DE3005208C2 - - Google Patents
Info
- Publication number
- DE3005208C2 DE3005208C2 DE3005208A DE3005208A DE3005208C2 DE 3005208 C2 DE3005208 C2 DE 3005208C2 DE 3005208 A DE3005208 A DE 3005208A DE 3005208 A DE3005208 A DE 3005208A DE 3005208 C2 DE3005208 C2 DE 3005208C2
- Authority
- DE
- Germany
- Prior art keywords
- cerebral
- treatment
- patients
- brain
- dementia
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired
Links
- 230000002490 cerebral effect Effects 0.000 claims description 16
- MEFKEPWMEQBLKI-AIRLBKTGSA-O S-adenosyl-L-methionine Chemical compound O[C@@H]1[C@H](O)[C@@H](C[S+](CC[C@H]([NH3+])C([O-])=O)C)O[C@H]1N1C2=NC=NC(N)=C2N=C1 MEFKEPWMEQBLKI-AIRLBKTGSA-O 0.000 claims description 10
- 206010012289 Dementia Diseases 0.000 claims description 4
- 150000003839 salts Chemical class 0.000 claims description 3
- 125000002339 acetoacetyl group Chemical group O=C([*])C([H])([H])C(=O)C([H])([H])[H] 0.000 claims 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 claims 1
- 239000002253 acid Substances 0.000 claims 1
- 125000004063 butyryl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 claims 1
- -1 hydroxybutyryl Chemical group 0.000 claims 1
- 125000001501 propionyl group Chemical group O=C([*])C([H])([H])C([H])([H])[H] 0.000 claims 1
- 230000000694 effects Effects 0.000 description 14
- 210000004556 brain Anatomy 0.000 description 12
- 229960001009 acetylcarnitine Drugs 0.000 description 10
- 239000003814 drug Substances 0.000 description 10
- RDHQFKQIGNGIED-MRVPVSSYSA-N O-acetyl-L-carnitine Chemical compound CC(=O)O[C@H](CC([O-])=O)C[N+](C)(C)C RDHQFKQIGNGIED-MRVPVSSYSA-N 0.000 description 9
- 229940079593 drug Drugs 0.000 description 7
- 229940124549 vasodilator Drugs 0.000 description 7
- 239000003071 vasodilator agent Substances 0.000 description 7
- 208000024827 Alzheimer disease Diseases 0.000 description 6
- 230000006872 improvement Effects 0.000 description 6
- 230000001575 pathological effect Effects 0.000 description 6
- 230000001537 neural effect Effects 0.000 description 5
- 230000009758 senescence Effects 0.000 description 5
- 230000004060 metabolic process Effects 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 3
- 206010039966 Senile dementia Diseases 0.000 description 3
- 230000004888 barrier function Effects 0.000 description 3
- 230000003727 cerebral blood flow Effects 0.000 description 3
- 230000000302 ischemic effect Effects 0.000 description 3
- 230000037023 motor activity Effects 0.000 description 3
- 230000002093 peripheral effect Effects 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- PHIQHXFUZVPYII-ZCFIWIBFSA-N (R)-carnitine Chemical compound C[N+](C)(C)C[C@H](O)CC([O-])=O PHIQHXFUZVPYII-ZCFIWIBFSA-N 0.000 description 2
- 208000001953 Hypotension Diseases 0.000 description 2
- 206010036631 Presenile dementia Diseases 0.000 description 2
- 201000004810 Vascular dementia Diseases 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- 230000017531 blood circulation Effects 0.000 description 2
- 229960004203 carnitine Drugs 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 238000011010 flushing procedure Methods 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 230000036543 hypotension Effects 0.000 description 2
- 208000028867 ischemia Diseases 0.000 description 2
- 238000000034 method Methods 0.000 description 2
- 210000000653 nervous system Anatomy 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 230000002792 vascular Effects 0.000 description 2
