DE3005208C2 - - Google Patents
Info
- Publication number
- DE3005208C2 DE3005208C2 DE3005208A DE3005208A DE3005208C2 DE 3005208 C2 DE3005208 C2 DE 3005208C2 DE 3005208 A DE3005208 A DE 3005208A DE 3005208 A DE3005208 A DE 3005208A DE 3005208 C2 DE3005208 C2 DE 3005208C2
- Authority
- DE
- Germany
- Prior art keywords
- cerebral
- treatment
- patients
- brain
- dementia
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired
Links
- 230000002490 cerebral effect Effects 0.000 claims description 16
- MEFKEPWMEQBLKI-AIRLBKTGSA-O S-adenosyl-L-methionine Chemical compound O[C@@H]1[C@H](O)[C@@H](C[S+](CC[C@H]([NH3+])C([O-])=O)C)O[C@H]1N1C2=NC=NC(N)=C2N=C1 MEFKEPWMEQBLKI-AIRLBKTGSA-O 0.000 claims description 10
- 206010012289 Dementia Diseases 0.000 claims description 4
- 150000003839 salts Chemical class 0.000 claims description 3
- 125000002339 acetoacetyl group Chemical group O=C([*])C([H])([H])C(=O)C([H])([H])[H] 0.000 claims 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 claims 1
- 239000002253 acid Substances 0.000 claims 1
- 125000004063 butyryl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 claims 1
- -1 hydroxybutyryl Chemical group 0.000 claims 1
- 125000001501 propionyl group Chemical group O=C([*])C([H])([H])C([H])([H])[H] 0.000 claims 1
- 230000000694 effects Effects 0.000 description 14
- 210000004556 brain Anatomy 0.000 description 12
- 229960001009 acetylcarnitine Drugs 0.000 description 10
- 239000003814 drug Substances 0.000 description 10
- RDHQFKQIGNGIED-MRVPVSSYSA-N O-acetyl-L-carnitine Chemical compound CC(=O)O[C@H](CC([O-])=O)C[N+](C)(C)C RDHQFKQIGNGIED-MRVPVSSYSA-N 0.000 description 9
- 229940079593 drug Drugs 0.000 description 7
- 229940124549 vasodilator Drugs 0.000 description 7
- 239000003071 vasodilator agent Substances 0.000 description 7
- 208000024827 Alzheimer disease Diseases 0.000 description 6
- 230000006872 improvement Effects 0.000 description 6
- 230000001575 pathological effect Effects 0.000 description 6
- 230000001537 neural effect Effects 0.000 description 5
- 230000009758 senescence Effects 0.000 description 5
- 230000004060 metabolic process Effects 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 3
- 206010039966 Senile dementia Diseases 0.000 description 3
- 230000004888 barrier function Effects 0.000 description 3
- 230000003727 cerebral blood flow Effects 0.000 description 3
- 230000000302 ischemic effect Effects 0.000 description 3
- 230000037023 motor activity Effects 0.000 description 3
- 230000002093 peripheral effect Effects 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- PHIQHXFUZVPYII-ZCFIWIBFSA-N (R)-carnitine Chemical compound C[N+](C)(C)C[C@H](O)CC([O-])=O PHIQHXFUZVPYII-ZCFIWIBFSA-N 0.000 description 2
- 208000001953 Hypotension Diseases 0.000 description 2
- 206010036631 Presenile dementia Diseases 0.000 description 2
- 201000004810 Vascular dementia Diseases 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- 230000017531 blood circulation Effects 0.000 description 2
- 229960004203 carnitine Drugs 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 238000011010 flushing procedure Methods 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 230000036543 hypotension Effects 0.000 description 2
- 208000028867 ischemia Diseases 0.000 description 2
- 238000000034 method Methods 0.000 description 2
- 210000000653 nervous system Anatomy 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 230000002792 vascular Effects 0.000 description 2
