208000020816 lung neoplasm Diseases 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 3
- 229910052751 metal Inorganic materials 0.000 description 3
- 239000002184 metal Substances 0.000 description 3
- 125000000325 methylidene group Chemical group [H]C([H])=* 0.000 description 3
- 229960003085 meticillin Drugs 0.000 description 3
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 150000007523 nucleic acids Chemical class 0.000 description 3
- 201000008968 osteosarcoma Diseases 0.000 description 3
- 244000045947 parasite Species 0.000 description 3
- 229940111202 pepsin Drugs 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Substances [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 3
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 3
- 230000003389 potentiating effect Effects 0.000 description 3
- 235000019833 protease Nutrition 0.000 description 3
- 238000011363 radioimmunotherapy Methods 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 3
- 229960004641 rituximab Drugs 0.000 description 3
- 201000000306 sarcoidosis Diseases 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 230000003248 secreting effect Effects 0.000 description 3
- 208000000587 small cell lung carcinoma Diseases 0.000 description 3
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 3
- 208000037969 squamous neck cancer Diseases 0.000 description 3
- JJAHTWIKCUJRDK-UHFFFAOYSA-N succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate Chemical compound C1CC(CN2C(C=CC2=O)=O)CCC1C(=O)ON1C(=O)CCC1=O JJAHTWIKCUJRDK-UHFFFAOYSA-N 0.000 description 3
- 231100000167 toxic agent Toxicity 0.000 description 3
- 239000003440 toxic substance Substances 0.000 description 3
- 230000009261 transgenic effect Effects 0.000 description 3
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 2
- NGNBDVOYPDDBFK-UHFFFAOYSA-N 2-[2,4-di(pentan-2-yl)phenoxy]acetyl chloride Chemical compound CCCC(C)C1=CC=C(OCC(Cl)=O)C(C(C)CCC)=C1 NGNBDVOYPDDBFK-UHFFFAOYSA-N 0.000 description 2
- AUDYZXNUHIIGRB-UHFFFAOYSA-N 3-thiophen-2-ylpyrrole-2,5-dione Chemical compound O=C1NC(=O)C(C=2SC=CC=2)=C1 AUDYZXNUHIIGRB-UHFFFAOYSA-N 0.000 description 2
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 2
- OVMSOCFBDVBLFW-VHLOTGQHSA-N 5beta,20-epoxy-1,7beta,13alpha-trihydroxy-9-oxotax-11-ene-2alpha,4alpha,10beta-triyl 4,10-diacetate 2-benzoate Chemical compound O([C@@H]1[C@@]2(C[C@H](O)C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)O)C(=O)C1=CC=CC=C1 OVMSOCFBDVBLFW-VHLOTGQHSA-N 0.000 description 2
- SJVGFKBLUYAEOK-SFHVURJKSA-N 6-[4-[(3S)-3-(3,5-difluorophenyl)-3,4-dihydropyrazole-2-carbonyl]piperidin-1-yl]pyrimidine-4-carbonitrile Chemical compound FC=1C=C(C=C(C=1)F)[C@@H]1CC=NN1C(=O)C1CCN(CC1)C1=CC(=NC=N1)C#N SJVGFKBLUYAEOK-SFHVURJKSA-N 0.000 description 2
- 102100024049 A-kinase anchor protein 13 Human genes 0.000 description 2
- 241000203022 Acholeplasma laidlawii Species 0.000 description 2
- 208000026872 Addison Disease Diseases 0.000 description 2
- USFZMSVCRYTOJT-UHFFFAOYSA-N Ammonium acetate Chemical compound N.CC(O)=O USFZMSVCRYTOJT-UHFFFAOYSA-N 0.000 description 2
- 239000005695 Ammonium acetate Substances 0.000 description 2
- 206010061424 Anal cancer Diseases 0.000 description 2
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 241000223838 Babesia bovis Species 0.000 description 2
- 231100000699 Bacterial toxin Toxicity 0.000 description 2
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 2
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 2
- 241000120506 Bluetongue virus Species 0.000 description 2
- 241000589969 Borreliella burgdorferi Species 0.000 description 2
- 241000589567 Brucella abortus Species 0.000 description 2
- 102100032528 C-type lectin domain family 11 member A Human genes 0.000 description 2
- 101710167766 C-type lectin domain family 11 member A Proteins 0.000 description 2
- 206010007953 Central nervous system lymphoma Diseases 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 206010008748 Chorea Diseases 0.000 description 2
- 206010008909 Chronic Hepatitis Diseases 0.000 description 2
- 206010009900 Colitis ulcerative Diseases 0.000 description 2
- 102000007644 Colony-Stimulating Factors Human genes 0.000 description 2
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical group [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 2
- 201000007336 Cryptococcosis Diseases 0.000 description 2
- 241000221204 Cryptococcus neoformans Species 0.000 description 2
- 201000003808 Cystic echinococcosis Diseases 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- 241000725619 Dengue virus Species 0.000 description 2
- 241000244170 Echinococcus granulosus Species 0.000 description 2
- 206010014733 Endometrial cancer Diseases 0.000 description 2
- 206010014759 Endometrial neoplasm Diseases 0.000 description 2
- 241000991587 Enterovirus C Species 0.000 description 2
- 206010014967 Ependymoma Diseases 0.000 description 2
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 2
- 206010015218 Erythema multiforme Diseases 0.000 description 2
- 206010015226 Erythema nodosum Diseases 0.000 description 2
- 108090000371 Esterases Proteins 0.000 description 2
- 241000714165 Feline leukemia virus Species 0.000 description 2
- 102000012673 Follicle Stimulating Hormone Human genes 0.000 description 2
- 108010079345 Follicle Stimulating Hormone Proteins 0.000 description 2
- JRZJKWGQFNTSRN-UHFFFAOYSA-N Geldanamycin Natural products C1C(C)CC(OC)C(O)C(C)C=C(C)C(OC(N)=O)C(OC)CCC=C(C)C(=O)NC2=CC(=O)C(OC)=C1C2=O JRZJKWGQFNTSRN-UHFFFAOYSA-N 0.000 description 2
- 208000007465 Giant cell arteritis Diseases 0.000 description 2
- 206010018372 Glomerulonephritis membranous Diseases 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 208000024869 Goodpasture syndrome Diseases 0.000 description 2
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 2
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 2
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 2
- 201000004331 Henoch-Schoenlein purpura Diseases 0.000 description 2
- 206010019617 Henoch-Schonlein purpura Diseases 0.000 description 2
- 241000711549 Hepacivirus C Species 0.000 description 2
- 241000700721 Hepatitis B virus Species 0.000 description 2
- 206010019755 Hepatitis chronic active Diseases 0.000 description 2
- 241000228404 Histoplasma capsulatum Species 0.000 description 2
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 2
- 101000833679 Homo sapiens A-kinase anchor protein 13 Proteins 0.000 description 2
- 101000935587 Homo sapiens Flavin reductase (NADPH) Proteins 0.000 description 2
- 108010000521 Human Growth Hormone Proteins 0.000 description 2
- 102000002265 Human Growth Hormone Human genes 0.000 description 2
- 239000000854 Human Growth Hormone Substances 0.000 description 2
- 241000701074 Human alphaherpesvirus 2 Species 0.000 description 2
- 241000701085 Human alphaherpesvirus 3 Species 0.000 description 2
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 2
- 206010020850 Hyperthyroidism Diseases 0.000 description 2
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 description 2
- 208000031814 IgA Vasculitis Diseases 0.000 description 2
- 208000010159 IgA glomerulonephritis Diseases 0.000 description 2
- 206010021263 IgA nephropathy Diseases 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 102100027268 Interferon-stimulated gene 20 kDa protein Human genes 0.000 description 2
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- 241000589248 Legionella Species 0.000 description 2
- 208000007764 Legionnaires' Disease Diseases 0.000 description 2
- 241000222736 Leishmania tropica Species 0.000 description 2
- 208000005777 Lupus Nephritis Diseases 0.000 description 2
- 102000009151 Luteinizing Hormone Human genes 0.000 description 2
- 108010073521 Luteinizing Hormone Proteins 0.000 description 2
- 241000712899 Lymphocytic choriomeningitis mammarenavirus Species 0.000 description 2
- 102000004083 Lymphotoxin-alpha Human genes 0.000 description 2
- 108090000542 Lymphotoxin-alpha Proteins 0.000 description 2
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 2
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 2
- 241000712079 Measles morbillivirus Species 0.000 description 2
- 241000520674 Mesocestoides corti Species 0.000 description 2
- 206010027406 Mesothelioma Diseases 0.000 description 2
- 241000713333 Mouse mammary tumor virus Species 0.000 description 2
- 241000711386 Mumps virus Species 0.000 description 2
- 241000714177 Murine leukemia virus Species 0.000 description 2
- 241000711408 Murine respirovirus Species 0.000 description 2
- 208000000112 Myalgia Diseases 0.000 description 2
- 241000186362 Mycobacterium leprae Species 0.000 description 2
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 2
- 241000204031 Mycoplasma Species 0.000 description 2
- 241000204028 Mycoplasma arginini Species 0.000 description 2
- 241000202956 Mycoplasma arthritidis Species 0.000 description 2
- 241000202938 Mycoplasma hyorhinis Species 0.000 description 2
- 241000202894 Mycoplasma orale Species 0.000 description 2
- 241000202934 Mycoplasma pneumoniae Species 0.000 description 2
- 241000202889 Mycoplasma salivarium Species 0.000 description 2
- 241000588650 Neisseria meningitidis Species 0.000 description 2
- 206010029260 Neuroblastoma Diseases 0.000 description 2
- 241000243985 Onchocerca volvulus Species 0.000 description 2
- 206010034277 Pemphigoid Diseases 0.000 description 2
- 201000011152 Pemphigus Diseases 0.000 description 2
- 208000031845 Pernicious anaemia Diseases 0.000 description 2
- FADYJNXDPBKVCA-STQMWFEESA-N Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 FADYJNXDPBKVCA-STQMWFEESA-N 0.000 description 2
- 208000007641 Pinealoma Diseases 0.000 description 2
- 231100000742 Plant toxin Toxicity 0.000 description 2
- 241000223960 Plasmodium falciparum Species 0.000 description 2
- 241000223810 Plasmodium vivax Species 0.000 description 2
- 206010065159 Polychondritis Diseases 0.000 description 2
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 2
- 101000762949 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) Exotoxin A Proteins 0.000 description 2
- 241000711798 Rabies lyssavirus Species 0.000 description 2
- 208000015634 Rectal Neoplasms Diseases 0.000 description 2
- 208000006265 Renal cell carcinoma Diseases 0.000 description 2
- 241000702263 Reovirus sp. Species 0.000 description 2
- 208000004453 Retinal Dysplasia Diseases 0.000 description 2
- 201000000582 Retinoblastoma Diseases 0.000 description 2
- 108010083644 Ribonucleases Proteins 0.000 description 2
- 102000006382 Ribonucleases Human genes 0.000 description 2
- 241000606701 Rickettsia Species 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 241000710799 Rubella virus Species 0.000 description 2
- 206010061934 Salivary gland cancer Diseases 0.000 description 2
- 241000242678 Schistosoma Species 0.000 description 2
- 241000242680 Schistosoma mansoni Species 0.000 description 2
- 206010039710 Scleroderma Diseases 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 241000700584 Simplexvirus Species 0.000 description 2
- 241000710960 Sindbis virus Species 0.000 description 2
- 206010041067 Small cell lung cancer Diseases 0.000 description 2
- 241000193985 Streptococcus agalactiae Species 0.000 description 2
- 241000193996 Streptococcus pyogenes Species 0.000 description 2
- 208000027522 Sydenham chorea Diseases 0.000 description 2
- 208000000389 T-cell leukemia Diseases 0.000 description 2
- 208000028530 T-cell lymphoblastic leukemia/lymphoma Diseases 0.000 description 2
- 206010042971 T-cell lymphoma Diseases 0.000 description 2
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 2
- 241001672171 Taenia hydatigena Species 0.000 description 2
- 241000244154 Taenia ovis Species 0.000 description 2
- 241000244159 Taenia saginata Species 0.000 description 2
- 208000001106 Takayasu Arteritis Diseases 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- 208000024313 Testicular Neoplasms Diseases 0.000 description 2
- 241000223779 Theileria parva Species 0.000 description 2
- 206010043540 Thromboangiitis obliterans Diseases 0.000 description 2
- 102000011923 Thyrotropin Human genes 0.000 description 2
- 108010061174 Thyrotropin Proteins 0.000 description 2
- 241000223997 Toxoplasma gondii Species 0.000 description 2
- 108010009583 Transforming Growth Factors Proteins 0.000 description 2
- 102000009618 Transforming Growth Factors Human genes 0.000 description 2
- 241000589884 Treponema pallidum Species 0.000 description 2
- 241000243777 Trichinella spiralis Species 0.000 description 2
- 241000223104 Trypanosoma Species 0.000 description 2
- 241000223105 Trypanosoma brucei Species 0.000 description 2
- 241000223109 Trypanosoma cruzi Species 0.000 description 2
- 241000223097 Trypanosoma rangeli Species 0.000 description 2
- 201000006704 Ulcerative Colitis Diseases 0.000 description 2
- 208000023915 Ureteral Neoplasms Diseases 0.000 description 2
- 206010046392 Ureteric cancer Diseases 0.000 description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 2
- 241000711975 Vesicular stomatitis virus Species 0.000 description 2
- 229940122803 Vinca alkaloid Drugs 0.000 description 2
- 206010047741 Vulval cancer Diseases 0.000 description 2
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 2
- 208000000260 Warts Diseases 0.000 description 2
- 241000710886 West Nile virus Species 0.000 description 2
- 208000017733 acquired polycythemia vera Diseases 0.000 description 2
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 150000001412 amines Chemical class 0.000 description 2
- 150000001414 amino alcohols Chemical class 0.000 description 2
- 229940043376 ammonium acetate Drugs 0.000 description 2
- 235000019257 ammonium acetate Nutrition 0.000 description 2
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 2
- 238000004873 anchoring Methods 0.000 description 2
- 239000005557 antagonist Substances 0.000 description 2
- 230000001093 anti-cancer Effects 0.000 description 2
- 230000000840 anti-viral effect Effects 0.000 description 2
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 2
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 229940120638 avastin Drugs 0.000 description 2
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 2
- 239000000688 bacterial toxin Substances 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- 229940056450 brucella abortus Drugs 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 208000000594 bullous pemphigoid Diseases 0.000 description 2
- 150000004649 carbonic acid derivatives Chemical class 0.000 description 2
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 2
- 229960004562 carboplatin Drugs 0.000 description 2
- 239000003638 chemical reducing agent Substances 0.000 description 2
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 description 2
- 229940047120 colony stimulating factors Drugs 0.000 description 2
- 239000002131 composite material Substances 0.000 description 2
- 229910052802 copper Inorganic materials 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 229940111134 coxibs Drugs 0.000 description 2
- 238000004132 cross linking Methods 0.000 description 2
- 239000012043 crude product Substances 0.000 description 2
- 239000003255 cyclooxygenase 2 inhibitor Substances 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 239000002254 cytotoxic agent Substances 0.000 description 2
- 231100000599 cytotoxic agent Toxicity 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 206010012601 diabetes mellitus Diseases 0.000 description 2
- 238000011026 diafiltration Methods 0.000 description 2
- WGLUMOCWFMKWIL-UHFFFAOYSA-N dichloromethane;methanol Chemical compound OC.ClCCl WGLUMOCWFMKWIL-UHFFFAOYSA-N 0.000 description 2
- HPNMFZURTQLUMO-UHFFFAOYSA-N diethylamine Chemical compound CCNCC HPNMFZURTQLUMO-UHFFFAOYSA-N 0.000 description 2
- 238000012377 drug delivery Methods 0.000 description 2
- 229960001904 epirubicin Drugs 0.000 description 2
- 229930013356 epothilone Natural products 0.000 description 2
- HESCAJZNRMSMJG-KKQRBIROSA-N epothilone A Chemical class C/C([C@@H]1C[C@@H]2O[C@@H]2CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)O1)O)C)=C\C1=CSC(C)=N1 HESCAJZNRMSMJG-KKQRBIROSA-N 0.000 description 2
- 229950009760 epratuzumab Drugs 0.000 description 2
- 229940082789 erbitux Drugs 0.000 description 2
- 230000001747 exhibiting effect Effects 0.000 description 2
- 201000010103 fibrous dysplasia Diseases 0.000 description 2
- 239000012467 final product Substances 0.000 description 2
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 2
- 229940028334 follicle stimulating hormone Drugs 0.000 description 2
- 125000000524 functional group Chemical group 0.000 description 2
- 230000002496 gastric effect Effects 0.000 description 2
- QTQAWLPCGQOSGP-GBTDJJJQSA-N geldanamycin Chemical compound N1C(=O)\C(C)=C/C=C\[C@@H](OC)[C@H](OC(N)=O)\C(C)=C/[C@@H](C)[C@@H](O)[C@H](OC)C[C@@H](C)CC2=C(OC)C(=O)C=C1C2=O QTQAWLPCGQOSGP-GBTDJJJQSA-N 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 201000010536 head and neck cancer Diseases 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 2
- 230000003463 hyperproliferative effect Effects 0.000 description 2
- 201000003535 hypohidrotic ectodermal dysplasia Diseases 0.000 description 2
- 208000035128 hypohidrotic/hair/tooth type autosomal recessive ectodermal dysplasia 10B Diseases 0.000 description 2
- 208000032771 hypohidrotic/hair/tooth type autosomal recessive ectodermal dysplasia 11B Diseases 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 208000015446 immunoglobulin a vasculitis Diseases 0.000 description 2
- 238000011065 in-situ storage Methods 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 210000004153 islets of langerhan Anatomy 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 201000005202 lung cancer Diseases 0.000 description 2
- 229940040129 luteinizing hormone Drugs 0.000 description 2
- 208000003747 lymphoid leukemia Diseases 0.000 description 2
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 208000020984 malignant renal pelvis neoplasm Diseases 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 2
- 201000008350 membranous glomerulonephritis Diseases 0.000 description 2
- 231100000855 membranous nephropathy Toxicity 0.000 description 2
- 229960001428 mercaptopurine Drugs 0.000 description 2
- 150000002739 metals Chemical class 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 230000001394 metastastic effect Effects 0.000 description 2
- 206010061289 metastatic neoplasm Diseases 0.000 description 2
- 208000037970 metastatic squamous neck cancer Diseases 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 206010028417 myasthenia gravis Diseases 0.000 description 2
- 201000005962 mycosis fungoides Diseases 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 201000008383 nephritis Diseases 0.000 description 2
- 208000002040 neurosyphilis Diseases 0.000 description 2
- BVJSUAQZOZWCKN-UHFFFAOYSA-N p-hydroxybenzyl alcohol Chemical compound OCC1=CC=C(O)C=C1 BVJSUAQZOZWCKN-UHFFFAOYSA-N 0.000 description 2
- 201000002530 pancreatic endocrine carcinoma Diseases 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 201000001976 pemphigus vulgaris Diseases 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- 239000003123 plant toxin Substances 0.000 description 2
- 201000006292 polyarteritis nodosa Diseases 0.000 description 2
- 208000037244 polycythemia vera Diseases 0.000 description 2
- 208000005987 polymyositis Diseases 0.000 description 2
- 208000016800 primary central nervous system lymphoma Diseases 0.000 description 2
- 210000002307 prostate Anatomy 0.000 description 2
- 108020001580 protein domains Proteins 0.000 description 2
- 208000005069 pulmonary fibrosis Diseases 0.000 description 2
- 238000001959 radiotherapy Methods 0.000 description 2
- 201000008158 rapidly progressive glomerulonephritis Diseases 0.000 description 2
- 206010038038 rectal cancer Diseases 0.000 description 2
- 201000001275 rectum cancer Diseases 0.000 description 2
- 201000007444 renal pelvis carcinoma Diseases 0.000 description 2
- 201000003068 rheumatic fever Diseases 0.000 description 2
- CXMXRPHRNRROMY-UHFFFAOYSA-N sebacic acid Chemical compound OC(=O)CCCCCCCCC(O)=O CXMXRPHRNRROMY-UHFFFAOYSA-N 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- 238000001542 size-exclusion chromatography Methods 0.000 description 2
- 201000010153 skin papilloma Diseases 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 208000017572 squamous cell neoplasm Diseases 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- KZNICNPSHKQLFF-UHFFFAOYSA-N succinimide Chemical compound O=C1CCC(=O)N1 KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 description 2
- 229910052717 sulfur Inorganic materials 0.000 description 2
- 201000008205 supratentorial primitive neuroectodermal tumor Diseases 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 208000011580 syndromic disease Diseases 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 208000002025 tabes dorsalis Diseases 0.000 description 2
- 206010043207 temporal arteritis Diseases 0.000 description 2
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 2
- BCNZYOJHNLTNEZ-UHFFFAOYSA-N tert-butyldimethylsilyl chloride Chemical compound CC(C)(C)[Si](C)(C)Cl BCNZYOJHNLTNEZ-UHFFFAOYSA-N 0.000 description 2
- 201000003120 testicular cancer Diseases 0.000 description 2
- 229940126585 therapeutic drug Drugs 0.000 description 2
- 206010043554 thrombocytopenia Diseases 0.000 description 2
- 208000005057 thyrotoxicosis Diseases 0.000 description 2
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 2
- 229960000303 topotecan Drugs 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- 229940096911 trichinella spiralis Drugs 0.000 description 2
- 239000013638 trimer Substances 0.000 description 2
- 201000008827 tuberculosis Diseases 0.000 description 2
- 229940046728 tumor necrosis factor alpha inhibitor Drugs 0.000 description 2
- 239000002451 tumor necrosis factor inhibitor Substances 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 241000712461 unidentified influenza virus Species 0.000 description 2
- 241001515965 unidentified phage Species 0.000 description 2
- 210000000626 ureter Anatomy 0.000 description 2
- 201000011294 ureter cancer Diseases 0.000 description 2
- 201000005112 urinary bladder cancer Diseases 0.000 description 2
- 206010046766 uterine cancer Diseases 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- 210000000239 visual pathway Anatomy 0.000 description 2
- 230000004400 visual pathway Effects 0.000 description 2
- 201000005102 vulva cancer Diseases 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 230000003442 weekly effect Effects 0.000 description 2
- FBDOJYYTMIHHDH-OZBJMMHXSA-N (19S)-19-ethyl-19-hydroxy-17-oxa-3,13-diazapentacyclo[11.8.0.02,11.04,9.015,20]henicosa-2,4,6,8,10,14,20-heptaen-18-one Chemical compound CC[C@@]1(O)C(=O)OCC2=CN3Cc4cc5ccccc5nc4C3C=C12 FBDOJYYTMIHHDH-OZBJMMHXSA-N 0.000 description 1
- PXOMSWXCVZBBIV-PQKSKRJKSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4S,6R)-4-amino-2-methyl-6-[[(1S,3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-2,4-dihydro-1H-tetracen-1-yl]oxy]oxan-3-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound C[C@H]1[C@@H]([C@H](C[C@@H](O1)O[C@H]2C[C@@](CC3=C2C(=C4C(=C3O)C(=O)C5=C(C4=O)C(=CC=C5)OC)O)(C(=O)CO)O)N)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)C(=O)O)O)O)O PXOMSWXCVZBBIV-PQKSKRJKSA-N 0.000 description 1
- KQRHTCDQWJLLME-XUXIUFHCSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-aminopropanoyl]amino]-4-methylpentanoyl]amino]propanoyl]amino]-4-methylpentanoic acid Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)N KQRHTCDQWJLLME-XUXIUFHCSA-N 0.000 description 1
- AGGWFDNPHKLBBV-YUMQZZPRSA-N (2s)-2-[[(2s)-2-amino-3-methylbutanoyl]amino]-5-(carbamoylamino)pentanoic acid Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=O AGGWFDNPHKLBBV-YUMQZZPRSA-N 0.000 description 1
- APOKYMYZOKIMLM-LUMVZWMBSA-N (2s,3s,4s,5r,6s)-3,4,5-trihydroxy-6-[4-[[(2s,3s,4s,6r)-3-hydroxy-2-methyl-6-[[(1s,3s)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-2,4-dihydro-1h-tetracen-1-yl]oxy]oxan-4-yl]carbamoyloxymethyl]-2-nitrophenoxy]oxane-2-carboxylic acid Chemical compound N([C@H]1C[C@@H](O[C@@H](C)[C@H]1O)O[C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)C(=O)OCC(C=C1[N+]([O-])=O)=CC=C1O[C@@H]1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O APOKYMYZOKIMLM-LUMVZWMBSA-N 0.000 description 1
- URCVASXWNJQAEH-HDWVWLDDSA-N (2s,3s,4s,5r,6s)-6-[4-[(5s,5ar,8ar,9r)-5-[[(2r,4ar,6r,7r,8r,8as)-7,8-dihydroxy-2-methyl-4,4a,6,7,8,8a-hexahydropyrano[3,2-d][1,3]dioxin-6-yl]oxy]-8-oxo-5a,6,8a,9-tetrahydro-5h-[2]benzofuro[5,6-f][1,3]benzodioxol-9-yl]-2,6-dimethoxyphenoxy]-3,4,5-trihydrox Chemical compound COC1=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=CC(OC)=C1O[C@@H]1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O URCVASXWNJQAEH-HDWVWLDDSA-N 0.000 description 1
- NXLNNXIXOYSCMB-UHFFFAOYSA-N (4-nitrophenyl) carbonochloridate Chemical compound [O-][N+](=O)C1=CC=C(OC(Cl)=O)C=C1 NXLNNXIXOYSCMB-UHFFFAOYSA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- ODIGIKRIUKFKHP-UHFFFAOYSA-N (n-propan-2-yloxycarbonylanilino) acetate Chemical compound CC(C)OC(=O)N(OC(C)=O)C1=CC=CC=C1 ODIGIKRIUKFKHP-UHFFFAOYSA-N 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- VWCUMTCXBIRRSG-UHFFFAOYSA-N 1-[chloro(diphenyl)methyl]-2-methoxybenzene Chemical compound COC1=CC=CC=C1C(Cl)(C=1C=CC=CC=1)C1=CC=CC=C1 VWCUMTCXBIRRSG-UHFFFAOYSA-N 0.000 description 1
- 102100025573 1-alkyl-2-acetylglycerophosphocholine esterase Human genes 0.000 description 1
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- VILCJCGEZXAXTO-UHFFFAOYSA-N 2,2,2-tetramine Chemical compound NCCNCCNCCN VILCJCGEZXAXTO-UHFFFAOYSA-N 0.000 description 1
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical compound O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 1
- JHALWMSZGCVVEM-UHFFFAOYSA-N 2-[4,7-bis(carboxymethyl)-1,4,7-triazonan-1-yl]acetic acid Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CC1 JHALWMSZGCVVEM-UHFFFAOYSA-N 0.000 description 1
- FSPQCTGGIANIJZ-UHFFFAOYSA-N 2-[[(3,4-dimethoxyphenyl)-oxomethyl]amino]-4,5,6,7-tetrahydro-1-benzothiophene-3-carboxamide Chemical compound C1=C(OC)C(OC)=CC=C1C(=O)NC1=C(C(N)=O)C(CCCC2)=C2S1 FSPQCTGGIANIJZ-UHFFFAOYSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- JUIKUQOUMZUFQT-UHFFFAOYSA-N 2-bromoacetamide Chemical compound NC(=O)CBr JUIKUQOUMZUFQT-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- IDPUKCWIGUEADI-UHFFFAOYSA-N 5-[bis(2-chloroethyl)amino]uracil Chemical compound ClCCN(CCCl)C1=CNC(=O)NC1=O IDPUKCWIGUEADI-UHFFFAOYSA-N 0.000 description 1
- WYWHKKSPHMUBEB-UHFFFAOYSA-N 6-Mercaptoguanine Natural products N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 1
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- FUXVKZWTXQUGMW-FQEVSTJZSA-N 9-Aminocamptothecin Chemical compound C1=CC(N)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 FUXVKZWTXQUGMW-FQEVSTJZSA-N 0.000 description 1
- 208000002008 AIDS-Related Lymphoma Diseases 0.000 description 1
- 108010066676 Abrin Proteins 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 108010059616 Activins Proteins 0.000 description 1
- 206010000830 Acute leukaemia Diseases 0.000 description 1
- RDIKFPRVLJLMER-BQBZGAKWSA-N Ala-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C)N RDIKFPRVLJLMER-BQBZGAKWSA-N 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- 201000003076 Angiosarcoma Diseases 0.000 description 1
- 102400000068 Angiostatin Human genes 0.000 description 1
- 108010079709 Angiostatins Proteins 0.000 description 1
- 208000001454 Anhidrotic Ectodermal Dysplasia 1 Diseases 0.000 description 1
- 108010005853 Anti-Mullerian Hormone Proteins 0.000 description 1
- 208000007860 Anus Neoplasms Diseases 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- 206010060971 Astrocytoma malignant Diseases 0.000 description 1
- 101710192393 Attachment protein G3P Proteins 0.000 description 1
- 208000037914 B-cell disorder Diseases 0.000 description 1
- 208000003950 B-cell lymphoma Diseases 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- 125000006847 BOC protecting group Chemical group 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 208000013165 Bowen disease Diseases 0.000 description 1
- 208000019337 Bowen disease of the skin Diseases 0.000 description 1
- 206010006143 Brain stem glioma Diseases 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- UOQJSQXSXQLVSS-SXFPIPMASA-N C#CCCC(=O)C1CCC(CN2C(=O)C=CC2=O)CC1.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(OC(=O)N(C)CCN(C)C(=O)OCC3=CC=C(NC(=O)C(CCCCN)CC(=O)C(CC5=CC=CC=C5)NC(=O)COCC(=O)NCCOCCN=[N+]=[N-])C=C3)C=C21)[C@@](O)(CC)C(=O)OC4.[3H]CC Chemical compound C#CCCC(=O)C1CCC(CN2C(=O)C=CC2=O)CC1.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(OC(=O)N(C)CCN(C)C(=O)OCC3=CC=C(NC(=O)C(CCCCN)CC(=O)C(CC5=CC=CC=C5)NC(=O)COCC(=O)NCCOCCN=[N+]=[N-])C=C3)C=C21)[C@@](O)(CC)C(=O)OC4.[3H]CC UOQJSQXSXQLVSS-SXFPIPMASA-N 0.000 description 1
- CKQXBQQRVTVPAO-ULNHYWIVSA-N C#CCCC(=O)C1CCC(CN2C(=O)C=CC2=O)CC1.[3H]CCNCCCCC(CC(=O)COCC(=O)CCCOCCN=[N+]=[N-])C(=O)NC1=CC=C(COC(=O)OC2(CC)C(=O)OCC3=C2C=C2C4=NC5=CC=C(O[Si](C)(C)C(C)(C)C)C=C5C(CC)=C4CN2C3=O)C=C1 Chemical compound C#CCCC(=O)C1CCC(CN2C(=O)C=CC2=O)CC1.[3H]CCNCCCCC(CC(=O)COCC(=O)CCCOCCN=[N+]=[N-])C(=O)NC1=CC=C(COC(=O)OC2(CC)C(=O)OCC3=C2C=C2C4=NC5=CC=C(O[Si](C)(C)C(C)(C)C)C=C5C(CC)=C4CN2C3=O)C=C1 CKQXBQQRVTVPAO-ULNHYWIVSA-N 0.000 description 1
- JZHVUNMBUWRLDS-UHFFFAOYSA-M C#CCNC(=O)C1CCC(CN2C(=O)C=CC2=O)CC1.CC.CC(C)C(CO)CC(=O)COCC(=O)CCCOCCN=[N+]=[N-].CC(C)C(N)CO.CCB(C)O.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(OB(C)O)C=C21)C(CC)(OC(=O)Cl)C(=O)OC4.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(OB(C)O)C=C21)C(CC)(OC(=O)OCC(NC(=O)COCC(=O)NCCOCCN=[N+]=[N-])C(C)C)C(=O)OC4.[Cu]Br.[N-]=[N+]=NCCOCCCC(=O)COCC(=O)O Chemical compound C#CCNC(=O)C1CCC(CN2C(=O)C=CC2=O)CC1.CC.CC(C)C(CO)CC(=O)COCC(=O)CCCOCCN=[N+]=[N-].CC(C)C(N)CO.CCB(C)O.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(OB(C)O)C=C21)C(CC)(OC(=O)Cl)C(=O)OC4.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(OB(C)O)C=C21)C(CC)(OC(=O)OCC(NC(=O)COCC(=O)NCCOCCN=[N+]=[N-])C(C)C)C(=O)OC4.[Cu]Br.[N-]=[N+]=NCCOCCCC(=O)COCC(=O)O JZHVUNMBUWRLDS-UHFFFAOYSA-M 0.000 description 1
- ADFKUIIFAFYHIG-LRNDNLPXSA-M C#CCNC(=O)C1CCC(CN2C(=O)C=CC2=O)CC1.CC.CC(C)C(N)CO.CCC.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC(NC(=O)C(CCCCN)CC(=O)COCC(=O)CCCOCN1C=C(CCC(=O)C2CCC(CN3C(=O)C=CC3=O)CC2)N=N1)C(C)C)C(=O)OC4.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O[Si](C)(C)C(C)(C)C)C=C21)C(CC)(OC(=O)Cl)C(=O)OC4.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O[Si](C)(C)C(C)(C)C)C=C21)C(CC)(OC(=O)OCC(NC(=O)C(CCCCN)CC(=O)COCC(=O)CCCOCCN=[N+]=[N-])C(C)C)C(=O)OC4.[3H]CCNCCCCC(CC(=O)COCC(=O)CCCOCCN=[N+]=[N-])C(=O)NC(CO)C(C)C.[3H]CCNCCCCC(CC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)O.[3H]CCNCCCCC(N)C(=O)NC(CO)C(C)C.[Cu]Br.[H]CC[3H].[H]CC[3H] Chemical compound C#CCNC(=O)C1CCC(CN2C(=O)C=CC2=O)CC1.CC.CC(C)C(N)CO.CCC.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC(NC(=O)C(CCCCN)CC(=O)COCC(=O)CCCOCN1C=C(CCC(=O)C2CCC(CN3C(=O)C=CC3=O)CC2)N=N1)C(C)C)C(=O)OC4.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O[Si](C)(C)C(C)(C)C)C=C21)C(CC)(OC(=O)Cl)C(=O)OC4.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O[Si](C)(C)C(C)(C)C)C=C21)C(CC)(OC(=O)OCC(NC(=O)C(CCCCN)CC(=O)COCC(=O)CCCOCCN=[N+]=[N-])C(C)C)C(=O)OC4.[3H]CCNCCCCC(CC(=O)COCC(=O)CCCOCCN=[N+]=[N-])C(=O)NC(CO)C(C)C.[3H]CCNCCCCC(CC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)O.[3H]CCNCCCCC(N)C(=O)NC(CO)C(C)C.[Cu]Br.[H]CC[3H].[H]CC[3H] ADFKUIIFAFYHIG-LRNDNLPXSA-M 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- YGXCFYMAPFXSCG-UHFFFAOYSA-N C.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC(NC(=O)C(CCCCN)CC(=O)COCC(=O)CCCOCCOCCOCCOCCOCCOCCOCCOCCN1C=C(C)N=N1)C(C)C)C(=O)OC4 Chemical compound C.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC(NC(=O)C(CCCCN)CC(=O)COCC(=O)CCCOCCOCCOCCOCCOCCOCCOCCOCCN1C=C(C)N=N1)C(C)C)C(=O)OC4 YGXCFYMAPFXSCG-UHFFFAOYSA-N 0.000 description 1
- ZTNPBLINYYMSOH-RCYQTNAPSA-N C.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(OC(=O)N(C)CCNC)C=C21)[C@@](O)(CC)C(=O)OC4.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(OC(=O)OC3=CC=C([N+](=O)[O-])C=C3)C=C21)[C@@](O)(CC)C(=O)OC4.CCCCNC.O=CC(F)(F)F.[3H]CC.[3H]CC.[3H]CCN(C)CCCC.[N-38]=S.[N-]=[N+]=NCCOCCNC(=O)COCC(=O)NC(CC1=CC=CC=C1)C(=O)CC(CCCCN)C(=O)NC1=CC=C(CO)C=C1.[N-]=[N+]=NCCOCCNC(=O)COCC(=O)NC(CC1=CC=CC=C1)C(=O)CC(CCCCN)C(=O)NC1=CC=C(COC(=O)OC2=CC=C([N+](=O)[O-])C=C2)C=C1 Chemical compound C.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(OC(=O)N(C)CCNC)C=C21)[C@@](O)(CC)C(=O)OC4.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(OC(=O)OC3=CC=C([N+](=O)[O-])C=C3)C=C21)[C@@](O)(CC)C(=O)OC4.CCCCNC.O=CC(F)(F)F.[3H]CC.[3H]CC.[3H]CCN(C)CCCC.[N-38]=S.[N-]=[N+]=NCCOCCNC(=O)COCC(=O)NC(CC1=CC=CC=C1)C(=O)CC(CCCCN)C(=O)NC1=CC=C(CO)C=C1.[N-]=[N+]=NCCOCCNC(=O)COCC(=O)NC(CC1=CC=CC=C1)C(=O)CC(CCCCN)C(=O)NC1=CC=C(COC(=O)OC2=CC=C([N+](=O)[O-])C=C2)C=C1 ZTNPBLINYYMSOH-RCYQTNAPSA-N 0.000 description 1
- AUFJNMCUPXPTPA-UHFFFAOYSA-N CCC1=C2CN3C(=O)C4=C(/C=C\3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC1=CC=C(C)C=C1)C(=O)OC4.CCN1C=C(CCC(=O)C2CCC(CN3C(=O)CC(C)C3=O)CC2)N=N1.CCN1C=C(CNC(=O)C2CCC(CN3C(=O)CC(C)C3=O)CC2)N=N1.CCOC(=O)OC1(CC)C(=O)OCC2=C1C=C1C3=NC4=CC=C(O)C=C4C(CC)=C3CN1C2=O.CCOCCOCCOCCOCCOCCOCCOCCOCCCC(=O)COCC(=O)CC(CCCCN)C(=O)NC.CCOCCOCCOCCOCCOCCOCCOCCOCCNC(=O)COCC(=O)CCNC(C)C(C)C Chemical compound CCC1=C2CN3C(=O)C4=C(/C=C\3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC1=CC=C(C)C=C1)C(=O)OC4.CCN1C=C(CCC(=O)C2CCC(CN3C(=O)CC(C)C3=O)CC2)N=N1.CCN1C=C(CNC(=O)C2CCC(CN3C(=O)CC(C)C3=O)CC2)N=N1.CCOC(=O)OC1(CC)C(=O)OCC2=C1C=C1C3=NC4=CC=C(O)C=C4C(CC)=C3CN1C2=O.CCOCCOCCOCCOCCOCCOCCOCCOCCCC(=O)COCC(=O)CC(CCCCN)C(=O)NC.CCOCCOCCOCCOCCOCCOCCOCCOCCNC(=O)COCC(=O)CCNC(C)C(C)C AUFJNMCUPXPTPA-UHFFFAOYSA-N 0.000 description 1
- SCCOZRQJRHPEFB-UHFFFAOYSA-N CCC1=C2CN3C(=O)C4=C(/C=C\3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC1=CC=C(C)C=C1)C(=O)OC4.CNC(=O)C(CCCCN)CC(=O)COCC(=O)CCCOCCOCCOCCOCCOCCOCCOCCOCCN1C=C(CCC(=O)C2CCC(CN3C(=O)CC(C)C3=O)CC2)N=N1 Chemical compound CCC1=C2CN3C(=O)C4=C(/C=C\3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC1=CC=C(C)C=C1)C(=O)OC4.CNC(=O)C(CCCCN)CC(=O)COCC(=O)CCCOCCOCCOCCOCCOCCOCCOCCOCCN1C=C(CCC(=O)C2CCC(CN3C(=O)CC(C)C3=O)CC2)N=N1 SCCOZRQJRHPEFB-UHFFFAOYSA-N 0.000 description 1
- DUBDNJQSNQOSME-UHFFFAOYSA-N CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC(NC(=O)C(CCCCN)CC(=O)COCC(=O)CCCOCCOCCOCCOCCOCCOCCOCCOCCN1C=C(CCC(=O)C2CCC(CN3C(=O)CC(C)C3=O)CC2)N=N1)C(C)C)C(=O)OC4.[N-38]=S Chemical compound CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC(NC(=O)C(CCCCN)CC(=O)COCC(=O)CCCOCCOCCOCCOCCOCCOCCOCCOCCN1C=C(CCC(=O)C2CCC(CN3C(=O)CC(C)C3=O)CC2)N=N1)C(C)C)C(=O)OC4.[N-38]=S DUBDNJQSNQOSME-UHFFFAOYSA-N 0.000 description 1
- PCRFFMASUWYDNR-UHFFFAOYSA-N CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC(NC(=O)C(CCCCNC(=O)C(F)(F)F)CC(=O)COCC(=O)CCCOCN1C=C(CCC(=O)C2CCC(CN3C(=O)C=CC3=O)CC2)N=N1)C(C)C)C(=O)OC4 Chemical compound CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC(NC(=O)C(CCCCNC(=O)C(F)(F)F)CC(=O)COCC(=O)CCCOCN1C=C(CCC(=O)C2CCC(CN3C(=O)C=CC3=O)CC2)N=N1)C(C)C)C(=O)OC4 PCRFFMASUWYDNR-UHFFFAOYSA-N 0.000 description 1
- XZYSQUCKXFMGCE-UHFFFAOYSA-N CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC(NC(=O)COCC(=O)NCCOCCN1C=C(CNC(=O)C2CCC(CN3C(=O)C=CC3=O)CC2)N=N1)C(C)C)C(=O)OC4.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(OB(C)O)C=C21)C(CC)(OC(=O)OCC(NC(=O)COCC(=O)NCCOCCN1C=C(CNC(=O)C2CCC(CN3C(=O)C=CC3=O)CC2)N=N1)C(C)C)C(=O)OC4 Chemical compound CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC(NC(=O)COCC(=O)NCCOCCN1C=C(CNC(=O)C2CCC(CN3C(=O)C=CC3=O)CC2)N=N1)C(C)C)C(=O)OC4.CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(OB(C)O)C=C21)C(CC)(OC(=O)OCC(NC(=O)COCC(=O)NCCOCCN1C=C(CNC(=O)C2CCC(CN3C(=O)C=CC3=O)CC2)N=N1)C(C)C)C(=O)OC4 XZYSQUCKXFMGCE-UHFFFAOYSA-N 0.000 description 1
- GIASWEHZWDFSDF-UHFFFAOYSA-N CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC(NC(=O)COCC(=O)NCCOCCOCCOCCOCCOCCOCCOCCOCCN1C=C(CNC(=O)C2CCC(CN3C(=O)CC(C)C3=O)CC2)N=N1)C(C)C)C(=O)OC4 Chemical compound CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O)C=C21)C(CC)(OC(=O)OCC(NC(=O)COCC(=O)NCCOCCOCCOCCOCCOCCOCCOCCOCCN1C=C(CNC(=O)C2CCC(CN3C(=O)CC(C)C3=O)CC2)N=N1)C(C)C)C(=O)OC4 GIASWEHZWDFSDF-UHFFFAOYSA-N 0.000 description 1
- XEUAOORHQACVGL-GNSFJQDSSA-N CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O[Si](C)(C)C(C)(C)C)C=C21)C(CC)(OC(=O)Cl)C(=O)OC4.NC1=CC=C(CO)C=C1.[3H]CCNCCCCC(CC(=O)COCC(=O)CCCOCCN=[N+]=[N-])C(=O)NC1=CC=C(CO)C=C1.[3H]CCNCCCCC(CC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)O.[3H]CCNCCCCC(N)C(=O)NC1=CC=C(CO)C=C1 Chemical compound CCC1=C2CN3C(=O)C4=C(C=C3C2=NC2=CC=C(O[Si](C)(C)C(C)(C)C)C=C21)C(CC)(OC(=O)Cl)C(=O)OC4.NC1=CC=C(CO)C=C1.[3H]CCNCCCCC(CC(=O)COCC(=O)CCCOCCN=[N+]=[N-])C(=O)NC1=CC=C(CO)C=C1.[3H]CCNCCCCC(CC(=O)OCC1C2=C(C=CC=C2)C2=C1C=CC=C2)C(=O)O.[3H]CCNCCCCC(N)C(=O)NC1=CC=C(CO)C=C1 XEUAOORHQACVGL-GNSFJQDSSA-N 0.000 description 1
- KLMONNQMRBDERO-UHFFFAOYSA-N CCCCCC(CC(=O)COCC(=O)CCCOCCN1C=C(CCC(=O)C2CCC(CN3C(=O)CC(C)C3=O)CC2)N=N1)C(=O)NC1=CC=C(COC(=O)OC2(CC)C(=O)OCC3=C2C=C2C4=NC5=CC=C(O)C=C5C(CC)=C4CN2C3=O)C=C1 Chemical compound CCCCCC(CC(=O)COCC(=O)CCCOCCN1C=C(CCC(=O)C2CCC(CN3C(=O)CC(C)C3=O)CC2)N=N1)C(=O)NC1=CC=C(COC(=O)OC2(CC)C(=O)OCC3=C2C=C2C4=NC5=CC=C(O)C=C5C(CC)=C4CN2C3=O)C=C1 KLMONNQMRBDERO-UHFFFAOYSA-N 0.000 description 1
- FVLVBPDQNARYJU-XAHDHGMMSA-N C[C@H]1CCC(CC1)NC(=O)N(CCCl)N=O Chemical compound C[C@H]1CCC(CC1)NC(=O)N(CCCl)N=O FVLVBPDQNARYJU-XAHDHGMMSA-N 0.000 description 1
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 1
- 101710169873 Capsid protein G8P Proteins 0.000 description 1
- KXDHJXZQYSOELW-UHFFFAOYSA-N Carbamic acid Chemical group NC(O)=O KXDHJXZQYSOELW-UHFFFAOYSA-N 0.000 description 1
- 102100025466 Carcinoembryonic antigen-related cell adhesion molecule 3 Human genes 0.000 description 1
- 102100025470 Carcinoembryonic antigen-related cell adhesion molecule 8 Human genes 0.000 description 1
- 206010007279 Carcinoid tumour of the gastrointestinal tract Diseases 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 102000005600 Cathepsins Human genes 0.000 description 1
- 108010084457 Cathepsins Proteins 0.000 description 1
- 206010008263 Cervical dysplasia Diseases 0.000 description 1
- JWBOIMRXGHLCPP-UHFFFAOYSA-N Chloditan Chemical compound C=1C=CC=C(Cl)C=1C(C(Cl)Cl)C1=CC=C(Cl)C=C1 JWBOIMRXGHLCPP-UHFFFAOYSA-N 0.000 description 1
- 206010008724 Chondroectodermal dysplasia Diseases 0.000 description 1
- 208000005243 Chondrosarcoma Diseases 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- 102100021809 Chorionic somatomammotropin hormone 1 Human genes 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 1
- 201000000304 Cleidocranial dysplasia Diseases 0.000 description 1
- 201000007408 Clouston syndrome Diseases 0.000 description 1
- 102100031162 Collagen alpha-1(XVIII) chain Human genes 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 208000009798 Craniopharyngioma Diseases 0.000 description 1
- VMQMZMRVKUZKQL-UHFFFAOYSA-N Cu+ Chemical compound [Cu+] VMQMZMRVKUZKQL-UHFFFAOYSA-N 0.000 description 1
- 102000008130 Cyclic AMP-Dependent Protein Kinases Human genes 0.000 description 1
- 108010049894 Cyclic AMP-Dependent Protein Kinases Proteins 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- LEVWYRKDKASIDU-QWWZWVQMSA-N D-cystine Chemical compound OC(=O)[C@H](N)CSSC[C@@H](N)C(O)=O LEVWYRKDKASIDU-QWWZWVQMSA-N 0.000 description 1
- XUIIKFGFIJCVMT-GFCCVEGCSA-N D-thyroxine Chemical compound IC1=CC(C[C@@H](N)C(O)=O)=CC(I)=C1OC1=CC(I)=C(O)C(I)=C1 XUIIKFGFIJCVMT-GFCCVEGCSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 108010092160 Dactinomycin Proteins 0.000 description 1
- 208000005335 Dentin Dysplasia Diseases 0.000 description 1
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 1
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 1
- 208000002699 Digestive System Neoplasms Diseases 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 208000006586 Ectromelia Diseases 0.000 description 1
- 201000002650 Ellis-van Creveld syndrome Diseases 0.000 description 1
- 201000009051 Embryonal Carcinoma Diseases 0.000 description 1
- 108010079505 Endostatins Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 208000031637 Erythroblastic Acute Leukemia Diseases 0.000 description 1
- 208000036566 Erythroleukaemia Diseases 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 102100038595 Estrogen receptor Human genes 0.000 description 1