- QHZUABXEBRGBLP-LKWYKXIFSA-N (6aR,9R,10aR)-N-[(2R,4R,9aS,9bR)-4-benzyl-9b-hydroxy-3,5-dioxo-2-propan-2-yl-3a,4,7,8,9,9a-hexahydrofuro[3,2-g]indolizin-2-yl]-7-methyl-6,6a,8,9,10,10a-hexahydro-4H-indolo[4,3-fg]quinoline-9-carboxamide (6aR,9R,10aR)-N-[(2R,4R,9aS,9bR)-9b-hydroxy-3,5-dioxo-2,4-di(propan-2-yl)-3a,4,7,8,9,9a-hexahydrofuro[3,2-g]indolizin-2-yl]-7-methyl-6,6a,8,9,10,10a-hexahydro-4H-indolo[4,3-fg]quinoline-9-carboxamide (6aR,10aR)-N-[(2S,4S,9bS)-9b-hydroxy-4-(2-methylpropyl)-3,5-dioxo-2-propan-2-yl-3a,4,7,8,9,9a-hexahydrofuro[3,2-g]indolizin-2-yl]-7-methyl-6,6a,8,9,10,10a-hexahydro-4H-indolo[4,3-fg]quinoline-9-carboxamide methanesulfonic acid Chemical compound CS(O)(=O)=O.CS(O)(=O)=O.CS(O)(=O)=O.C1=CC([C@H]2C[C@H](CN(C)[C@@H]2C2)C(=O)N[C@]3(C(=O)C4[C@H](C(N5CCC[C@H]5[C@]4(O)O3)=O)C(C)C)C(C)C)=C3C2=CNC3=C1.C1=CC([C@H]2CC(CN(C)[C@@H]2C2)C(=O)N[C@@]3(C(=O)C4[C@@H](C(N5CCCC5[C@@]4(O)O3)=O)CC(C)C)C(C)C)=C3C2=CNC3=C1.C([C@H]1C(=O)N2CCC[C@H]2[C@]2(O)O[C@](C(C21)=O)(NC(=O)[C@H]1CN(C)[C@H]2[C@@H](C=3C=CC=C4NC=C(C=34)C2)C1)C(C)C)C1=CC=CC=C1 QHZUABXEBRGBLP-LKWYKXIFSA-N 0.000 description 1
- BMUKKTUHUDJSNZ-UHFFFAOYSA-N 4-[1-hydroxy-2-(1-phenoxypropan-2-ylamino)propyl]phenol Chemical compound C=1C=C(O)C=CC=1C(O)C(C)NC(C)COC1=CC=CC=C1 BMUKKTUHUDJSNZ-UHFFFAOYSA-N 0.000 description 1
- 206010054196 Affect lability Diseases 0.000 description 1
- 206010001497 Agitation Diseases 0.000 description 1
- 206010002091 Anaesthesia Diseases 0.000 description 1
- 206010002660 Anoxia Diseases 0.000 description 1
- 241000976983 Anoxia Species 0.000 description 1
- 201000006474 Brain Ischemia Diseases 0.000 description 1
- 206010008120 Cerebral ischaemia Diseases 0.000 description 1
- 206010010305 Confusional state Diseases 0.000 description 1
- 101710088194 Dehydrogenase Proteins 0.000 description 1
- 208000010201 Exanthema Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 206010017711 Gangrene Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- 206010021143 Hypoxia Diseases 0.000 description 1
- 206010021639 Incontinence Diseases 0.000 description 1
- 206010061216 Infarction Diseases 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 206010028347 Muscle twitching Diseases 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- 102000004357 Transferases Human genes 0.000 description 1
- 108090000992 Transferases Proteins 0.000 description 1
- 206010044565 Tremor Diseases 0.000 description 1
- 206010054880 Vascular insufficiency Diseases 0.000 description 1
- 238000002679 ablation Methods 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N adenyl group Chemical class N1=CN=C2N=CNC2=C1N GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 230000037005 anaesthesia Effects 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000007953 anoxia Effects 0.000 description 1
- 230000002253 anti-ischaemic effect Effects 0.000 description 1
- 206010003119 arrhythmia Diseases 0.000 description 1
- 230000006793 arrhythmia Effects 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 230000006399 behavior Effects 0.000 description 1
- 229960003237 betaine Drugs 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 230000036471 bradycardia Effects 0.000 description 1
- 208000006218 bradycardia Diseases 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 210000001627 cerebral artery Anatomy 0.000 description 1
- 206010008118 cerebral infarction Diseases 0.000 description 1
- 208000026106 cerebrovascular disease Diseases 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 230000003749 cleanliness Effects 0.000 description 1
- 230000002566 clonic effect Effects 0.000 description 1
- 230000036461 convulsion Effects 0.000 description 1
- WZHCOOQXZCIUNC-UHFFFAOYSA-N cyclandelate Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C(O)C1=CC=CC=C1 WZHCOOQXZCIUNC-UHFFFAOYSA-N 0.000 description 1
- 229960000729 cyclandelate Drugs 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 230000009429 distress Effects 0.000 description 1