- QHZUABXEBRGBLP-LKWYKXIFSA-N (6aR,9R,10aR)-N-[(2R,4R,9aS,9bR)-4-benzyl-9b-hydroxy-3,5-dioxo-2-propan-2-yl-3a,4,7,8,9,9a-hexahydrofuro[3,2-g]indolizin-2-yl]-7-methyl-6,6a,8,9,10,10a-hexahydro-4H-indolo[4,3-fg]quinoline-9-carboxamide (6aR,9R,10aR)-N-[(2R,4R,9aS,9bR)-9b-hydroxy-3,5-dioxo-2,4-di(propan-2-yl)-3a,4,7,8,9,9a-hexahydrofuro[3,2-g]indolizin-2-yl]-7-methyl-6,6a,8,9,10,10a-hexahydro-4H-indolo[4,3-fg]quinoline-9-carboxamide (6aR,10aR)-N-[(2S,4S,9bS)-9b-hydroxy-4-(2-methylpropyl)-3,5-dioxo-2-propan-2-yl-3a,4,7,8,9,9a-hexahydrofuro[3,2-g]indolizin-2-yl]-7-methyl-6,6a,8,9,10,10a-hexahydro-4H-indolo[4,3-fg]quinoline-9-carboxamide methanesulfonic acid Chemical compound CS(O)(=O)=O.CS(O)(=O)=O.CS(O)(=O)=O.C1=CC([C@H]2C[C@H](CN(C)[C@@H]2C2)C(=O)N[C@]3(C(=O)C4[C@H](C(N5CCC[C@H]5[C@]4(O)O3)=O)C(C)C)C(C)C)=C3C2=CNC3=C1.C1=CC([C@H]2CC(CN(C)[C@@H]2C2)C(=O)N[C@@]3(C(=O)C4[C@@H](C(N5CCCC5[C@@]4(O)O3)=O)CC(C)C)C(C)C)=C3C2=CNC3=C1.C([C@H]1C(=O)N2CCC[C@H]2[C@]2(O)O[C@](C(C21)=O)(NC(=O)[C@H]1CN(C)[C@H]2[C@@H](C=3C=CC=C4NC=C(C=34)C2)C1)C(C)C)C1=CC=CC=C1 QHZUABXEBRGBLP-LKWYKXIFSA-N 0.000 description 1
- BMUKKTUHUDJSNZ-UHFFFAOYSA-N 4-[1-hydroxy-2-(1-phenoxypropan-2-ylamino)propyl]phenol Chemical compound C=1C=C(O)C=CC=1C(O)C(C)NC(C)COC1=CC=CC=C1 BMUKKTUHUDJSNZ-UHFFFAOYSA-N 0.000 description 1
- 206010054196 Affect lability Diseases 0.000 description 1
- 206010001497 Agitation Diseases 0.000 description 1
- 206010002091 Anaesthesia Diseases 0.000 description 1
- 206010002660 Anoxia Diseases 0.000 description 1
- 241000976983 Anoxia Species 0.000 description 1
- 201000006474 Brain Ischemia Diseases 0.000 description 1
- 206010008120 Cerebral ischaemia Diseases 0.000 description 1
- 206010010305 Confusional state Diseases 0.000 description 1
- 101710088194 Dehydrogenase Proteins 0.000 description 1
- 208000010201 Exanthema Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 206010017711 Gangrene Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- 206010021143 Hypoxia Diseases 0.000 description 1
- 206010021639 Incontinence Diseases 0.000 description 1
- 206010061216 Infarction Diseases 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 206010028347 Muscle twitching Diseases 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- 102000004357 Transferases Human genes 0.000 description 1
- 108090000992 Transferases Proteins 0.000 description 1
- 206010044565 Tremor Diseases 0.000 description 1
- 206010054880 Vascular insufficiency Diseases 0.000 description 1
- 238000002679 ablation Methods 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N adenyl group Chemical class N1=CN=C2N=CNC2=C1N GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 230000037005 anaesthesia Effects 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000007953 anoxia Effects 0.000 description 1
- 230000002253 anti-ischaemic effect Effects 0.000 description 1
- 206010003119 arrhythmia Diseases 0.000 description 1
- 230000006793 arrhythmia Effects 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 230000006399 behavior Effects 0.000 description 1
- 229960003237 betaine Drugs 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 230000036471 bradycardia Effects 0.000 description 1
- 208000006218 bradycardia Diseases 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 210000001627 cerebral artery Anatomy 0.000 description 1
- 206010008118 cerebral infarction Diseases 0.000 description 1
- 208000026106 cerebrovascular disease Diseases 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 230000003749 cleanliness Effects 0.000 description 1
- 230000002566 clonic effect Effects 0.000 description 1
- 230000036461 convulsion Effects 0.000 description 1