- 208000017259 Extragonadal germ cell tumor Diseases 0.000 description 1
- 206010067141 Faciodigitogenital dysplasia Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 1
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 1
- 208000000571 Fibrocystic breast disease Diseases 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 208000008961 Fibrous Dysplasia of Bone Diseases 0.000 description 1
- 241000724791 Filamentous phage Species 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 206010073655 Freeman-Sheldon syndrome Diseases 0.000 description 1
- 206010017533 Fungal infection Diseases 0.000 description 1
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 1
- GYHNNYVSQQEPJS-UHFFFAOYSA-N Gallium Chemical compound [Ga] GYHNNYVSQQEPJS-UHFFFAOYSA-N 0.000 description 1
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 1
- 206010051635 Gastrointestinal tract adenoma Diseases 0.000 description 1
- 208000015872 Gaucher disease Diseases 0.000 description 1
- 108700004714 Gelonium multiflorum GEL Proteins 0.000 description 1
- 208000021309 Germ cell tumor Diseases 0.000 description 1
- 201000010915 Glioblastoma multiforme Diseases 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 201000003200 Goldenhar Syndrome Diseases 0.000 description 1
- 102000006771 Gonadotropins Human genes 0.000 description 1
- 108010086677 Gonadotropins Proteins 0.000 description 1
- 108010039334 HIV Envelope Protein gp120 Proteins 0.000 description 1
- 208000001258 Hemangiosarcoma Diseases 0.000 description 1
- 208000031916 Hidrotic ectodermal dysplasia Diseases 0.000 description 1
- 108010025076 Holoenzymes Proteins 0.000 description 1
- 206010050469 Holt-Oram syndrome Diseases 0.000 description 1
- 101000897480 Homo sapiens C-C motif chemokine 2 Proteins 0.000 description 1
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 1
- 101000914337 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 3 Proteins 0.000 description 1
- 101000914320 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 8 Proteins 0.000 description 1
- 101001059454 Homo sapiens Serine/threonine-protein kinase MARK2 Proteins 0.000 description 1
- 101000614798 Homo sapiens cAMP-dependent protein kinase type II-alpha regulatory subunit Proteins 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 1
- 208000019758 Hypergammaglobulinemia Diseases 0.000 description 1
- 206010020880 Hypertrophy Diseases 0.000 description 1
- 206010021042 Hypopharyngeal cancer Diseases 0.000 description 1
- 206010056305 Hypopharyngeal neoplasm Diseases 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102100026818 Inhibin beta E chain Human genes 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 1
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 1
- 102100025947 Insulin-like growth factor II Human genes 0.000 description 1
- 102000003996 Interferon-beta Human genes 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 102000003814 Interleukin-10 Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 108090000177 Interleukin-11 Proteins 0.000 description 1
- 102000003815 Interleukin-11 Human genes 0.000 description 1
- 108090000176 Interleukin-13 Proteins 0.000 description 1
- 101800003050 Interleukin-16 Proteins 0.000 description 1
- 102000049772 Interleukin-16 Human genes 0.000 description 1
- 102100030703 Interleukin-22 Human genes 0.000 description 1
- 102000000646 Interleukin-3 Human genes 0.000 description 1
- 108010002386 Interleukin-3 Proteins 0.000 description 1
- 102000004388 Interleukin-4 Human genes 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 102100039897 Interleukin-5 Human genes 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 102100021592 Interleukin-7 Human genes 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 102000000585 Interleukin-9 Human genes 0.000 description 1
- 208000005016 Intestinal Neoplasms Diseases 0.000 description 1
- 208000032177 Intestinal Polyps Diseases 0.000 description 1
- 206010061252 Intraocular melanoma Diseases 0.000 description 1
- 108010044467 Isoenzymes Proteins 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 208000001126 Keratosis Diseases 0.000 description 1
- 102100020880 Kit ligand Human genes 0.000 description 1
- 235000019766 L-Lysine Nutrition 0.000 description 1
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 1
- 206010023825 Laryngeal cancer Diseases 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- 102000016267 Leptin Human genes 0.000 description 1
- 108010092277 Leptin Proteins 0.000 description 1
- LSPYFSHXDAYVDI-SRVKXCTJSA-N Leu-Ala-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC(C)C LSPYFSHXDAYVDI-SRVKXCTJSA-N 0.000 description 1
- 206010024305 Leukaemia monocytic Diseases 0.000 description 1
- 102100032352 Leukemia inhibitory factor Human genes 0.000 description 1
- 108090000581 Leukemia inhibitory factor Proteins 0.000 description 1
- 206010024503 Limb reduction defect Diseases 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- 208000028018 Lymphocytic leukaemia Diseases 0.000 description 1
- 102000008072 Lymphokines Human genes 0.000 description 1
- 108010074338 Lymphokines Proteins 0.000 description 1
- 206010025312 Lymphoma AIDS related Diseases 0.000 description 1
- 208000030289 Lymphoproliferative disease Diseases 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 101710156564 Major tail protein Gp23 Proteins 0.000 description 1
- 208000004059 Male Breast Neoplasms Diseases 0.000 description 1
- 208000006644 Malignant Fibrous Histiocytoma Diseases 0.000 description 1
- 208000030070 Malignant epithelial tumor of ovary Diseases 0.000 description 1
- 206010025557 Malignant fibrous histiocytoma of bone Diseases 0.000 description 1
- 208000032271 Malignant tumor of penis Diseases 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 201000001853 McCune-Albright syndrome Diseases 0.000 description 1
- 208000007054 Medullary Carcinoma Diseases 0.000 description 1
- 208000009018 Medullary thyroid cancer Diseases 0.000 description 1
- 206010054949 Metaplasia Diseases 0.000 description 1
- 102000009664 Microtubule-Associated Proteins Human genes 0.000 description 1
- 108010020004 Microtubule-Associated Proteins Proteins 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 108010006519 Molecular Chaperones Proteins 0.000 description 1
- 102000013967 Monokines Human genes 0.000 description 1
- 108010050619 Monokines Proteins 0.000 description 1
- 241000186359 Mycobacterium Species 0.000 description 1
- 208000031888 Mycoses Diseases 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 208000014767 Myeloproliferative disease Diseases 0.000 description 1
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 1
- 101150111783 NTRK1 gene Proteins 0.000 description 1
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 241000588653 Neisseria Species 0.000 description 1
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 1
- 108010025020 Nerve Growth Factor Proteins 0.000 description 1
- 102000007072 Nerve Growth Factors Human genes 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 206010051934 Oculoauriculovertebral dysplasia Diseases 0.000 description 1
- 208000008909 Oculodentodigital dysplasia Diseases 0.000 description 1
- 208000004910 Odontodysplasia Diseases 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 206010050171 Oesophageal dysplasia Diseases 0.000 description 1
- 201000010133 Oligodendroglioma Diseases 0.000 description 1
- 206010031096 Oropharyngeal cancer Diseases 0.000 description 1
- 206010057444 Oropharyngeal neoplasm Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 101710160107 Outer membrane protein A Proteins 0.000 description 1
- 208000007571 Ovarian Epithelial Carcinoma Diseases 0.000 description 1
- 206010061328 Ovarian epithelial cancer Diseases 0.000 description 1
- 206010033268 Ovarian low malignant potential tumour Diseases 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 241000282520 Papio Species 0.000 description 1
- 208000002774 Paraproteinemias Diseases 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 208000000821 Parathyroid Neoplasms Diseases 0.000 description 1
- 102000003982 Parathyroid hormone Human genes 0.000 description 1
- 108090000445 Parathyroid hormone Proteins 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 206010034299 Penile cancer Diseases 0.000 description 1
- 229940083963 Peptide antagonist Drugs 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- ABLZXFCXXLZCGV-UHFFFAOYSA-N Phosphorous acid Chemical group OP(O)=O ABLZXFCXXLZCGV-UHFFFAOYSA-N 0.000 description 1
- 208000007913 Pituitary Neoplasms Diseases 0.000 description 1
- 108010003044 Placental Lactogen Proteins 0.000 description 1
- 239000000381 Placental Lactogen Substances 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 229920001054 Poly(ethylene‐co‐vinyl acetate) Polymers 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 208000006994 Precancerous Conditions Diseases 0.000 description 1
- 108010076181 Proinsulin Proteins 0.000 description 1
- 102000003946 Prolactin Human genes 0.000 description 1
- 108010057464 Prolactin Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 102100020718 Receptor-type tyrosine-protein kinase FLT3 Human genes 0.000 description 1
- 101710151245 Receptor-type tyrosine-protein kinase FLT3 Proteins 0.000 description 1
- 108090000103 Relaxin Proteins 0.000 description 1
- 102000003743 Relaxin Human genes 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 208000004337 Salivary Gland Neoplasms Diseases 0.000 description 1
- 201000010208 Seminoma Diseases 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- 102100028904 Serine/threonine-protein kinase MARK2 Human genes 0.000 description 1
- 208000009359 Sezary Syndrome Diseases 0.000 description 1
- 208000021388 Sezary disease Diseases 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical class [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 1
- 108010039445 Stem Cell Factor Proteins 0.000 description 1
- 208000031673 T-Cell Cutaneous Lymphoma Diseases 0.000 description 1
- 208000027585 T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- WDLRUFUQRNWCPK-UHFFFAOYSA-N Tetraxetan Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC1 WDLRUFUQRNWCPK-UHFFFAOYSA-N 0.000 description 1
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 1
- 108060008245 Thrombospondin Proteins 0.000 description 1
- 102000002938 Thrombospondin Human genes 0.000 description 1
- 201000009365 Thymic carcinoma Diseases 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- 102400001320 Transforming growth factor alpha Human genes 0.000 description 1
- 101800004564 Transforming growth factor alpha Proteins 0.000 description 1
- 206010044407 Transitional cell cancer of the renal pelvis and ureter Diseases 0.000 description 1
- 208000015778 Undifferentiated pleomorphic sarcoma Diseases 0.000 description 1
- 206010046431 Urethral cancer Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 201000005969 Uveal melanoma Diseases 0.000 description 1
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 1
- 206010047115 Vasculitis Diseases 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 208000014070 Vestibular schwannoma Diseases 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- YUYDPYBEGXWUEP-UHFFFAOYSA-N [N-]=[N+]=NCCOCCOCCOCCOCCOCCOCCOCCOCCNC(=O)COCC(=O)ONS Chemical compound [N-]=[N+]=NCCOCCOCCOCCOCCOCCOCCOCCOCCNC(=O)COCC(=O)ONS YUYDPYBEGXWUEP-UHFFFAOYSA-N 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 208000004064 acoustic neuroma Diseases 0.000 description 1
- 208000009621 actinic keratosis Diseases 0.000 description 1
- 229940125666 actinium-225 Drugs 0.000 description 1
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000000488 activin Substances 0.000 description 1
- 208000021841 acute erythroid leukemia Diseases 0.000 description 1
- 208000020990 adrenal cortex carcinoma Diseases 0.000 description 1
- 208000007128 adrenocortical carcinoma Diseases 0.000 description 1
- 208000014619 adult acute lymphoblastic leukemia Diseases 0.000 description 1
- 201000011184 adult acute lymphocytic leukemia Diseases 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 108010054982 alanyl-leucyl-alanyl-leucine Proteins 0.000 description 1
- 229940045714 alkyl sulfonate alkylating agent Drugs 0.000 description 1
- 150000008052 alkyl sulfonates Chemical class 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 201000007538 anal carcinoma Diseases 0.000 description 1
- 229960002932 anastrozole Drugs 0.000 description 1
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 1
- 239000004037 angiogenesis inhibitor Substances 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 230000003527 anti-angiogenesis Effects 0.000 description 1
- 230000001772 anti-angiogenic effect Effects 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 230000000843 anti-fungal effect Effects 0.000 description 1
- 230000002924 anti-infective effect Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000002001 anti-metastasis Effects 0.000 description 1
- 230000002927 anti-mitotic effect Effects 0.000 description 1
- 239000000868 anti-mullerian hormone Substances 0.000 description 1
- 230000002223 anti-pathogen Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 230000001147 anti-toxic effect Effects 0.000 description 1
- 238000009175 antibody therapy Methods 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- 102000025171 antigen binding proteins Human genes 0.000 description 1
- 108091000831 antigen binding proteins Proteins 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 229940045687 antimetabolites folic acid analogs Drugs 0.000 description 1
- 239000003080 antimitotic agent Substances 0.000 description 1
- 229940045719 antineoplastic alkylating agent nitrosoureas Drugs 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 201000011165 anus cancer Diseases 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000008135 aqueous vehicle Substances 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 208000037979 autoimmune inflammatory disease Diseases 0.000 description 1
- QQOBRRFOVWGIMD-OJAKKHQRSA-N azaribine Chemical compound CC(=O)O[C@@H]1[C@H](OC(C)=O)[C@@H](COC(=O)C)O[C@H]1N1C(=O)NC(=O)C=N1 QQOBRRFOVWGIMD-OJAKKHQRSA-N 0.000 description 1
- 229950010054 azaribine Drugs 0.000 description 1
- 125000000852 azido group Chemical group *N=[N+]=[N-] 0.000 description 1
- 229930014667 baccatin III Natural products 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 229960002707 bendamustine Drugs 0.000 description 1
- YTKUWDBFDASYHO-UHFFFAOYSA-N bendamustine Chemical compound ClCCN(CCCl)C1=CC=C2N(C)C(CCCC(O)=O)=NC2=C1 YTKUWDBFDASYHO-UHFFFAOYSA-N 0.000 description 1
- 201000007180 bile duct carcinoma Diseases 0.000 description 1
- 208000026900 bile duct neoplasm Diseases 0.000 description 1
- 229920000249 biocompatible polymer Polymers 0.000 description 1
- 238000007622 bioinformatic analysis Methods 0.000 description 1
- ACBQROXDOHKANW-UHFFFAOYSA-N bis(4-nitrophenyl) carbonate Chemical compound C1=CC([N+](=O)[O-])=CC=C1OC(=O)OC1=CC=C([N+]([O-])=O)C=C1 ACBQROXDOHKANW-UHFFFAOYSA-N 0.000 description 1
- 201000001531 bladder carcinoma Diseases 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 201000008873 bone osteosarcoma Diseases 0.000 description 1
- 208000012172 borderline epithelial tumor of ovary Diseases 0.000 description 1
- 150000001639 boron compounds Chemical class 0.000 description 1
- 229960001467 bortezomib Drugs 0.000 description 1
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 1
- 108010006025 bovine growth hormone Proteins 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 208000011803 breast fibrocystic disease Diseases 0.000 description 1
- 208000003362 bronchogenic carcinoma Diseases 0.000 description 1
- 206010006475 bronchopulmonary dysplasia Diseases 0.000 description 1
- 229960005539 bryostatin 1 Drugs 0.000 description 1
- MJQUEDHRCUIRLF-TVIXENOKSA-N bryostatin 1 Chemical compound C([C@@H]1CC(/[C@@H]([C@@](C(C)(C)/C=C/2)(O)O1)OC(=O)/C=C/C=C/CCC)=C\C(=O)OC)[C@H]([C@@H](C)O)OC(=O)C[C@H](O)C[C@@H](O1)C[C@H](OC(C)=O)C(C)(C)[C@]1(O)C[C@@H]1C\C(=C\C(=O)OC)C[C@H]\2O1 MJQUEDHRCUIRLF-TVIXENOKSA-N 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical class C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 1
- 229940112129 campath Drugs 0.000 description 1
- 125000005587 carbonate group Chemical group 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-N carbonic acid Chemical class OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 229940047495 celebrex Drugs 0.000 description 1
- RZEKVGVHFLEQIL-UHFFFAOYSA-N celecoxib Chemical compound C1=CC(C)=CC=C1C1=CC(C(F)(F)F)=NN1C1=CC=C(S(N)(=O)=O)C=C1 RZEKVGVHFLEQIL-UHFFFAOYSA-N 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 201000007335 cerebellar astrocytoma Diseases 0.000 description 1
- 208000030239 cerebral astrocytoma Diseases 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 208000007287 cheilitis Diseases 0.000 description 1
- 239000013522 chelant Substances 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 208000018805 childhood acute lymphoblastic leukemia Diseases 0.000 description 1
- 201000011633 childhood acute lymphocytic leukemia Diseases 0.000 description 1
- 201000002687 childhood acute myeloid leukemia Diseases 0.000 description 1
- 201000004018 childhood brain stem glioma Diseases 0.000 description 1
- 201000004677 childhood cerebellar astrocytic neoplasm Diseases 0.000 description 1
- 201000008522 childhood cerebral astrocytoma Diseases 0.000 description 1
- 201000005793 childhood medulloblastoma Diseases 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- AOGYCOYQMAVAFD-UHFFFAOYSA-N chlorocarbonic acid Chemical class OC(Cl)=O AOGYCOYQMAVAFD-UHFFFAOYSA-N 0.000 description 1
- 208000006990 cholangiocarcinoma Diseases 0.000 description 1
- 208000001020 chondrodysplasia punctata Diseases 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 208000024207 chronic leukemia Diseases 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 230000000112 colonic effect Effects 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 230000000536 complexating effect Effects 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000006184 cosolvent Substances 0.000 description 1
- 239000003431 cross linking reagent Substances 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 230000005574 cross-species transmission Effects 0.000 description 1
- 239000013058 crude material Substances 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 201000007241 cutaneous T cell lymphoma Diseases 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 208000002445 cystadenocarcinoma Diseases 0.000 description 1
- 229960003067 cystine Drugs 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 210000004292 cytoskeleton Anatomy 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 229960000640 dactinomycin Drugs 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 229940124447 delivery agent Drugs 0.000 description 1
- 125000000422 delta-lactone group Chemical group 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 210000003298 dental enamel Anatomy 0.000 description 1
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 150000004985 diamines Chemical class 0.000 description 1
- 208000015799 differentiated thyroid carcinoma Diseases 0.000 description 1
- 238000002050 diffraction method Methods 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 210000002249 digestive system Anatomy 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- AFOSIXZFDONLBT-UHFFFAOYSA-N divinyl sulfone Chemical compound C=CS(=O)(=O)C=C AFOSIXZFDONLBT-UHFFFAOYSA-N 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 229940000406 drug candidate Drugs 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 229940126534 drug product Drugs 0.000 description 1
- 239000003596 drug target Substances 0.000 description 1
- 238000002651 drug therapy Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 208000031068 ectodermal dysplasia syndrome Diseases 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 210000001671 embryonic stem cell Anatomy 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 1
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 1
- 208000037828 epithelial carcinoma Diseases 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 229960001842 estramustine Drugs 0.000 description 1
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 1
- 108010038795 estrogen receptors Proteins 0.000 description 1
- 150000002169 ethanolamines Chemical class 0.000 description 1
- 125000005912 ethyl carbonate group Chemical class 0.000 description 1
- RIFGWPKJUGCATF-UHFFFAOYSA-N ethyl chloroformate Chemical compound CCOC(Cl)=O RIFGWPKJUGCATF-UHFFFAOYSA-N 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960000752 etoposide phosphate Drugs 0.000 description 1
- LIQODXNTTZAGID-OCBXBXKTSA-N etoposide phosphate Chemical compound COC1=C(OP(O)(O)=O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 LIQODXNTTZAGID-OCBXBXKTSA-N 0.000 description 1
- 239000003777 experimental drug Substances 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 201000008819 extrahepatic bile duct carcinoma Diseases 0.000 description 1
- 208000024519 eye neoplasm Diseases 0.000 description 1
- 208000030503 familial ossifying fibroma Diseases 0.000 description 1
- 201000007741 female breast cancer Diseases 0.000 description 1
- 201000002276 female breast carcinoma Diseases 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 229940126864 fibroblast growth factor Drugs 0.000 description 1
- 208000008487 fibromuscular dysplasia Diseases 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 208000003341 florid cemento-osseous dysplasia Diseases 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 229960002074 flutamide Drugs 0.000 description 1
- MKXKFYHWDHIYRV-UHFFFAOYSA-N flutamide Chemical compound CC(C)C(=O)NC1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 MKXKFYHWDHIYRV-UHFFFAOYSA-N 0.000 description 1
- 150000002224 folic acids Chemical class 0.000 description 1
- VVIAGPKUTFNRDU-ABLWVSNPSA-N folinic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-ABLWVSNPSA-N 0.000 description 1
- 235000008191 folinic acid Nutrition 0.000 description 1
- 239000011672 folinic acid Substances 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 201000010175 gallbladder cancer Diseases 0.000 description 1
- 229910052733 gallium Inorganic materials 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- 229960003297 gemtuzumab ozogamicin Drugs 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 201000007116 gestational trophoblastic neoplasm Diseases 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 150000002333 glycines Chemical class 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000002622 gonadotropin Substances 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 239000000122 growth hormone Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 201000009277 hairy cell leukemia Diseases 0.000 description 1
- 201000000459 head and neck squamous cell carcinoma Diseases 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000029427 heart-hand syndrome Diseases 0.000 description 1
- 208000025750 heavy chain disease Diseases 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 208000014845 hemimelia Diseases 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 201000000284 histiocytoma Diseases 0.000 description 1
- 102000051387 human PRKAR2A Human genes 0.000 description 1
- 150000007857 hydrazones Chemical class 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000005661 hydrophobic surface Effects 0.000 description 1
- 150000002440 hydroxy compounds Chemical class 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 201000006866 hypopharynx cancer Diseases 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- 229960001101 ifosfamide Drugs 0.000 description 1
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000008938 immune dysregulation Effects 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 239000002596 immunotoxin Substances 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 239000000893 inhibin Substances 0.000 description 1
- ZPNFWUPYTFPOJU-LPYSRVMUSA-N iniprol Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@H]2CSSC[C@H]3C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC=4C=CC=CC=4)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=4C=CC=CC=4)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]2N(CCC2)C(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N2[C@@H](CCC2)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N2[C@@H](CCC2)C(=O)N3)C(=O)NCC(=O)NCC(=O)N[C@@H](C)C(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H](C(=O)N1)C(C)C)[C@@H](C)O)[C@@H](C)CC)=O)[C@@H](C)CC)C1=CC=C(O)C=C1 ZPNFWUPYTFPOJU-LPYSRVMUSA-N 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 108010074108 interleukin-21 Proteins 0.000 description 1
- 239000013067 intermediate product Substances 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 208000020082 intraepithelial neoplasia Diseases 0.000 description 1
- 238000003402 intramolecular cyclocondensation reaction Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000007914 intraventricular administration Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- PGLTVOMIXTUURA-UHFFFAOYSA-N iodoacetamide Chemical compound NC(=O)CI PGLTVOMIXTUURA-UHFFFAOYSA-N 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 206010023841 laryngeal neoplasm Diseases 0.000 description 1
- 231100001231 less toxic Toxicity 0.000 description 1
- 229960001691 leucovorin Drugs 0.000 description 1
- 208000002741 leukoplakia Diseases 0.000 description 1
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 239000012731 long-acting form Substances 0.000 description 1
- 201000005249 lung adenocarcinoma Diseases 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- RVFGKBWWUQOIOU-NDEPHWFRSA-N lurtotecan Chemical compound O=C([C@]1(O)CC)OCC(C(N2CC3=4)=O)=C1C=C2C3=NC1=CC=2OCCOC=2C=C1C=4CN1CCN(C)CC1 RVFGKBWWUQOIOU-NDEPHWFRSA-N 0.000 description 1
- 229950002654 lurtotecan Drugs 0.000 description 1
- 208000037829 lymphangioendotheliosarcoma Diseases 0.000 description 1
- 208000012804 lymphangiosarcoma Diseases 0.000 description 1
- 230000001926 lymphatic effect Effects 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 230000000329 lymphopenic effect Effects 0.000 description 1
- 230000002132 lysosomal effect Effects 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 201000000564 macroglobulinemia Diseases 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 238000009115 maintenance therapy Methods 0.000 description 1
- 201000003175 male breast cancer Diseases 0.000 description 1
- 208000010907 male breast carcinoma Diseases 0.000 description 1
- 208000030883 malignant astrocytoma Diseases 0.000 description 1
- 208000006178 malignant mesothelioma Diseases 0.000 description 1
- 208000026045 malignant tumor of parathyroid gland Diseases 0.000 description 1
- KJLLKLRVCJAFRY-UHFFFAOYSA-N mebutizide Chemical compound ClC1=C(S(N)(=O)=O)C=C2S(=O)(=O)NC(C(C)C(C)CC)NC2=C1 KJLLKLRVCJAFRY-UHFFFAOYSA-N 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 230000015689 metaplastic ossification Effects 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 1
- 210000003470 mitochondria Anatomy 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 229960000350 mitotane Drugs 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- 229960001156 mitoxantrone Drugs 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 201000006894 monocytic leukemia Diseases 0.000 description 1
- 208000008084 monostotic fibrous dysplasia Diseases 0.000 description 1
- 108091005763 multidomain proteins Proteins 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- KVKFRMCSXWQSNT-UHFFFAOYSA-N n,n'-dimethylethane-1,2-diamine Chemical compound CNCCNC KVKFRMCSXWQSNT-UHFFFAOYSA-N 0.000 description 1
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 1
- 208000018795 nasal cavity and paranasal sinus carcinoma Diseases 0.000 description 1
- 229940086322 navelbine Drugs 0.000 description 1
- 208000025189 neoplasm of testis Diseases 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 201000008026 nephroblastoma Diseases 0.000 description 1
- 201000011519 neuroendocrine tumor Diseases 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 239000002547 new drug Substances 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 238000001668 nucleic acid synthesis Methods 0.000 description 1
- 230000000269 nucleophilic effect Effects 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical class CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- 201000008106 ocular cancer Diseases 0.000 description 1
- 201000002575 ocular melanoma Diseases 0.000 description 1
- 208000017920 oculo-auriculo-vertebral spectrum Diseases 0.000 description 1
- 238000006384 oligomerization reaction Methods 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 208000022982 optic pathway glioma Diseases 0.000 description 1
- 210000004789 organ system Anatomy 0.000 description 1
- 201000006958 oropharynx cancer Diseases 0.000 description 1
- 230000002138 osteoinductive effect Effects 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 208000021284 ovarian germ cell tumor Diseases 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 201000010198 papillary carcinoma Diseases 0.000 description 1
- 239000000199 parathyroid hormone Substances 0.000 description 1
- 229960001319 parathyroid hormone Drugs 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 208000030940 penile carcinoma Diseases 0.000 description 1
- 201000008174 penis carcinoma Diseases 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- 201000002628 peritoneum cancer Diseases 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 238000009522 phase III clinical trial Methods 0.000 description 1
- 208000028591 pheochromocytoma Diseases 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 150000004713 phosphodiesters Chemical class 0.000 description 1
- 239000000906 photoactive agent Substances 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 208000024724 pineal body neoplasm Diseases 0.000 description 1
- 201000004123 pineal gland cancer Diseases 0.000 description 1
- 201000003113 pineoblastoma Diseases 0.000 description 1
- 208000010916 pituitary tumor Diseases 0.000 description 1
- 208000010626 plasma cell neoplasm Diseases 0.000 description 1
- 210000004180 plasmocyte Anatomy 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 229960003171 plicamycin Drugs 0.000 description 1
- 229950008499 plitidepsin Drugs 0.000 description 1
- UUSZLLQJYRSZIS-LXNNNBEUSA-N plitidepsin Chemical compound CN([C@H](CC(C)C)C(=O)N[C@@H]1C(=O)N[C@@H]([C@H](CC(=O)O[C@H](C(=O)[C@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N2CCC[C@H]2C(=O)N(C)[C@@H](CC=2C=CC(OC)=CC=2)C(=O)O[C@@H]1C)C(C)C)O)[C@@H](C)CC)C(=O)[C@@H]1CCCN1C(=O)C(C)=O UUSZLLQJYRSZIS-LXNNNBEUSA-N 0.000 description 1
- 108010049948 plitidepsin Proteins 0.000 description 1
- 231100000614 poison Toxicity 0.000 description 1
- 108700028325 pokeweed antiviral Proteins 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000570 polyether Polymers 0.000 description 1
- 229920002643 polyglutamic acid Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 208000001061 polyostotic fibrous dysplasia Diseases 0.000 description 1
- 235000020004 porter Nutrition 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 230000001855 preneoplastic effect Effects 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 208000025638 primary cutaneous T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 230000000861 pro-apoptotic effect Effects 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- 229940097325 prolactin Drugs 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- JKANAVGODYYCQF-UHFFFAOYSA-N prop-2-yn-1-amine Chemical compound NCC#C JKANAVGODYYCQF-UHFFFAOYSA-N 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 108010087851 prorelaxin Proteins 0.000 description 1
- 150000003180 prostaglandins Chemical class 0.000 description 1
- 239000003528 protein farnesyltransferase inhibitor Substances 0.000 description 1
- 230000006916 protein interaction Effects 0.000 description 1
- 238000001814 protein method Methods 0.000 description 1
- 231100000654 protein toxin Toxicity 0.000 description 1
- 239000001990 protein-drug conjugate Substances 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 239000012264 purified product Substances 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 229940051022 radioimmunoconjugate Drugs 0.000 description 1
- 229960005562 radium-223 Drugs 0.000 description 1
- GZUITABIAKMVPG-UHFFFAOYSA-N raloxifene Chemical compound C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 GZUITABIAKMVPG-UHFFFAOYSA-N 0.000 description 1
- 229960004622 raloxifene Drugs 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 208000015347 renal cell adenocarcinoma Diseases 0.000 description 1
- 208000030859 renal pelvis/ureter urothelial carcinoma Diseases 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- VHXNKPBCCMUMSW-FQEVSTJZSA-N rubitecan Chemical compound C1=CC([N+]([O-])=O)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VHXNKPBCCMUMSW-FQEVSTJZSA-N 0.000 description 1
- 229950009213 rubitecan Drugs 0.000 description 1
- 201000003804 salivary gland carcinoma Diseases 0.000 description 1
- 201000008407 sebaceous adenocarcinoma Diseases 0.000 description 1
- 229960003440 semustine Drugs 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 208000002477 septooptic dysplasia Diseases 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 239000013605 shuttle vector Substances 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 210000002027 skeletal muscle Anatomy 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 201000008261 skin carcinoma Diseases 0.000 description 1
- 201000002314 small intestine cancer Diseases 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 125000005415 substituted alkoxy group Chemical group 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- WPLOVIFNBMNBPD-ATHMIXSHSA-N subtilin Chemical compound CC1SCC(NC2=O)C(=O)NC(CC(N)=O)C(=O)NC(C(=O)NC(CCCCN)C(=O)NC(C(C)CC)C(=O)NC(=C)C(=O)NC(CCCCN)C(O)=O)CSC(C)C2NC(=O)C(CC(C)C)NC(=O)C1NC(=O)C(CCC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C1NC(=O)C(=C/C)/NC(=O)C(CCC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C2NC(=O)CNC(=O)C3CCCN3C(=O)C(NC(=O)C3NC(=O)C(CC(C)C)NC(=O)C(=C)NC(=O)C(CCC(O)=O)NC(=O)C(NC(=O)C(CCCCN)NC(=O)C(N)CC=4C5=CC=CC=C5NC=4)CSC3)C(C)SC2)C(C)C)C(C)SC1)CC1=CC=CC=C1 WPLOVIFNBMNBPD-ATHMIXSHSA-N 0.000 description 1
- 229960002317 succinimide Drugs 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 201000010965 sweat gland carcinoma Diseases 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 101150047061 tag-72 gene Proteins 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- ILMRJRBKQSSXGY-UHFFFAOYSA-N tert-butyl(dimethyl)silicon Chemical group C[Si](C)C(C)(C)C ILMRJRBKQSSXGY-UHFFFAOYSA-N 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 230000002381 testicular Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 229960003433 thalidomide Drugs 0.000 description 1
- 229960001196 thiotepa Drugs 0.000 description 1
- 210000000115 thoracic cavity Anatomy 0.000 description 1
- 201000005990 thymic dysplasia Diseases 0.000 description 1
- 208000008732 thymoma Diseases 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 229940034208 thyroxine Drugs 0.000 description 1
- XUIIKFGFIJCVMT-UHFFFAOYSA-N thyroxine-binding globulin Natural products IC1=CC(CC([NH3+])C([O-])=O)=CC(I)=C1OC1=CC(I)=C(O)C(I)=C1 XUIIKFGFIJCVMT-UHFFFAOYSA-N 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- MNRILEROXIRVNJ-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=NC=N[C]21 MNRILEROXIRVNJ-UHFFFAOYSA-N 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000003151 transfection method Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 150000004654 triazenes Chemical class 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 208000029387 trophoblastic neoplasm Diseases 0.000 description 1
- 208000018417 undifferentiated high grade pleomorphic sarcoma of bone Diseases 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 229960001055 uracil mustard Drugs 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 208000010570 urinary bladder carcinoma Diseases 0.000 description 1
- 208000012991 uterine carcinoma Diseases 0.000 description 1
- 208000037965 uterine sarcoma Diseases 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 206010046885 vaginal cancer Diseases 0.000 description 1
- 208000013139 vaginal neoplasm Diseases 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- GBABOYUKABKIAF-IELIFDKJSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-IELIFDKJSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- CILBMBUYJCWATM-PYGJLNRPSA-N vinorelbine ditartrate Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O.OC(=O)[C@H](O)[C@@H](O)C(O)=O.C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC CILBMBUYJCWATM-PYGJLNRPSA-N 0.000 description 1
- 244000052613 viral pathogen Species 0.000 description 1
- 229910052727 yttrium Inorganic materials 0.000 description 1
- VWQVUPCCIRVNHF-UHFFFAOYSA-N yttrium atom Chemical compound [Y] VWQVUPCCIRVNHF-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/47—Quinolines; Isoquinolines
- A61K31/4738—Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems
- A61K31/4745—Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems condensed with ring systems having nitrogen as a ring hetero atom, e.g. phenantrolines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68037—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a camptothecin [CPT] or derivatives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6839—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting material from viruses
- A61K47/6841—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting material from viruses the antibody targeting a RNA virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6853—Carcino-embryonic antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6855—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from breast cancer cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6857—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from lung cancer cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6859—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from liver or pancreas cancer cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6861—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from kidney or bladder cancer cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6889—Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/10—X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D491/00—Heterocyclic compounds containing in the condensed ring system both one or more rings having oxygen atoms as the only ring hetero atoms and one or more rings having nitrogen atoms as the only ring hetero atoms, not provided for by groups C07D451/00 - C07D459/00, C07D463/00, C07D477/00 or C07D489/00
- C07D491/22—Heterocyclic compounds containing in the condensed ring system both one or more rings having oxygen atoms as the only ring hetero atoms and one or more rings having nitrogen atoms as the only ring hetero atoms, not provided for by groups C07D451/00 - C07D459/00, C07D463/00, C07D477/00 or C07D489/00 in which the condensed system contains four or more hetero rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1036—Retroviridae, e.g. leukemia viruses
- C07K16/1045—Lentiviridae, e.g. HIV, FIV, SIV
- C07K16/1063—Lentiviridae, e.g. HIV, FIV, SIV env, e.g. gp41, gp110/120, gp160, V3, PND, CD4 binding site
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2833—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2887—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/303—Liver or Pancreas
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3046—Stomach, Intestines
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3076—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3076—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
- C07K16/3092—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated mucins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention relates to therapeutic conjugates with improved ability to target various cancer cells, infectious disease organisms and/or for treating autoimmune diseases, which conjugates contain a targeting (binding) moiety and a therapeutic moiety belonging to the camptothecin group of drugs.