- 208000002173 dizziness Diseases 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 201000005884 exanthem Diseases 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 230000004129 fatty acid metabolism Effects 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 235000012631 food intake Nutrition 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 230000000004 hemodynamic effect Effects 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 230000007574 infarction Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 229960004819 isoxsuprine Drugs 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000015654 memory Effects 0.000 description 1
- 230000003340 mental effect Effects 0.000 description 1
- 230000006996 mental state Effects 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000008450 motivation Effects 0.000 description 1
- 230000002107 myocardial effect Effects 0.000 description 1
- 208000031225 myocardial ischemia Diseases 0.000 description 1
- 125000001820 oxy group Chemical group [*:1]O[*:2] 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 208000037920 primary disease Diseases 0.000 description 1
- 230000010344 pupil dilation Effects 0.000 description 1
- 206010037844 rash Diseases 0.000 description 1
- 230000035484 reaction time Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000006403 short-term memory Effects 0.000 description 1
- 210000005070 sphincter Anatomy 0.000 description 1
- 230000008925 spontaneous activity Effects 0.000 description 1
- 108010003641 statine renin inhibitory peptide Proteins 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 210000003371 toe Anatomy 0.000 description 1
- 238000003325 tomography Methods 0.000 description 1
- 208000023577 vascular insufficiency disease Diseases 0.000 description 1
- 230000024883 vasodilation Effects 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 230000005428 wave function Effects 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/185—Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
- A61K31/205—Amine addition salts of organic acids; Inner quaternary ammonium salts, e.g. betaine, carnitine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/21—Esters, e.g. nitroglycerine, selenocyanates
- A61K31/215—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids
- A61K31/22—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids of acyclic acids, e.g. pravastatin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/21—Esters, e.g. nitroglycerine, selenocyanates
- A61K31/215—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids
- A61K31/22—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids of acyclic acids, e.g. pravastatin
- A61K31/23—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids of acyclic acids, e.g. pravastatin of acids having a carboxyl group bound to a chain of seven or more carbon atoms
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Emergency Medicine (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| IT7947976A IT1206954B (it) | 1979-02-12 | 1979-02-12 | Agenti terapeutici a base di un acil derivato della carnitina per la cura di vasculopatie periferiche |
| IT50795/79A IT1164062B (it) | 1979-11-09 | 1979-11-09 | Composizione farmaceutica comprendente una acil-carnitina per il trattamento del rallentato metabolismo cerebrale |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| DE3005208A1 DE3005208A1 (de) | 1980-08-21 |
| DE3005208C2 true DE3005208C2 (enExample) | 1989-12-28 |
Family
ID=26329263
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DE19803005208 Granted DE3005208A1 (de) | 1979-02-12 | 1980-02-12 | Verwendung von acylcarnitin in arzneimitteln zur behandlung von stoerungen im gehirn-metabolismus |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US4346107A (enExample) |
| AU (1) | AU535518B2 (enExample) |
| BE (1) | BE881680A (enExample) |
| CH (1) | CH641673A5 (enExample) |
| DE (1) | DE3005208A1 (enExample) |
| FR (1) | FR2448348A1 (enExample) |
| GB (1) | GB2046593A (enExample) |
| NL (1) | NL8000768A (enExample) |