- WZHCOOQXZCIUNC-UHFFFAOYSA-N cyclandelate Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C(O)C1=CC=CC=C1 WZHCOOQXZCIUNC-UHFFFAOYSA-N 0.000 description 1
- 229960000729 cyclandelate Drugs 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 230000009429 distress Effects 0.000 description 1
- 208000002173 dizziness Diseases 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 201000005884 exanthem Diseases 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 230000004129 fatty acid metabolism Effects 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 235000012631 food intake Nutrition 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 230000000004 hemodynamic effect Effects 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 230000007574 infarction Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 229960004819 isoxsuprine Drugs 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000015654 memory Effects 0.000 description 1
- 230000003340 mental effect Effects 0.000 description 1
- 230000006996 mental state Effects 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000008450 motivation Effects 0.000 description 1
- 230000002107 myocardial effect Effects 0.000 description 1
- 208000031225 myocardial ischemia Diseases 0.000 description 1
- 125000001820 oxy group Chemical group [*:1]O[*:2] 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 208000037920 primary disease Diseases 0.000 description 1
- 230000010344 pupil dilation Effects 0.000 description 1
- 206010037844 rash Diseases 0.000 description 1
- 230000035484 reaction time Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000006403 short-term memory Effects 0.000 description 1
- 210000005070 sphincter Anatomy 0.000 description 1
- 230000008925 spontaneous activity Effects 0.000 description 1
- 108010003641 statine renin inhibitory peptide Proteins 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 210000003371 toe Anatomy 0.000 description 1
- 238000003325 tomography Methods 0.000 description 1
- 208000023577 vascular insufficiency disease Diseases 0.000 description 1
- 230000024883 vasodilation Effects 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 230000005428 wave function Effects 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/185—Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
- A61K31/205—Amine addition salts of organic acids; Inner quaternary ammonium salts, e.g. betaine, carnitine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/21—Esters, e.g. nitroglycerine, selenocyanates
- A61K31/215—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids
- A61K31/22—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids of acyclic acids, e.g. pravastatin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/21—Esters, e.g. nitroglycerine, selenocyanates
- A61K31/215—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids
- A61K31/22—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids of acyclic acids, e.g. pravastatin
- A61K31/23—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids of acyclic acids, e.g. pravastatin of acids having a carboxyl group bound to a chain of seven or more carbon atoms
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Emergency Medicine (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| IT7947976A IT1206954B (it) | 1979-02-12 | 1979-02-12 | Agenti terapeutici a base di un acil derivato della carnitina per la cura di vasculopatie periferiche |
| IT50795/79A IT1164062B (it) | 1979-11-09 | 1979-11-09 | Composizione farmaceutica comprendente una acil-carnitina per il trattamento del rallentato metabolismo cerebrale |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| DE3005208A1 DE3005208A1 (de) | 1980-08-21 |