- the targeting and therapeutic moieties are linked via an intracellularly cleavable linkage that increases therapeutic efficacy.
- MAbs monoclonal antibodies
- suitable toxic agents have been developed, but have had mixed success in the therapy of cancer, and virtually no application in other diseases, such as infectious and autoimmune diseases.
- the toxic agent is most commonly a chemotherapeutic drug, although particle-emitting radionuclides, or bacterial or plant toxins have also been conjugated to MAbs, especially for the therapy of cancer (Sharkey and Goldenberg, C A Cancer J. Clin.
- MAb-chemotherapeutic drug conjugates are that (a) the chemotherapeutic drug itself is structurally well defined; (b) the chemotherapeutic drug is linked to the MAb protein using very well defined conjugation chemistries, often at specific sites remote from the MAbs antigen binding regions; (c) MAb-chemotherapeutic drug conjugates can be made more reproducibly than chemical conjugates involving MAbs and bacterial or plant toxins, and as such are more amenable to commercial development and regulatory approval; and (d) the MAb-chemotherapeutic drug conjugates are orders of magnitude less toxic systemically than radionuclide MAb conjugates.
- MAb-chemotherapeutic drug conjugates prepared using mild acid-cleavable linkers, such as those containing a hydrazone were developed, based on the observation that the pH inside tumors was often lower than normal physiological pH (Willner et al., U.S. Pat. No. 5,708,146; Trail et al. (Science 261:212-215 (1993)).
- the first approved MAb-drug conjugate, Gemtuzumab Ozogamicin incorporates a similar acid-labile hydrazone bond between an anti-CD33 antibody, humanized P67.6, and a potent calicheamicin derivative. Sievers et al., J Clin Oncol.
- the MAb-chemotherapeutic drug conjugates were made with reductively labile hindered disulfide bonds between the chemotherapeutic drugs and the MAb (Liu et al., Proc Natl Acad Sci USA 93: 8618-8623 (1996)).
- cleavable linker involves cathepsin B-labile dipeptide spacers, such as Phe-Lys or Val-Cit, similar to the lysosomally labile peptide spacers of Trouet et al. containing from one to four amino acids, which additionally incorporated a collapsible spacer between the drug and the dipeptide (Dubowchik, et al., Bioconjugate Chem. 13:855-869 (2002); Firestone et al., U.S. Pat. No. 6,214,345 B1; Doronina et al., Nat. Biotechnol. 21: 778-784 (2003)).
- cathepsin B-labile dipeptide spacers such as Phe-Lys or Val-Cit
- the conjugates of the instant invention possess greater efficacy, in many cases, than unconjugated or “naked” antibodies or antibody fragments, although such unconjugated targeting molecules have been of use in specific situations.
- naked antibodies have come to play a role in the treatment of lymphomas (CAMPATH® and RITUXAN®), colorectal and other cancers (ERBITUX® and AVASTIN®), breast cancer (HERECEPTIN®), as well as a large number now in clinical development (e.g., epratuzumab).
- cancer for example, naked antibodies have come to play a role in the treatment of lymphomas (CAMPATH® and RITUXAN®), colorectal and other cancers (ERBITUX® and AVASTIN®), breast cancer (HERECEPTIN®), as well as a large number now in clinical development (e.g., epratuzumab).
- cancer for example, naked antibodies have come to play a role in the treatment of lymphomas (CAMP
- a variety of antibodies are also in use for the treatment of autoimmune and other immune dysregulatory diseases, such as tumor necrosis factor (TNF) and B-cell (RITUXAN®) antibodies in arthritis, and are being investigated in other such diseases, such as the B-cell antibodies, RITUXAN® and epratuzumab, in systemic lupus erythematosus and Sjögren's syndrome, as well as juvenile diabetes and multiple sclerosis. Naked antibodies are also being studied in sepsis and septic shock, Alzheimer's disease, and infectious diseases.
- TNF tumor necrosis factor
- RITUXAN® B-cell antibodies
- epratuzumab in systemic lupus erythematosus and Sjögren's syndrome
- juvenile diabetes and multiple sclerosis as well as juvenile diabetes and multiple sclerosis.
- naked antibodies are also being studied in sepsis and septic shock, Alzheimer's disease, and infectious diseases.
- Such antibody-mediated therapeutics can be developed for the treatment of many different pathogens, including bacteria, fungi, viruses, and parasites, either as naked (unconjugated), radio-labeled, or drug/toxin conjugates.
- pathogens including bacteria, fungi, viruses, and parasites, either as naked (unconjugated), radio-labeled, or drug/toxin conjugates.
- antibody conjugates with intracellularly cleavable linkers of use for the treatment of cancer, pathogens and other diseases.
- the present invention resolves an unfulfilled need in the art by providing improved methods and compositions for preparation of drug-binding moiety conjugates.
- the disclosed methods and compositions are of use for the treatment of a variety of diseases and conditions which are refractory or less responsive to other forms of therapy, and can include diseases against which suitable targeting (binding) moieties for selective targeting can be developed, or are available or known.
- the targeting moiety is an antibody, antibody fragment, bispecific or other multivalent antibody, or other antibody-based molecule or compound.
- the antibody can be of various isotypes, preferably IgG1, IgG2a, IgG3, IgG4 or IgA, and can be a chimeric human-mouse, a chimeric human-primate, a humanized (human framework and murine hyper-variable (CDR) regions), or fully human antibody, as well as variations thereof, such as half-IgG4 antibodies (referred to as “unibodies”) as described by van der Neut Kolfschoten et al. (Science 2007; 317:1554-1557), incorporated herein by reference.
- other binding moieties known in the art such as aptamers, avimers or targeting peptides, may be used.
- Preferred diseases or conditions against which such targeting moieties exist are, for example, cancer, immune dysregulatory conditions, including autoimmune diseases and inflammatory diseases, and diseases caused by infectious organisms.
- the disclosed methods and compositions may thus be applied for treatment of diseases and conditions for which targeting moieties are of use to deliver cytotoxic agents.
- diseases or conditions may be characterized by the presence of a target molecule or target cell that is insufficiently affected when unconjugated, or naked, targeting moieties are used, such as in the immunotherapy of cancer or of infection with pathogenic organisms.
- targeting moieties such as in the immunotherapy of cancer or of infection with pathogenic organisms.
- camptothecin (CPT) and its analogs and derivatives are preferred chemotherapeutic moieties, although the invention is not so limited.
- Other chemotherapeutic moieties that are within the scope of the invention are taxanes (e.g, baccatin III, taxol), epothilones, anthracycline drugs (e.g., doxorubicin (DOX), epirubicin, morpholinodoxorubicin (morpholino-DOX), cyanomorpholino-doxorubicin (cyanomorpholino-DOX), and 2-pyrrolinodoxorubicin (2-PDOX); see Priebe W (ed.), ACS symposium series 574, published by American Chemical Society, Washington D.C., 1995 (332 pp) and Nagy et al., Proc.
- the targeting moiety links to at least one chemotherapeutic moiety; preferably 1 to about 5 chemotherapeutic moieties; most preferably about 7 to about 12 chemotherapeutic moieties.
- CPT group of drugs issues of insolubility in aqueous buffers and the lability of the ⁇ -lactone moiety of the E-ring of their structures under physiological conditions are relevant.
- One approach has been to acylate the 20-hydroxyl group with an amino acid, and couple the ⁇ -amino group of the amino acid to poly-L-glutamic acid (Singer et al. in The Camptothecins: Unfolding Their Anticancer Potential, Liehr J. G., Giovanella, B. C. and Verschraegen (eds), NY Acad. Sci., NY 922:136-150 (2000)).
- This approach relies on the passive diffusion of a polymeric molecule into tumor sites.
- This glycine conjugation has also been reported as a method of making a water-soluble derivative of CPT (Vishnuvajjala et al., U.S. Pat. No. 4,943,579) and in the preparation of a PEG-derivatized CPT (Greenwald, et al. J. Med. Chem. 39: 1938-1940 (1996)).
- the approach has been devised in the context of developing water-soluble and long acting forms of CPT, whereby CPT's in vivo half-life is enhanced, and the drug is gradually released from its conjugate while in circulation in vivo.
- An example of a water soluble CPT derivative is CPT-11.
- drug conjugates of antibodies or antibody fragments may be used for targeting the therapeutic drug to pathogens, such as bacteria, viruses, fungi, and parasites.
- pathogens such as bacteria, viruses, fungi, and parasites.
- drug-conjugated targeting moieties can be used in combination with other therapeutic modalities, such as anti-fungal, antibiotics and anti-viral drugs and/or naked antibodies, immunomodulators (e.g., interferons, interleukins, and/or cytokines).
- immunomodulators e.g., interferons, interleukins, and/or cytokines.
- the drug conjugates may be used in combination with surgery, radiation therapy, chemotherapy, immunotherapy with naked antibodies, radioimmunotherapy, immunomodulators, vaccines, and the like. Similar combinations are preferred in the treatment of other diseases amenable to targeting moieties, such as autoimmune diseases.
- camptothecin conjugates can be combined with TNF inhibitors, B-cell antibodies, interferons, interleukins, and other effective agents for the treatment of autoimmune diseases, such as rheumatoid arthritis, systemic lupus erythematosis, Sjögren's syndrome, multiple sclerosis, vasculitis, as well as type-I diabetes (juvenile diabetes).
- the drug immunoconjugates can be combined with other therapeutic drugs, immunomodulators, naked MAbs, or vaccines (e.g., MAbs against hepatitis, HIV, or papilloma viruses, or vaccines based on immunogens of these viruses).
- vaccines e.g., MAbs against hepatitis, HIV, or papilloma viruses, or vaccines based on immunogens of these viruses.
- Antibodies and antigen-based vaccines against these and other viral pathogens are known in the art and, in some cases, already in commercial use.
- the invention relates to a process of preparing conjugates, wherein a drug is first derivatized with a first linker, which first linker contains a reactive moiety that is capable of combining with a second linker that additionally contains a targeting-moiety-coupling group; wherein the first linker also possesses a defined polyethylene glycol (PEG) moiety for water-solubility, and optionally an intracellularly-cleavable moiety cleavable by intracellular peptidases or cleavable by the low pH environment of endosomal and lysosomal vescicles, and optionally an amino acid spacer between the drug and the first linker; wherein the second linker contains a reactive group capable of reacting with drug-(first linker) conjugate by the copper (+1) ion-catalyzed acetylene-azide cycloaddition reaction, referred to as ‘click chemistry’.
- the defined PEG moiety is a low
- Another embodiment relates to a process of preparing conjugates as discussed in the paragraph above, wherein the second linker has a single targeting-moiety-coupling group, but multiples of the reactive group capable of reacting with drug-(first linker) conjugate, thereby amplifying the number of drug molecules conjugated to the targeting moiety.
- a further embodiment relates to a process of preparing conjugates, wherein the linker is first conjugated to a drug, thereby producing a drug-linker conjugate; wherein said drug-linker conjugate preparation involves the selective protection and deprotection of a more reactive group in a drug containing multiple functional groups; wherein said drug-linker conjugate is optionally not purified; and wherein said drug-linker conjugate is subsequently conjugated to a monoclonal antibody or fragment.
- Yet another embodiment is a method of treating cancer (malignancy), an autoimmune disease, an infection, or an infectious lesion with the conjugates described herein.
- Alternative embodiments concern the drug-targeting moiety conjugates made by the claimed processes and/or kits for performing the claimed processes.
- the invention relates to an immunoconjugate comprising:
- the invention relates to an immunoconjugate comprising:
- linker attachment to therapeutic moiety further comprises an L-amino acid or a polypeptide made up of up to four L-amino acids.
- the intracellularly-cleavable moiety is a carbonate comprising an activated hydroxyl group of the chemotherapeutic moiety and a substituted ethanolamine moiety or a 4-aminobenzyl alcohol, and the latter is attached, via its amino group, to a cross-linker terminating in the targeting moiety-binding group; and wherein the substituted ethanolamine moiety is derived from a natural L amino acid, with the carboxylic acid group of the latter replaced with a hydroxymethyl moiety; and wherein the 4-aminobenzyl alcohol is optionally substituted with a C 1 -C 10 alkyl group at the benzylic position.
- the intracellularly-cleavable moiety is a carbonate comprising an activated hydroxyl group of the chemotherapeutic moiety and a substituted ethanolamine moiety, and the latter, via its amino group, is attached to an L-amino acid or a polypeptide comprising up to four L-amino acid moieties; wherein the N-terminus is attached to a cross-linker terminating in the targeting moiety-binding group; and wherein the substituted ethanolamine moiety is optionally derived from an L amino acid, with the carboxylic acid group of the latter replaced with a hydroxymethyl moiety.
- the intracellularly-cleavable moiety is a carbonate comprising an activated hydroxyl group of the chemotherapeutic moiety and a 4-aminobenzyl alcohol or substituted 4-aminobenzyl alcohol substituted with a C 1 -C 10 alkyl group at the benzylic position, and the latter, via its amino group, is attached to an L-amino acid or a polypeptide comprising up to four L-amino acid moieties; wherein the N-terminus is attached to a cross-linker terminating in the targeting moiety-binding group.
- an amino group of a chemotherapeutic moiety is coupled to the activated hydroxyl group of a substituted, and amine-protected, ethanolamine moiety or a 4-aminobenzyl alcohol, and the latter is attached, via its amino group, to an L-amino acid or a polypeptide comprising up to four L-amino acid moieties; wherein the N-terminus is attached to a cross-linker terminating in the targeting moiety-binding group; wherein said substituted ethanolamine moiety is optionally derived from an L amino acid, with the carboxylic acid group of the latter replaced with a hydroxymethyl moiety; and wherein the 4-aminobenzyl alcohol is optionally substituted with a C 1 -C 10 alkyl group at the benzylic position.
- the bifunctional drug derivative is then conjugated to a targeting moiety to obtain an immunoconjugate as discussed above.
- the immunoconjugate is endocytosed and catabolized to release the drug-linker moiety; wherein the free amino group of the substituted ethanolamine moiety assists in the liberation of free drug by nucleophilic attack at the carbonyl group of the carbamate moiety.
- FIG. 1 Preclinical in vivo therapy of athymic nude mice, bearing Capan 1 human pancreatic carcinoma, with MAb-CL2A-SN-38 conjugates.
- FIG. 2 Preclinical in vivo therapy of athymic nude mice, bearing BxPC3 human pancreatic carcinoma, with MAb-CL2A-SN-38 conjugates.
- FIG. 3 Preclinical in vivo therapy of athymic nude mice, bearing LS174T human colon carcinoma, with hMN-14-CL2A-SN-38 conjugate.
- a or an means “one or more.”
- targeting moiety refers to a molecule, complex or aggregate, that binds specifically or selectively to a target molecule, cell, particle, tissue or aggregate.
- specific binding refers to binding to a particular target without cross-reactivity to other targets, while selective binding refers to preferential binding to a particular target.
- a targeting moiety is an antibody, antibody fragment, bispecific antibody or other antibody-based molecule or compound.
- targeting moieties are known in the art and may be used, such as aptamers, avimers, receptor-binding ligands, nucleic acids, biotin-avidin binding pairs, binding peptides or proteins, etc.
- targeting moiety and “binding moiety” are used synonymously herein.
- an antibody refers to a full-length (i.e., naturally occurring or formed by normal immunoglobulin gene fragment recombinatorial processes) immunoglobulin molecule (e.g., an IgG antibody) or an antigen-binding portion of an immunoglobulin molecule, such as an antibody fragment.
- An antibody or antibody fragment may be conjugated or otherwise derivatized within the scope of the claimed subject matter.
- Such antibodies include but are not limited to IgG1, IgG2a, IgG3, IgG4 (and IgG4 subforms), as well as IgA isotypes.
- An antibody fragment is a portion of an antibody such as F(ab′) 2 , F(ab) 2 , Fab′, Fab, Fv, scFv (single chain Fv), single domain antibodies (DABs or VHHs) and the like, including the half-molecules of IgG4 cited above (van der Neut Kolfschoten et al. (Science 2007; 317(14 September):1554-1557). Regardless of structure, an antibody fragment of use binds with the same antigen that is recognized by the intact antibody.
- the term “antibody fragment” also includes synthetic or genetically engineered proteins that act like an antibody by binding to a specific antigen to form a complex.
- antibody fragments include isolated fragments consisting of the variable regions, such as the “Fv” fragments consisting of the variable regions of the heavy and light chains, recombinant single chain polypeptide molecules in which light and heavy variable regions are connected by a peptide linker (“scFv proteins”), and minimal recognition units consisting of the amino acid residues that mimic the hypervariable region, such as CDRs.
- the Fv fragments may be constructed in different ways to yield multivalent and/or multispecific binding forms. In the case of multivalent, they have more than one binding site against the specific epitope, whereas with multispecific forms, more than one epitope (either of the same antigen or against one antigen and a different antigen) is bound.
- the term antibody component includes an entire antibody, a fusion protein, and fragments thereof.
- a naked antibody is generally an entire antibody that is not conjugated to a therapeutic agent. This is so because the Fc portion of the antibody molecule provides effector or immunological functions, such as complement fixation and ADCC (antibody-dependent cell cytotoxicity), which set mechanisms into action that may result in cell lysis. However, the Fc portion may not be required for therapeutic function of the antibody, but rather other mechanisms, such as apoptosis, anti-angiogenesis, anti-metastatic activity, anti-adhesion activity, such as inhibition of heterotypic or homotypic adhesion, and interference in signaling pathways, may come into play and interfere with disease progression.
- effector or immunological functions such as complement fixation and ADCC (antibody-dependent cell cytotoxicity)
- ADCC antibody-dependent cell cytotoxicity
- the Fc portion may not be required for therapeutic function of the antibody, but rather other mechanisms, such as apoptosis, anti-angiogenesis, anti-metastatic activity, anti-adhesion activity, such as inhibition of heterotypic or homotyp
- Naked antibodies include both polyclonal and monoclonal antibodies, and fragments thereof, that include murine antibodies, as well as certain recombinant antibodies, such as chimeric, humanized or human antibodies and fragments thereof. Therefore, in some cases a “naked antibody” may also refer to a “naked” antibody fragment. As defined herein, “naked” is synonymous with “unconjugated,” and means not linked or conjugated to a therapeutic agent.
- Autoimmune Diseases are disorders that are caused by the body producing an immune response against its own tissues. Examples include Class III autoimmune diseases such as immune-mediated thrombocytopenias, acute idiopathic thrombocytopenic purpura and chronic idiopathic thrombocytopenic purpura, dermatomyositis, Sjögren's syndrome, multiple sclerosis, Sydenham's chorea, myasthenia gravis, systemic lupus erythematosus, lupus nephritis, rheumatic fever, polyglandular syndromes, bullous pemphigoid, diabetes mellitus, Henoch-Schonlein purpura, post-streptococcal nephritis, erythema nodosum, Takayasu's arteritis, Addison's disease, rheumatoid arthritis, sarcoidosis, ulcerative colitis, erythema multiform
- a chimeric antibody is a recombinant protein that contains the variable domains of both the heavy and light antibody chains, including the complementarity determining regions (CDRs) of an antibody derived from one species, preferably a rodent antibody, more preferably a murine antibody, while the constant domains of the antibody molecule are derived from those of a human antibody.
- CDRs complementarity determining regions
- the constant domains of the chimeric antibody may be derived from that of other species, such as a primate, cat or dog.
- a humanized antibody is a recombinant protein in which the CDRs from an antibody from one species; e.g., a murine antibody, are transferred from the heavy and light variable chains of the murine antibody into human heavy and light variable domains (framework regions).
- the constant domains of the antibody molecule are derived from those of a human antibody.
- specific residues of the framework region of the humanized antibody particularly those that are touching or close to the CDR sequences, may be modified, for example replaced with the corresponding residues from the original murine, rodent, subhuman primate, or other antibody.
- a human antibody is an antibody obtained, for example, from transgenic mice that have been “engineered” to produce human antibodies in response to antigenic challenge.
- elements of the human heavy and light chain loci are introduced into strains of mice derived from embryonic stem cell lines that contain targeted disruptions of the endogenous heavy chain and light chain loci.
- the transgenic mice can synthesize human antibodies specific for various antigens, and the mice can be used to produce human antibody-secreting hybridomas.
- Methods for obtaining human antibodies from transgenic mice are described by Green et al., Nature Genet. 7:13 (1994), Lonberg et al., Nature 368:856 (1994), and Taylor et al., Int. Immun. 6:579 (1994).
- a fully human antibody also can be constructed by genetic or chromosomal transfection methods, as well as phage display technology, all of which are known in the art. See for example, McCafferty et al., Nature 348:552-553 (1990) for the production of human antibodies and fragments thereof in vitro, from immunoglobulin variable domain gene repertoires from unimmunized donors.
- antibody variable domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, and displayed as functional antibody fragments on the surface of the phage particle.
- the filamentous particle contains a single-stranded DNA copy of the phage genome, selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties. In this way, the phage mimics some of the properties of the B cell.
- Phage display can be performed in a variety of formats, for their review, see e.g. Johnson and Chiswell, Current Opinion in Structural Biology 3:5564-571 (1993).
- Human antibodies may also be generated by in vitro activated B cells. See U.S. Pat. Nos. 5,567,610 and 5,229,275, the Examples section of each of which is incorporated herein by reference.
- Infectious Diseases as used herein are diseases involving infection by pathogens such as bacteria, rickettsia, mycoplasma, protozoa, fungi, viruses, parasites, or other microbial agents.
- pathogens such as bacteria, rickettsia, mycoplasma, protozoa, fungi, viruses, parasites, or other microbial agents.
- HIV human immunodeficiency virus
- examples include human immunodeficiency virus (HIV) causing AIDS, Mycobacterium of tuberculosis, Streptococcus agalactiae, methicillin-resistant Staphylococcus aureus, Legionella pneumophilia, Streptococcus pyogenes, Escherichia coli, Neisseria gonorrhoeae, Neisseria meningitidis, Pneumococcus, Cryptococcus neoformans, Histoplasma capsulatum, Hem
- a therapeutic agent is a molecule or atom that is administered separately, concurrently or sequentially with a binding moiety, e.g., an antibody or antibody fragment, or a subfragment thereof, and is useful in the treatment of a disease.
- therapeutic agents include, but are not limited to, antibodies, antibody fragments, conjugates, drugs, cytotoxic agents, proapopoptotic agents, toxins, nucleases (including DNAses and RNAses), hormones, immunomodulators, chelators, boron compounds, photoactive agents or dyes, radioisotopes or radionuclides, oligonucleotides, interference RNA, peptides, anti-angiogenic agents, chemotherapeutic agents, cyokines, chemokines, prodrugs, enzymes, binding proteins or peptides or combinations thereof.
- a conjugate is an antibody component or other targeting moiety conjugated to a therapeutic agent, such as those described above.
- conjugated an antibody component or other targeting moiety conjugated to a therapeutic agent, such as those described above.
- conjugated an antibody component or other targeting moiety conjugated to a therapeutic agent, such as those described above.
- conjugated an antibody component or other targeting moiety conjugated to a therapeutic agent, such as those described above.
- conjugated an antibody component or other targeting moiety conjugated to a therapeutic agent
- antibody fusion protein is a recombinantly-produced antigen-binding molecule in which one or more natural antibodies, single-chain antibodies or antibody fragments are linked (fused) to another moiety, such as a protein or peptide toxin, cytokine, hormone, etc.
- the fusion protein may comprise two or more of the same or different antibodies, antibody fragments or single-chain antibodies fused together, which may bind to the same epitope, different epitopes on the same antigen, or different antigens.
- An antibody fusion protein comprises at least one antigen binding site.
- the valency of the fusion protein indicates the total number of binding arms or sites the fusion protein has to antigen(s) or epitope(s); i.e., monovalent, bivalent, trivalent or mutlivalent.
- the multivalency of the antibody fusion protein means that it can take advantage of multiple interactions in binding to an antigen, thus increasing the avidity of binding to the antigen, or to different antigens. Specificity indicates how many different types of antigen or epitope an antibody fusion protein is able to bind; i.e., monospecific, bispecific, trispecific, multispecific.
- a natural antibody e.g., an IgG
- a monospecific, multivalent fusion protein has more than one binding site for the same antigen or epitope.
- a monospecific diabody is a fusion protein with two binding sites reactive with the same antigen.
- the fusion protein may comprise a multivalent or multispecific combination of different antibody components or multiple copies of the same antibody component.
- the fusion protein may additionally comprise a therapeutic agent.
- An immunomodulator is a therapeutic agent that when present, alters, suppresses or stimulates the body's immune system.
- an immunomodulator of use stimulates immune cells to proliferate or become activated in an immune response cascade, such as macrophages, dendritic cells, B-cells, and/or T-cells.
- an immunomodulator may suppress proliferation or activation of immune cells, as in therapeutic treatment of autoimmune disease.
- An example of an immunomodulator as described herein is a cytokine, which is a soluble small protein of approximately 5-20 kDa that is released by one cell population (e.g., primed T-lymphocytes) on contact with specific antigens, and which acts as an intercellular mediator between cells.
- cytokines include lymphokines, monokines, interleukins, and several related signaling molecules, such as tumor necrosis factor (TNF) and interferons.
- TNF tumor necrosis factor
- Chemokines are a subset of cytokines.
- Certain interleukins and interferons are examples of cytokines that stimulate T cell or other immune cell proliferation.
- CPT is abbreviation for camptothecin, and as used in the present application CPT represents camptothecin itself or an analog or derivative of camptothecin.
- TM chemotherapeutic drugs with targeting moieties
- the disclosed methods represent a preferred embodiment of the invention.
- a defined polyethyleneglycol (PEG) moiety i.e., a PEG containing a defined number of monomeric units
- the defined PEG is a low molecular weight PEG, preferably containing 1-30 monomeric units, more preferably containing 1-12 monomeric units
- a first linker connects the drug at one end and terminates with an acetylene or an azide group at the other end; this first linker comprises a defined PEG moiety with an azide or acetylene group at one end and a different reactive group, such as carboxylic acid or hydroxyl group, at the other end and said bifunctional defined PEG is attached to the amine group of an amino alcohol, and the hydroxyl group of the latter is attached
- the azide part may be on L2 with the acetylene part on L3.
- L2 may contain acetylene, with L3 containing azide.
- Click chemistry is a copper (+1)-catalyzed cycloaddition reaction between an acetylene moiety and an azide moiety, and is a relatively recent technique in bioconjugations (Kolb H C and Sharpless K B, Drug Discov Today 2003; 8: 1128-37). Click chemistry takes place in aqueous solution at near-neutral pH conditions, and is thus amenable for drug conjugation.
- click chemistry is that it is chemoselective, and complements other well-known conjugation chemistries such as the thiol-maleimide reaction.
- a conjugate comprises an antibody or antibody fragment
- another type of binding moiety such as an aptamer, avimer or targeting peptide, may be substituted.
- An exemplary preferred embodiment is directed to a conjugate of a drug derivative and an antibody of the general formula 2, MAb[L2]-[L1]-[AA] m -[A′]-Drug (2)
- MAb is a disease-targeting antibody
- L2 is a component of the cross-linker comprising an antibody-coupling moiety and one or more of acetylene (or azide) groups
- L1 comprises a defined PEG with azide (or acetylene) at one end, complementary to the acetylene (or azide) moiety in L2, and a reactive group such as carboxylic acid or hydroxyl group at the other end
- AA is an L-amino acid
- m is an integer with values of 0, 1, 2, 3, or 4
- A′ is an additional spacer, selected from the group of ethanolamine, 4-hydroxybenzyl alcohol, 4-aminobenzyl alcohol, or substituted or unsubstituted ethylenediamine.
- the L amino acids of ‘AA’ are selected from alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine. If the A′ group contains hydroxyl, it is linked to the hydroxyl group or amino group of the drug in the form of a carbonate or carbamate, respectively.
- A′ is a substituted ethanolamine derived from an L-amino acid, wherein the carboxylic acid group of the amino acid is replaced by a hydroxymethyl moiety.
- A′ may be derived from any one of the following L-amino acids: alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine.
- m is 1 and represented by a derivatized L-lysine, A′ is L-valinol, and the drug is exemplified by SN-38.
- the structure is shown in formula 4.
- an amide bond is first formed between the carboxylic acid of an amino acid such as lysine and the amino group of valinol, using orthogonal protecting groups for the lysine amino groups.
- the protecting group on the N-terminus of lysine is removed, keeping the protecting group on the side chain of lysine intact, and the N-terminus is coupled to the carboxyl group on the defined PEG with azide (or acetylene) at the other end.
- the small MW SN-38 product namely valinol-SN-38 carbonate, generated after intracellular proteolysis, has the additional pathway of liberation of intact SN-38 through intramolecular cyclization involving the amino group of valinol and the carbonyl of the carbonate.