| DE3005208C2 true DE3005208C2 (enExample) | 1989-12-28 |
Family
ID=26329263
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DE19803005208 Granted DE3005208A1 (de) | 1979-02-12 | 1980-02-12 | Verwendung von acylcarnitin in arzneimitteln zur behandlung von stoerungen im gehirn-metabolismus |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US4346107A (enExample) |
| AU (1) | AU535518B2 (enExample) |
| BE (1) | BE881680A (enExample) |
| CH (1) | CH641673A5 (enExample) |
| DE (1) | DE3005208A1 (enExample) |
| FR (1) | FR2448348A1 (enExample) |
| GB (1) | GB2046593A (enExample) |
| NL (1) | NL8000768A (enExample) |
Families Citing this family (56)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IT1198434B (it) * | 1981-01-06 | 1988-12-21 | Sigma Tau Ind Farmaceuti | Composizione farmaceutica comprendente gamma butirrobetaina per il trattamento di sindromi da carenze di carnitina |
| IT1142934B (it) * | 1981-11-06 | 1986-10-15 | Sigma Tau Ind Farmaceuti | Uso della carnitina e delle acilcarnitine inferiori nel trattamento terapeutico della patologia delle vene |
| IT1157238B (it) * | 1982-10-29 | 1987-02-11 | Sigma Tau Ind Farmaceuti | Impiego di 1-carnitina per migliorare i paramenti biochimici e comportamentali dell'eta' senile |
| IT1150396B (it) * | 1982-12-09 | 1986-12-10 | Sigma Tau Ind Farmaceuti | Impiego di alcanoil l-carnitine per il trattamento terapeutico di miopa tie e distrofie muscolari |
| CH655005A5 (it) * | 1983-02-16 | 1986-03-27 | Sigma Tau Ind Farmaceuti | Composizione farmaceutica ad azione metabolica ed energetica utilizzabile in terapia cardiaca e vascolare. |
| IT1181682B (it) * | 1985-06-11 | 1987-09-30 | Sigma Tau Ind Farmaceuti | Impiego di alcanoil l-carnitine per il trattamento terapeutico del parkinsonismo idiopatico o indotto |
| IT1184655B (it) * | 1985-10-14 | 1987-10-28 | Sigma Tau Ind Farmaceuti | Imiego di acetil l-carnitina nel trattamento terapeutico degli stati di shock |
| IT1195852B (it) * | 1986-07-04 | 1988-10-27 | Sigma Tau Ind Farmaceuti | Impiego di l-carnitina nel trattamento degli effetti tossici indotti dall'inalazione di alotano e di altri anestitici generali alogenati |
| IT1196564B (it) * | 1986-08-04 | 1988-11-16 | Sigma Tau Ind Farmaceuti | Impiego di acetil l-carnitina nel trattamento terapeutico delle neuropatie periferiche |
| SE8701662L (sv) * | 1987-04-22 | 1988-10-23 | Gelder Nico M Van | Saett och medel foer att behandla neurologiska sjukdomar, exempelvis migraen genom paaverkan av nervcellerna |
| IT1224842B (it) * | 1988-12-27 | 1990-10-24 | Sigma Tau Ind Farmaceuti | Uso di derivati della l-carnitina nel trattamento terapeutico delle alterazioni degenerative del sistema nervoso |
| IT1230141B (it) * | 1989-05-03 | 1991-10-14 | Fidia Spa | Impiego di derivati della fosfatidil carnitina per la preparazione di composizioni farmaceutiche aventi attivita' nella terapia delle patologie dell'uomo associate con un danno neuronale. |
| IT1244636B (it) * | 1991-01-04 | 1994-08-08 | Sigma Tau Ind Farmaceuti | Uso dell'acetil l-carnitina nel trattamento terapeutico del coma e composizioni farmaceutiche utili in tale trattamento. |
| IT1263004B (it) * | 1992-10-08 | 1996-07-23 | Sigma Tau Ind Farmaceuti | Impiego della l-carnitina e acil l-carnitine nel trattamento a lungo termine di pazienti diabetici non insulino-dipendenti. |
| JP4598203B2 (ja) | 1995-12-01 | 2010-12-15 | ビーティージー・インターナショナル・リミテッド | 脳機能改善剤 |