- A′ of the general formula 2 is A-OH, whereby A-OH is a collapsible moiety such as 4-aminobenzyl alcohol or a substituted 4-aminobenzyl alcohol substituted with a C 1 -C 10 alkyl group at the benzylic position, and the latter, via its amino group, is attached to an L-amino acid or a polypeptide comprising up to four L-amino acid moieties; wherein the N-terminus is attached to a cross-linker terminating in the targeting moiety-binding group.
- A-OH is a collapsible moiety such as 4-aminobenzyl alcohol or a substituted 4-aminobenzyl alcohol substituted with a C 1 -C 10 alkyl group at the benzylic position, and the latter, via its amino group, is attached to an L-amino acid or a polypeptide comprising up to four L-amino acid moieties; wherein the N-terminus is attached to a
- the structure is represented below (formula 5, referred to as MAb-CLX-SN-38).
- Single amino acid of AA is selected from any one of the following L-amino acids: alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine.
- the substituent R on 4-aminobenzyl alcohol moiety is hydrogen or an alkyl group selected from C 1 -C 10 alkyl groups.
- MAb-CLX-SN-38 of formula 5 wherein the single amino acid AA is L-lysine and R ⁇ H, and the drug is exemplified by SN-38 (formula 6; referred to as MAb-CL2A-SN-38).
- A′ is a substituted ethylenediamine.
- AA comprises a polypeptide moiety, preferably a di, tri or tetrapeptide, that is cleavable by intracellular peptidase.
- polypeptide moiety preferably a di, tri or tetrapeptide, that is cleavable by intracellular peptidase. Examples are: Ala-Leu, Leu-Ala-Leu, and Ala-Leu-Ala-Leu (SEQ ID NO:15) (Trouet et al., 1982).
- the L1 component of the conjugate contains a defined polyethyleneglycol (PEG) spacer with 1-30 repeating monomeric units.
- PEG polyethyleneglycol
- PEG is a defined PEG with 1-12 repeating monomeric units.
- the introduction of PEG may involve using heterobifunctionalized PEG derivatives which are available commercially.
- the heterobifunctional PEG may contain an azide or acetylene group.
- An example of a hetero-bifunctional defined PEG containing 8 repeating monomeric units, with ‘NHS’ being succinimidyl, is given below in formula 8:
- L2 has a plurality of acetylene (or azide) groups, ranging from 2-40, but preferably 2-20, and more preferably 2-5, and a single targeting vector-binding moiety.
- a representative SN-38 conjugate of an antibody containing multiple drug molecules and a single targeting vector-binding moiety is shown below.
- the 12′ component of this structure is appended to 2 acetylenic groups, resulting in the attachment of two azide-appended SN-38 molecules.
- the bonding to MAb is represented as a succinimide.
- the thiols on the antibody are generated on the lysine groups of the antibody using a thiolating reagent.
- Methods for introducing thiol groups onto antibodies by modifications of MAb's lysine groups are well known in the art (Wong in Chemistry of protein conjugation and cross-linking, CRC Press, Inc., Boca Raton, Fla. (1991), pp 20-22).
- mild reduction of interchain disulfide bonds on the antibody (Willner et al., Bioconjugate Chem.
- DTT dithiothreitol
- the preferred chemotherapeutic moiety is selected from the group consisting of doxorubicin (DOX), epirubicin, morpholinodoxorubicin (morpholino-DOX), cyanomorpholino-doxorubicin (cyanomorpholino-DOX), 2-pyrrolino-doxorubicin (2-PDOX), CPT, 10-hydroxy camptothecin, SN-38, topotecan, lurtotecan, 9-aminocamptothecin, 9-nitrocamptothecin, taxanes, geldanamycin, ansamycins, and epothilones.
- the chemotherapeutic moiety is SN-38.
- the targeting moiety links to at least one chemotherapeutic moiety; preferably 1 to about 12 chemotherapeutic moieties; most preferably about 6 to about 12 chemotherapeutic moieties.
- the linker component 12′ comprises a thiol group that reacts with a thiol-reactive residue introduced at one or more lysine side chain amino groups of said targeting moiety.
- the antibody is pre-derivatized with a thiol-reactive group such as a maleimide, vinylsulfone, bromoacetamide, or iodoacetamide by procedures well described in the art.
- CPT drug-linkers can be prepared wherein CPT additionally has a 10-hydroxyl group.
- This process involves, but is not limited to, the protection of the 10-hydroxyl group as a t-butyloxycarbonyl (BOC) derivative, followed by the preparation of the penultimate intermediate of the drug-linker conjugate.
- BOC t-butyloxycarbonyl
- removal of BOC group requires treatment with strong acid such as trifluoroacetic acid (TFA).
- TFA trifluoroacetic acid
- the CPT 20-O-linker carbonate, containing protecting groups to be removed is also susceptible to cleavage, thereby giving rise to unmodified CPT.
- An alternative approach involves protecting the CPT analog's 10-hydroxy position with a group other than ‘BOC’, such that the final product is ready for conjugation to antibodies without a need for deprotecting the 10-OH protecting group.
- the 10-hydroxy protecting group which converts the 10-OH into a phenolic carbonate or a phenolic ester, is readily deprotected by physiological pH conditions or by esterases after in vivo administration of the conjugate.
- the faster removal of a phenolic carbonate at the 10 position vs. a tertiary carbonate at the 20 position of 10-hydroxycamptothecin under physiological condition has been described by He et al. (He et al., Bioorganic & Medicinal Chemistry 12: 4003-4008 (2004)).
- a 10-hydroxy protecting group on SN-38 can be ‘COR’ where R can be a substituted alkyl such as “N(CH 3 ) 2 —(CH 2 ) n —” where n is 1-10 and wherein the terminal amino group is optionally in the form of a quaternary salt for enhanced aqueous solubility, or a simple alkyl residue such as “CH 3 —(CH 2 ) n —” where n is 0-10, or it can be an alkoxy moiety such as “CH 3 —(CH 2 ) n —O—” where n is 0-10, or “N(CH 3 ) 2 —(CH 2 ) n —O—” where n is 2-10, or “R 1 O—(CH 2 —CH 2 —O) n —CH 2 —CH 2 —O—” where R 1 is ethyl or methyl and n is an integer with values of 0-10.
- 10-hydroxy derivatives are readily prepared by treatment with the chloroformate of the chosen reagent, if the final derivative is to be a carbonate.
- the 10-hydroxy-containing camptothecin such as SN-38 is treated with a molar equivalent of the chloroformate in dimethylformamide using triethylamine as the base. Under these conditions, the 20-OH position is unaffected.
- the acid chloride of the chosen reagent is used.
- the bifunctional drug moiety, [L2]-[L1]-[AA] m [A-X]-Drug is first prepared, followed by the conjugation of the bifunctional drug moiety to the targeting moiety, TM.
- cross-linker [L1]-[AA] m -[A-OH]
- [L1]-[AA] m -[A-OH] is attached to drug's hydroxyl or amino group, and this is followed by attachment to the L1 moiety, by taking recourse to the reaction between azide (or acetylene) and acetylene (or azide) groups in L1 and L2 via click chemistry.
- the targeting moiety, TM is a monoclonal antibody (MAb).
- the targeting moiety may be a multivalent and/or multispecific MAb.
- the targeting moiety may be a murine, chimeric, humanized, or human monoclonal antibody, and said antibody may be in intact, fragment (Fab, Fab′, F(ab) 2 , F(ab′) 2 ), or sub-fragment (single-chain constructs) form, or of an IgG1, IgG2a, IgG3, IgG4, IgA isotype, or submolecules therefrom.
- the targeting moiety is a monoclonal antibody that is reactive with an antigen or epitope of an antigen expressed on a cancer or malignant cell.
- the cancer cell is preferably a cell from a hematopoietic tumor, carcinoma, sarcoma, melanoma or a glial tumor.
- a preferred malignancy to be treated according to the present invention is a malignant solid tumor or hematopoietic neoplasm.
- the intracellularly-cleavable moiety may be cleaved after it is internalized into the cell upon binding by the MAb-drug conjugate to a receptor thereof, and particularly cleaved by esterases and peptidases.
- the targeting moiety is preferably an antibody (including fully human, non-human, humanized, or chimeric antibodies) or an antibody fragment (including enzymatically or recombinantly produced fragments) or binding proteins incorporating sequences from antibodies or antibody fragments.
- the antibodies, fragments, and binding proteins may be multivalent and multispecific or multivalent and monospecific as defined above.
- monoclonal antibodies can be obtained by injecting mice with a composition comprising an antigen, removing the spleen to obtain B-lymphocytes, fusing the B-lymphocytes with myeloma cells to produce hybridomas, cloning the hybridomas, selecting positive clones which produce antibodies to the antigen, culturing the clones that produce antibodies to the antigen, and isolating the antibodies from the hybridoma cultures.
- MAbs can be isolated and purified from hybridoma cultures by a variety of well-established techniques. Such isolation techniques include affinity chromatography with Protein-A or Protein-G Sepharose, size-exclusion chromatography, and ion-exchange chromatography. See, for example, Coligan at pages 2.7.1-2.7.12 and pages 2.9.1-2.9.3. Also, see Baines et al., “Purification of Immunoglobulin G (IgG),” in METHODS IN MOLECULAR BIOLOGY, VOL. 10, pages 79-104 (The Humana Press, Inc. 1992).
- the antibodies can be sequenced and subsequently prepared by recombinant techniques. Humanization and chimerization of murine antibodies and antibody fragments are well known to those skilled in the art, as discussed below.
- Antibodies of use may be commercially obtained from a wide variety of known sources.
- a variety of antibody secreting hybridoma lines are available from the American Type Culture Collection (ATCC, Manassas, Va.).
- a large number of antibodies against various disease targets, including but not limited to tumor-associated antigens, have been deposited at the ATCC and/or have published variable region sequences and are available for use in the claimed methods and compositions. See, e.g., U.S. Pat. Nos.
- antibody sequences or antibody-secreting hybridomas against almost any disease-associated antigen may be obtained by a simple search of the ATCC, NCBI and/or USPTO databases for antibodies against a selected disease-associated target of interest.
- the antigen binding domains of the cloned antibodies may be amplified, excised, ligated into an expression vector, transfected into an adapted host cell and used for protein production, using standard techniques well known in the art.
- Isolated antibodies may be conjugated to therapeutic agents, such as camptothecins, using the techniques disclosed herein.
- a chimeric antibody is a recombinant protein in which the variable regions of a human antibody have been replaced by the variable regions of, for example, a mouse antibody, including the complementarity-determining regions (CDRs) of the mouse antibody.
- Chimeric antibodies exhibit decreased immunogenicity and increased stability when administered to a subject.
- Methods for constructing chimeric antibodies are well known in the art (e.g., Leung et al., 1994, Hybridoma 13:469).
- a chimeric monoclonal antibody may be humanized by transferring the mouse CDRs from the heavy and light variable chains of the mouse immunoglobulin into the corresponding variable domains of a human antibody.
- the mouse framework regions (FR) in the chimeric monoclonal antibody are also replaced with human FR sequences.
- one or more human FR residues may be replaced by the mouse counterpart residues.
- Humanized monoclonal antibodies may be used for therapeutic treatment of subjects. Techniques for production of humanized monoclonal antibodies are well known in the art.
- an antibody may be a human monoclonal antibody. Such antibodies may be obtained from transgenic mice that have been engineered to produce specific human antibodies in response to antigenic challenge, as discussed below.
- the phage display technique may be used to generate human antibodies (e.g., Dantas-Barbosa et al., 2005, Genet. Mol. Res. 4:126-40, incorporated herein by reference).
- Human antibodies may be generated from normal humans or from humans that exhibit a particular disease state, such as cancer (Dantas-Barbosa et al., 2005).
- the advantage to constructing human antibodies from a diseased individual is that the circulating antibody repertoire may be biased towards antibodies against disease-associated antigens.
- RNAs were converted to cDNAs and used to make Fab cDNA libraries using specific primers against the heavy and light chain immunoglobulin sequences (Marks et al., 1991, J. Mol. Biol. 222:581-97, incorporated herein by reference).
- transgenic animals that have been genetically engineered to produce human antibodies may be used to generate antibodies against essentially any immunogenic target, using standard immunization protocols as discussed above.
- Methods for obtaining human antibodies from transgenic mice are described by Green et al., Nature Genet. 7:13 (1994), Lonberg et al., Nature 368:856 (1994), and Taylor et al., Int. Immun. 6:579 (1994).
- a non-limiting example of such a system is the XenoMouse® (e.g., Green et al., 1999, J. Immunol. Methods 231:11-23, incorporated herein by reference) from Abgenix (Fremont, Calif.).
- the mouse antibody genes have been inactivated and replaced by functional human antibody genes, while the remainder of the mouse immune system remains intact.
- the XenoMouse® was transformed with germline-configured YACs (yeast artificial chromosomes) that contained portions of the human IgH and Ig kappa loci, including the majority of the variable region sequences, along accessory genes and regulatory sequences.
- the human variable region repertoire may be used to generate antibody producing B cells, which may be processed into hybridomas by known techniques.
- a XenoMouse® immunized with a target antigen will produce human antibodies by the normal immune response, which may be harvested and/or produced by standard techniques discussed above.
- a variety of strains of XenoMouse® are available, each of which is capable of producing a different class of antibody.
- Transgenically produced human antibodies have been shown to have therapeutic potential, while retaining the pharmacokinetic properties of normal human antibodies (Green et al., 1999).
- the skilled artisan will realize that the claimed compositions and methods are not limited to use of the XenoMouse® system but may utilize any transgenic animal that has been genetically engineered to produce human antibodies.
- Some embodiments of the claimed methods and/or compositions may concern antibody fragments.
- Such antibody fragments may be obtained, for example, by pepsin or papain digestion of whole antibodies by conventional methods.
- antibody fragments may be produced by enzymatic cleavage of antibodies with pepsin to provide a 5S fragment denoted F(ab′) 2 .
- This fragment may be further cleaved using a thiol reducing agent and, optionally, a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce 3.5S Fab′ monovalent fragments.
- an enzymatic cleavage using pepsin produces two monovalent Fab fragments and an Fc fragment.
- Fv fragments comprise an association of V H and V L chains. This association can be noncovalent, as described in Inbar et al., 1972, Proc. Nat'l. Acad. Sci. USA, 69:2659.
- the variable chains may be linked by an intermolecular disulfide bond or cross-linked by chemicals such as glutaraldehyde. See Sandhu, 1992, Crit. Rev. Biotech., 12:437.
- the Fv fragments comprise V H and V L chains connected by a peptide linker.
- These single-chain antigen binding proteins are prepared by constructing a structural gene comprising DNA sequences encoding the V H and V L domains, connected by an oligonucleotides linker sequence. The structural gene is inserted into an expression vector that is subsequently introduced into a host cell, such as E. coli. The recombinant host cells synthesize a single polypeptide chain with a linker peptide bridging the two V domains. Methods for producing scFvs are well-known in the art.
- an antibody fragment is a single-domain antibody (dAb), sometimes referred to as a single chain antibody.
- Techniques for producing single-domain antibodies are well known in the art (see, e.g., Cossins et al., Protein Expression and Purification, 2007, 51:253-59; Shuntao et al., Molec Immunol 2006, 43:1912-19; Tanha et al., J. Biol. Chem. 2001, 276:24774-780).
- Other types of antibody fragments may comprise one or more complementarity-determining regions (CDRs).
- CDR peptides (“minimal recognition units”) can be obtained by constructing genes encoding the CDR of an antibody of interest.
- Such genes are prepared, for example, by using the polymerase chain reaction to synthesize the variable region from RNA of antibody-producing cells. See Larrick et al., 1991, Methods: A Companion to Methods in Enzymology 2:106; Ritter et al. (eds.), 1995, MONOCLONAL ANTIBODIES: PRODUCTION, ENGINEERING AND CLINICAL APPLICATION, pages 166-179 (Cambridge University Press); Birch et al., (eds.), 1995, MONOCLONAL ANTIBODIES: PRINCIPLES AND APPLICATIONS, pages 137-185 (Wiley-Liss, Inc.)
- the sequences of antibodies may be varied to optimize the physiological characteristics of the conjugates, such as the half-life in serum.
- Methods of substituting amino acid sequences in proteins are widely known in the art, such as by site-directed mutagenesis (e.g. Sambrook et al., Molecular Cloning, A laboratory manual, 2 nd Ed, 1989).
- the variation may involve the addition or removal of one or more glycosylation sites in the Fc sequence (e.g., U.S. Pat. No. 6,254,868, the Examples section of which is incorporated herein by reference).
- specific amino acid substitutions in the Fc sequence may be made (e.g., Hornick et al., 2000, J Nucl Med 41:355-62; Hinton et al., 2006, J Immunol 176:346-56; Petkova et al. 2006, Int Immunol 18:1759-69; U.S. Pat. No. 7,217,797; each incorporated herein by reference).
- Bispecific antibodies are useful in a number of biomedical applications. For instance, a bispecific antibody with binding sites for a tumor cell surface antigen and for a T-cell surface receptor can direct the lysis of specific tumor cells by T cells. Bispecific antibodies recognizing gliomas and the CD3 epitope on T cells have been successfully used in treating brain tumors in human patients (Nitta, et al. Lancet. 1990; 355:368-371). In certain embodiments, the techniques and compositions for therapeutic agent conjugation disclosed herein may be used with bi specific or multispecific antibodies as the targeting moieties.
- Bispecific antibodies can be produced by the quadroma method, which involves the fusion of two different hybridomas, each producing a monoclonal antibody recognizing a different antigenic site (Milstein and Cuello, Nature, 1983; 305:537-540).
- bispecific antibodies Another method for producing bispecific antibodies uses heterobifunctional cross-linkers to chemically tether two different monoclonal antibodies (Staerz, et al. Nature. 1985; 314:628-631; Perez, et al. Nature. 1985; 316:354-356). Bispecific antibodies can also be produced by reduction of each of two parental monoclonal antibodies to the respective half molecules, which are then mixed and allowed to reoxidize to obtain the hybrid structure (Staerz and Bevan. Proc Natl Acad Sci USA. 1986; 83:1453-1457). Another alternative involves chemically cross-linking two or three separately purified Fab′ fragments using appropriate linkers. (See, e.g., European Patent Application 0453082).
- hybrid hybridomas include improving the efficiency of generating hybrid hybridomas by gene transfer of distinct selectable markers via retrovirus-derived shuttle vectors into respective parental hybridomas, which are fused subsequently (DeMonte, et M. Proc Natl Acad Sci USA. 1990, 87:2941-2945); or transfection of a hybridoma cell line with expression plasmids containing the heavy and light chain genes of a different antibody.
- Cognate V H and V L domains can be joined with a peptide linker of appropriate composition and length (usually consisting of more than 12 amino acid residues) to form a single-chain Fv (scFv) with binding activity.
- a peptide linker of appropriate composition and length usually consisting of more than 12 amino acid residues
- Methods of manufacturing scFvs are disclosed in U.S. Pat. No. 4,946,778 and U.S. Pat. No. 5,132,405, the Examples section of each of which is incorporated herein by reference. Reduction of the peptide linker length to less than 12 amino acid residues prevents pairing of V H and V L domains on the same chain and forces pairing of V H and V L domains with complementary domains on other chains, resulting in the formation of functional multimers.
- Polypeptide chains of V H and V L domains that are joined with linkers between 3 and 12 amino acid residues form predominantly dimers (termed diabodies). With linkers between 0 and 2 amino acid residues, trimers (termed triabody) and tetramers (termed tetrabody) are favored, but the exact patterns of oligomerization appear to depend on the composition as well as the orientation of V-domains (V H -linker-V L or V L -linker-V H ), in addition to the linker length.
- the technique utilizes complementary protein binding domains, referred to as anchoring domains (AD) and dimerization and docking domains (DDD), which bind to each other and allow the assembly of complex structures, ranging from dimers, trimers, tetramers, quintamers and hexamers. These form stable complexes in high yield without requirement for extensive purification.
- DNL technique allows the assembly of monospecific, bispecific or multispecific antibodies. Any of the techniques known in the art for making bispecific or multispecific antibodies may be utilized in the practice of the presently claimed methods.
- a conjugate as disclosed herein may be part of a composite, multispecific antibody.
- Such antibodies may contain two or more different antigen binding sites, with differing specificities.
- the multispecific composite may bind to different epitopes of the same antigen, or alternatively may bind to two different antigens.
- Some of the more preferred target combinations include those listed in Table 1. This is a list of examples of preferred combinations, but is not intended to be exhaustive.
- First target Second target MIF A second proinflammatoiy effector cytokine, especially HMGB-1, TNF- ⁇ , IL-1, or IL-6 MIF Proinflammatory effector chemokine, especially MCP-1, RANTES, MIP-1A, or MIP-1B MIF Proinflammatory effector receptor, especially IL-6R, IL-13R, and IL-15R MIF Coagulation factor, especially TF or thrombin MIF Complement factor, especially C3, C5, C3a, or C5a MIF Complement regulatory protein, especially CD46, CD55, CD59, and mCRP MIF Cancer associated antigen or receptor HMGB-1
- CD20+CD22 antibodies include CD74+CD20 antibodies, CD74+CD22 antibodies, CEACAM5 (CEA)+CEACAM6 (NCA) antibodies, insulin-like growth factor (ILGF)+CEACAM5 antibodies, EGP-1 (e.g., RS-7)+ILGF antibodies, CEACAM5+EGFR antibodies.
- CEACAM5 CEA
- CEACAM6 CEACAM6
- ILGF insulin-like growth factor
- EGP-1 e.g., RS-7+ILGF antibodies
- CEACAM5+EGFR antibodies Such antibodies need not only be used in combination, but can be combined as fusion proteins of various forms, such as IgG, Fab, scFv, and the like, as described in U.S. Pat. Nos. 6,083,477; 6,183,744 and 6,962,702 and U.S. Patent Application Publication Nos.
- antibodies are used that recognize or bind to markers or tumor-associated antigens that are expressed at high levels on target cells and that are expressed predominantly or only on diseased cells versus normal tissues, and antibodies that internalize rapidly.
- Antibodies useful within the scope of the present invention include MAbs with properties as described above (and show distinguishing properties of different levels of internalization into cells and microorganisms), and contemplate the use of, but are not limited to, in cancer, the following MAbs: LL1 (anti-CD74), LL2 and RFB4 (anti-CD22), RS7 (anti-epithelial glycoprotein-1 (EGP-1)), PAM4 and KC4 (both anti-mucin), MN-14 (anti-carcinoembryonic antigen (CEA, also known as CD66e), Mu-9 (anti-colon-specific antigen-p), Immu 31 (an anti-alpha-fetoprotein), TAG-72 (e.g., CC49), Tn, J591 or HuJ591 (
- hPAM4 U.S. Pat. No. 7,282,567
- hA20 U.S. Pat. No. 7,151,164
- hA19 U.S. Pat. No. 7,109,304
- hIMMU31 U.S. Pat. No. 7,300,655
- hLL1 U.S. Pat. No. 7,312,318,
- hLL2 U.S. Pat. No. 7,074,403
- hMu-9 U.S. Pat. No.
- Suitable antigens include carbonic anhydrase IX, B7, CCCL19, CCCL21, CSAp, HER-2/neu, BrE3, CD1, CD1a, CD2, CD3, CD4, CDS, CD8, CD11A, CD14, CD15, CD16, CD18, CD19, CD20 (e.g., C2B8, hA20, 1F5 MAbs), CD21, CD22, CD23, CD25, CD29, CD30, CD32b, CD33, CD37, CD38, CD40, CD40L, CD44, CD45, CD46, CD52, CD54, CD55, CD59, CD64, CD67, CD70, CD74, CD79a, CD80, CD83, CD95, CD126, CD133, CD138, CD147, CD154, CEACAM5, CEACAM-6, alpha-fetoprotein (AFP), VEGF (e.g.AVASTIN®, fibronectin splice variant), ED-
- the CD66 antigens consist of five different glycoproteins with similar structures, CD66a-e, encoded by the carcinoembryonic antigen (CEA) gene family members, BCG, CGM6, NCA, CGM1 and CEA, respectively. These CD66 antigens (e.g., CEACAM6) are expressed mainly in granulocytes, normal epithelial cells of the digestive tract and tumor cells of various tissues. Also included as suitable targets for cancers are cancer testis antigens, such as NY-ESO-1 (Theurillat et al., Int. J. Cancer 2007;120(11):2411-7), as well as CD79a in myeloid leukemia (Kozlov et al., Cancer Genet. Cytogenet.
- suitable targeting antibodies have been described against, for example, CD38 and CD138 (Stevenson, Mol Med 2006; 12(11-12):345-346; Tassone et al., Blood 2004; 104(12):3688-96), CD74 (Stein et al., ibid.), CS1 (Tai et al., Blood 2007; October 9 (epub ahead of print), and CD40 (Tai et al., 2005; Cancer Res. 65(13):5898-5906).
- CD Cluster Designation
- antibodies are used that internalize rapidly and are then re-expressed, processed and presented on cell surfaces, enabling continual uptake and accretion of circulating conjugate by the cell.
- An example of a most-preferred antibody/antigen pair is LL1, an anti-CD74 MAb (invariant chain, class II-specific chaperone, Ii) (see, e.g., U.S. Pat. Nos. 6,653,104; 7,312,318; the Examples section of each incorporated herein by reference).
- the CD74 antigen is highly expressed on B-cell lymphomas (including multiple myeloma) and leukemias, certain T-cell lymphomas, melanomas, colonic, lung, and renal cancers, glioblastomas, and certain other cancers (Ong et al., Immunology 98:296-302 (1999)), as well as certain autoimmune diseases.
- B-cell lymphomas including multiple myeloma
- leukemias certain T-cell lymphomas, melanomas, colonic, lung, and renal cancers, glioblastomas, and certain other cancers (Ong et al., Immunology 98:296-302 (1999)), as well as certain autoimmune diseases.
- CD74 antibodies are contained in Stein et al., Clin Cancer Res. 2007 Sep. 15; 13(18 Pt 2):5556s-5563s, incorporated herein by reference.
- the diseases that are preferably treated with anti-CD74 antibodies include, but are not limited to, non-Hodgkin's lymphoma, Hodgkin's disease, melanoma, lung, renal, colonic cancers, glioblastome multiforme, histiocytomas, myeloid leukemias, and multiple myeloma.
- Continual expression of the CD74 antigen for short periods of time on the surface of target cells, followed by internalization of the antigen, and re-expression of the antigen enables the targeting LL1 antibody to be internalized along with any chemotherapeutic moiety it carries. This allows a high, and therapeutic, concentration of LL1-chemotherapeutic drug conjugate to be accumulated inside such cells. Internalized LL1-chemotherapeutic drug conjugates are cycled through lysosomes and endosomes, and the chemotherapeutic moiety is released in an active form within the target cells.
- bispecific or multispecific antibodies may be produced using the dock-and-lock technology (see, e.g., U.S. Pat. Nos. 7,521,056; 7,550,143; 7,534,866; 7,527,787 and U.S. patent application Ser. No. 11/925,408; the Examples section of each of which is incorporated herein by reference).
- the DNL method exploits specific protein/protein interactions that occur between the regulatory (R) subunits of cAMP-dependent protein kinase (PKA) and the anchoring domain (AD) of A-kinase anchoring proteins (AKAPs) (Baillie et al., FEBS Letters. 2005; 579: 3264. Wong and Scott, Nat. Rev.
- PKA which plays a central role in one of the best studied signal transduction pathways triggered by the binding of the second messenger cAMP to the R subunits
- the structure of the holoenzyme consists of two catalytic subunits held in an inactive form by the R subunits (Taylor, J. Biol. Chem. 1989; 264:8443). Isozymes of PKA are found with two types of R subunits (RI and RII), and each type has ⁇ and ⁇ isoforms (Scott, Pharmacol. Ther.
- R subunits have been isolated only as stable dimers and the dimerization domain has been shown to consist of the first 44 amino-terminal residues (Newlon et al., Nat. Struct. Biol. 1999; 6:222). Binding of cAMP to the R subunits leads to the release of active catalytic subunits for a broad spectrum of serine/threonine kinase activities, which are oriented toward selected substrates through the compartmentalization of PKA via its docking with AKAPs (Scott et al., J. Biol. Chem. 1990; 265; 21561)
- AKAP microtubule-associated protein-2
- the amino acid sequences of the AD are quite varied among individual AKAPs, with the binding affinities reported for RII dimers ranging from 2 to 90 nM (Alto et al., Proc. Natl. Acad. Sci. USA. 2003; 100:4445). Interestingly, AKAPs will only bind to dimeric R subunits. For human Mkt, the AD binds to a hydrophobic surface formed by the 23 amino-terminal residues (Colledge and Scott, Trends Cell Biol. 1999; 6:216). Thus, the dimerization domain and AKAP binding domain of human RII ⁇ are both located within the same N-terminal 44 amino acid sequence (Newlon et al., Nat. Struct. Biol. 1999; 6:222; Newlon et al., EMBO J. 2001; 20:1651), which is termed the DDD herein.
- Entity B is constructed by linking an AD sequence to a precursor of B, resulting in a second component hereafter referred to as b.
- the dimeric motif of DDD contained in a 2 will create a docking site for binding to the AD sequence contained in b, thus facilitating a ready association of a 2 and b to form a binary, trimeric complex composed of a 2 b.
- This binding event is made irreversible with a subsequent reaction to covalently secure the two entities via disulfide bridges, which occurs very efficiently based on the principle of effective local concentration because the initial binding interactions should bring the reactive thiol groups placed onto both the DDD and AD into proximity (Chmura et al., Proc. Natl. Acad. Sci. USA. 2001; 98:8480) to ligate site-specifically.
- fusion proteins A variety of methods are known for making fusion proteins, including nucleic acid synthesis, hybridization and/or amplification to produce a synthetic double-stranded nucleic acid encoding a fusion protein of interest.
- double-stranded nucleic acids may be inserted into expression vectors for fusion protein production by standard molecular biology techniques (see, e.g. Sambrook et al., Molecular Cloning, A laboratory manual, 2 nd Ed, 1989).
- the AD and/or DDD moiety may be attached to either the N-terminal or C-terminal end of an effector protein or peptide, such as an antibody or fragment.
- site of attachment of an AD or DDD moiety to an effector moiety may vary, depending on the chemical nature of the effector moiety and the part(s) of the effector moiety involved in its physiological activity.
- Site-specific attachment of a variety of effector moieties may be performed using techniques known in the art, such as the use of bivalent cross-linking reagents and/or other chemical conjugation techniques.
- the fusion proteins are assembled by the dock and lock (DNL) techniques disclosed in, e.g., Rossi E A, et al., Proc Natl Acad Sci USA 2006; 103:6841-6846; U.S. Pat. Nos. 7,521,056; 7,550,143; 7,534,866; 7,527,787 and U.S. patent application Ser. No. 11/925,408; the Examples section of each of which is incorporated herein by reference.
- DDD and AD sequences that may be utilized in the DNL method to form synthetic complexes are disclosed below.
- DDD1 (SEQ ID NO: 1) SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA DDD2 (SEQ ID NO: 2) CGHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA AD1 (SEQ ID NO: 3) QIEYLAKQIVDNAIQQA AD2 (SEQ ID NO: 4) CGQIEYLAKQIVDNAIQQAGC
- sequence variants of the AD and/or DDD moieties may be utilized in construction of the DNL complexes.
- the structure-function relationships of the AD and DDD domains have been the subject of investigation. (See, e.g., Burns-Hamuro et al., 2005, Protein Sci 14:2982-92; Carr et al., 2001, J Biol Chem 276:17332-38; Alto et al., 2003, Proc Natl Acad Sci USA 100:4445-50; Hundsrucker et al., 2006, Biochem J 396:297-306; Stokka et al., 2006, Biochem J 400:493-99; Gold et al., 2006, Mol Cell 24:383-95; Kinderman et al., 2006, Mol Cell 24:397-408.)
- Alto et al. (2003) performed a bioinformatic analysis of the AD sequence of various AKAP proteins to design an RII selective AD sequence called AKAP-IS (SEQ ID NO:5), with a binding constant for DDD of 0.4 nM.
- the AKAP-IS sequence was designed as a peptide antagonist of AKAP binding to PKA. Residues in the AKAP-IS sequence where substitutions tended to decrease binding to DDD are underlined in SEQ ID NO:3.
- AKAP-IS SEQUENCE (SEQ ID NO: 3) QIEYL A KQ IV DN AI QQA
- the SuperAKAP-IS sequence may be substituted for the AKAP-IS AD moiety sequence to prepare DNL constructs.
- Other alternative sequences that might be substituted for the AKAP-IS AD sequence are shown in SEQ ID NO:6-8. Substitutions relative to the AKAP-IS sequence are underlined. It is anticipated that, as with the AKAP-IS sequence (SEQ ID NO:3), the AD moiety may also include the additional N-terminal residues cysteine and glycine and C-terminal residues glycine and cysteine, as shown in SEQ ID NO:4.
- Ht31 SEQ ID NO:9
- RIAD SEQ ID NO:10
- PV-38 SEQ ID NO:11
- Ht31 (SEQ ID NO: 9) DLIEEAASRIVDAVIEQVKAAGAY RIAD (SEQ ID NO: 10) LEQYANQLADQIIKEATE PV-38 (SEQ ID NO: 11) FEELAWKIAKMIWSDVFQQC
- Hundsrucker et al. (2006) developed still other peptide competitors for AKAP binding to PKA, with a binding constant as low as 0.4 nM to the DDD of the RII form of PKA.
- the sequences of various AKAP antagonistic peptides is provided in Table 1 of Hundsrucker et al. (incorporated herein by reference). Residues that were highly conserved among the AD domains of different AKAP proteins are indicated below by underlining with reference to the AKAP IS sequence. The residues are the same as observed by Alto et al. (2003), with the addition of the C-terminal alanine residue. (See FIG. 4 of Hundsrucker et al. (2006), incorporated herein by reference.) The sequences of peptide antagonists with particularly high affinities for the RII DDD sequence are shown in SEQ ID NO:12-14.
- AKAP-IS (SEQ ID NO: 3) QTEYL A KQ IV DN AI QQ A AKAP7 ⁇ -wt-pep (SEQ ID NO: 12) PEDAELVALSKRLVENAVLKAVQQY AKAP7 ⁇ -L304T-pep (SEQ ID NO: 13) PEDAELVRTSKRLVENAVLKAVQQY AKAP7 ⁇ -L308D-pep (SEQ ID NO: 14) PEDAELVALSKRDVENAVLKAVQQY
- Carr et al. examined the degree of sequence homology between different AKAP-binding DDD sequences from human and non-human proteins and identified residues in the DDD sequences that appeared to be the most highly conserved among different DDD moieties. These are indicated below by underlining with reference to the human PKA RII ⁇ DDD sequence of SEQ ID NO:1. Residues that were particularly conserved are further indicated by italics. The residues overlap with, but are not identical to those suggested by Kinderman et al. (2006) to be important for binding to AKAP proteins.
- amino acid residues that are highly conserved in the DDD and AD sequences from different proteins are ones that it may be preferred to remain constant in making amino acid substitutions, while residues that are less highly conserved may be more easily varied to produce sequence variants of the AD and/or DDD sequences described herein.
- the disclosed methods and compositions may involve production and use of proteins or peptides with one or more substituted amino acid residues.
- the DDD and/or AD sequences used to make DNL constructs may be modified as discussed above.
- amino acid substitutions typically involve the replacement of an amino acid with another amino acid of relatively similar properties (i.e., conservative amino acid substitutions).
- conservative amino acid substitutions The properties of the various amino acids and effect of amino acid substitution on protein structure and function have been the subject of extensive study and knowledge in the art.
- the hydropathic index of amino acids may be considered (Kyte & Doolittle, 1982, J. Mol. Biol., 157:105-132).
- the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules.
- Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics (Kyte & Doolittle, 1982), these are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine ( ⁇ 0.4); threonine ( ⁇ 0.7); serine ( ⁇ 0.8); tryptophan ( ⁇ 0.9); tyrosine ( ⁇ 1.3); proline ( ⁇ 1.6); histidine ( ⁇ 3.2); glutamate ( ⁇ 3.5); glutamine ( ⁇ 3.5); aspartate ( ⁇ 3.5); asparagine ( ⁇ 3.5); lysine ( ⁇ 3.9); and arginine ( ⁇ 4.5).
- the use of amino acids whose hydropathic indices are within ⁇ 2 is preferred, within ⁇ 1 are more preferred, and within ⁇ 0.5 are even more preferred.
- Amino acid substitution may also take into account the hydrophilicity of the amino acid residue (e.g., U.S. Pat. No. 4,554,101). Hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0); glutamate (+3.0); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine ( ⁇ 0.4); proline ( ⁇ 0.5+ ⁇ 0.1); alanine ( ⁇ 0.5); histidine ( ⁇ 0.5); cysteine ( ⁇ 1.0); methionine ( ⁇ 1.3); valine ( ⁇ 1.5); leucine ( ⁇ 1.8); isoleucine ( ⁇ 1.8); tyrosine ( ⁇ 2.3); phenylalanine ( ⁇ 2.5); tryptophan ( ⁇ 3.4). Replacement of amino acids with others of similar hydrophilicity is preferred.
- amino acid side chain For example, it would generally not be preferred to replace an amino acid with a compact side chain, such as glycine or serine, with an amino acid with a bulky side chain, e.g., tryptophan or tyrosine.
- a compact side chain such as glycine or serine
- an amino acid with a bulky side chain e.g., tryptophan or tyrosine.
- the effect of various amino acid residues on protein secondary structure is also a consideration. Through empirical study, the effect of different amino acid residues on the tendency of protein domains to adopt an alpha-helical, beta-sheet or reverse turn secondary structure has been determined and is known in the art (see, e.g., Chou & Fasman, 1974, Biochemistry, 13:222-245; 1978, Ann. Rev. Biochem., 47: 251-276; 1979, Biophys. J., 26:367-384).