| IT1284650B1 (it) * | 1996-05-24 | 1998-05-21 | Sigma Tau Ind Farmaceuti | Farmaco a base di un derivato della carnitina per il trattamento della demenza di alzheimer in pazienti ad insorgenza precoce della patologia |
| US20090253781A1 (en) * | 2002-05-24 | 2009-10-08 | Btg International Limited | Therapeutic compositions |
| US6316038B1 (en) | 1997-03-17 | 2001-11-13 | Btg International Limited | Therapeutic compositions |
| CA2283642C (en) * | 1997-03-17 | 2012-05-15 | Btg International Limited | Therapeutic compositions |
| US6323237B1 (en) | 1997-03-17 | 2001-11-27 | Btg International Limited | Therapeutic compositions |
| IT1291127B1 (it) | 1997-04-01 | 1998-12-29 | Sigma Tau Ind Farmaceuti | Integratore alimentare per soggetti dediti ad intensa e prolungata attivita' fisica |
| US5889055A (en) * | 1997-04-04 | 1999-03-30 | Howard; James R. | L-carnitine and acetyl-L-carnitine combined for prevention and treatment of syndromes related to diseases of energy metabolism |
| US5869528A (en) * | 1997-07-22 | 1999-02-09 | Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. | Therapeutical method for the treatment of attention-deficit/hyperactive disorders |
| IT1299195B1 (it) * | 1998-06-25 | 2000-02-29 | Sigma Tau Healthscience Spa | Composizione ad attivita' neuroprotettiva per la prevenzione ed il trattamento delle alterazioni nervose e comportamentali legate a stati |
| IT1302365B1 (it) * | 1998-10-09 | 2000-09-05 | Sigma Tau Healthscience Spa | Uso di carnitine e resveratrolo per produrre una composizione per laprevenzione o il trattamento terapeutico di alterazioni cerebrali |
| WO2001032168A1 (en) * | 1999-11-03 | 2001-05-10 | Juvenon, Inc. | Method of treating benign forgetfulness |
| US20080009467A1 (en) * | 2000-05-01 | 2008-01-10 | Accera, Inc. | Combinations of medium chain triglycerides and therapeutic agents for the treatment and prevention of alzheimers disease and other diseases resulting from reduced neuronal metabolism |
| US6835750B1 (en) | 2000-05-01 | 2004-12-28 | Accera, Inc. | Use of medium chain triglycerides for the treatment and prevention of alzheimer's disease and other diseases resulting from reduced neuronal metabolism II |
| US20070179197A1 (en) * | 2000-05-01 | 2007-08-02 | Accera, Inc. | Compositions and methods for improving or preserving brain function |
| WO2001082928A1 (en) * | 2000-05-01 | 2001-11-08 | Accera, Inc. | Use of medium chain triglycerides for the treatment and prevention of alzheimer's disease and other diseases resulting from reduced neuronal metabolism |
| US8124589B2 (en) * | 2000-05-01 | 2012-02-28 | Accera, Inc. | Use of ketogenic compounds for treatment of age-associated memory impairment |
| EP1399143B1 (en) * | 2001-05-29 | 2006-11-15 | Sigma-Tau Industrie Farmaceutiche Riunite S.p.A. | Use of acetyl l-carnitine for the preparation of a medication to treat anhedonia |
| US7407778B2 (en) * | 2002-02-07 | 2008-08-05 | Pettegrew Jay W | Compounds, compositions and methods for treating neuropsychiatric disorders |
| US20100010336A1 (en) * | 2002-02-07 | 2010-01-14 | Pettegrew Jay W | Method and system for diagnosis of neuropsychiatric disorders including attention deficit hyperactivity disorder (adhd), autism, and schizophrenia |
| US7700074B2 (en) * | 2002-02-07 | 2010-04-20 | Pettegrew Jay W | Method and system for diagnosis of neuropsychiatric disorders including chronic alcoholism |
| JP2005523269A (ja) * | 2002-02-07 | 2005-08-04 | シグマ−タウ・インドゥストリエ・ファルマチェウチケ・リウニテ・ソシエタ・ペル・アチオニ | 老人性うつ病の治療におけるカルニチン |
| US8894973B2 (en) * | 2002-02-07 | 2014-11-25 | Jay W. Pettegrew | Method and system for differential diagnosis of chronic schizophrenia and chronic alcoholism |