- amino acid substitutions include whether or not the residue is located in the interior of a protein or is solvent exposed.
- conservative substitutions would include: Asp and Asn; Ser and Thr; Ser and Ala; Thr and Ala; Ala and Gly; Ile and Val; Val and Leu; Leu and Ile; Leu and Met; Phe and Tyr; Tyr and Trp.
- conservative substitutions would include: Asp and Asn; Asp and Glu; Glu and Gln; Glu and Ala; Gly and Asn; Ala and Pro; Ala and Gly; Ala and Ser; Ala and Lys; Ser and Thr; Lys and Arg; Val and Leu; Leu and Ile; Be and Val; Phe and Tyr.
- amino acid substitutions In determining amino acid substitutions, one may also consider the existence of intermolecular or intramolecular bonds, such as formation of ionic bonds (salt bridges) between positively charged residues (e.g., His, Arg, Lys) and negatively charged residues (e.g., Asp, Glu) or disulfide bonds between nearby cysteine residues.
- ionic bonds salt bridges
- positively charged residues e.g., His, Arg, Lys
- negatively charged residues e.g., Asp, Glu
- disulfide bonds between nearby cysteine residues.
- the binding moieties described herein may comprise one or more avimer sequences.
- Avimers are a class of binding proteins somewhat similar to antibodies in their affinities and specificities for various target molecules. They were developed from human extracellular receptor domains by in vitro exon shuffling and phage display. (Silverman et al., 2005, Nat. Biotechnol. 23:1493-94; Silverman et al., 2006, Nat. Biotechnol. 24:220.)
- the resulting multidomain proteins may comprise multiple independent binding domains, that may exhibit improved affinity (in some cases sub-nanomolar) and specificity compared with single-epitope binding proteins.
- avimers may be attached to, for example, DDD and/or AD sequences for use in the claimed methods and compositions. Additional details concerning methods of construction and use of avimers are disclosed, for example, in U.S. Patent Application Publication Nos. 20040175756, 20050048512, 20050053973, 20050089932 and 20050221384, the Examples section of each of which is incorporated herein by reference.
- compositions and/or methods may concern binding peptides and/or peptide mimetics of various target molecules, cells or tissues.
- Binding peptides may be identified by any method known in the art, including but not limiting to the phage display technique.
- Various methods of phage display and techniques for producing diverse populations of peptides are well known in the art.
- U.S. Pat. Nos. 5,223,409; 5,622,699 and 6,068,829 disclose methods for preparing a phage library.
- the phage display technique involves genetically manipulating bacteriophage so that small peptides can be expressed on their surface (Smith and Scott, 1985, Science 228:1315-1317; Smith and Scott, 1993, Meth. Enzymol. 21:228-257).
- larger protein domains such as single-chain antibodies may also be displayed on the surface of phage particles (Arap et al., 1998, Science 279:377-380).
- Targeting amino acid sequences selective for a given organ, tissue, cell type or target molecule may be isolated by panning (Pasqualini and Ruoslahti, 1996, Nature 380:364-366; Pasqualini, 1999, The Quart. J. Nucl. Med. 43:159462).
- a library of phage containing putative targeting peptides is administered to an intact organism or to isolated organs, tissues, cell types or target molecules and samples containing bound phage are collected.
- Phage that bind to a target may be eluted from a target organ, tissue, cell type or target molecule and then amplified by growing them in host bacteria.
- the phage may be propagated in host bacteria between rounds of panning. Rather than being lysed by the phage, the bacteria may instead secrete multiple copies of phage that display a particular insert. If desired, the amplified phage may be exposed to the target organs, tissues, cell types or target molecule again and collected for additional rounds of panning. Multiple rounds of panning may be performed until a population of selective or specific binders is obtained.
- the amino acid sequence of the peptides may be determined by sequencing the DNA corresponding to the targeting peptide insert in the phage genome. The identified targeting peptide may then be produced as a synthetic peptide by standard protein chemistry techniques (Arap et al., 1998, Smith et al., 1985).
- a subtraction protocol may be used to further reduce background phage binding.
- the purpose of subtraction is to remove phage from the library that bind to targets other than the target of interest.
- the phage library may be prescreened against a control cell, tissue or organ. For example, tumor-binding peptides may be identified after prescreening a library against a control normal cell line. After subtraction the library may be screened against the molecule, cell, tissue or organ of interest.
- Other methods of subtraction protocols are known and may be used in the practice of the claimed methods, for example as disclosed in U.S. Pat. Nos. 5,840,841, 5,705,610, 5,670,312 and 5,492,807.
- a targeting moiety of use may be an aptamer.
- Methods of constructing and determining the binding characteristics of aptamers are well known in the art. For example, such techniques are described in U.S. Pat. Nos. 5,582,981, 5,595,877 and 5,637,459, the Examples section of each incorporated herein by reference. Methods for preparation and screening of aptamers that bind to particular targets of interest are well known, for example U.S. Pat. No. 5,475,096 and U.S. Pat. No. 5,270,163, the Examples section of each incorporated herein by reference.
- Aptamers may be prepared by any known method, including synthetic, recombinant, and purification methods, and may be used alone or in combination with other ligands specific for the same target. In general, a minimum of approximately 3 nucleotides, preferably at least 5 nucleotides, are necessary to effect specific binding. Aptamers of sequences shorter than 10 bases may be feasible, although aptamers of 10, 20, 30 or 40 nucleotides may be preferred.
- Aptamers may be isolated, sequenced, and/or amplified or synthesized as conventional DNA or RNA molecules.
- aptamers of interest may comprise modified oligomers. Any of the hydroxyl groups ordinarily present in aptamers may be replaced by phosphonate groups, phosphate groups, protected by a standard protecting group, or activated to prepare additional linkages to other nucleotides, or may be conjugated to solid supports.
- One or more phosphodiester linkages may be replaced by alternative linking groups, such as P(O)O replaced by P(O)S, P(O)NR 2 , P(O)R, P(O)OR′, CO, or CNR 2 , wherein R is H or alkyl (1-20C) and R′ is alkyl (1-20C); in addition, this group may be attached to adjacent nucleotides through O or S, Not all linkages in an oligomer need to be identical.
- alternative linking groups such as P(O)O replaced by P(O)S, P(O)NR 2 , P(O)R, P(O)OR′, CO, or CNR 2 , wherein R is H or alkyl (1-20C) and R′ is alkyl (1-20C); in addition, this group may be attached to adjacent nucleotides through O or S, Not all linkages in an oligomer need to be identical.
- the preferred conjugation protocol is based on a thiol-maleimide, a thiol-vinylsulfone, a thiol-bromoacetamide, or a thiol-iodoacetamide reaction that are facile at neutral or acidic pH. This obviates the need for higher pH conditions for conjugations as, for instance, would be necessitated when using active esters. Further details of exemplary conjugation protocols are described below in the Examples section.
- the invention in another aspect, relates to a method of treating a subject, comprising administering a therapeutically effective amount of a therapeutic conjugate as described herein to a subject.
- Diseases that may be treated with the therapeutic conjugates described herein include, but are not limited to B-cell malignancies (e.g., non-Hodgkin's lymphoma and chronic lymphocytic leukemia using, for example LL2 MAb; see U.S. Pat. No. 6,183,744), adenocarcinomas of endodermally-derived digestive system epithelia, cancers such as breast cancer and non-small cell lung cancer, and other carcinomas, sarcomas, glial tumors, myeloid leukemias, etc.
- B-cell malignancies e.g., non-Hodgkin's lymphoma and chronic lymphocytic leukemia using, for example LL2 MAb; see U.S. Pat. No. 6,183,744
- antibodies against an antigen e.g., an oncofetal antigen, produced by or associated with a malignant solid tumor or hematopoietic neoplasm, e.g., a gastrointestinal, lung, breast, prostate, ovarian, testicular, brain or lymphatic tumor, a sarcoma or a melanoma
- an antigen e.g., an oncofetal antigen
- a malignant solid tumor or hematopoietic neoplasm e.g., a gastrointestinal, lung, breast, prostate, ovarian, testicular, brain or lymphatic tumor, a sarcoma or a melanoma
- Such therapeutics can be given once or repeatedly, depending on the disease state and tolerability of the conjugate, and can also be used optimally in combination with other therapeutic modalities, such as surgery, external radiation, radioimmunotherapy, immunotherapy, chemotherapy, antisense therapy, interference RNA therapy, gene therapy, and the like.
- the term “subject” refers to any animal (i.e., vertebrates and invertebrates) including, but not limited to mammals, including humans. It is not intended that the term be limited to a particular age or sex. Thus, adult and newborn subjects, as well as fetuses, whether male or female, are encompassed by the term.
- therapeutic conjugates comprising the Mu-9 MAb can be used to treat colorectal, as well as pancreatic and ovarian cancers as disclosed in U.S. Pat. Nos. 6,962,702 and 7,387,772, the Examples section of each incorporated herein by reference.
- therapeutic conjugates comprising the PAM4 MAb can be used to treat pancreatic cancer, as disclosed in U.S. Pat. Nos. 7,238,786 and 7,282,567, the Examples section of each incorporated herein by reference.
- therapeutic conjugates comprising the RS7 MAb (binding to epithelial glycoprotein-1 [EGP-1] antigen) can be used to treat carcinomas such as carcinomas of the lung, stomach, urinary bladder, breast, ovary, uterus, and prostate, as disclosed in U.S. Pat. No. 7,238,785, the Examples section of which is incorporated herein by reference.
- RS7 MAb binding to epithelial glycoprotein-1 [EGP-1] antigen
- therapeutic conjugates comprising the anti-AFP MAb can be used to treat hepato-cellular carcinoma, germ cell tumors, and other AFP-producing tumors using humanized, chimeric and human antibody forms, as disclosed in U.S. Pat. No. 7,300,655, the Examples section of which is incorporated herein by reference.
- therapeutic conjugates comprising anti-tenascin antibodies can be used to treat hematopoietic and solid tumors and conjugates comprising antibodies to tenascin can be used to treat solid tumors, preferably brain cancers like glioblastomas.
- the antibodies that are used in the treatment of human disease are human or humanized (CDR-grafted) versions of antibodies; although murine and chimeric versions of antibodies can be used.
- Same species IgG molecules as delivery agents are mostly preferred to minimize immune responses. This is particularly important when considering repeat treatments.
- a human or humanized IgG antibody is less likely to generate an anti-IgG immune response from patients.
- Antibodies such as hLL1 and hLL2 rapidly internalize after binding to internalizing antigen on target cells, which means that the chemotherapeutic drug being carried is rapidly internalized into cells as well. However, antibodies that have slower rates of internalization can also be used to effect selective therapy.
- the therapeutic conjugates can be used against pathogens, since antibodies against pathogens are known.
- antibodies and antibody fragments which specifically bind markers produced by or associated with infectious lesions, including viral, bacterial, fungal and parasitic infections, for example caused by pathogens such as bacteria, rickettsia, mycoplasma, protozoa, fungi, and viruses, and antigens and products associated with such microorganisms have been disclosed, inter alia, in Hansen et al., U.S. Pat. No. 3,927,193 and Goldenberg U.S. Pat. Nos.
- the pathogens are selected from the group consisting of HIV virus, Mycobacterium tuberculosis, Streptococcus agalactiae, methicillin-resistant Staphylococcus aureus, Legionella pneumophilia, Streptococcus pyogenes, Escherichia coli, Neisseria gonorrhosae, Neisseria meningitidis, Pneumococcus, Cryptococcus neoformans, Histoplasma capsulatum, Hemophilis influenzae B, Treponema pallidum, Lyme disease spirochetes, Pseudomonas aeruginosa, Mycobacterium leprae, Bruce
- drug conjugates of the present invention comprising anti-gp120 and other such anti-HIV antibodies can be used as therapeutics for HIV in AIDS patients; and drug conjugates of antibodies to Mycobacterium tuberculosis are suitable as therapeutics for drug-refractive tuberculosis.
- Fusion proteins of anti-gp120 MAb (anti HIV MAb) and a toxin, such as Pseudomonas exotoxin, have been examined for antiviral properties (Van Oigen et al., J Drug Target, 5:75-91, 1998). Attempts at treating HIV infection in AIDS patients failed, possibly due to insufficient efficacy or unacceptable host toxicity.
- the drug conjugates of the present invention advantageously lack such toxic side effects of protein toxins, and are therefore advantageously used in treating HIV infection in AIDS patients. These drug conjugates can be given alone or in combination with other antibiotics or therapeutic agents that are effective in such patients when given alone.
- Candidate anti-HIV antibodies include the anti-envelope antibody described by Johansson et al. (AIDS. 2006 Oct. 3; 20(15):1911-5), as well as the anti-HIV antibodies described and sold by Polymun (Vienna, Austria), also described in U.S. Pat. No. 5,831,034, U.S. Pat. No.
- a preferred targeting agent for HIV is various combinations of these antibodies in order to overcome resistance.
- diseases that may be treated using the therapeutic conjugates of the preferred embodiments of the present invention include, but are not limited to immune dysregulation disease and related autoimmune diseases, including Class III autoimmune diseases such as immune-mediated thrombocytopenias, such as acute idiopathic thrombocytopenic purpura and chronic idiopathic thrombocytopenic purpura, dermatomyositis, Sjögren's syndrome, multiple sclerosis, Sydenham's chorea, myasthenia gravis, systemic lupus erythematosus, lupus nephritis, rheumatic fever, polyglandular syndromes, bullous pemphigoid, diabetes mellitus, Henoch-Schonlein purpura, post-streptococcal nephritis, erythema nodosum, Takayasu's arteritis, Addison's disease, rheumatoid arthritis,
- Typical antibodies useful in these diseases include, but are not limited to, those reactive with HLA-DR antigens, B-cell and plasma-cell antigens (e.g., CD19, CD20, CD21, CD22, CD23, CD4, CD5, CD8, CD14, CD15, CD19, CD20, CD21, CD22, CD23, CD25, CD33, CD37, CD38, CD40, CD40L, CD46, CD52, CD54, CD74, CD80, CD126, CD138, B7, MUC1, Ia, HM1.24, and HLA-DR), IL-6, IL-17.
- HLA-DR antigens e.g., CD19, CD20, CD21, CD22, CD23, CD4, CD5, CD8, CD14, CD15, CD19, CD20, CD21, CD22, CD23, CD25, CD33, CD37, CD38, CD40, CD40L, CD46, CD52, CD54, CD74, CD80, CD126, CD138, B7, MUC1,
- autoimmune diseases are affected by autoantibodies made by aberrant B-cell populations
- depletion of these B-cells by therapeutic conjugates involving such antibodies-therapeutic agent conjugates described herein is a preferred method of autoimmune disease therapy, especially when B-cell antibodies are combined, in certain circumstances, with HLA-DR antibodies and/or T-cell antibodies (including those which target IL-2 as an antigen, such as anti-TAC antibody).
- the anti-B-cell, anti-T-cell, or anti-macrophage or other such antibodies of use in the treatment of patients with autoimmune diseases also can be conjugated to result in more effective therapeutics to control the host responses involved in said autoimmune diseases, and can be given alone or in combination with other therapeutic agents, such as TNF inhibitors or TNF antibodies, unconjugated B- or T-cell antibodies, and the like.
- a more effective incorporation into cells and pathogens can be accomplished by using multivalent, multispecific or multivalent, monospecific antibodies.
- multivalent, multispecific or multivalent, monospecific antibodies are found in U.S. Pat. Nos. 7,387,772; 7,300,655; 7,238,785; and 7,282,567, the Examples section of each of which is incorporated herein by reference.
- These multivalent or multispecific antibodies are particularly preferred in the targeting of cancers and infectious organisms (pathogens), which express multiple antigen targets and even multiple epitopes of the same antigen target, but which often evade antibody targeting and sufficient binding for immunotherapy because of insufficient expression or availability of a single antigen target on the cell or pathogen.
- pathogens cancers and infectious organisms
- said antibodies show a higher binding and residence time on the target, thus affording a higher saturation with the drug being targeted in this invention.
- a therapeutic agent used in combination with the camptothecin conjugate of this invention may comprise one or more isotopes.
- Radioactive isotopes useful for treating diseased tissue include, but are not limited to— 111 In, 177 Lu, 212 Bi, 213 Bi, 211 At, 62 Cu, 67 Cu, 90 Y, 125 I, 131 I, 32 P, 33 P, 47 Sc, 111 Ag, 67 Ga, 142 Pr, 153 Sm, 161 Tb, 166 Dy, 166 Ho, 186 Re, 188 Re, 189 Re, 212 Pb, 223 Ra, 225 Ac, 59 Fe, 75 Se, 77 As, 89 Sr, 99 Mo, 105 Rh, 109 Pd, 143 Pr, 149 Pm, 169 Er, 194 Ir, 198 Au, 199 Au, and 211 Pb.
- the therapeutic radionuclide preferably has a decay-energy in the range of 20 to 6,000 keV, preferably in the ranges 60 to 200 keV for an Auger emitter, 100-2,500 keV for a beta emitter, and 4,000-6,000 keV for an alpha emitter.
- Maximum decay energies of useful beta-particle-emitting nuclides are preferably 20-5,000 keV, more preferably 100-4,000 keV, and most preferably 500-2,500 keV. Also preferred are radionuclides that substantially decay with Auger-emitting particles.
- Radionuclides that substantially decay with generation of alpha-particles. Such radionuclides include, but are not limited to: Dy-152, At-211, Bi-212, Ra-223, Rn-219, Po-215, Bi-211, Ac-225, Fr-221, At-217, Bi-213 and Fm-255.
- Decay energies of useful alpha-particle-emitting radionuclides are preferably 2,000-10,000 keV, more preferably 3,000-8,000 keV, and most preferably 4,000-7,000 keV.
- Additional potential radioisotopes of use include 11 C, 13 N, 15 O, 75 Br, 198 Au, 224 Ac, 126 I, 133 I, 77 Br, 113m In, 95 Ru, 97 Ru, 103 Ru, 105 Ru, 107 Hg, 203 Hg, 121m Te, 122m Te, 125m Te, 165 Tm, 168 Tm, 197 Pt, 109 Pd, 105 Rh, 142 Pr, 143 Pr, 161 Tb, 166 Ho, 199 Au, 57 Co, 58 Co, 51 Cr, 59 Fe, 75 Se, 201 Tl, 225 Ac, 76 Br, 169 Yb, and the like.
- Radionuclides and other metals may be delivered, for example, using chelating groups attached to an antibody or conjugate.
- Macrocyclic chelates such as NOTA, DOTA, and TETA are of use with a variety of metals and radiometals, most particularly with radionuclides of gallium, yttrium and copper, respectively.
- metal-chelate complexes can be made very stable by tailoring the ring size to the metal of interest.
- Other ring-type chelates, such as macrocyclic polyethers for complexing 223 Ra may be used.
- Therapeutic agents of use in combination with the camptothecin conjugates described herein also include, for example, chemotherapeutic drugs such as vinca alkaloids, anthracyclines, epidophyllotoxins, taxanes, antimetabolites, alkylating agents, antibiotics, Cox-2 inhibitors, antimitotics, antiangiogenic and proapoptotic agents, particularly doxorubicin, methotrexate, taxol, other camptothecins, and others from these and other classes of anticancer agents, and the like.
- chemotherapeutic drugs such as vinca alkaloids, anthracyclines, epidophyllotoxins, taxanes, antimetabolites, alkylating agents, antibiotics, Cox-2 inhibitors, antimitotics, antiangiogenic and proapoptotic agents, particularly doxorubicin, methotrexate, taxol, other camptothecins, and others from these and other classes of anticancer agents, and the like.
- cancer chemotherapeutic drugs include nitrogen mustards, alkyl sulfonates, nitrosoureas, triazenes, folic acid analogs, pyrimidine analogs, purine analogs, platinum coordination complexes, hormones, and the like.
- Suitable chemotherapeutic agents are described in REMINGTON'S PHARMACEUTICAL SCIENCES, 19th Ed. (Mack Publishing Co. 1995), and in GOODMAN AND GILMAN'S THE PHARMACOLOGICAL BASIS OF THERAPEUTICS, 7th Ed. (MacMillan Publishing Co. 1985), as well as revised editions of these publications.
- Other suitable chemotherapeutic agents, such as experimental drugs are known to those of skill in the art.
- Exemplary drugs of use include, but are not limited to, 5-fluorouracil, aplidin, azaribine, anastrozole, anthracyclines, bendamustine, bleomycin, bortezomib, bryostatin-1, busulfan, calicheamycin, camptothecin, carboplatin, 10-hydroxycamptothecin, carmustine, celebrex, chlorambucil, cisplatin (CDDP), Cox-2 inhibitors, irinotecan (CPT-11), SN-38, carboplatin, cladribine, camptothecans, cyclophosphamide, cytarabine, dacarbazine, docetaxel, dactinomycin, daunorubicin, doxorubicin, 2-pyrrolinodoxorubicine (2P-DOX), cyano-morpholino doxorubicin, doxorubicin glucuronide, epirubicin glucur
- Such agents may part of the conjugates described herein or may alternatively be administered in combination with the described conjugates, either prior to, simultaneously with or after the conjugate.
- one or more therapeutic naked antibodies as are known in the art may be used in combination with the described conjugates. Exemplary therapeutic naked antibodies are described in the preceding section.
- Therapeutic agents that may be used in concert with the camptothecin conjugates also may comprise toxins conjugated to targeting moieties.
- Toxins that may be used in this regard include ricin, abrin, ribonuclease (RNase), DNase I, Staphylococcal enterotoxin-A, pokeweed antiviral protein, gelonin, diphtherin toxin, Pseudomonas exotoxin, and Pseudomonas endotoxin.
- RNase ribonuclease
- DNase I DNase I
- Staphylococcal enterotoxin-A Staphylococcal enterotoxin-A
- pokeweed antiviral protein pokeweed antiviral protein
- gelonin gelonin
- diphtherin toxin diphtherin toxin
- Pseudomonas exotoxin Pseudomonas endotoxin.
- Immunomodulators of use may be selected from a cytokine, a stem cell growth factor, a lymphotoxin, a hematopoietic factor, a colony stimulating factor (CSF), an interferon (IFN), erythropoietin, thrombopoietin and a combination thereof.
- CSF colony stimulating factor
- IFN interferon
- lymphotoxins such as tumor necrosis factor (TNF), hematopoietic factors, such as interleukin (IL), colony stimulating factor, such as granulocyte-colony stimulating factor (G-CSF) or granulocyte macrophage-colony stimulating factor (GM-CSF), interferon, such as interferons- ⁇ , - ⁇ or - ⁇ , and stem cell growth factor, such as that designated “S1 factor”.
- TNF tumor necrosis factor
- IL interleukin
- colony stimulating factor such as granulocyte-colony stimulating factor (G-CSF) or granulocyte macrophage-colony stimulating factor (GM-CSF)
- interferon such as interferons- ⁇ , - ⁇ or - ⁇
- stem cell growth factor such as that designated “S1 factor”.
- cytokines include growth hormones such as human growth hormone, N-methionyl human growth hormone, and bovine growth hormone; parathyroid hormone; thyroxine; insulin; proinsulin; relaxin; prorelaxin; glycoprotein hormones such as follicle stimulating hormone (FSH), thyroid stimulating hormone (TSH), and luteinizing hormone (LH); hepatic growth factor; prostaglandin, fibroblast growth factor; prolactin; placental lactogen, OB protein; tumor necrosis factor- ⁇ and - ⁇ ; mullerian-inhibiting substance; mouse gonadotropin-associated peptide; inhibin; activin; vascular endothelial growth factor; integrin; thrombopoietin (TPO); nerve growth factors such as NGF- ⁇ ; platelet-growth factor; transforming growth factors (TGFs) such as TGF- ⁇ and TGF- ⁇ ; insulin-like growth factor-I and -II; erythropoietin (
- Chemokines of use include RANTES, MCAF, MIP1-alpha, MIP1-Beta and IP-10.
- Suitable routes of administration of the conjugates include, without limitation, oral, parenteral, rectal, transmucosal, intestinal administration, intramuscular, subcutaneous, intramedullary, intrathecal, direct intraventricular, intravenous, intravitreal, intraperitoneal, intranasal, or intraocular injections.
- the preferred routes of administration are parenteral.
- Immunoconjugates can be formulated according to known methods to prepare pharmaceutically useful compositions, whereby the immunoconjugate is combined in a mixture with a pharmaceutically suitable excipient.
- Sterile phosphate-buffered saline is one example of a pharmaceutically suitable excipient.
- Other suitable excipients are well-known to those in the art. See, for example, Ansel et al., PHARMACEUTICAL DOSAGE FORMS AND DRUG DELIVERY SYSTEMS, 5th Edition (Lea & Febiger 1990), and Gennaro (ed.), REMINGTON'S PHARMACEUTICAL SCIENCES, 18th Edition (Mack Publishing Company 1990), and revised editions thereof.
- the immunoconjugate can be formulated for intravenous administration via, for example, bolus injection or continuous infusion.
- the antibody of the present invention is infused over a period of less than about 4 hours, and more preferably, over a period of less than about 3 hours.
- the first 25-50 mg could be infused within 30 minutes, preferably even 15 min, and the remainder infused over the next 2-3 hrs.
- Formulations for injection can be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative.
- the compositions can take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- the active ingredient can be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- Control release preparations can be prepared through the use of polymers to complex or adsorb the immunoconjugate.
- biocompatible polymers include matrices of poly(ethylene-co-vinyl acetate) and matrices of a polyanhydride copolymer of a stearic acid dimer and sebacic acid. Sherwood et al., Bio/Technology 10: 1446 (1992). The rate of release of an immunoconjugate from such a matrix depends upon the molecular weight of the immunoconjugate, the amount of immunoconjugate within the matrix, and the size of dispersed particles. Saltzman et al., Biophys. J.
- the dosage of an administered immunoconjugate for humans will vary depending upon such factors as the patient's age, weight, height, sex, general medical condition and previous medical history. It may be desirable to provide the recipient with a dosage of immunoconjugate that is in the range of from about 1 mg/kg to 25 mg/kg as a single intravenous infusion, although a lower or higher dosage also may be administered as circumstances dictate.
- the dosage may be repeated as needed, for example, once per week for 4-10 weeks, once per week for 8 weeks, or once per week for 4 weeks. It may also be given less frequently, such as every other week for several months, or monthly or quarterly for many months, as needed in a maintenance therapy.
- an immunoconjugate may be administered as one dosage every 2 or 3 weeks, repeated for a total of at least 3 dosages. Or, twice per week for 4-6 weeks. If the dosage is lowered to approximately 200-300 mg/m 2 (340 mg per dosage for a 1.7-m patient, or 4.9 mg/kg for a 70 kg patient), it may be administered once or even twice weekly for 4 to 10 weeks. Alternatively, the dosage schedule may be decreased, namely every 2 or 3 weeks for 2-3 months. It has been determined, however, that even higher doses, such as 20 mg/kg once weekly or once every 2-3 weeks can be administered by slow i.v. infusion, for repeated dosing cycles. The dosing schedule can optionally be repeated at other intervals and dosage may be given through various parenteral routes, with appropriate adjustment of the dose and schedule.
- the immunoconjugates are of use for therapy of cancer.
- cancers include, but are not limited to, carcinoma, lymphoma, glioblastoma, melanoma, sarcoma, and leukemia, myeloma, or lymphoid malignancies.
- squamous cell cancer e.g., epithelial squamous cell cancer
- Ewing sarcoma e.g., Ewing sarcoma
- Wilms tumor astrocytomas
- lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma multiforme, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, hepatocellular carcinoma, neuroendocrine tumors, medullary thyroid cancer, differentiated thyroid carcinoma, breast cancer, ovarian cancer, colon cancer, rectal cancer, endometrial cancer or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulvar cancer, anal carcinoma, penile carcinoma, as well as head-and-neck cancer.
- cancer includes primary malignant cells or tumors (e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor) and secondary malignant cells or tumors (e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor).
- primary malignant cells or tumors e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor
- secondary malignant cells or tumors e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor.
- cancers or malignancies include, but are not limited to: Acute Childhood Lymphoblastic Leukemia, Acute Lymphoblastic Leukemia, Acute Lymphocytic Leukemia, Acute Myeloid Leukemia, Adrenocortical Carcinoma, Adult (Primary) Hepatocellular Cancer, Adult (Primary) Liver Cancer, Adult Acute Lymphocytic Leukemia, Adult Acute Myeloid Leukemia, Adult Hodgkin's Lymphoma, Adult Lymphocytic Leukemia, Adult Non-Hodgkin's Lymphoma, Adult Primary Liver Cancer, Adult Soft Tissue Sarcoma, AIDS-Related Lymphoma, AIDS-Related Malignancies, Anal Cancer, Astrocytoma, Bile Duct Cancer, Bladder Cancer, Bone Cancer, Brain Stem Glioma, Brain Tumors, Breast Cancer, Cancer of the Renal Pelvis and Ureter, Central Nervous System (Primary) Lymphoma,
- compositions described and claimed herein may be used to treat malignant or premalignant conditions and to prevent progression to a neoplastic or malignant state, including but not limited to those disorders described above.
- Such uses are indicated in conditions known or suspected of preceding progression to neoplasia or cancer, in particular, where non-neoplastic cell growth consisting of hyperplasia, metaplasia, or most particularly, dysplasia has occurred (for review of such abnormal growth conditions, see Robbins and Angell, Basic Pathology, 2d Ed., W. B. Saunders Co., Philadelphia, pp. 68-79 (1976)).
- Dysplasia is frequently a forerunner of cancer, and is found mainly in the epithelia. It is the most disorderly form of non-neoplastic cell growth, involving a loss in individual cell uniformity and in the architectural orientation of cells. Dysplasia characteristically occurs where there exists chronic irritation or inflammation.
- Dysplastic disorders which can be treated include, but are not limited to, anhidrotic ectodermal dysplasia, anterofacial dysplasia, asphyxiating thoracic dysplasia, atriodigital dysplasia, bronchopulmonary dysplasia, cerebral dysplasia, cervical dysplasia, chondroectodermal dysplasia, cleidocranial dysplasia, congenital ectodermal dysplasia, craniodiaphysial dysplasia, craniocarpotarsal dysplasia, craniometaphysial dysplasia, dentin dysplasia, diaphysial dysplasia, ectodermal dysplasia, enamel dysplasia, encephalo-ophthalmic dysplasia, dysplasia epiphysialis hemimelia, dysplasia epiphysialis multiplex, dysplasia epiphysialis punctata, epi
- Additional pre-neoplastic disorders which can be treated include, but are not limited to, benign dysproliferative disorders (e.g., benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps or adenomas, and esophageal dysplasia), leukoplakia, keratoses, Bowen's disease, Farmer's Skin, solar cheilitis, and solar keratosis.
- benign dysproliferative disorders e.g., benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps or adenomas, and esophageal dysplasia
- leukoplakia keratoses
- Bowen's disease keratoses
- Farmer's Skin Farmer's Skin
- solar cheilitis solar cheilitis
- the method of the invention is used to inhibit growth, progression, and/or metastasis of cancers, in particular those listed above.
- Additional hyperproliferative diseases, disorders, and/or conditions include, but are not limited to, progression, and/or metastases of malignancies and related disorders such as leukemia (including acute leukemias (e.g., acute lymphocytic leukemia, acute myelocytic leukemia (including myeloblastic, promyelocytic, myelomonocytic, monocytic, and erythroleukemia)) and chronic leukemias (e.g., chronic myelocytic (granulocytic) leukemia and chronic lymphocytic leukemia)), polycythemia vera, lymphomas (e.g., Hodgkin's disease and non-Hodgkin's disease), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors including, but not limited to, sarcomas and carcinomas such as fibrosarcoma, myxosarcoma, liposarcoma
- kits containing components suitable for treating diseased tissue in a patient may contain at least one conjugated antibody or other targeting moiety as described herein. If the composition containing components for administration is not formulated for delivery via the alimentary canal, such as by oral delivery, a device capable of delivering the kit components through some other route may be included.
- a device capable of delivering the kit components through some other route may be included.
- the kit components may be packaged together or separated into two or more containers.
- the containers may be vials that contain sterile, lyophilized formulations of a composition that are suitable for reconstitution.
- a kit may also contain one or more buffers suitable for reconstitution and/or dilution of other reagents.
- Other containers that may be used include, but are not limited to, a pouch, tray, box, tube, or the like.
- Kit components may be packaged and maintained sterilely within the containers. Another component that can be included is instructions to a person using a kit for its use.
- DCC dicyclohexylcarbodiimide
- NHS N-hydroxysuccinimide
- DMAP 4-dimethylaminopyridine
- EEDQ 2-ethoxy-1-ethoxycarbonyl-1,2-dihydroquinoline
- MMT monomethoxytrityl
- PABOH p-aminobenzyl alcohol
- PEG polyethylene glycol
- SMCC succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate
- TBAF tetrabutylammonium fluoride
- TBDMS tert-butyldimethylsilyl chloride.
- Chloroformates of hydroxy compounds in the following examples were prepared using triphosgene and DMAP according to the procedure described in Moon et al. (J. Medicinal Chem. 51:6916-6926, 2008), which is incorporated by reference. Extractive work-up refers to extraction with chloroform, dichloromethane or ethyl acetate, and washing optionally with saturated bicarbonate, water, and with saturated sodium chloride. Flash chromatography was done using 230-400 mesh silica gel and methanol-dichloromethane gradient, using up to 15% v/v methanol-dichloromethane, unless otherwise stated.
- Reverse phase HPLC was performed by Method A using a 7.8 ⁇ 300 mm C18 HPLC column, fitted with a precolumn filter, and using a solvent gradient of 100% solvent A to 100% solvent B in 10 minutes at a flow rate of 3 mL per minute and maintaining at 100% solvent B at a flow rate of 4.5 mL per minute for 5 or 10 minutes; or by Method B using a 4.6 ⁇ 30 mm Xbridge C18, 2.5 ⁇ m, column, fitted with a precolumn filter, using the solvent gradient of 100% solvent A to 100% of solvent B at a flow rate of 1.5 mL per minutes for 4 min and 100% of solvent B at a flow rate of 2 mL per minutes for 1 minutes.
- Solvent A was 0.3% aqueous ammonium acetate, pH 4.46 while solvent B was 9:1 acetonitrile-aqueous ammonium acetate (0.3%), pH 4.46.
- HPLC was monitored by a dual in-line absorbance detector set at 360 nm and 254 nm.
- CL6-SN-38 is represented in Scheme-1.
- Commercially available O-(2-azidoethyl)-O′—(N-diglycolyl-2-aminoethyl)heptaethyleneglycol (‘PEG-N 3 ’; 227 mg) was activated with DCC (100 mg), NHS (56 mg), and a catalytic amount of DMAP in 10 mL of dichloromethane for 10 min. To this mixture was added L-valinol (46.3 mg), and the reaction ixture was stirred for 1 h at ambient temperature. Filtration, followed by solvent removal and flash chromatography yielded 214 mg of clear oily material.
- the maleimide-containing acetylenic reagent namely 4-(N-maleimidomethyl)-N-(2-propynyl)cyclohexane-1-carboxamide, required for click cycloaddition, was prepared by reacting 0.107 g of SMCC and 0.021 mL of propargylamine (0.018 g; 1.01 equiv.) in dichloromethane using 1.1 equiv. of diisopropylethylamine. After 1 h, the solvent was removed and the product was purified by flash chromatography to obtain 83 mg of the product (colorless powder).
- Electrospray mass spectrum showed peaks at m/e 275 (M+H) and a base peak at m/e 192 in the positive ion mode, consistent with the structure calculated for C 15 H 18 N 2 O 3 : 275.1390 (M+H). found: 275.1394 (exact mass).
- This intermediate (200 mg) was deprotected with diethylamine (10 mL), and the product (135 mg) was obtained in ⁇ 90% purity after flash chromatography. HPLC: t R 10.91 min; electrospray mass spectrum: M+Na at m/z 527.
- This product (135 mg) was coupled with the commercially available O-(2-azidoethyl)-O′—(N-diglycolyl-2-aminoethyl)heptaethyleneglycol (‘PEG-N 3 ’; 150 mg, 1.1 equiv.) in presence of EEDQ (72 mg, 1.1 equiv.) in 10 mL of dichloromethane, and stirred overnight at ambient temperature.
- R can be a substituted alkyl such as (CH 2 ) n —N(CH 3 ) 2 where n is 2-10, or a simple alkyl such as (CH 2 ) n —CH 3 where n is 0-10, or it can be an alkoxy moiety such as “CH 3 —(CH 2 ) n —O—” where n is 0-10, or a substituted alkoxy moiety such as such as O—(CH 2 ) n —N(CH 3 ) 2 where n is 2-10 and wherein the terminal amino group is optionally in the form of a quaternary salt for enhanced aqueous solubility, or “R 1 O—(CH 2 —CH 2 —O) n —CH 2 —CH 2 —O—” where R 1 is ethyl or methyl and n is an integer with values of 0-10.
- Valinol is coupled to ‘PEG-N3’ of Scheme-1 according to the procedure described in Example 1.
- the product is reacted with 0.4 molar equivalent of triphosgene, 3.1 molar equivalent of DMAP, in dichloromethane.
- the chloroformate so formed is reacted with an equimolar amount of paclitaxel for 15 minutes at ambient temperature.
- the reactive 2′-hydroxyl group of paclitaxel (the side chain secondary hydroxyl group) reacts with the chloroformate of the cross-linker.
- the product is isolated by flash chromatography.
- This intermediate (0.1 mmol) is dissolved in DMSO (1.5 mL) and water (0.4 mL), and reacted with 60 mg of 4-(N-maleimidomethyl)-N-(2-propynyl)cyclohexane-1-carboxamide (prepared as described in Example 1) and 15 mg of cuprous bromide and stirred for 30 min at ambient temperature. Flash chromatography, after work up of the reaction mixture, furnishes the bifunctional paclitaxel, namely CL6-paclitaxel.
- L-Valinol (40 mg) is reacted with commercially available Fmoc-Lys(MMT)-OH, and the product is then reacted with O-(2-azidoethyl)-O′—(N-diglycolyl-2-aminoethyl)heptaethyleneglycol (‘PEG-N 3 ’), as described in Example 2.
- the chloroformate of this derivative is formed by the method of Example-6, and reacted with an equimolar amount of paclitaxel.
- the reactive 2′-hydroxyl group of paclitaxel (the side chain secondary hydroxyl group) reacts with the chloroformate of the cross-linker.
- Valinol is coupled to ‘PEG-N3’ of Scheme-1 according to the procedure described in Example 1.
- the product is reacted with 0.4 molar equivalent of triphosgene, 3.1 molar equivalent of DMAP, in dichloromethane.
- the chloroformate so formed is reacted with an equimolar amount of morpholino doxorubicin for 15 minutes at ambient temperature.
- the primary hydroxyl group of morpholino doxorubicin reacts with the chloroformate of the cross-linker.
- the product is isolated by flash chromatography.
- This intermediate (0.1 mmol) is dissolved in DMSO (1.5 mL) and water (0.4 mL), and reacted with 60 mg of 4-(N-maleimidomethyl)-N-(2-propynyl)cyclohexane-1-carboxamide (prepared as described in Example 1) and 15 mg of cuprous bromide and stirred for 30 min at ambient temperature. Flash chromatography, after work up of the reaction mixture, furnishes the bifunctional paclitaxel, namely CL6-[morpholino doxorubicin].
- L-Valinol (40 mg) is reacted with commercially available Fmoc-Lys(MMT)-OH, and the product is then reacted with O-(2-azidoethyl)-O′—(N-diglycolyl-2-aminoethyl)heptaethyleneglycol (‘PEG-N 3 ’), as described in Example 2.
- the chloroformate of this derivative is formed by the method of Example-6, and reacted with an equimolar amount of morpholino doxorubicin.
- the primary hydroxyl group of morpholino doxorubicin reacts with the chloroformate of the cross-linker.
- Electrospray mass spectrum showed peaks at m/e 1753.3 (M+H), m/e 1751.6 (M ⁇ H), 1864.5 (M+TFA), consistent with structure.
- deprotection of the penultimate intermediate (0.22 g) with a mixture of dichloroacetic acid (0.3 mL) and anisole (0.03 mL) in methylene chloride (3 mL), followed by precipitation with ether yielded 0.18 g (97% yield) of CL2A-SN-38; (7) in Scheme-3) as light yellow powder.
- Electrospray mass spectrum showed peaks at m/e 1480.7 (M+H), 1478.5 (M ⁇ H), consistent with structure.
- This intermediate (0.442 g) was deprotected with a mixture of trifluoroacetic acid (1 mL) and anisole (0.1 mL) in methylene chloride (5 mL), followed by precipitation with ether to obtain 0.197 g of the product ((3) in Scheme-4) as white solid.
- This intermediate ((3); 0.197 g) was coupled with activated azide-containing-dipeptide incorporated-PEG-linker ((5) in Scheme-4), which activation was done by reacting PEG-linker ((4) in Scheme-4; 0.203 g) with bis(4-nitrophenyl) carbonate (0.153 g) and DIEA (0.044 mL) in methylene chloride (8 mL).
- Electrospray mass spectrum showed peaks at m/e 2035.9 (M+Na + ), m/e 2047.9 (M+Cl ⁇ ), consistent with structure.
- HPLC ret. time 1.95 min., ⁇ 99% purity.
- Electrospray mass spectrum showed peaks at m/e 1741.1 (M+H), 1775.5 (M+Cl ⁇ ), consistent with structure.
- Each antibody was reduced with dithiothreitol (DTT), used in a 50- to-70-fold molar excess, in 40 mM PBS, pH 7.4, containing 5.4 mM EDTA, at 37° C. (bath) for 45 min.
- DTT dithiothreitol
- the reduced product was purified by size-exclusion chromatography and/or diafiltration, and was buffer-exchanged into a suitable buffer at pH 6.5.
- the thiol content was determined by Ellman's assay, and was in the 6.540-8.5 SH/IgG range.
- the antibodies were reduced with Tris(2-carboxyethyl) phosphine (TCEP) in phosphate buffer at pH in the range of 5-7, followed by in situ conjugation.
- TCEP Tris(2-carboxyethyl) phosphine
- the reduced MAb was reacted with ⁇ 10- to-15-fold molar excess of ‘CL6-SN-38’ of Example 1, or ‘CL7-SN-38’ of Example 2, or ‘CL6-SN-38-10-O—CO 2 Et’ of Example 3, or ‘CL7-SN-38-10-O—CO 2 Et’ of Example 4, CL2A-SN-38 of Example 10, or CL2E-SN-38 of Example 11 using DMSO at 7-15% v/v as co-solvent, and incubating for 20 min at ambient temperature.
- the conjugate was purified by centrifuged SEC, passage through a hydrophobic column, and finally by ultrafiltration-diafiltration.
- the product was assayed for SN-38 by absorbance at 366 nm and correlating with standard values, while the protein concentration was deduced from absorbance at 280 nm, corrected for spillover of SN-38 absorbance at this wavelength. This way, the SN-38/MAb substitution ratios were determined.
- the purified conjugates were stored as lyophilized formulations in glass vials, capped under vacuum and stored in a ⁇ 20° C. freezer. SN-38 molar substitution ratios (MSR) obtained for some of these conjugates, which were typically in the 5- to-7 range, are shown in Table 2.
- FIG. 1 shows a Capan 1 pancreatic tumor model, wherein specific CL2A-SN-38 conjugates of hRS7 (anti-EGP-1), hPAM4 (anti-mucin), and hMN-14 (anti-CEACAM5) antibodies showed better efficacies than control hA20-CL2A-SN-38 conjugate (anti-CD20) and untreated control.
- a MAb targeted to the HIV envelope protein gp120, anti-gp120 antibody such as P4/D10, is reduced using conditions described in Example 7, and the reduced MAb is reacted with a 20-fold molar excess of the drug linker CL7-SN-38, which is as described in Example 2.
- An anti-gp120-SN-38 conjugate with a substitution of ⁇ 8 drug molecules per antibody is obtained.
- An in vitro HIV-inhibition assay with said conjugate is performed by using various mixtures of uninfected Jurkat-T cells and fully HIV-infected Jurkat T-cells (in the ratios of 99.8:0.2 to 95:5), and treating with serial dilutions of the conjugate, non-specific hRS7-CL7-SN38 conjugate control, naked antibody, and HIV-negative serum from 100 to 0.00001 ⁇ g/mL.
- the cells so treated are incubated in RPMI 1640 culture medium at 37° C. for seven days, and then assayed for HIV inhibition by ELISA test. This experiment shows a strong and specific inhibition of intercellular spread of HIV by the specific drug conjugate.
- mice isologous HIV-infected cells together with specific and non-specific SN-38 conjugates.
- primary murine splenocytes infected by HIV-1/MuLV pseudotype virus are intraperitoneally transferred to groups of mice simultaneously with immunoconjugate administration. Peritoneal cells are harvested 10 days later. While infectious HIV presence is demonstrated in control mice, no infectious HIV is detected in mice treated with 100 ⁇ g or less of anti-gp120-SN-38 conjugate. No protection is seen with mice treated with control conjugates.
Abstract
Description
MAb[L2]-[L1]-[AA]m-[A′]-Drug (2)
where MAb is a disease-targeting antibody; L2 is a component of the cross-linker comprising an antibody-coupling moiety and one or more of acetylene (or azide) groups; L1 comprises a defined PEG with azide (or acetylene) at one end, complementary to the acetylene (or azide) moiety in L2, and a reactive group such as carboxylic acid or hydroxyl group at the other end; AA is an L-amino acid; m is an integer with values of 0, 1, 2, 3, or 4; and A′ is an additional spacer, selected from the group of ethanolamine, 4-hydroxybenzyl alcohol, 4-aminobenzyl alcohol, or substituted or unsubstituted ethylenediamine. The L amino acids of ‘AA’ are selected from alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine. If the A′ group contains hydroxyl, it is linked to the hydroxyl group or amino group of the drug in the form of a carbonate or carbamate, respectively.
TABLE 1 |
Some Examples of multispecific antibodies. |
First | |
target | Second target |
MIF | A second proinflammatoiy effector cytokine, |
especially HMGB-1, TNF-α, IL-1, or IL-6 | |
MIF | Proinflammatory effector chemokine, especially |
MCP-1, RANTES, MIP-1A, or MIP-1B | |
MIF | Proinflammatory effector receptor, especially |
IL-6R, IL-13R, and IL-15R | |
MIF | Coagulation factor, especially TF or thrombin |
MIF | Complement factor, especially C3, C5, C3a, or C5a |
MIF | Complement regulatory protein, especially CD46, |
CD55, CD59, and mCRP | |
MIF | Cancer associated antigen or receptor |
HMGB-1 | A second proinflammatoiy effector cytokine, |
especially MIF, TNF-α, IL-1, or IL-6 | |
HMGB-1 | Proinflammatory effector chemokine, especially |
MCP-1, RANTES, MIP-1A, or MIP-1B | |
HMGB-1 | Proinflammatory effector receptor especially MCP-1, |
RANTES, MIP-1A, or MIP-1B | |
HMGB-1 | Coagulation factor, especially TF or thrombin |
HMGB-1 | Complement factor, especially C3, C5, C3a, or C5a |
HMGB-1 | Complement regulatory protein, especially CD46, CD55, |
CD59, and mCRP | |
HMGB-1 | Cancer associated antigen or receptor |
TNF-α | A second proinflammatoiy effector cytokine, especially |
MIF, HMGB-1, TNF-α, IL-1, or IL-6 | |
TNF-α | Proinflammatory effector chemokine, especially MCP-1, |
RANTES, MIP-1A, or MIP-1B | |
TNF-α | Proinflammatory effector receptor, especially IL-6R |
IL-13R, and IL-15R | |
TNF-α | Coagulation factor, especially TF or thrombin |
TNF-α | Complement factor, especially C3, C5, C3a, or C5a |
TNF-α | Complement regulatory protein, especially CD46, CD55, |
CD59, and mCRP | |
TNF-α | Cancer associated antigen or receptor |
LPS | Proinflammatory effector cytokine, especially MIF, |
HMGB-1, TNF-α, IL-1, or IL-6 | |
LPS | Proinflammatory effector chemokine, especially MCP-1, |
RANTES, MIP-1A, or MIP-1B | |
LPS | Proinflammatory effector receptor, especially IL-6R |
EL-13R, and EL-15R | |
LPS | Coagulation factor, especially TF or thrombin |
LPS | Complement factor, especially C3, C5, C3a, or C5a |
LPS | Complement regulatory protein, especially CD46, CD55, |
CD59, and mCRP | |
TF or | Proinflammatory effector cytokine, especially MIF, |
thrombin | HMGB-1, TNF-α, IL-1, or IL-6 |
TF or | Proinflammatory effector chemokine, especially MCP-1, |
thrombin | RANTES, MIP-1A, or MIP-1B |
TF or | Proinflammatory effector receptor, especially IL-6R |
thrombin | IL-13R, and IL-15R |
TF or | Complement factor, especially C3, C5, C3a, or C5a |
thrombin | |
TF or | Complement regulatory protein, especially CD46, CD55, |
thrombin | CD59, and mCRP |
TF or | Cancer associated antigen or receptor |
thrombin | |
DDD1 | |
(SEQ ID NO: 1) | |
SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA | |
DDD2 | |
(SEQ ID NO: 2) | |
CGHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA | |
AD1 | |
(SEQ ID NO: 3) | |
QIEYLAKQIVDNAIQQA | |
AD2 | |
(SEQ ID NO: 4) | |
CGQIEYLAKQIVDNAIQQAGC |
(SEQ ID NO: 1) | |
SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA |
AKAP-IS SEQUENCE | |
(SEQ ID NO: 3) | |
QIEYLAKQIVDNAIQQA |
SuperAKAP-IS | |
(SEQ ID NO: 5) | |
QIEYVAKQIVDYAIHQA | |
Alternative AKAP sequences | |
(SEQ ID NO: 6) | |
QIEYKAKQIVDHAIHQA | |
(SEQ ID NO: 7) | |
QIEYHAKQIVDHAIHQA | |
(SEQ ID NO: 8) | |
QIEYVAKQIVDHAIHQA |
Ht31 | |
(SEQ ID NO: 9) | |
DLIEEAASRIVDAVIEQVKAAGAY | |
RIAD | |
(SEQ ID NO: 10) | |
LEQYANQLADQIIKEATE | |
PV-38 | |
(SEQ ID NO: 11) | |
FEELAWKIAKMIWSDVFQQC |
AKAP-IS | |
(SEQ ID NO: 3) | |
QTEYLAKQIVDNAIQQA | |
AKAP7δ-wt-pep | |
(SEQ ID NO: 12) | |
PEDAELVALSKRLVENAVLKAVQQY | |
AKAP7δ-L304T-pep | |
(SEQ ID NO: 13) | |
PEDAELVRTSKRLVENAVLKAVQQY | |
AKAP7δ-L308D-pep | |
(SEQ ID NO: 14) | |
PEDAELVALSKRDVENAVLKAVQQY |
(SEQ ID NO : 1) | |
SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA |
TABLE 2 |
SN-38/MAb Molar substitution ratios (MSR) in some conjugates |
MAb | Conjugate | MSR | |
hMN-14 | hMN-14-[CL2A-SN-38 | 6.1 | |
drug-linker of Example 10 | |||
hMN-14-[CL6-SN-38], using | 6.8 | ||
drug-linker of Example 1 | |||
hMN-14-[CL7-SN-38], using | 5.9 | ||
drug-linker of Example 2 | |||
hMN-14-[CL7-SN-38-10-O—CO2Et], | 5.8 | ||
using drug-linker of Example 4 | |||
hMN-14-[CL2E-SN-38], using | 5.9 | ||
drug-linker of Example 11 | |||
hRS7 | hRS7-CL2A-SN-38 using | 5.8 | |
drug-linker of Example 10 | |||
hRS7-CL7-SN-38 using | 5.9 | ||
drug-linker of Example 2 | |||
hRS7-CL7-SN-38 (Et) using | 6.1 | ||
drug-linker of Example 4 | |||
hA20 | hA20-CL2A-SN-38 using | 5.8 | |
drug-linker of Example 10 | |||
hLL2 | hLL2-CL2A-SN-38 using | 5.7 | |
drug-linker of Example 10 | |||
hPAM4 | hPAM4-CL2A-SN-38 using | 5.9 | |
drug-linker of Example 10 | |||
Claims (16)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US16/218,384 USRE48751E1 (en) | 2002-12-13 | 2018-12-12 | Immunoconjugates with an intracellularly-cleavable linkage |
Applications Claiming Priority (13)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US43301702P | 2002-12-13 | 2002-12-13 | |
US10/734,589 US7585491B2 (en) | 2002-12-13 | 2003-12-15 | Immunoconjugates with an intracellularly-cleavable linkage |
US66860305P | 2005-04-06 | 2005-04-06 | |
US72829205P | 2005-10-19 | 2005-10-19 | |
US75119605P | 2005-12-16 | 2005-12-16 | |
US11/388,032 US8877901B2 (en) | 2002-12-13 | 2006-03-23 | Camptothecin-binding moiety conjugates |
US12/026,811 US7591994B2 (en) | 2002-12-13 | 2008-02-06 | Camptothecin-binding moiety conjugates |
US20789009P | 2009-02-13 | 2009-02-13 | |
US12/629,404 US7999083B2 (en) | 2002-12-13 | 2009-12-02 | Immunoconjugates with an intracellularly-cleavable linkage |
US13/164,275 US8080250B1 (en) | 2002-12-13 | 2011-06-20 | Immunoconjugates with an intracellularly-cleavable linkage |
US13/291,238 US8741300B2 (en) | 2002-12-13 | 2011-11-08 | Immunoconjugates with an intracellularly-cleavable linkage |
US13/705,756 US8759496B2 (en) | 2002-12-13 | 2012-12-05 | Immunoconjugates with an intracellularly-cleavable linkage |
US16/218,384 USRE48751E1 (en) | 2002-12-13 | 2018-12-12 | Immunoconjugates with an intracellularly-cleavable linkage |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/705,756 Reissue US8759496B2 (en) | 2002-12-13 | 2012-12-05 | Immunoconjugates with an intracellularly-cleavable linkage |
Publications (1)
Publication Number | Publication Date |
---|---|
USRE48751E1 true USRE48751E1 (en) | 2021-09-28 |
Family
ID=42562013
Family Applications (21)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/629,404 Active 2028-10-30 US7999083B2 (en) | 2002-02-26 | 2009-12-02 | Immunoconjugates with an intracellularly-cleavable linkage |
US13/164,275 Expired - Lifetime US8080250B1 (en) | 2002-03-01 | 2011-06-20 | Immunoconjugates with an intracellularly-cleavable linkage |
US13/291,238 Expired - Lifetime US8741300B2 (en) | 2002-03-01 | 2011-11-08 | Immunoconjugates with an intracellularly-cleavable linkage |
US13/705,756 Ceased US8759496B2 (en) | 2002-12-13 | 2012-12-05 | Immunoconjugates with an intracellularly-cleavable linkage |
US14/048,222 Active 2029-12-25 US9102735B2 (en) | 2009-02-13 | 2013-10-08 | Immunoconjugates with an intracellularly-cleavable linkage |
US14/258,228 Expired - Lifetime US9138485B2 (en) | 2002-03-01 | 2014-04-22 | Immunoconjugates with an intracellularly-cleavable linkage |
US14/294,651 Active US8999344B2 (en) | 2009-02-13 | 2014-06-03 | Immunoconjugates with an intracellularly-cleavable linkage |
US14/635,530 Active US9198978B2 (en) | 2009-02-13 | 2015-03-02 | Immunoconjugates with an intracellularly-cleavable linkage |
US14/636,790 Active US9345783B2 (en) | 2009-02-13 | 2015-03-03 | Immunoconjugates with an intracellularly-cleavable linkage |
US14/660,310 Expired - Lifetime US9233172B2 (en) | 2002-12-13 | 2015-03-17 | Immunoconjugates with an intracellularly-cleavable linkage |
US14/956,769 Expired - Lifetime US9700634B2 (en) | 2002-12-13 | 2015-12-02 | Immunoconjugates with an intracellularly-cleavable linkage |
US15/133,675 Active US9480756B2 (en) | 2009-02-13 | 2016-04-20 | Immunoconjugates with an intracellularly-cleavable linkage |
US15/267,910 Active US9675706B2 (en) | 2009-02-13 | 2016-09-16 | Immunoconjugates with an intracellularly-cleavable linkage |
US15/587,526 Active US10064957B2 (en) | 2009-02-13 | 2017-05-05 | Immunoconjugates with an intracellularly-cleavable linkage |
US15/612,672 Expired - Lifetime US10561738B2 (en) | 2002-12-13 | 2017-06-02 | Immunoconjugates with an intracellularly-cleavable linkage |
US16/045,400 Active US10265414B2 (en) | 2009-02-13 | 2018-07-25 | Immunoconjugates with an intracellularly-cleavable linkage |
US16/218,384 Expired - Lifetime USRE48751E1 (en) | 2002-12-13 | 2018-12-12 | Immunoconjugates with an intracellularly-cleavable linkage |
US16/276,173 Active US10322193B1 (en) | 2009-02-13 | 2019-02-14 | Immunoconjugates with an intracellularly-cleavable linkage |
US16/733,816 Expired - Lifetime US11077201B2 (en) | 2002-12-13 | 2020-01-03 | Immunoconjugates with an intracellularly-cleavable linkage |
US16/841,345 Expired - Lifetime US11020489B2 (en) | 2002-12-13 | 2020-04-06 | Immunoconjugates with an intracellularly-cleavable linkage |
US17/236,709 Abandoned US20210346511A1 (en) | 2002-12-13 | 2021-04-21 | Immunoconjugates with an intracellularly-cleavable linkage |
Family Applications Before (16)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/629,404 Active 2028-10-30 US7999083B2 (en) | 2002-02-26 | 2009-12-02 | Immunoconjugates with an intracellularly-cleavable linkage |
US13/164,275 Expired - Lifetime US8080250B1 (en) | 2002-03-01 | 2011-06-20 | Immunoconjugates with an intracellularly-cleavable linkage |
US13/291,238 Expired - Lifetime US8741300B2 (en) | 2002-03-01 | 2011-11-08 | Immunoconjugates with an intracellularly-cleavable linkage |
US13/705,756 Ceased US8759496B2 (en) | 2002-12-13 | 2012-12-05 | Immunoconjugates with an intracellularly-cleavable linkage |
US14/048,222 Active 2029-12-25 US9102735B2 (en) | 2009-02-13 | 2013-10-08 | Immunoconjugates with an intracellularly-cleavable linkage |
US14/258,228 Expired - Lifetime US9138485B2 (en) | 2002-03-01 | 2014-04-22 | Immunoconjugates with an intracellularly-cleavable linkage |
US14/294,651 Active US8999344B2 (en) | 2009-02-13 | 2014-06-03 | Immunoconjugates with an intracellularly-cleavable linkage |
US14/635,530 Active US9198978B2 (en) | 2009-02-13 | 2015-03-02 | Immunoconjugates with an intracellularly-cleavable linkage |
US14/636,790 Active US9345783B2 (en) | 2009-02-13 | 2015-03-03 | Immunoconjugates with an intracellularly-cleavable linkage |
US14/660,310 Expired - Lifetime US9233172B2 (en) | 2002-12-13 | 2015-03-17 | Immunoconjugates with an intracellularly-cleavable linkage |
US14/956,769 Expired - Lifetime US9700634B2 (en) | 2002-12-13 | 2015-12-02 | Immunoconjugates with an intracellularly-cleavable linkage |
US15/133,675 Active US9480756B2 (en) | 2009-02-13 | 2016-04-20 | Immunoconjugates with an intracellularly-cleavable linkage |
US15/267,910 Active US9675706B2 (en) | 2009-02-13 | 2016-09-16 | Immunoconjugates with an intracellularly-cleavable linkage |
US15/587,526 Active US10064957B2 (en) | 2009-02-13 | 2017-05-05 | Immunoconjugates with an intracellularly-cleavable linkage |
US15/612,672 Expired - Lifetime US10561738B2 (en) | 2002-12-13 | 2017-06-02 | Immunoconjugates with an intracellularly-cleavable linkage |
US16/045,400 Active US10265414B2 (en) | 2009-02-13 | 2018-07-25 | Immunoconjugates with an intracellularly-cleavable linkage |
Family Applications After (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/276,173 Active US10322193B1 (en) | 2009-02-13 | 2019-02-14 | Immunoconjugates with an intracellularly-cleavable linkage |
US16/733,816 Expired - Lifetime US11077201B2 (en) | 2002-12-13 | 2020-01-03 | Immunoconjugates with an intracellularly-cleavable linkage |
US16/841,345 Expired - Lifetime US11020489B2 (en) | 2002-12-13 | 2020-04-06 | Immunoconjugates with an intracellularly-cleavable linkage |
US17/236,709 Abandoned US20210346511A1 (en) | 2002-12-13 | 2021-04-21 | Immunoconjugates with an intracellularly-cleavable linkage |
Country Status (18)
Country | Link |
---|---|
US (21) | US7999083B2 (en) |
EP (6) | EP3243527B1 (en) |
CN (1) | CN102448494B (en) |
CA (2) | CA2749501C (en) |
CY (1) | CY1125700T1 (en) |
DK (3) | DK3903829T3 (en) |
ES (4) | ES2931923T3 (en) |
FI (2) | FI3903829T3 (en) |
FR (1) | FR22C1009I2 (en) |
HR (2) | HRP20230487T1 (en) |
HU (3) | HUE062339T2 (en) |
LT (3) | LT3912643T (en) |
NL (1) | NL301164I2 (en) |
PL (3) | PL3912643T3 (en) |
PT (2) | PT3912643T (en) |
SI (1) | SI3903829T1 (en) |
TR (1) | TR201910848T4 (en) |
WO (1) | WO2010093395A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20210346511A1 (en) * | 2002-12-13 | 2021-11-11 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
Families Citing this family (187)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7585491B2 (en) * | 2002-12-13 | 2009-09-08 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US8877901B2 (en) * | 2002-12-13 | 2014-11-04 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
US7591994B2 (en) | 2002-12-13 | 2009-09-22 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
US9770517B2 (en) | 2002-03-01 | 2017-09-26 | Immunomedics, Inc. | Anti-Trop-2 antibody-drug conjugates and uses thereof |
US8420086B2 (en) * | 2002-12-13 | 2013-04-16 | Immunomedics, Inc. | Camptothecin conjugates of anti-CD22 antibodies for treatment of B cell diseases |
CA2587143C (en) * | 2004-12-08 | 2017-12-05 | Immunomedics, Inc. | Methods and compositions for immunotherapy and detection of inflammatory and immune-dysregulatory disease, infectious disease, pathologic angiogenesis and cancer |
US9707302B2 (en) | 2013-07-23 | 2017-07-18 | Immunomedics, Inc. | Combining anti-HLA-DR or anti-Trop-2 antibodies with microtubule inhibitors, PARP inhibitors, bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
US10058621B2 (en) | 2015-06-25 | 2018-08-28 | Immunomedics, Inc. | Combination therapy with anti-HLA-DR antibodies and kinase inhibitors in hematopoietic cancers |
US8481041B2 (en) | 2005-04-06 | 2013-07-09 | Ibc Pharmaceuticals, Inc. | Dock-and-lock (DNL) constructs for human immunodeficiency virus (HIV) therapy |
US8475794B2 (en) | 2005-04-06 | 2013-07-02 | Ibc Pharmaceuticals, Inc. | Combination therapy with anti-CD74 antibodies provides enhanced toxicity to malignancies, Autoimmune disease and other diseases |
US20100226884A1 (en) * | 2009-01-20 | 2010-09-09 | Immunomedics, Inc. | Novel Class of Monospecific and Bispecific Humanized Antibodies that Target the Insulin-like Growth Factor Type I Receptor (IGF-1R) |
AU2011292178B8 (en) * | 2006-12-05 | 2016-01-21 | Ibc Pharmaceuticals, Inc. | Compositions and methods of use comprising combinations of anti-CD74 antibodies with a therapeutic agent. the therapeutic agent may be attached to the anti-CD74 antibody or may be separately administered, either before, simultaneously with or after the anti-CD74 antibody |
US8398956B2 (en) | 2007-01-11 | 2013-03-19 | Immunomedics, Inc. | In vivo copper-free click chemistry for delivery of therapeutic and/or diagnostic agents |
CA2749339A1 (en) | 2009-01-12 | 2010-07-15 | Cytomx Therapeutics, Llc | Modified antibody compositions, methods of making and using thereof |
US8535477B2 (en) | 2009-02-21 | 2013-09-17 | Sofradim Production | Medical devices incorporating functional adhesives |
AU2010215199B2 (en) | 2009-02-21 | 2015-01-15 | Sofradim Production | Compounds and medical devices activated with solvophobic linkers |
CA2753189A1 (en) | 2009-02-21 | 2010-08-26 | Nadya Belcheva | Medical devices having activated surfaces |
WO2010096649A1 (en) | 2009-02-21 | 2010-08-26 | Tyco Healthcare Group Lp | Medical devices having activated surfaces |
US9375699B2 (en) | 2009-02-21 | 2016-06-28 | Sofradim Production | Apparatus and method of reacting polymers by exposure to UV radiation to produce injectable medical devices |
US9523159B2 (en) | 2009-02-21 | 2016-12-20 | Covidien Lp | Crosslinked fibers and method of making same using UV radiation |
EP2398845B1 (en) | 2009-02-21 | 2017-12-13 | Sofradim Production | Amphiphilic compounds and self-assembling compositions made therefrom |
EP2398850B1 (en) | 2009-02-21 | 2018-08-22 | Sofradim Production | Medical devices with an activated coating |
US8648144B2 (en) | 2009-02-21 | 2014-02-11 | Sofradim Production | Crosslinked fibers and method of making same by extrusion |
WO2010095047A2 (en) | 2009-02-21 | 2010-08-26 | Sofradim Production | Apparatus and method of reacting polymers passing through metal ion chelated resin matrix to produce injectable medical devices |
US9272074B2 (en) | 2010-03-25 | 2016-03-01 | Sofradim Production | Surgical fasteners and methods for sealing wounds |
US8795331B2 (en) | 2010-03-25 | 2014-08-05 | Covidien Lp | Medical devices incorporating functional adhesives |
AU2011276443A1 (en) | 2010-06-29 | 2013-01-31 | Covidien Lp | Microwave-powered reactor and method for in situ forming implants |
AU2011273102A1 (en) | 2010-07-01 | 2013-01-31 | Sofradim Production | Medical device with predefined activated cellular integration |
AU2011284449B2 (en) | 2010-07-27 | 2015-07-23 | Sofradim Production | Polymeric fibers having tissue reactive members |
TW201302793A (en) | 2010-09-03 | 2013-01-16 | Glaxo Group Ltd | Novel antigen binding proteins |
EP2635300A4 (en) * | 2010-11-03 | 2014-04-02 | Ibc Pharmaceuticals Inc | Dock-and-lock (dnl) constructs for human immunodeficiency virus (hiv) therapy |
AU2011336396B2 (en) * | 2010-12-02 | 2016-02-04 | Immunomedics, Inc. | In vivo copper-free click chemistry for delivery of therapeutic and/or diagnostic agents |
CA2827170A1 (en) | 2011-02-11 | 2012-08-16 | David M. Hilbert | Monovalent and multivalent multispecific complexes and uses thereof |
EP2699596A4 (en) | 2011-04-22 | 2015-01-14 | Emergent Product Dev Seattle | Prostate-specific membrane antigen binding proteins and related compositions and methods |
US9150504B2 (en) * | 2011-04-29 | 2015-10-06 | Catabasis Pharmaceuticals, Inc. | Fatty acid guanidine and salicylate guanidine derivatives and their uses |
WO2012162561A2 (en) | 2011-05-24 | 2012-11-29 | Zyngenia, Inc. | Multivalent and monovalent multispecific complexes and their uses |
PT2714752T (en) * | 2011-05-27 | 2018-02-26 | Amicus Therapeutics Inc | Methods for coupling targeting peptides onto recombinant lysosomal enzymes for improved treatments of lysosomal storage diseases |
US9244074B2 (en) | 2011-06-07 | 2016-01-26 | University Of Hawaii | Biomarker of asbestos exposure and mesothelioma |
WO2012170742A2 (en) | 2011-06-07 | 2012-12-13 | University Of Hawaii | Treatment and prevention of cancer with hmgb1 antagonists |
US9757458B2 (en) | 2011-12-05 | 2017-09-12 | Immunomedics, Inc. | Crosslinking of CD22 by epratuzumab triggers BCR signaling and caspase-dependent apoptosis in hematopoietic cancer cells |
JP2015509091A (en) | 2012-01-09 | 2015-03-26 | ザ スクリプス リサーチ インスティテュート | Humanized antibody |
JP6684490B2 (en) | 2012-01-09 | 2020-04-22 | ザ・スクリップス・リサーチ・インスティテュート | Ultralong complementarity determining regions and uses thereof |
GB201202268D0 (en) * | 2012-02-09 | 2012-03-28 | Medical Res Council | Intracellular immunity |
US9504756B2 (en) | 2012-05-15 | 2016-11-29 | Seattle Genetics, Inc. | Self-stabilizing linker conjugates |
NZ630870A (en) * | 2012-05-15 | 2016-10-28 | Seattle Genetics Inc | Self-stabilizing linker conjugates |
US9382329B2 (en) | 2012-08-14 | 2016-07-05 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to Trop-2 expressing cells |
KR101974583B1 (en) | 2012-08-29 | 2019-05-02 | 삼성전자주식회사 | Linker polypeptides and metod for analyzing target material using the same |
CN115960111A (en) | 2012-10-11 | 2023-04-14 | 第一三共株式会社 | Antibody-drug conjugates |
JP6272230B2 (en) | 2012-10-19 | 2018-01-31 | 第一三共株式会社 | Antibody-drug conjugate conjugated with a linker containing a hydrophilic structure |
AU2012395148B2 (en) | 2012-11-24 | 2016-10-27 | Hangzhou Dac Biotech Co., Ltd. | Hydrophilic linkers and their uses for conjugation of drugs to cell binding molecules |
US10413539B2 (en) | 2012-12-13 | 2019-09-17 | Immunomedics, Inc. | Therapy for metastatic urothelial cancer with the antibody-drug conjugate, sacituzumab govitecan (IMMU-132) |
WO2014092804A1 (en) | 2012-12-13 | 2014-06-19 | Immunomedics, Inc. | Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity |
US10137196B2 (en) | 2012-12-13 | 2018-11-27 | Immunomedics, Inc. | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
ES2819573T3 (en) | 2012-12-13 | 2021-04-16 | Immunomedics Inc | Method for Producing Antibody-SN-38 Immunoconjugates with a CL2A Linker |
US9492566B2 (en) * | 2012-12-13 | 2016-11-15 | Immunomedics, Inc. | Antibody-drug conjugates and uses thereof |
US10744129B2 (en) | 2012-12-13 | 2020-08-18 | Immunomedics, Inc. | Therapy of small-cell lung cancer (SCLC) with a topoisomerase-I inhibiting antibody-drug conjugate (ADC) targeting Trop-2 |
US10206918B2 (en) * | 2012-12-13 | 2019-02-19 | Immunomedics, Inc. | Efficacy of anti-HLA-DR antiboddy drug conjugate IMMU-140 (hL243-CL2A-SN-38) in HLA-DR positive cancers |
US9931417B2 (en) | 2012-12-13 | 2018-04-03 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
WO2014110368A1 (en) * | 2013-01-11 | 2014-07-17 | The California Institute For Biomedical Research | Bovine fusion antibodies |
DK3611180T3 (en) | 2013-03-15 | 2022-02-28 | Biomolecular Holdings Llc | HYBRID IMMUNOGLOBULIN CONTAINING NON-PEPTIDYL BINDING |
US9775928B2 (en) | 2013-06-18 | 2017-10-03 | Covidien Lp | Adhesive barbed filament |
AU2014290361B2 (en) | 2013-07-18 | 2019-04-18 | Taurus Biosciences, Llc | Humanized antibodies with ultralong complementarity determining regions |
EP3024460B1 (en) * | 2013-07-23 | 2020-07-22 | Immunomedics, Inc. | Method for producing antibody-sn-38 immunoconjugates with a cl2a linker |
US11253606B2 (en) | 2013-07-23 | 2022-02-22 | Immunomedics, Inc. | Combining anti-HLA-DR or anti-Trop-2 antibodies with microtubule inhibitors, PARP inhibitors, Bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
EP3406633B1 (en) | 2013-07-25 | 2022-03-02 | Cytomx Therapeutics Inc. | Multispecific antibodies, multispecific activatable antibodies and methods of using the same |
JP6736464B2 (en) * | 2013-08-29 | 2020-08-05 | シティ・オブ・ホープCity of Hope | Cell-permeable conjugates and methods of use thereof |
CA2920192A1 (en) * | 2013-09-27 | 2015-04-02 | Immunomedics, Inc. | Anti-trop-2 antibody-drug conjugates and uses thereof |
EP3456700A1 (en) | 2013-10-18 | 2019-03-20 | Deutsches Krebsforschungszentrum | Labeled inhibitors of prostate specific membrane antigen (psma), their use as imaging agents and pharmaceutical agents for the treatment of prostate cancer |
US20150125386A1 (en) * | 2013-11-05 | 2015-05-07 | Immunomedics, Inc. | Humanized anti-ceacam5 antibody and uses thereof |
EP3088419B1 (en) | 2013-12-25 | 2018-10-10 | Daiichi Sankyo Company, Limited | Anti-trop2 antibody-drug conjugate |
KR102362920B1 (en) | 2014-01-31 | 2022-02-14 | 다이이찌 산쿄 가부시키가이샤 | Anti-her2 antibody-drug conjugate |
US9119832B2 (en) | 2014-02-05 | 2015-09-01 | The Regents Of The University Of California | Methods of treating mild brain injury |
CA2937236C (en) | 2014-02-21 | 2023-03-07 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to trop-2 expressing cells |
WO2015130416A1 (en) | 2014-02-25 | 2015-09-03 | Immunomedics, Inc. | Humanized rfb4 anti-cd22 antibody |
FI3122757T3 (en) | 2014-02-28 | 2023-10-10 | Hangzhou Dac Biotech Co Ltd | Charged linkers and their uses for conjugation |
WO2015138638A1 (en) | 2014-03-11 | 2015-09-17 | Theraly Pharmaceuticals, Inc. | Long acting trail receptor agonists for treatment of autoimmune diseases |
LT3116486T (en) * | 2014-03-14 | 2020-04-10 | Biomolecular Holdings Llc | Hybrid immunoglobulin containing non-peptidyl linkage |
EP3125866B1 (en) * | 2014-04-04 | 2021-03-03 | President and Fellows of Harvard College | Refillable drug delivery devices and methods of use thereof |
RU2722788C2 (en) | 2014-04-07 | 2020-06-03 | Чугаи Сейяку Кабусики Кайся | Immunoactivating antigen-binding molecule |
TWI745021B (en) | 2014-04-10 | 2021-11-01 | 日商第一三共股份有限公司 | Method for producting anti-her3 antibody drug conjugate |
ES2754348T3 (en) | 2014-04-10 | 2020-04-17 | Daiichi Sankyo Co Ltd | Conjugate of (anti-HER2 antibody) -pharmaceutical |
CA2947157A1 (en) | 2014-05-13 | 2015-11-19 | Chugai Seiyaku Kabushiki Kaisha | T cell-redirected antigen-binding molecule for cells having immunosuppression function |