| US20050272812A1 (en) * | 2002-02-07 | 2005-12-08 | Pettegrew Jay W | Methor for use of acetyl-L-carnitine (ALCAR) for treatment of depressive disorders in humans |
| US20060257842A1 (en) * | 2003-05-29 | 2006-11-16 | Pettegrew Jay W | Cryopreservation media and molecules |
| CN1795198B (zh) * | 2003-05-29 | 2011-08-17 | 杰伊·W·佩特格尤 | 对神经精神疾病进行医学成像所用的甘油磷酸胆碱及其衍生物 |
| US20050232911A1 (en) * | 2004-04-19 | 2005-10-20 | Schreiber Brian D | Prevention and treatment of metabolic abnormalities associated with excess intramyocellular lipid |
| GB0420856D0 (en) * | 2004-09-20 | 2004-10-20 | Ketocytonyx Inc | Cns modulators |
| USD516320S1 (en) | 2004-07-15 | 2006-03-07 | The Procter & Gamble Company | Surface pattern of a paper product |
| WO2006020137A2 (en) | 2004-07-16 | 2006-02-23 | Ketocytonyx Inc. | Oligomeric compounds |
| WO2006020179A2 (en) * | 2004-07-20 | 2006-02-23 | Ketocytonyx Inc. | Oligomeric ketone compounds |
| EP1778212A4 (en) * | 2004-07-23 | 2010-12-08 | Btg Int Ltd | SACCHARIDES CETOGENES |
| US20070197645A1 (en) * | 2004-09-21 | 2007-08-23 | Martin Keith F | Treatment of adhd |
| ES2574557T3 (es) * | 2004-09-21 | 2016-06-20 | Btg International Limited | Miméticos dopaminérgicos |
| USD510665S1 (en) | 2004-09-29 | 2005-10-18 | The Procter & Gamble Company | Surface pattern for an embossed paper product |
| US20060252775A1 (en) * | 2005-05-03 | 2006-11-09 | Henderson Samuel T | Methods for reducing levels of disease associated proteins |
| EP2468273A3 (en) * | 2005-06-20 | 2012-07-11 | Accera, Inc. | Method to reduce oxidative damage and improve mitochondrial efficiency |
| ES2556534T3 (es) | 2007-07-31 | 2016-01-18 | Accera, Inc. | Uso de ensayo genómico y compuestos cetogénicos para tratamiento de una función cognitiva reducida |
| US9125881B2 (en) * | 2008-07-03 | 2015-09-08 | Accera, Inc. | Monoglyceride of acetoacetate and derivatives for the treatment of neurological disorders |
| ES2670836T3 (es) | 2010-06-16 | 2018-06-01 | Alfasigma S.P.A. | Acetil-carnitina para uso en un método para incrementar la neurogénesis en el tejido neuronal |
| WO2021228788A1 (en) | 2020-05-15 | 2021-11-18 | Alfasigma S.P.A. | Composition comprising methylfolate |
| IT202100020729A1 (it) | 2021-08-02 | 2023-02-02 | Univ Degli Studi Di Napoli Federico Ii | Preparazione combinata per il trattamento della malattia di Pompe |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| BE700864A (enExample) * | 1967-07-03 | 1967-12-18 | ||
| GB1256162A (en) * | 1968-08-16 | 1971-12-08 | Braun Fa B | Improvements in and relating to liquid products for intravenous administration |
| US3810994A (en) * | 1972-06-01 | 1974-05-14 | Ethyl Corp | Method and composition for treating obesity |
| JPS531812B2 (enExample) * | 1972-12-07 | 1978-01-23 | ||
| AU518617B2 (en) * | 1977-04-29 | 1981-10-08 | Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. | Therapeutic application of acetyl-d, 1-carnitine |
| IT1143611B (it) * | 1977-11-03 | 1986-10-22 | Sigma Tau Ind Farmaceuti | Applicazione della acetil-carnitina nella terapia delle affezioni cardiache di/tipo anossico,ischemico,cardiotossico e nelle sindromi aritmiche |
| FR2414914A1 (fr) * | 1978-01-18 | 1979-08-17 | Sigma Tau Ind Farmaceuti | Utilisations therapeutiques nouvelles de l'acetyl-1-carnitine et d'autres derives acyles de la 1-carnitine |
| IT1156741B (it) * | 1978-05-15 | 1987-02-04 | Sigma Tau Ind Farmaceuti | Applicazione terapeutica della carnitina e di alcuni derivati acilati della carnitina nell'emodialisi |
-
1980
- 1980-02-05 US US06/119,075 patent/US4346107A/en not_active Expired - Lifetime