GB201412658D0 (en) | 2014-07-16 | 2014-08-27 | Ucb Biopharma Sprl | Molecules |
WO2016014974A2 (en) | 2014-07-25 | 2016-01-28 | Cytomx Therapeutics, Inc. | Anti-cd3 antibodies, activatable anti-cd3 antibodies, multispecific anti-cd3 antibodies, multispecific activatable anti-cd3 antibodies, and methods of using the same |
GB201416960D0 (en) | 2014-09-25 | 2014-11-12 | Antikor Biopharma Ltd | Biological materials and uses thereof |
TWI591075B (en) * | 2015-01-16 | 2017-07-11 | 中央研究院 | Peptide core-based multi-arm linkers |
CN107531778A (en) * | 2015-02-06 | 2018-01-02 | 赛尔伊迪克斯公司 | The immunoreagent of antigen coupling |
EP3865139B1 (en) | 2015-02-18 | 2023-05-03 | Enlivex Therapeutics Rdo Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
US11596652B2 (en) | 2015-02-18 | 2023-03-07 | Enlivex Therapeutics R&D Ltd | Early apoptotic cells for use in treating sepsis |
US11497767B2 (en) | 2015-02-18 | 2022-11-15 | Enlivex Therapeutics R&D Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
US11000548B2 (en) | 2015-02-18 | 2021-05-11 | Enlivex Therapeutics Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
US11318163B2 (en) | 2015-02-18 | 2022-05-03 | Enlivex Therapeutics Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
US11304976B2 (en) | 2015-02-18 | 2022-04-19 | Enlivex Therapeutics Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
CA3016686A1 (en) * | 2015-03-09 | 2016-09-15 | Oxeia Biopharmaceuticals, Inc. | Methods of treating cognitive impairments or dysfunction |
JP6869187B2 (en) | 2015-04-07 | 2021-05-12 | メモリアル スローン ケタリング キャンサー センター | Nanoparticle immunoconjugate |
WO2016172214A1 (en) | 2015-04-20 | 2016-10-27 | Tolero Pharmaceuticals, Inc. | Predicting response to alvocidib by mitochondrial profiling |
AU2016250570B2 (en) | 2015-04-21 | 2021-07-01 | Enlivex Therapeutics Rdo Ltd | Therapeutic pooled blood apoptotic cell preparations and uses thereof |
EP3286224A4 (en) * | 2015-04-22 | 2018-11-14 | Immunomedics, Inc. | Isolation, detection, diagnosis and/or characterization of circulating trop-2-positive cancer cells |
KR102608921B1 (en) | 2015-05-18 | 2023-12-01 | 스미토모 파마 온콜로지, 인크. | Albocidip prodrug with increased bioavailability |
US20160340427A1 (en) * | 2015-05-20 | 2016-11-24 | Immunwork Inc. | Molecular constructs for treating infectious diseases |
US10751412B2 (en) | 2015-05-29 | 2020-08-25 | Merck Sharp & Dohme Corp. | Combination of a PD-1 antagonist and CPG-C type oligonucleotide for treating cancer |
CA2983597A1 (en) | 2015-06-25 | 2016-12-29 | Immunomedics, Inc. | Combining anti-hla-dr or anti-trop-2 antibodies with microtubule inhibitors, parp inhibitors, bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
US10195175B2 (en) | 2015-06-25 | 2019-02-05 | Immunomedics, Inc. | Synergistic effect of anti-Trop-2 antibody-drug conjugate in combination therapy for triple-negative breast cancer when used with microtubule inhibitors or PARP inhibitors |
US11173213B2 (en) | 2015-06-29 | 2021-11-16 | Daiichi Sankyo Company, Limited | Method for selectively manufacturing antibody-drug conjugate |
EP3316885B1 (en) * | 2015-07-01 | 2021-06-23 | Immunomedics, Inc. | Antibody-sn-38 immunoconjugates with a cl2a linker |
GB201601073D0 (en) | 2016-01-20 | 2016-03-02 | Ucb Biopharma Sprl | Antibodies |
GB201601075D0 (en) | 2016-01-20 | 2016-03-02 | Ucb Biopharma Sprl | Antibodies molecules |
CN106344930B (en) * | 2015-07-16 | 2021-08-17 | 亚飞(上海)生物医药科技有限公司 | Preparation and application of molecular site-specific targeting and activating short peptide adriamycin |
GB201601077D0 (en) | 2016-01-20 | 2016-03-02 | Ucb Biopharma Sprl | Antibody molecule |
KR20180034538A (en) | 2015-08-03 | 2018-04-04 | 톨레로 파마수티컬스, 인크. | Concurrent therapy for the treatment of cancer |
CN108135968A (en) | 2015-08-28 | 2018-06-08 | 阿穆尼克斯运营公司 | Chimeric polyeptides assembly and its preparation and application |
US9623118B2 (en) * | 2015-09-01 | 2017-04-18 | Immunwork Inc. | Multi-arm linker constructs for treating pathological blood clots |
CA2998740A1 (en) * | 2015-09-17 | 2017-03-23 | The Scripps Research Institute | Dual variable domain immunoconjugates and uses thereof |
UA126278C2 (en) | 2015-09-21 | 2022-09-14 | Аптево Рісьорч Енд Девелопмент Ллс | Cd3 binding polypeptides |
EP3378488A4 (en) | 2015-11-18 | 2019-10-30 | Chugai Seiyaku Kabushiki Kaisha | Method for enhancing humoral immune response |
WO2017086367A1 (en) | 2015-11-18 | 2017-05-26 | 中外製薬株式会社 | Combination therapy using t cell redirection antigen binding molecule against cell having immunosuppressing function |
PT3387019T (en) | 2015-12-09 | 2022-01-14 | Scripps Research Inst | Relaxin immunoglobulin fusion proteins and methods of use |
CA3008392C (en) | 2015-12-17 | 2021-11-09 | The Johns Hopkins University | Ameliorating systemic sclerosis with death receptor agonists |
CN108601841A (en) | 2016-02-10 | 2018-09-28 | 免疫医疗公司 | The combination of ABCG2 inhibitor and SACITUZUMAB GOVITECAN (IMMU-132) overcome the resistance to SN-38 in the cancer for expressing TROP-2 |
AU2017219415B2 (en) | 2016-02-18 | 2023-08-10 | Enlivex Therapeutics Rdo Ltd | Combination immune therapy and cytokine control therapy for cancer treatment |
US11786603B2 (en) | 2016-02-26 | 2023-10-17 | Regeneron Pharmaceuticals, Inc. | Optimized transglutaminase site-specific antibody conjugation |
EA201892260A1 (en) | 2016-04-07 | 2019-03-29 | Дзе Джонс Хопкинс Юниверсити | COMPOSITIONS AND METHODS FOR THE TREATMENT OF PANCREATITIS AND PAIN WITH THE APPLICATION OF THE AGONISTS OF THE DEATH RECEPTOR |
BR112018071105A2 (en) | 2016-04-15 | 2019-02-26 | Macrogenics, Inc. | drug and antibody conjugate, binding molecule, pharmaceutical composition and use |
RU2725292C2 (en) | 2016-04-27 | 2020-06-30 | Иммьюномедикс, Инк. | Efficacy of conjugates of anti-trop-2 antibody with drug sn-38 for therapy of recurrent/refractory to inhibitors of tumor control point |
SG11201900699QA (en) | 2016-08-09 | 2019-02-27 | Seattle Genetics Inc | Drug conjugates with self-stabilizing linkers having improved physiochemical properties |
MX2019004434A (en) | 2016-10-17 | 2019-09-26 | Pfizer | Anti-edb antibodies and antibody-drug conjugates. |
CN108066772B (en) * | 2016-11-14 | 2021-07-13 | 中国科学院上海药物研究所 | Antibody and Drug Conjugate (ADC) molecules targeting TACTD 2 |
US11279694B2 (en) | 2016-11-18 | 2022-03-22 | Sumitomo Dainippon Pharma Oncology, Inc. | Alvocidib prodrugs and their use as protein kinase inhibitors |
EP3552626A4 (en) | 2016-12-12 | 2020-06-10 | Daiichi Sankyo Company, Limited | Combination of antibody-drug conjugate and immune checkpoint inhibitor |
US10132797B2 (en) | 2016-12-19 | 2018-11-20 | Tolero Pharmaceuticals, Inc. | Profiling peptides and methods for sensitivity profiling |
CN110382535A (en) | 2017-01-17 | 2019-10-25 | 第一三共株式会社 | Anti- GPR20 antibody and anti-GPR20 antibody-drug conjugates |
JP7181181B2 (en) | 2017-02-28 | 2022-11-30 | 第一三共株式会社 | Method for treating EGFR-TKI-resistant non-small cell lung cancer by administration of anti-HER3 antibody-drug conjugate |
CN108727208B (en) * | 2017-03-07 | 2020-06-30 | 天津键凯科技有限公司 | Linker compound, polyethylene glycol-linker conjugate and derivative thereof, and polyethylene glycol-linker-drug conjugate |
CA3050332A1 (en) | 2017-03-27 | 2018-10-04 | Immunomedics, Inc. | Treatment of trop-2 expressing triple negative breast cancer with sacituzumab govitecan and a rad51 inhibitor |
EP3606964A4 (en) * | 2017-04-03 | 2020-12-09 | Immunomedics, Inc. | Subcutaneous administration of antibody-drug conjugates for cancer therapy |
KR101957563B1 (en) | 2017-04-07 | 2019-03-12 | 영남대학교 산학협력단 | Device for manufacturing nano graphene oxide, nanocomposite comprising the same and manufacturing device thereof |
TWI794230B (en) | 2017-05-15 | 2023-03-01 | 日商第一三共股份有限公司 | Anti cdh6 antibodies and anti cdh6 antibody drug conjugates, as well as manufacturing method thereof |
CN111094330A (en) | 2017-07-03 | 2020-05-01 | 转矩医疗股份有限公司 | Polynucleotides encoding immunostimulatory fusion molecules and uses thereof |
CN109106951A (en) * | 2017-08-18 | 2019-01-01 | 四川百利药业有限责任公司 | A kind of camptothecine-antibody coupling matter |
CN109125736B (en) * | 2017-08-18 | 2022-01-04 | 四川百利药业有限责任公司 | Non-natural amatoxin antibody conjugate |
BR112020003646A2 (en) | 2017-08-31 | 2020-09-01 | Daiichi Sankyo Company, Limited | crystals, methods for producing crystals and an antibody-drug conjugate, and, salt. |
SG11202001514XA (en) | 2017-08-31 | 2020-03-30 | Daiichi Sankyo Co Ltd | Novel method for producing antibody-drug conjugate |
US11497756B2 (en) | 2017-09-12 | 2022-11-15 | Sumitomo Pharma Oncology, Inc. | Treatment regimen for cancers that are insensitive to BCL-2 inhibitors using the MCL-1 inhibitor alvocidib |
CN111148758B (en) * | 2017-09-29 | 2022-12-09 | 瑞泽恩制药公司 | Bispecific antigen binding molecules that bind to staphylococcal target antigens and complement components and uses thereof |
CN109589415B (en) | 2017-09-30 | 2022-02-18 | 天津键凯科技有限公司 | Conjugate of polyethylene glycol-polypeptide and protein medicine |
CN114668852A (en) * | 2017-09-30 | 2022-06-28 | 天津键凯科技有限公司 | Conjugate of polyethylene glycol-polypeptide and protein drugs |
WO2019154120A1 (en) * | 2018-02-11 | 2019-08-15 | 四川科伦博泰生物医药股份有限公司 | Cytotoxic agent and conjugate thereof, preparation method therefor and use thereof |
TWI808169B (en) | 2018-04-30 | 2023-07-11 | 美商阿米庫斯醫療股份有限公司 | Gene therapy constructs and methods of use |
EP4249002A3 (en) | 2018-05-18 | 2023-11-22 | Daiichi Sankyo Co., Ltd. | Anti-muc1- exatecan antibody-drug conjugate |
TW202016317A (en) | 2018-08-23 | 2020-05-01 | 日商第一三共股份有限公司 | Susceptibility markers for antibody-drug conjugates |
CN112912109A (en) | 2018-09-20 | 2021-06-04 | 第一三共株式会社 | Treatment of HER 3-mutated cancer by administration of anti-HER 3 antibody-drug conjugates |
AR116624A1 (en) | 2018-10-10 | 2021-05-26 | Amicus Therapeutics Inc | COMPOSITIONS OF POLYPEPTIDES STABILIZED BY DISULFIDE LINKS AND METHODS OF USE |
EP3890749A4 (en) | 2018-12-04 | 2022-08-03 | Sumitomo Dainippon Pharma Oncology, Inc. | Cdk9 inhibitors and polymorphs thereof for use as agents for treatment of cancer |
JP2022518771A (en) * | 2019-01-22 | 2022-03-16 | ザ ブリガム アンド ウィメンズ ホスピタル インコーポレイテッド | Antigen presentation neutrophil-derived dendritic cells and how to use them |
JP2022525149A (en) | 2019-03-20 | 2022-05-11 | スミトモ ダイニッポン ファーマ オンコロジー, インコーポレイテッド | Treatment of Acute Myeloid Leukemia (AML) with Venetoclax Failure |
WO2020191342A1 (en) | 2019-03-20 | 2020-09-24 | The Regents Of The University Of California | Claudin-6 antibodies and drug conjugates |
SG11202112429PA (en) | 2019-05-29 | 2021-12-30 | Daiichi Sankyo Co Ltd | Dosage of an antibody-drug conjugate |
CN114341141A (en) | 2019-07-11 | 2022-04-12 | 太阳医药高级研究有限公司 | Camptothecin derivatives having a disulfide moiety and a piperazine moiety |
CA3176095A1 (en) | 2020-03-20 | 2021-09-23 | Immunomedics, Inc. | Biomarkers for sacituzumab govitecan therapy |
WO2021226440A1 (en) | 2020-05-08 | 2021-11-11 | Bolt Biotherapeutics, Inc. | Elastase-substrate, peptide linker immunoconjugates, and uses thereof |
US11767353B2 (en) | 2020-06-05 | 2023-09-26 | Theraly Fibrosis, Inc. | Trail compositions with reduced immunogenicity |
CN115515644A (en) * | 2020-06-28 | 2022-12-23 | 昆山新蕴达生物科技有限公司 | Antibody-drug conjugate, preparation method and application thereof |
JPWO2022014698A1 (en) | 2020-07-17 | 2022-01-20 | ||
EP4196168A1 (en) | 2020-08-13 | 2023-06-21 | Bolt Biotherapeutics, Inc. | Pyrazoloazepine immunoconjugates, and uses thereof |
EP4313162A1 (en) | 2021-03-26 | 2024-02-07 | Bolt Biotherapeutics, Inc. | 2-amino-4-carboxamide-benzazepine immunoconjugates, and uses thereof |
EP4313161A1 (en) | 2021-03-26 | 2024-02-07 | Bolt Biotherapeutics, Inc. | 2-amino-4-carboxamide-benzazepine immunoconjugates, and uses thereof |
EP4319820A1 (en) | 2021-04-10 | 2024-02-14 | Profoundbio Us Co. | Folr1 binding agents, conjugates thereof and methods of using the same |
CN117203238A (en) | 2021-04-23 | 2023-12-08 | 普方生物制药美国公司 | CD70 binding agents, conjugates thereof, and methods of use thereof |
US20220389394A1 (en) | 2021-05-18 | 2022-12-08 | Gilead Sciences, Inc. | METHODS OF USING FLT3L-Fc FUSION PROTEINS |
AU2022290855A1 (en) | 2021-06-11 | 2023-12-07 | Gilead Sciences, Inc. | Combination mcl-1 inhibitors with anti-body drug conjugates |
EP4351564A1 (en) | 2021-06-11 | 2024-04-17 | Gilead Sciences, Inc. | Combination mcl-1 inhibitors with anti-cancer agents |
US20230183216A1 (en) | 2021-10-28 | 2023-06-15 | Gilead Sciences, Inc. | Pyridizin-3(2h)-one derivatives |
US11919869B2 (en) | 2021-10-29 | 2024-03-05 | Gilead Sciences, Inc. | CD73 compounds |
WO2023076599A1 (en) | 2021-10-29 | 2023-05-04 | Bolt Biotherapeutics, Inc. | Tlr agonist immunoconjugates with cysteine-mutant antibodies, and uses thereof |
WO2023078230A1 (en) | 2021-11-02 | 2023-05-11 | 烟台迈百瑞国际生物医药股份有限公司 | Antibody-drug conjugate intermediate comprising sn38 and preparation method therefor |
WO2023092099A1 (en) | 2021-11-19 | 2023-05-25 | Ardeagen Corporation | Gpc3 binding agents, conjugates thereof and methods of using the same |
WO2023122581A2 (en) | 2021-12-22 | 2023-06-29 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
WO2023122615A1 (en) | 2021-12-22 | 2023-06-29 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
CN115594766A (en) * | 2021-12-30 | 2023-01-13 | 辽宁键凯科技有限公司(Cn) | Conjugate and antibody coupling drug prepared from same |
TW202340168A (en) | 2022-01-28 | 2023-10-16 | 美商基利科學股份有限公司 | Parp7 inhibitors |
WO2023151679A1 (en) * | 2022-02-11 | 2023-08-17 | Shenzhen Enduring Biotech , Ltd. | Pegylated antibody hydroxyl-bearing drug conjugate |
US20230373950A1 (en) | 2022-03-17 | 2023-11-23 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
US20230355796A1 (en) | 2022-03-24 | 2023-11-09 | Gilead Sciences, Inc. | Combination therapy for treating trop-2 expressing cancers |
WO2023201267A1 (en) | 2022-04-13 | 2023-10-19 | Gilead Sciences, Inc. | Combination therapy for treating trop-2 expressing cancers |
WO2023201268A1 (en) | 2022-04-13 | 2023-10-19 | Gilead Sciences, Inc. | Combination therapy for treating tumor antigen expressing cancers |
TW202400138A (en) | 2022-04-21 | 2024-01-01 | 美商基利科學股份有限公司 | Kras g12d modulating compounds |
WO2024006929A1 (en) | 2022-07-01 | 2024-01-04 | Gilead Sciences, Inc. | Cd73 compounds |
Citations (35)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4359457A (en) | 1980-09-30 | 1982-11-16 | Neville Jr David M | Anti Thy 1.2 monoclonal antibody-ricin hybrid utilized as a tumor suppressant |
EP0253202A2 (en) | 1986-06-30 | 1988-01-20 | Oncogen | Novel immunoconjugates and methods for their use in tumor therapy |
EP0306943A2 (en) | 1987-09-10 | 1989-03-15 | Neorx Corporation | Immunconjugates joined by thioether bonds having reduced toxicity and improved selectivity |
US5112954A (en) | 1988-02-26 | 1992-05-12 | Neorx Corporation | Method of enhancing the effect of cytotoxic agents |
US5708146A (en) | 1992-01-23 | 1998-01-13 | Bristol-Myers Squibb Company | Thioether conjugates |
US5824701A (en) | 1993-10-20 | 1998-10-20 | Enzon, Inc. | Taxane-based prodrugs |
US6156754A (en) | 1996-09-30 | 2000-12-05 | Bayer Aktiengesellschaft | Glycoconjugates of modified camptothecin derivatives (A-or B-ring linkage) |
WO2000076551A2 (en) | 1999-06-09 | 2000-12-21 | Ktb Tumorforschungs Gmbh | Method for producing an injectable medicament preparation |
US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
WO2001024763A2 (en) | 1999-10-01 | 2001-04-12 | Immunogen, Inc. | Compositions and methods for treating cancer using immunoconjugates and chemotherapeutic agents |
US20010034363A1 (en) | 1996-03-12 | 2001-10-25 | Chun Li | Water soluble paclitaxel derivatives |
US6310261B1 (en) | 1998-01-16 | 2001-10-30 | Basf Aktiengesellschaft | Method for the production of aldehydes |
JP2002212121A (en) | 2001-01-18 | 2002-07-31 | Takasago Internatl Corp | Method for producing isopulegol |
US20030133972A1 (en) | 2000-10-11 | 2003-07-17 | Targesome, Inc. | Targeted multivalent macromolecules |
US20040001838A1 (en) | 2001-12-21 | 2004-01-01 | Immunogen, Inc. | Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same |
WO2004054622A1 (en) | 2002-12-13 | 2004-07-01 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US20060074265A1 (en) | 2004-09-24 | 2006-04-06 | Julian Vaughan-Spickers | Asymmetric catalytic systems |
US20060142506A1 (en) | 2004-10-25 | 2006-06-29 | Kurt Breitenkamp | Heterobifunctional poly(ethylene glycol) and uses thereof |
US7122636B1 (en) | 1997-02-21 | 2006-10-17 | Genentech, Inc. | Antibody fragment-polymer conjugates and uses of same |
WO2007018431A2 (en) | 2005-08-05 | 2007-02-15 | Syntarga B.V. | Triazole-containing releasable linkers and conjugates comprising the same |
WO2007038658A2 (en) | 2005-09-26 | 2007-04-05 | Medarex, Inc. | Antibody-drug conjugates and methods of use |
US7238785B2 (en) | 2002-03-01 | 2007-07-03 | Immunomedics, Inc. | RS7 antibodies |
US7312318B2 (en) | 2002-03-01 | 2007-12-25 | Immunomedics, Inc. | Internalizing anti-CD74 antibodies and methods of use |
JP2008524287A (en) | 2004-12-22 | 2008-07-10 | ビーエーエスエフ ソシエタス・ヨーロピア | Preparation method of isopulegol |
US20080166363A1 (en) | 2002-12-13 | 2008-07-10 | Immunomedics, Inc. | Camptothecin-Binding Moiety Conjugates |
US7999083B2 (en) * | 2002-12-13 | 2011-08-16 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US20140170063A1 (en) | 2012-12-13 | 2014-06-19 | Immunomedics, Inc. | Dosages of Immunoconjugates of Antibodies and SN-38 for Improved Efficacy and Decreased Toxicity |
US8877901B2 (en) | 2002-12-13 | 2014-11-04 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
US20150132217A1 (en) | 2012-08-14 | 2015-05-14 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to trop-2 expressing cells |
US9107960B2 (en) * | 2012-12-13 | 2015-08-18 | Immunimedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
US9492566B2 (en) * | 2012-12-13 | 2016-11-15 | Immunomedics, Inc. | Antibody-drug conjugates and uses thereof |
US9707302B2 (en) * | 2013-07-23 | 2017-07-18 | Immunomedics, Inc. | Combining anti-HLA-DR or anti-Trop-2 antibodies with microtubule inhibitors, PARP inhibitors, bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
US9931417B2 (en) * | 2012-12-13 | 2018-04-03 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
US10058621B2 (en) * | 2015-06-25 | 2018-08-28 | Immunomedics, Inc. | Combination therapy with anti-HLA-DR antibodies and kinase inhibitors in hematopoietic cancers |
US10266605B2 (en) * | 2016-04-27 | 2019-04-23 | Immunomedics, Inc. | Efficacy of anti-trop-2-SN-38 antibody drug conjugates for therapy of tumors relapsed/refractory to checkpoint inhibitors |
Family Cites Families (238)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US672015A (en) | 1900-10-05 | 1901-04-16 | Alfred Schlatter | Automatic switch for groups of transformers. |
US2676403A (en) | 1951-10-10 | 1954-04-27 | Gray Rosa | Hand-held motor-driven shear |
US3927193A (en) | 1973-05-18 | 1975-12-16 | Hoffmann La Roche | Localization of tumors by radiolabelled antibodies |
US4036945A (en) | 1976-05-03 | 1977-07-19 | The Massachusetts General Hospital | Composition and method for determining the size and location of myocardial infarcts |
US4303004A (en) | 1978-05-31 | 1981-12-01 | Karl Eickmann | Snap ring assembly for two bodies |
US4331647A (en) | 1980-03-03 | 1982-05-25 | Goldenberg Milton David | Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers |
US4348376A (en) | 1980-03-03 | 1982-09-07 | Goldenberg Milton David | Tumor localization and therapy with labeled anti-CEA antibody |
US4444744A (en) | 1980-03-03 | 1984-04-24 | Goldenberg Milton David | Tumor localization and therapy with labeled antibodies to cell surface antigens |
US4361544A (en) | 1980-03-03 | 1982-11-30 | Goldenberg Milton David | Tumor localization and therapy with labeled antibodies specific to intracellular tumor-associated markers |
US4554101A (en) | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
US4468457A (en) | 1981-06-01 | 1984-08-28 | David M. Goldenberg | Method for producing a CSAp tryptic peptide and anti-CSAp antibodies |
US4818709A (en) | 1983-01-21 | 1989-04-04 | Primus Frederick J | CEA-family antigens, Anti-CEA antibodies and CEA immunoassay |
US4624846A (en) | 1983-07-29 | 1986-11-25 | Immunomedics, Inc. | Method for enhancing target specificity of antibody localization and clearance of non-target diagnostic and therapeutic principles |
US4824659A (en) | 1985-06-07 | 1989-04-25 | Immunomedics, Inc. | Antibody conjugates |
US5525338A (en) | 1992-08-21 | 1996-06-11 | Immunomedics, Inc. | Detection and therapy of lesions with biotin/avidin conjugates |
US5776093A (en) | 1985-07-05 | 1998-07-07 | Immunomedics, Inc. | Method for imaging and treating organs and tissues |
US4699784A (en) | 1986-02-25 | 1987-10-13 | Center For Molecular Medicine & Immunology | Tumoricidal methotrexate-antibody conjugate |
US6861511B1 (en) | 1986-06-04 | 2005-03-01 | Bayer Corporation | Detection and quantification of neu related proteins in the biological fluids of humans |
US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
US6893625B1 (en) | 1986-10-27 | 2005-05-17 | Royalty Pharma Finance Trust | Chimeric antibody with specificity to human B cell surface antigen |
IL85035A0 (en) | 1987-01-08 | 1988-06-30 | Int Genetic Eng | Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same |
US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
US4943579A (en) | 1987-10-06 | 1990-07-24 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Water soluble prodrugs of camptothecin |
US5831034A (en) | 1987-11-13 | 1998-11-03 | Hermann Katinger | Human monoclonal anti-HIV-I-antibodies |
US6511665B1 (en) | 1987-11-25 | 2003-01-28 | Immunex Corporation | Antibodies to interleukin-1 receptors |
US5120525A (en) | 1988-03-29 | 1992-06-09 | Immunomedics, Inc. | Radiolabeled antibody cytotoxic therapy of cancer |
US5612016A (en) | 1988-04-01 | 1997-03-18 | Immunomedics, Inc. | Conjugates of antibodies and bifunctional ligands |
US5541297A (en) | 1988-04-01 | 1996-07-30 | Immunomedics, Inc. | Therapeutic conjugates of toxins and drugs |
US20030068322A1 (en) | 1988-04-18 | 2003-04-10 | Immunomedics, Inc. | Methods of antibody-directed enzyme-prodrug therapy |
US5439665A (en) | 1988-07-29 | 1995-08-08 | Immunomedics | Detection and treatment of infectious and inflammatory lesions |
US4925648A (en) | 1988-07-29 | 1990-05-15 | Immunomedics, Inc. | Detection and treatment of infectious and inflammatory lesions |
US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
US6362325B1 (en) | 1988-11-07 | 2002-03-26 | Advanced Research And Technology Institute, Inc. | Murine 4-1BB gene |
US6352694B1 (en) | 1994-06-03 | 2002-03-05 | Genetics Institute, Inc. | Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells |
US5571714A (en) | 1988-12-22 | 1996-11-05 | Celtrix Pharmaceuticals, Inc. | Monoclonal antibodies which bind both transforming growth factors β1 and β2 and methods of use |
US6432402B1 (en) | 1989-05-25 | 2002-08-13 | Sloan-Kettering Institute For Cancer Research | Anti-idiotypic antibody which induces an immune response against a glycosphingolipid and use thereof |
ATE143376T1 (en) | 1989-06-02 | 1996-10-15 | Univ Johns Hopkins Med | MONOCLONAL ANTIBODIES DIRECTED AGAINST THE BETA CHAIN OF THE LEUKOCYTE ADHESION RECEPTOR, METHOD FOR THEIR PRODUCTION AND THEIR USE |
US5332567A (en) | 1989-08-24 | 1994-07-26 | Immunomedics | Detection and treatment of infections with immunoconjugates |
KR0162259B1 (en) | 1989-12-05 | 1998-12-01 | 아미 펙터 | Chimeric antibody for detection and therapy of infectious and inflammatory lesions |
DE69030172T2 (en) | 1990-01-26 | 1997-06-19 | Immunomedics Inc | Vaccines against cancer and infectious diseases |
IL97459A0 (en) | 1990-03-09 | 1992-06-21 | Hybritech Inc | Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent |
US7041293B1 (en) | 1990-04-03 | 2006-05-09 | Genentech, Inc. | HIV env antibodies |
US5229275A (en) | 1990-04-26 | 1993-07-20 | Akzo N.V. | In-vitro method for producing antigen-specific human monoclonal antibodies |
US5252296A (en) | 1990-05-15 | 1993-10-12 | Chiron Corporation | Method and apparatus for biopolymer synthesis |
US5270163A (en) | 1990-06-11 | 1993-12-14 | University Research Corporation | Methods for identifying nucleic acid ligands |
US5496938A (en) | 1990-06-11 | 1996-03-05 | Nexstar Pharmaceuticals, Inc. | Nucleic acid ligands to HIV-RT and HIV-1 rev |
WO1991019813A1 (en) | 1990-06-11 | 1991-12-26 | The University Of Colorado Foundation, Inc. | Nucleic acid ligands |
US5637459A (en) | 1990-06-11 | 1997-06-10 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: chimeric selex |
US5582981A (en) | 1991-08-14 | 1996-12-10 | Gilead Sciences, Inc. | Method for identifying an oligonucleotide aptamer specific for a target |
US6764681B2 (en) | 1991-10-07 | 2004-07-20 | Biogen, Inc. | Method of prophylaxis or treatment of antigen presenting cell driven skin conditions using inhibitors of the CD2/LFA-3 interaction |
US5854416A (en) | 1991-11-14 | 1998-12-29 | The United States Of America As Represented By The Department Of Health And Human Services | Streptococcus pneumoniae 37-KDA surface adhesin a protein and nucleic acids coding therefor |
US5474771A (en) | 1991-11-15 | 1995-12-12 | The Trustees Of Columbia University In The City Of New York | Murine monoclonal antibody (5c8) recognizes a human glycoprotein on the surface of T-lymphocytes, compositions containing same |
WO1993015405A1 (en) | 1992-01-29 | 1993-08-05 | Sci-Clone, Inc. | Carcinoma associated antigen (sk1) monoclonal antibodies against sk1, methods of producing these antibodies and use therfor |
ATE255902T1 (en) | 1992-03-09 | 2003-12-15 | San Diego Regional Cancer Ct | AN ANTIDIOTYPIC ANTIBODY AND ITS USE IN THE DIAGNOSIS AND THERAPY OF HIV-RELATED DISEASES |
US6129914A (en) | 1992-03-27 | 2000-10-10 | Protein Design Labs, Inc. | Bispecific antibody effective to treat B-cell lymphoma and cell line |
EP0633945B1 (en) | 1992-04-03 | 1998-12-30 | Genentech, Inc. | ANTIBODIES TO ALPHAvBETA3 INTEGRIN |
EP0643583B1 (en) | 1992-05-06 | 2000-07-26 | Immunomedics, Inc. | Intraoperative, intravascular and endoscopic tumor and lesion detection and therapy |
US6096289A (en) | 1992-05-06 | 2000-08-01 | Immunomedics, Inc. | Intraoperative, intravascular, and endoscopic tumor and lesion detection, biopsy and therapy |
AU4231393A (en) | 1992-05-08 | 1993-12-13 | Genentech Inc. | Antibodies to leukemia inhibitory factor |
US5686072A (en) | 1992-06-17 | 1997-11-11 | Board Of Regents, The University Of Texas | Epitope-specific monoclonal antibodies and immunotoxins and uses thereof |
US5397703A (en) | 1992-07-09 | 1995-03-14 | Cetus Oncology Corporation | Method for generation of antibodies to cell surface molecules |
DK0669836T3 (en) | 1992-11-13 | 1996-10-14 | Idec Pharma Corp | Therapeutic use of chimeric and radiolabeled antibodies and human B lymphocyte restricted differentiation antigen for the treatment of B cell lymphoma |
WO1994026297A1 (en) | 1993-05-17 | 1994-11-24 | Immunomedics, Inc. | Improved detection and therapy of lesions with biotin/avidin-metal chelating protein conjugates |
US6120768A (en) | 1993-05-17 | 2000-09-19 | Immunomedics, Inc. | Dota-biotin derivatives |
EP0751962B1 (en) | 1993-05-28 | 2006-08-02 | The Scripps Research Institute | Methods for inhibiting cd14 mediated cell activation |
US6084067A (en) | 1993-07-26 | 2000-07-04 | Dana-Farber Cancer Institute | CTLA4/CD28 ligands and uses therefor |
UA40577C2 (en) | 1993-08-02 | 2001-08-15 | Мерк Патент Гмбх | Bispecific antigen molecule for lysis of tumor cells, method for preparing of bispecific antigen molecule, monoclonal antibody (variants), pharmaceutical preparation, pharmaceutical kit for lysis of tumor cells (variants), method of lysis of tumor cells |
WO1995007102A1 (en) | 1993-09-09 | 1995-03-16 | Duke University | A method of promoting cellular function |
AU1289795A (en) | 1993-11-19 | 1995-06-06 | Baylor College Of Medicine | Monoclonal antibodies specific for human interleukin-5 |
US5492807A (en) | 1993-11-19 | 1996-02-20 | Santi; Daniel V. | Method of obtaining diagnostic reagents, assays and therapeutics based on clinical manifestations of a disease |
US5443953A (en) | 1993-12-08 | 1995-08-22 | Immunomedics, Inc. | Preparation and use of immunoconjugates |
US6432404B1 (en) | 1993-12-23 | 2002-08-13 | Icos Corporation | Methods of inhibiting locomotor damage following spinal cord injury with α D-specific antibodies |
US5922572A (en) | 1994-01-25 | 1999-07-13 | Human Genome Sciences, Inc. | Polynucleotides encoding haemopoietic maturation factor |
US6074642A (en) | 1994-05-02 | 2000-06-13 | Alexion Pharmaceuticals, Inc. | Use of antibodies specific to human complement component C5 for the treatment of glomerulonephritis |
US6100389A (en) | 1995-04-21 | 2000-08-08 | Human Genome Sciences, Inc. | Polynucleotides encoding a human chemotactic protein |
US5798100A (en) | 1994-07-06 | 1998-08-25 | Immunomedics, Inc. | Multi-stage cascade boosting vaccine |
US6303769B1 (en) | 1994-07-08 | 2001-10-16 | Immunex Corporation | Lerk-5 dna |
IL114909A (en) | 1994-08-12 | 1999-10-28 | Immunomedics Inc | Immunoconjugates and humanized antibodies specific for b-cell lymphoma and leukemia cells |
US5587459A (en) | 1994-08-19 | 1996-12-24 | Regents Of The University Of Minnesota | Immunoconjugates comprising tyrosine kinase inhibitors |
US6174995B1 (en) | 1994-08-23 | 2001-01-16 | Haodong Li | Human chemokines, CKβ4 and CKβ10/MCP-4 |
US6458349B1 (en) | 1995-06-02 | 2002-10-01 | Human Genome Sciences, Inc. | Chemokine β-4 polypeptides |
US6709653B1 (en) | 1994-09-16 | 2004-03-23 | Human Genome Sciences, Inc. | Antibodies specific for human inositol monophosphatase H1 |
US5874540A (en) | 1994-10-05 | 1999-02-23 | Immunomedics, Inc. | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies |
US5750370A (en) | 1995-06-06 | 1998-05-12 | Human Genome Sciences, Inc. | Nucleic acid encoding human endothlein-bombesin receptor and method of producing the receptor |
US6538121B1 (en) | 1994-11-01 | 2003-03-25 | Human Genome Sciences, Inc. | Interleukin-1 β converting enzyme like apoptosis protease-3 and 4 |
US5677136A (en) | 1994-11-14 | 1997-10-14 | Systemix, Inc. | Methods of obtaining compositions enriched for hematopoietic stem cells, compositions derived therefrom and methods of use thereof |
US6521227B1 (en) | 1999-11-18 | 2003-02-18 | Peter L. Hudson | Polynucleotides encoding prostatic growth factor and process for producing prostatic growth factor polypeptides |
US6537764B1 (en) | 1995-01-19 | 2003-03-25 | Children's Medical Center Corporation | Method of identifying inhibitors of C—C chemokine receptor 3 |
US5786204A (en) | 1995-01-20 | 1998-07-28 | Human Genome Sciences, Inc. | Human prostatic specific reductase |
US6312691B1 (en) | 1996-01-26 | 2001-11-06 | Jeffrey L. Browning | Lymphotoxin-α/β complexes and anti-lympotoxin-β receptor antibodies as anti-tumor agents |
US6949244B1 (en) | 1995-12-20 | 2005-09-27 | The Board Of Trustees Of The University Of Kentucky | Murine monoclonal anti-idiotype antibody 11D10 and methods of use thereof |
US5783404A (en) | 1995-04-13 | 1998-07-21 | Amgen Inc. | Methods and compositions for determining HER-2/neu expression using monoclonal antibodies |
EP0822941B1 (en) | 1995-04-19 | 2002-06-12 | Polymun Scientific Immunbiologische Forschung GmbH | Monoclonal antibodies against hiv-1 and vaccines made thereof |
US5686292A (en) | 1995-06-02 | 1997-11-11 | Genentech, Inc. | Hepatocyte growth factor receptor antagonist antibodies and uses thereof |
US6605441B1 (en) | 1995-06-05 | 2003-08-12 | Human Genome Sciences, Inc. | Antibodies against fibroblast growth factor 11 |
US5773292A (en) | 1995-06-05 | 1998-06-30 | Cornell University | Antibodies binding portions, and probes recognizing an antigen of prostate epithelial cells but not antigens circulating in the blood |