- 1980-02-06 AU AU55267/80A patent/AU535518B2/en not_active Expired
- 1980-02-07 NL NL8000768A patent/NL8000768A/nl not_active Application Discontinuation
- 1980-02-08 CH CH102880A patent/CH641673A5/it not_active IP Right Cessation
- 1980-02-12 GB GB8004602A patent/GB2046593A/en not_active Withdrawn
- 1980-02-12 DE DE19803005208 patent/DE3005208A1/de active Granted
- 1980-02-12 BE BE0/199368A patent/BE881680A/fr not_active IP Right Cessation
- 1980-02-12 FR FR8003015A patent/FR2448348A1/fr active Pending
Also Published As
| Publication number | Publication date |
|---|---|
| NL8000768A (nl) | 1980-08-14 |
| GB2046593A (en) | 1980-11-19 |
| US4346107A (en) | 1982-08-24 |
| CH641673A5 (it) | 1984-03-15 |
| DE3005208A1 (de) | 1980-08-21 |
| AU535518B2 (en) | 1984-03-29 |
| AU5526780A (en) | 1980-08-21 |
| FR2448348A1 (fr) | 1980-09-05 |
| BE881680A (fr) | 1980-05-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DE3005208C2 (enExample) | ||
| DE69028542T2 (de) | Felbamat zur Behandlung der Lennox-Gastaut syndrome | |
| DE2911670A1 (de) | Arzneimittel zur therapeutischen behandlung von peripheren vaskularen erkrankungen | |
| DE3780618T2 (de) | Verwendung von buspiron zur verbesserung des kurzzeitgedaechtnisses. | |
| CH653891A5 (de) | Mittel fuer die orale verabreichung an einen menschen und/oder ein saeugetier. | |
| DE3247062A1 (de) | Verwendung eines chelatbildners als arzneimittel zur behandlung der alzheimer-krankheit | |
| DE69201660T2 (de) | Verwendung von Acetyl L-Carnitin zur therapeutischen Behandlung von Coma. | |
| DE69605531T2 (de) | Carnitinderivat als Arzneimittel zur Behandlung von Arteriosklerose obliterans | |
| DE4232899C2 (de) | Verwendung von NADH und NADPH zur Behandlung von Morbus Alzheimer | |
| CH695983A5 (de) | Tetraiodthyropropionsäure oder Tetraiodthyroessigsäure zur Herstellung eines dermatologischen Präparates. | |
| DE3639378A1 (de) | Acyloxyalkanoylcholin-salze zur linderung und therapie von dementia | |
| DE4214953A1 (de) | Arzneimittel zur Erhöhung des Testosteronspiegels | |
| CH670952A5 (enExample) | ||
| DE69829290T2 (de) | Verwendung von alkanoylcarnitinderivaten zur behandlung von hyperaktivität mit aufmerksamkeitsstörungen | |
| DE3344173C2 (de) | Verwendung von alkanoyl-l-carnitin zur behandlung von myopathien oder muskulaeren dystrophien | |
| WO2003099265A2 (de) | Pharmazeutische wirkstoffkombination sowie deren verwendung | |
| EP1001756B1 (de) | Synergistisch wirkende zusammensetzungen zur selektiven bekämpfung von tumorgewebe | |
| DE60305534T2 (de) | Verwendung von docosahexaensäure als wirkstoff bei der behandlung von lipodystrophie | |
| DE602004003173T2 (de) | Verwendung von konjugierter Linolsäure zur Behandlung der Erkältung | |
| DE69821970T2 (de) | Verwendung von CITICOLINE ZUR BEHANDLUNG VON MULTIPLER SKLEROSE | |
| DE2611976A1 (de) | Pharmazeutisches praeparat zur besserung und wiederherstellung bei verminderten bewusstseinszustaenden | |
| DE19629802A1 (de) | Arzneimittel zur Behandlung von Neuropathien | |
| DE60109799T2 (de) | Verwendung von quetiapin für aufmerksamkeitsmangel-hyperaktivitätsstörungen oder verhaltensstörungen | |
| DE60012183T2 (de) | Verwendung einer makrolid-verbindung zur herstellung eines medikaments zur behandlung von gehirnschäden aufgrund von ischämie oder blutungen | |
| DE19731432C2 (de) | Verwendung von Cholincitrat |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 8110 | Request for examination paragraph 44 | ||
| 8125 | Change of the main classification |
Ipc: A61K 31/205 |
|
| D2 | Grant after examination | ||
| 8364 | No opposition during term of opposition |