US5773252A (en) | 1995-06-05 | 1998-06-30 | Human Genome Sciences, Inc. | Fibroblast growth factor 15 |
AU6223296A (en) | 1995-06-07 | 1996-12-30 | Novartis Ag | Methods for obtaining compositions enriched for hematopoieti c stem cells and antibodies for use therein |
US5622699A (en) | 1995-09-11 | 1997-04-22 | La Jolla Cancer Research Foundation | Method of identifying molecules that home to a selected organ in vivo |
US6068829A (en) | 1995-09-11 | 2000-05-30 | The Burnham Institute | Method of identifying molecules that home to a selected organ in vivo |
US6340459B1 (en) | 1995-12-01 | 2002-01-22 | The Trustees Of Columbia University In The City Of New York | Therapeutic applications for the anti-T-BAM (CD40-L) monoclonal antibody 5C8 in the treatment of reperfusion injury in non-transplant recipients |
US5783186A (en) | 1995-12-05 | 1998-07-21 | Amgen Inc. | Antibody-induced apoptosis |
US5945309A (en) | 1996-03-19 | 1999-08-31 | Human Genome Sciences, Inc. | Cytostatin III nucleic acids encoding |
ATE267610T1 (en) | 1996-03-20 | 2004-06-15 | Immunomedics Inc | GLYCOSYLATED IGG ANTIBODIES |
CA2250080C (en) | 1996-03-20 | 2010-06-15 | Immunomedics, Inc. | Humanization of an anti-carcinoembryonic antigen anti-idiotype antibody and use as a tumor vaccine and for targeting applications |
US6174992B1 (en) | 1997-03-21 | 2001-01-16 | Human Genome Sciences, Inc. | Human endometrial specific steroid-binding factor I, II and III |
FR2746398B1 (en) | 1996-03-21 | 1998-04-30 | Bio Merieux | STAPHYLOCOCCUS AUREAUS SPECIFIC ANTIBODIES AND USES |
US6962981B1 (en) | 1996-03-25 | 2005-11-08 | Medarex, Inc. | Monoclonal antibodies specific for the extracellular domain of prostate-specific membrane antigen |
US6004780A (en) | 1996-03-26 | 1999-12-21 | Human Genome Sciences, Inc. | Growth factor HTTER36 |
US6110463A (en) | 1996-03-29 | 2000-08-29 | North Carolina State University | Anti-Cryptosporidium parvum preparations |
US6066617A (en) | 1996-04-03 | 2000-05-23 | Human Genome Sciences, Inc. | Human cystatin F |
CA2253904A1 (en) | 1996-05-03 | 1997-11-13 | Immunomedics, Inc. | Targeted combination immunotherapy of cancer |
US6136311A (en) | 1996-05-06 | 2000-10-24 | Cornell Research Foundation, Inc. | Treatment and diagnosis of cancer |
US6107090A (en) | 1996-05-06 | 2000-08-22 | Cornell Research Foundation, Inc. | Treatment and diagnosis of prostate cancer with antibodies to extracellur PSMA domains |
US6558669B1 (en) | 1996-08-28 | 2003-05-06 | Immunomedics, Inc. | Stable radioiodine conjugates and methods for their synthesis |
AU4031997A (en) | 1996-09-03 | 1998-03-26 | Kaneka Corporation | Method for inducing immunosuppressive cells and culturing device to be used herefor |
DE69731977T2 (en) | 1996-10-09 | 2005-12-08 | Canterbury Health Ltd. | SPECIFIC ANTIBODIES FOR DENDRITIC CELLS |
US6653104B2 (en) | 1996-10-17 | 2003-11-25 | Immunomedics, Inc. | Immunotoxins, comprising an internalizing antibody, directed against malignant and normal cells |
WO1998016254A1 (en) | 1996-10-17 | 1998-04-23 | Immunomedics, Inc. | Non-antigenic toxin-conjugate and fusion protein of internalizing receptor system |
US6812327B1 (en) | 1996-10-25 | 2004-11-02 | Human Genome Sciences, Inc. | Neutrokine-alpha polypeptides |
US6528625B1 (en) | 1996-10-28 | 2003-03-04 | Millennium Pharmaceuticals, Inc. | Anti-CCR5 antibodies and kits comprising same |
US6043348A (en) | 1996-11-13 | 2000-03-28 | Lawman; Michael J. P. | Antibody recognizing a small subset of human hematopoietic cells |
US6455040B1 (en) | 1997-01-14 | 2002-09-24 | Human Genome Sciences, Inc. | Tumor necrosis factor receptor 5 |
US6605699B1 (en) | 1997-01-21 | 2003-08-12 | Human Genome Sciences, Inc. | Galectin-11 polypeptides |
US6046031A (en) | 1997-01-21 | 2000-04-04 | Human Genome Sciences, Inc. | Metalloproteinases |
JP4450870B2 (en) | 1997-01-28 | 2010-04-14 | ヒューマン ジノーム サイエンシーズ, インコーポレイテッド | Binding to death domain containing receptor 4 (DR4: death receptor 4), a member of the TNF-receptor superfamily and TRAIL |
WO1998043089A1 (en) | 1997-03-03 | 1998-10-01 | Bristol-Myers Squibb Company | Monoclonal antibodies to human cd6 |
US6951924B2 (en) | 1997-03-14 | 2005-10-04 | Human Genome Sciences, Inc. | Antibodies against secreted protein HTEBYII |
US6919433B2 (en) | 1997-03-14 | 2005-07-19 | Human Genome Sciences, Inc. | Antibodies to protein HPMBQ91 |
US6872568B1 (en) | 1997-03-17 | 2005-03-29 | Human Genome Sciences, Inc. | Death domain containing receptor 5 antibodies |
US6306393B1 (en) | 1997-03-24 | 2001-10-23 | Immunomedics, Inc. | Immunotherapy of B-cell malignancies using anti-CD22 antibodies |
US6183744B1 (en) | 1997-03-24 | 2001-02-06 | Immunomedics, Inc. | Immunotherapy of B-cell malignancies using anti-CD22 antibodies |
WO1998050435A1 (en) | 1997-05-02 | 1998-11-12 | The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services | Immunotoxins, comprising an onc protein, directed against malignant cells |
US6284474B1 (en) | 1998-04-23 | 2001-09-04 | The Regents Of The University Of California | Detection and diagnosis of conditions associated with lung injury |
US6372217B1 (en) | 1997-06-03 | 2002-04-16 | Regents Of The University Of Minnesota | Methods for the treatment of CD7+ viral infection with TXU-7-PAP |
US6545130B2 (en) | 1997-06-04 | 2003-04-08 | Albert Einstein College Of Medicine Of Yeshiva University | Monoclonal antibodies to mycobacterium tuberculosis and a modified ELISA assay |
US6358508B1 (en) | 1997-06-11 | 2002-03-19 | Human Genome Sciences, Inc. | Antibodies to human tumor necrosis factor receptor TR9 |
JP3992923B2 (en) | 1997-09-03 | 2007-10-17 | イムノメディクス, インコーポレイテッド | Protein and peptide fluorination process for F-18 positron emission tomography |
ES2306480T3 (en) | 1997-09-18 | 2008-11-01 | Genentech, Inc. | DCR3 POLYPEPTIDE, A TNFR HOMOLOGIST. |
US6689607B2 (en) | 1997-10-21 | 2004-02-10 | Human Genome Sciences, Inc. | Human tumor, necrosis factor receptor-like proteins TR11, TR11SV1 and TR11SV2 |
US6355244B1 (en) | 1997-11-17 | 2002-03-12 | University Of Kentucky Research Foundation | Methods and compositions for the treatment of psoriasis |
US6610833B1 (en) | 1997-11-24 | 2003-08-26 | The Institute For Human Genetics And Biochemistry | Monoclonal human natural antibodies |
WO1999033878A1 (en) | 1997-12-25 | 1999-07-08 | Japan Tobacco Inc. | Monoclonal antibody against connective tissue growth factor and medicinal uses thereof |
US6956107B2 (en) | 1998-02-20 | 2005-10-18 | Tanox, Inc. | Inhibitors of complement activation |
US6861227B2 (en) | 1998-03-19 | 2005-03-01 | Human Genome Sciences, Inc. | Antibodies to cytokine receptor common gamma chain like |
US6200765B1 (en) | 1998-05-04 | 2001-03-13 | Pacific Northwest Cancer Foundation | Non-invasive methods to detect prostate cancer |
US6071490A (en) | 1998-05-07 | 2000-06-06 | Immunomedics, Inc. | Position emission tomography using gallium-68 chelates |
EP1079862B1 (en) | 1998-05-20 | 2010-07-07 | Immunomedics, Inc. | Therapeutics using a bispecific anti-hla class ii invariant chain x anti-pathogen antibody |
JP2002518347A (en) | 1998-06-15 | 2002-06-25 | アルタレックス コーポレイション | Immunotherapeutic compositions and methods for treating prostate cancer |
US7405320B2 (en) | 1998-06-22 | 2008-07-29 | Immunomedics, Inc. | Therapeutic and diagnostic conjugates for use with multispecific antibodies |
US6528269B1 (en) | 1998-06-22 | 2003-03-04 | Case Western Reserve University | Immunological agents specific for prion protein (PRP) |
US20040166115A1 (en) | 2002-11-15 | 2004-08-26 | Immunomedics, Inc. | Use of multi-specific, non-covalent complexes for targeted delivery of therapeutics |
US6962702B2 (en) | 1998-06-22 | 2005-11-08 | Immunomedics Inc. | Production and use of novel peptide-based agents for use with bi-specific antibodies |
US7387772B1 (en) | 1999-06-22 | 2008-06-17 | Immunimedics, Inc. | Chimeric, human and humanized anti-CSAP monoclonal antibodies |
US7138103B2 (en) | 1998-06-22 | 2006-11-21 | Immunomedics, Inc. | Use of bi-specific antibodies for pre-targeting diagnosis and therapy |
US6312689B1 (en) | 1998-07-23 | 2001-11-06 | Millennium Pharmaceuticals, Inc. | Anti-CCR2 antibodies and methods of use therefor |
US6572856B1 (en) | 1998-09-10 | 2003-06-03 | The University Of Virginia Patent Foundation | Methods for the prevention and treatment of cancer using anti-C3b(i) antibodies |
US6818749B1 (en) | 1998-10-31 | 2004-11-16 | The United States Of America As Represented By The Department Of Health And Human Services | Variants of humanized anti carcinoma monoclonal antibody cc49 |
WO2000026418A1 (en) | 1998-11-05 | 2000-05-11 | The Board Of Trustees Of Leland Stanford Junior University | Human pan-hcv human monoclonal antibodies |
DE69930872T8 (en) | 1998-12-21 | 2007-05-03 | Ludwig Institute For Cancer Research | ANTIBODIES AGAINST SHORTENED VEGF-D AND ITS USES |
US6682736B1 (en) | 1998-12-23 | 2004-01-27 | Abgenix, Inc. | Human monoclonal antibodies to CTLA-4 |
WO2000039327A1 (en) | 1998-12-23 | 2000-07-06 | Human Genome Sciences, Inc. | Peptidoglycan recognition proteins |
US6488930B1 (en) | 1999-01-15 | 2002-12-03 | Millennium Pharmaceuticals, Inc. | Anti-CCR4 antibodies and methods of use therefor |
CN101073668A (en) | 1999-04-28 | 2007-11-21 | 德克萨斯大学董事会 | Antibody compositions for selectively inhibiting vegf |
US7534866B2 (en) | 2005-10-19 | 2009-05-19 | Ibc Pharmaceuticals, Inc. | Methods and compositions for generating bioactive assemblies of increased complexity and uses |
US7550143B2 (en) | 2005-04-06 | 2009-06-23 | Ibc Pharmaceuticals, Inc. | Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses |
US7829064B2 (en) | 1999-05-10 | 2010-11-09 | Immunomedics, Inc. | Anti-CD74 immunoconjugates and methods |
US7527787B2 (en) | 2005-10-19 | 2009-05-05 | Ibc Pharmaceuticals, Inc. | Multivalent immunoglobulin-based bioactive assemblies |
US6946129B1 (en) | 1999-06-08 | 2005-09-20 | Seattle Genetics, Inc. | Recombinant anti-CD40 antibody and uses thereof |
DK1194167T3 (en) | 1999-06-09 | 2009-11-16 | Immunomedics Inc | Immunotherapy of autoimmune diseases using B-cell specific antibodies |
US20020002270A1 (en) | 1999-06-16 | 2002-01-03 | Raymond P. Zinkowski | Purified antigen for alzheimer's disease, and methods of obtaining and using same |
US6355481B1 (en) | 1999-06-18 | 2002-03-12 | Emory University | Hybridoma cell line and monoclonal antibody for huntingtin protein |
EP1189641B1 (en) | 1999-06-25 | 2009-07-29 | Genentech, Inc. | HUMANIZED ANTI-ErbB2 ANTIBODIES AND TREATMENT WITH ANTI-ErbB2 ANTIBODIES |
US6964854B1 (en) | 1999-07-13 | 2005-11-15 | Science & Technology Corporation | Compositions and methods useful for the diagnosis and treatment of heparin induced thrombocytopenia/thrombosis |
US6693176B1 (en) | 1999-07-23 | 2004-02-17 | University Of Massachusetts | Antitumor antibodies, proteins, and uses thereof |
US6376654B1 (en) | 1999-08-13 | 2002-04-23 | Molecular Discoveries, Llc | Myeloma cell and ovarian cancer cell surface glycoproteins, antibodies thereto, and uses thereof |
US6716966B1 (en) | 1999-08-18 | 2004-04-06 | Altarex Corp. | Therapeutic binding agents against MUC-1 antigen and methods for their use |
US6630144B1 (en) | 1999-08-30 | 2003-10-07 | The United States Of America As Represented By The Secretary Of The Army | Monoclonal antibodies to Ebola glycoprotein |
US6824780B1 (en) | 1999-10-29 | 2004-11-30 | Genentech, Inc. | Anti-tumor antibody compositions and methods of use |
US6832203B1 (en) | 1999-11-05 | 2004-12-14 | Cim, Ltd. | Skills based contact routing |
US6835370B2 (en) | 1999-11-08 | 2004-12-28 | Rhode Island Hospital | Diagnosis and treatment of malignant neoplasms |
US20030031670A1 (en) | 1999-11-08 | 2003-02-13 | Jack R. Wands | Diagnosis and treatment of malignant neoplasms |
US6994852B1 (en) | 1999-11-12 | 2006-02-07 | Temple University-Of The Commonwealth System Of Higher Education | Inhibition of angiogenesis by antibodies against high molecular weight kininogen domain 5 |
US6994976B1 (en) | 1999-11-19 | 2006-02-07 | Tittle Thomas V | Tr3-specific binding agents and methods for their use |
US6319675B1 (en) | 1999-11-24 | 2001-11-20 | Millennium Pharmaceuticals, Inc. | Methods for detecting and/or identifying agents which bind and/or modulate function of “bonzo” chemokine receptor |
US6835549B2 (en) | 2000-02-24 | 2004-12-28 | University Of Medicine & Dentistry Of New Jersey | Immunoassay method for the diagnosis of gastric intestinal metaplasia associated with gastric carcinoma |
ATE435873T1 (en) | 2000-03-23 | 2009-07-15 | Genentech Inc | ANTI-C2/C2A INHIBITORS FOR COMPLEMENT ACTIVATION |
US6629995B1 (en) | 2000-03-31 | 2003-10-07 | Super Gen, Inc. | Camptothecin conjugates |
CA2408549A1 (en) | 2000-05-11 | 2001-11-15 | Altarex Corp. | Therapeutic method and composition utilizing antigen-antibody complexation and presentation by dendritic cells |
EP1292619B1 (en) | 2000-06-06 | 2008-02-06 | Bristol-Myers Squibb Company | B7-related nucleic acids and polypeptides and their uses for immunomodulation |
WO2002010764A2 (en) | 2000-07-31 | 2002-02-07 | The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services | SPECIFIC BINDING AGENTS FOR KSHV vIL-6 THAT NEUTRALIZE A BIOLOGICAL ACTIVITY |
US7060802B1 (en) | 2000-09-18 | 2006-06-13 | The Trustees Of Columbia University In The City Of New York | Tumor-associated marker |
ATE464374T1 (en) | 2000-10-02 | 2010-04-15 | Oklahoma Med Res Found | ASSAY FOR THE RAPID DETECTION OF HUMAN ACTIVATED PROTEIN C AND HIGHLY SPECIFIC MONOCLONAL ANTIBODIES AGAINST IT |
EP1325033B1 (en) | 2000-10-10 | 2009-11-25 | Genentech, Inc. | Inhibition of complement c5 activation for the treatment and prevention of delayed xenograft or acute vascular rejection |
PE20020801A1 (en) | 2001-01-05 | 2002-09-06 | Pfizer | ANTIBODIES AGAINST INSULIN-LIKE GROWTH FACTOR RECEPTOR |
US6743898B2 (en) | 2001-03-15 | 2004-06-01 | Ochsner Clinic Foundation | Monoclonal antibodies that suppress B cell growth and/or differentiation |
DE60213771T2 (en) | 2001-03-30 | 2007-08-16 | The University of Massachusetts, Worcester | MORPHOLINE IMAGING AND THERAPY |
US6824778B2 (en) | 2001-04-23 | 2004-11-30 | The United States Of America As Represented By The Secretary Of The Army | Prophylactic and therapeutic monoclonal antibodies |
US20050048512A1 (en) | 2001-04-26 | 2005-03-03 | Avidia Research Institute | Combinatorial libraries of monomer domains |
WO2002088171A2 (en) | 2001-04-26 | 2002-11-07 | Avidia Research Institute | Combinatorial libraries of monomer domains |
US20050053973A1 (en) | 2001-04-26 | 2005-03-10 | Avidia Research Institute | Novel proteins with targeted binding |
US20040175756A1 (en) | 2001-04-26 | 2004-09-09 | Avidia Research Institute | Methods for using combinatorial libraries of monomer domains |
US20050089932A1 (en) | 2001-04-26 | 2005-04-28 | Avidia Research Institute | Novel proteins with targeted binding |
AU2002303832A1 (en) | 2001-05-21 | 2002-12-03 | Beth Israel Deaconess Medical Center, Inc. | P.aeruginosa mucoid exopolysaccharide specific binding peptides |
EP1411987A2 (en) | 2001-07-31 | 2004-04-28 | Immunomedics, Inc. | Targeted polymeric delivery systems |
US20040043030A1 (en) | 2001-07-31 | 2004-03-04 | Immunomedics, Inc. | Polymeric delivery systems |
NZ513418A (en) | 2001-08-07 | 2004-04-30 | Univ Massey | Vaccine comprising proteins from mycobacterium paratuberculosis |
US6720150B2 (en) | 2001-08-27 | 2004-04-13 | University Of New Hampshire | Method for identifying fast - growing fish |
JP2005507659A (en) * | 2001-10-15 | 2005-03-24 | イミューノメディクス、インコーポレイテッド | Direct targeting binding protein |
US7151164B2 (en) | 2002-02-14 | 2006-12-19 | Immunomedics, Inc. | Anti-CD20 antibodies and fusion proteins thereof and methods of use |
US7049060B2 (en) | 2001-11-05 | 2006-05-23 | Ortho-Clinical Diagnostics, Inc. | HCV anti-core monoclonal antibodies |
US6593334B1 (en) * | 2002-05-02 | 2003-07-15 | The University Of North Carolina At Chapel Hill | Camptothecin-taxoid conjugates as antimitotic and antitumor agents |
JP5110768B2 (en) | 2002-06-14 | 2012-12-26 | イミューノメディクス、インコーポレイテッド | Monoclonal antibody PAM4 and its use for diagnosis and treatment of pancreatic cancer |
KR101143035B1 (en) | 2002-06-14 | 2012-05-08 | 이뮤노메딕스, 인코오포레이티드 | Monoclonal antibody hPAM4 |
AU2003248982B2 (en) | 2002-08-01 | 2009-12-10 | Immunomedics, Inc. | Alpha-fetoprotein immu31 antibodies and fusion proteins and methods of use thereof |
US7541440B2 (en) | 2002-09-30 | 2009-06-02 | Immunomedics, Inc. | Chimeric, human and humanized anti-granulocyte antibodies and methods of use |
US7217797B2 (en) | 2002-10-15 | 2007-05-15 | Pdl Biopharma, Inc. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
US7534427B2 (en) | 2002-12-31 | 2009-05-19 | Immunomedics, Inc. | Immunotherapy of B cell malignancies and autoimmune diseases using unconjugated antibodies and conjugated antibodies and antibody combinations and fusion proteins |
US20040202666A1 (en) | 2003-01-24 | 2004-10-14 | Immunomedics, Inc. | Anti-cancer anthracycline drug-antibody conjugates |
US6875580B2 (en) | 2003-01-28 | 2005-04-05 | Schering Corporation | Antibodies specific for plasmacytoid dendritic cells |
AU2004268932B2 (en) | 2003-06-13 | 2010-06-24 | Immunomedics, Inc. | D-amino acid peptides |
EP1660519B1 (en) | 2003-07-29 | 2014-05-14 | Immunomedics, Inc. | Conjugates comprising 2-[18F]fluoro-2-deoxy-D-glucose and a peptide molecule |
EP2216342B1 (en) | 2003-07-31 | 2015-04-22 | Immunomedics, Inc. | Anti-CD19 antibodies |
US20050079184A1 (en) | 2003-08-08 | 2005-04-14 | Immunomedics, Inc. | Bispecific antibodies for inducing apoptosis of tumor and diseased cells |
US7259240B2 (en) | 2003-10-31 | 2007-08-21 | The Regents Of The University Of California | Primate prokineticin receptor polypeptides |
EP1720996A4 (en) | 2004-02-13 | 2007-03-21 | Immunomedics Inc | Fusion proteins containing recombinant cytotoxic rnases |
US7251164B2 (en) | 2004-11-10 | 2007-07-31 | Innovative Silicon S.A. | Circuitry for and method of improving statistical distribution of integrated circuits |
ES2665422T3 (en) | 2005-03-03 | 2018-04-25 | Immunomedics Inc. | Humanized L243 antibodies |
CN101484182B (en) | 2005-04-06 | 2014-06-11 | Ibc药品公司 | Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses |
CN101534865A (en) | 2005-10-19 | 2009-09-16 | Ibc药品公司 | Methods and compositions for generating bioactive assemblies of increased complexity and uses |
WO2008088658A2 (en) * | 2007-01-17 | 2008-07-24 | Immunomedics, Inc. | Polymeric carriers of therapeutic agents and recognition moieties for antibody-based targeting of disease sites |
ITTO20080313A1 (en) | 2008-04-22 | 2009-10-23 | Marco Colombatti | ISOLATED MONOCLONAL ANTIBODY OR ITS FRAGMENT BINDING THE PROSTATE'S SPECIFIC MEMBRANE ANTIGEN, ITS CONJUGATES AND ITS USES |
US10206918B2 (en) * | 2012-12-13 | 2019-02-19 | Immunomedics, Inc. | Efficacy of anti-HLA-DR antiboddy drug conjugate IMMU-140 (hL243-CL2A-SN-38) in HLA-DR positive cancers |
US10413539B2 (en) * | 2012-12-13 | 2019-09-17 | Immunomedics, Inc. | Therapy for metastatic urothelial cancer with the antibody-drug conjugate, sacituzumab govitecan (IMMU-132) |
US10744129B2 (en) * | 2012-12-13 | 2020-08-18 | Immunomedics, Inc. | Therapy of small-cell lung cancer (SCLC) with a topoisomerase-I inhibiting antibody-drug conjugate (ADC) targeting Trop-2 |
US10137196B2 (en) * | 2012-12-13 | 2018-11-27 | Immunomedics, Inc. | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
EP3606964A4 (en) * | 2017-04-03 | 2020-12-09 | Immunomedics, Inc. | Subcutaneous administration of antibody-drug conjugates for cancer therapy |
-
2009
- 2009-12-02 HU HUE21178798A patent/HUE062339T2/en unknown
- 2009-12-02 HR HRP20230487TT patent/HRP20230487T1/en unknown
- 2009-12-02 LT LTEP21176545.8T patent/LT3912643T/en unknown
- 2009-12-02 EP EP17178086.9A patent/EP3243527B1/en active Active
- 2009-12-02 TR TR2019/10848T patent/TR201910848T4/en unknown
- 2009-12-02 PL PL21176545.8T patent/PL3912643T3/en unknown
- 2009-12-02 EP EP21189065.2A patent/EP3939617A1/en active Pending
- 2009-12-02 EP EP09840166.4A patent/EP2396036B1/en active Active
- 2009-12-02 EP EP21178798.1A patent/EP3903829B1/en active Active
- 2009-12-02 CN CN200980156218.3A patent/CN102448494B/en active Active
- 2009-12-02 PL PL21178798.1T patent/PL3903829T3/en unknown
- 2009-12-02 DK DK21178798.1T patent/DK3903829T3/en active
- 2009-12-02 CA CA2749501A patent/CA2749501C/en active Active
- 2009-12-02 EP EP21176545.8A patent/EP3912643B8/en active Active
- 2009-12-02 HU HUE21176545A patent/HUE060624T2/en unknown
- 2009-12-02 CA CA2948693A patent/CA2948693C/en active Active
- 2009-12-02 LT LTEP21178798.1T patent/LT3903829T/en unknown
- 2009-12-02 SI SI200932183T patent/SI3903829T1/en unknown
- 2009-12-02 PL PL09840166T patent/PL2396036T3/en unknown
- 2009-12-02 PT PT211765458T patent/PT3912643T/en unknown
- 2009-12-02 DK DK21176545.8T patent/DK3912643T3/en active
- 2009-12-02 ES ES21176545T patent/ES2931923T3/en active Active
- 2009-12-02 ES ES17178086T patent/ES2738700T3/en active Active
- 2009-12-02 US US12/629,404 patent/US7999083B2/en active Active
- 2009-12-02 HR HRP20221259TT patent/HRP20221259T1/en unknown
- 2009-12-02 PT PT211787981T patent/PT3903829T/en unknown
- 2009-12-02 ES ES09840166.4T patent/ES2640013T3/en active Active
- 2009-12-02 ES ES21178798T patent/ES2945533T3/en active Active
- 2009-12-02 EP EP18200201.4A patent/EP3470087A1/en active Pending
- 2009-12-02 WO PCT/US2009/066371 patent/WO2010093395A1/en active Application Filing
- 2009-12-02 DK DK09840166.4T patent/DK2396036T3/en active
- 2009-12-02 FI FIEP21178798.1T patent/FI3903829T3/en active
-
2011
- 2011-06-20 US US13/164,275 patent/US8080250B1/en not_active Expired - Lifetime
- 2011-11-08 US US13/291,238 patent/US8741300B2/en not_active Expired - Lifetime
-
2012
- 2012-12-05 US US13/705,756 patent/US8759496B2/en not_active Ceased
-
2013
- 2013-10-08 US US14/048,222 patent/US9102735B2/en active Active
-
2014
- 2014-04-22 US US14/258,228 patent/US9138485B2/en not_active Expired - Lifetime
- 2014-06-03 US US14/294,651 patent/US8999344B2/en active Active
-
2015
- 2015-03-02 US US14/635,530 patent/US9198978B2/en active Active
- 2015-03-03 US US14/636,790 patent/US9345783B2/en active Active
- 2015-03-17 US US14/660,310 patent/US9233172B2/en not_active Expired - Lifetime
- 2015-12-02 US US14/956,769 patent/US9700634B2/en not_active Expired - Lifetime
-
2016
- 2016-04-20 US US15/133,675 patent/US9480756B2/en active Active
- 2016-09-16 US US15/267,910 patent/US9675706B2/en active Active
-
2017
- 2017-05-05 US US15/587,526 patent/US10064957B2/en active Active
- 2017-06-02 US US15/612,672 patent/US10561738B2/en not_active Expired - Lifetime
-
2018
- 2018-07-25 US US16/045,400 patent/US10265414B2/en active Active
- 2018-12-12 US US16/218,384 patent/USRE48751E1/en not_active Expired - Lifetime
-
2019
- 2019-02-14 US US16/276,173 patent/US10322193B1/en active Active
-
2020
- 2020-01-03 US US16/733,816 patent/US11077201B2/en not_active Expired - Lifetime
- 2020-04-06 US US16/841,345 patent/US11020489B2/en not_active Expired - Lifetime
-
2021
- 2021-04-21 US US17/236,709 patent/US20210346511A1/en not_active Abandoned
-
2022
- 2022-03-07 NL NL301164C patent/NL301164I2/en unknown
- 2022-03-07 FR FR22C1009C patent/FR22C1009I2/en active Active
- 2022-12-05 CY CY20221100764T patent/CY1125700T1/en unknown
-
2023
- 2023-02-09 FI FIC20230010C patent/FIC20230010I1/en unknown
- 2023-02-13 LT LTPA2023506C patent/LTPA2023506I1/lt unknown
- 2023-02-21 HU HUS2300010C patent/HUS2300010I1/en unknown
Patent Citations (66)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4359457A (en) | 1980-09-30 | 1982-11-16 | Neville Jr David M | Anti Thy 1.2 monoclonal antibody-ricin hybrid utilized as a tumor suppressant |
EP0253202A2 (en) | 1986-06-30 | 1988-01-20 | Oncogen | Novel immunoconjugates and methods for their use in tumor therapy |
EP0306943A2 (en) | 1987-09-10 | 1989-03-15 | Neorx Corporation | Immunconjugates joined by thioether bonds having reduced toxicity and improved selectivity |
US5112954A (en) | 1988-02-26 | 1992-05-12 | Neorx Corporation | Method of enhancing the effect of cytotoxic agents |
US5708146A (en) | 1992-01-23 | 1998-01-13 | Bristol-Myers Squibb Company | Thioether conjugates |
US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
US5824701A (en) | 1993-10-20 | 1998-10-20 | Enzon, Inc. | Taxane-based prodrugs |
US20010034363A1 (en) | 1996-03-12 | 2001-10-25 | Chun Li | Water soluble paclitaxel derivatives |
US6156754A (en) | 1996-09-30 | 2000-12-05 | Bayer Aktiengesellschaft | Glycoconjugates of modified camptothecin derivatives (A-or B-ring linkage) |
US7122636B1 (en) | 1997-02-21 | 2006-10-17 | Genentech, Inc. | Antibody fragment-polymer conjugates and uses of same |
US6310261B1 (en) | 1998-01-16 | 2001-10-30 | Basf Aktiengesellschaft | Method for the production of aldehydes |
JP2002509127A (en) | 1998-01-16 | 2002-03-26 | ビーエーエスエフ アクチェンゲゼルシャフト | Method for producing aldehyde |
WO2000076551A2 (en) | 1999-06-09 | 2000-12-21 | Ktb Tumorforschungs Gmbh | Method for producing an injectable medicament preparation |
WO2001024763A2 (en) | 1999-10-01 | 2001-04-12 | Immunogen, Inc. | Compositions and methods for treating cancer using immunoconjugates and chemotherapeutic agents |
US20030133972A1 (en) | 2000-10-11 | 2003-07-17 | Targesome, Inc. | Targeted multivalent macromolecules |
JP2002212121A (en) | 2001-01-18 | 2002-07-31 | Takasago Internatl Corp | Method for producing isopulegol |
US20040001838A1 (en) | 2001-12-21 | 2004-01-01 | Immunogen, Inc. | Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same |
US6716821B2 (en) | 2001-12-21 | 2004-04-06 | Immunogen Inc. | Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same |
US7238785B2 (en) | 2002-03-01 | 2007-07-03 | Immunomedics, Inc. | RS7 antibodies |
US7312318B2 (en) | 2002-03-01 | 2007-12-25 | Immunomedics, Inc. | Internalizing anti-CD74 antibodies and methods of use |
US8741300B2 (en) | 2002-12-13 | 2014-06-03 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US9233172B2 (en) * | 2002-12-13 | 2016-01-12 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US10561738B2 (en) * | 2002-12-13 | 2020-02-18 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US9700634B2 (en) * | 2002-12-13 | 2017-07-11 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US9138485B2 (en) * | 2002-12-13 | 2015-09-22 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US8877901B2 (en) | 2002-12-13 | 2014-11-04 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
US20080166363A1 (en) | 2002-12-13 | 2008-07-10 | Immunomedics, Inc. | Camptothecin-Binding Moiety Conjugates |
US8759496B2 (en) | 2002-12-13 | 2014-06-24 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US7591994B2 (en) | 2002-12-13 | 2009-09-22 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
US7999083B2 (en) * | 2002-12-13 | 2011-08-16 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US8080250B1 (en) * | 2002-12-13 | 2011-12-20 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US20120082617A1 (en) * | 2002-12-13 | 2012-04-05 | Immunomedics, Inc. | Immunoconjugates with an Intracellularly-Cleavable Linkage |
WO2004054622A1 (en) | 2002-12-13 | 2004-07-01 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US20060074265A1 (en) | 2004-09-24 | 2006-04-06 | Julian Vaughan-Spickers | Asymmetric catalytic systems |
US20060142506A1 (en) | 2004-10-25 | 2006-06-29 | Kurt Breitenkamp | Heterobifunctional poly(ethylene glycol) and uses thereof |
US7550633B2 (en) | 2004-12-22 | 2009-06-23 | Basf Se | Method for the production of isopulegol |
JP2008524287A (en) | 2004-12-22 | 2008-07-10 | ビーエーエスエフ ソシエタス・ヨーロピア | Preparation method of isopulegol |
WO2007018431A2 (en) | 2005-08-05 | 2007-02-15 | Syntarga B.V. | Triazole-containing releasable linkers and conjugates comprising the same |
WO2007038658A2 (en) | 2005-09-26 | 2007-04-05 | Medarex, Inc. | Antibody-drug conjugates and methods of use |
US8999344B2 (en) * | 2009-02-13 | 2015-04-07 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US10322193B1 (en) * | 2009-02-13 | 2019-06-18 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US9102735B2 (en) * | 2009-02-13 | 2015-08-11 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US9198978B2 (en) * | 2009-02-13 | 2015-12-01 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US9345783B2 (en) * | 2009-02-13 | 2016-05-24 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US10265414B2 (en) * | 2009-02-13 | 2019-04-23 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US9480756B2 (en) * | 2009-02-13 | 2016-11-01 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US10064957B2 (en) * | 2009-02-13 | 2018-09-04 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US9675706B2 (en) * | 2009-02-13 | 2017-06-13 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
US20150132217A1 (en) | 2012-08-14 | 2015-05-14 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to trop-2 expressing cells |
US9522959B2 (en) * | 2012-12-13 | 2016-12-20 | Immunomedics, Inc. | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
US9492566B2 (en) * | 2012-12-13 | 2016-11-15 | Immunomedics, Inc. | Antibody-drug conjugates and uses thereof |
US20140170063A1 (en) | 2012-12-13 | 2014-06-19 | Immunomedics, Inc. | Dosages of Immunoconjugates of Antibodies and SN-38 for Improved Efficacy and Decreased Toxicity |
US9493574B2 (en) * | 2012-12-13 | 2016-11-15 | Immunomedics, Inc. | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
US10751420B2 (en) * | 2012-12-13 | 2020-08-25 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
US9855344B2 (en) * | 2012-12-13 | 2018-01-02 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
US9931417B2 (en) * | 2012-12-13 | 2018-04-03 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
US10034950B2 (en) * | 2012-12-13 | 2018-07-31 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
US10682347B2 (en) * | 2012-12-13 | 2020-06-16 | Immunomedics, Inc. | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
US9629926B2 (en) * | 2012-12-13 | 2017-04-25 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
US10143756B2 (en) * | 2012-12-13 | 2018-12-04 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
US9375489B2 (en) * | 2012-12-13 | 2016-06-28 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
US20140219914A1 (en) | 2012-12-13 | 2014-08-07 | Immunomedics, Inc. | Dosages of Immunoconjugates of Antibodies and SN-38 for Improved Efficacy and Decreased Toxicity |
US9107960B2 (en) * | 2012-12-13 | 2015-08-18 | Immunimedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
US9707302B2 (en) * | 2013-07-23 | 2017-07-18 | Immunomedics, Inc. | Combining anti-HLA-DR or anti-Trop-2 antibodies with microtubule inhibitors, PARP inhibitors, bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
US10058621B2 (en) * | 2015-06-25 | 2018-08-28 | Immunomedics, Inc. | Combination therapy with anti-HLA-DR antibodies and kinase inhibitors in hematopoietic cancers |
US10266605B2 (en) * | 2016-04-27 | 2019-04-23 | Immunomedics, Inc. | Efficacy of anti-trop-2-SN-38 antibody drug conjugates for therapy of tumors relapsed/refractory to checkpoint inhibitors |
Non-Patent Citations (122)
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20210346511A1 (en) * | 2002-12-13 | 2021-11-11 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11020489B2 (en) | Immunoconjugates with an intracellularly-cleavable linkage |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
AS | Assignment |
Owner name: IMMUNOMEDICS, INC., NEW JERSEY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GOVINDAN, SERENGULAM V.;MOON, SUNG-JU;GOLDENBERG, DAVID M.;REEL/FRAME:056580/0012 Effective date: 20100201 |
|
MAFP | Maintenance fee payment |
Free format text: PAYMENT OF MAINTENANCE FEE, 8TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1552); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY Year of fee payment: 8 |