Families Citing this family (56)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IT1198434B (it) * | 1981-01-06 | 1988-12-21 | Sigma Tau Ind Farmaceuti | Composizione farmaceutica comprendente gamma butirrobetaina per il trattamento di sindromi da carenze di carnitina |
| IT1142934B (it) * | 1981-11-06 | 1986-10-15 | Sigma Tau Ind Farmaceuti | Uso della carnitina e delle acilcarnitine inferiori nel trattamento terapeutico della patologia delle vene |
| IT1157238B (it) * | 1982-10-29 | 1987-02-11 | Sigma Tau Ind Farmaceuti | Impiego di 1-carnitina per migliorare i paramenti biochimici e comportamentali dell'eta' senile |
| IT1150396B (it) * | 1982-12-09 | 1986-12-10 | Sigma Tau Ind Farmaceuti | Impiego di alcanoil l-carnitine per il trattamento terapeutico di miopa tie e distrofie muscolari |
| CH655005A5 (it) * | 1983-02-16 | 1986-03-27 | Sigma Tau Ind Farmaceuti | Composizione farmaceutica ad azione metabolica ed energetica utilizzabile in terapia cardiaca e vascolare. |
| IT1181682B (it) * | 1985-06-11 | 1987-09-30 | Sigma Tau Ind Farmaceuti | Impiego di alcanoil l-carnitine per il trattamento terapeutico del parkinsonismo idiopatico o indotto |
| IT1184655B (it) * | 1985-10-14 | 1987-10-28 | Sigma Tau Ind Farmaceuti | Imiego di acetil l-carnitina nel trattamento terapeutico degli stati di shock |
| IT1195852B (it) * | 1986-07-04 | 1988-10-27 | Sigma Tau Ind Farmaceuti | Impiego di l-carnitina nel trattamento degli effetti tossici indotti dall'inalazione di alotano e di altri anestitici generali alogenati |
| IT1196564B (it) * | 1986-08-04 | 1988-11-16 | Sigma Tau Ind Farmaceuti | Impiego di acetil l-carnitina nel trattamento terapeutico delle neuropatie periferiche |
| SE8701662L (sv) * | 1987-04-22 | 1988-10-23 | Gelder Nico M Van | Saett och medel foer att behandla neurologiska sjukdomar, exempelvis migraen genom paaverkan av nervcellerna |
| IT1224842B (it) * | 1988-12-27 | 1990-10-24 | Sigma Tau Ind Farmaceuti | Uso di derivati della l-carnitina nel trattamento terapeutico delle alterazioni degenerative del sistema nervoso |
| IT1230141B (it) * | 1989-05-03 | 1991-10-14 | Fidia Spa | Impiego di derivati della fosfatidil carnitina per la preparazione di composizioni farmaceutiche aventi attivita' nella terapia delle patologie dell'uomo associate con un danno neuronale. |
| IT1244636B (it) * | 1991-01-04 | 1994-08-08 | Sigma Tau Ind Farmaceuti | Uso dell'acetil l-carnitina nel trattamento terapeutico del coma e composizioni farmaceutiche utili in tale trattamento. |
| IT1263004B (it) * | 1992-10-08 | 1996-07-23 | Sigma Tau Ind Farmaceuti | Impiego della l-carnitina e acil l-carnitine nel trattamento a lungo termine di pazienti diabetici non insulino-dipendenti. |
| JP4598203B2 (ja) * | 1995-12-01 | 2010-12-15 | ビーティージー・インターナショナル・リミテッド | 脳機能改善剤 |
| IT1284650B1 (it) * | 1996-05-24 | 1998-05-21 | Sigma Tau Ind Farmaceuti | Farmaco a base di un derivato della carnitina per il trattamento della demenza di alzheimer in pazienti ad insorgenza precoce della patologia |
| US6323237B1 (en) * | 1997-03-17 | 2001-11-27 | Btg International Limited | Therapeutic compositions |
| US6316038B1 (en) | 1997-03-17 | 2001-11-13 | Btg International Limited | Therapeutic compositions |
| KR100839689B1 (ko) * | 1997-03-17 | 2008-06-18 | 비티지 인터내셔널 리미티드 | 치료용 조성물 |
| US20090253781A1 (en) * | 2002-05-24 | 2009-10-08 | Btg International Limited | Therapeutic compositions |
| IT1291127B1 (it) * | 1997-04-01 | 1998-12-29 | Sigma Tau Ind Farmaceuti | Integratore alimentare per soggetti dediti ad intensa e prolungata attivita' fisica |
| US5889055A (en) * | 1997-04-04 | 1999-03-30 | Howard; James R. | L-carnitine and acetyl-L-carnitine combined for prevention and treatment of syndromes related to diseases of energy metabolism |
| US5869528A (en) * | 1997-07-22 | 1999-02-09 | Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. | Therapeutical method for the treatment of attention-deficit/hyperactive disorders |
| IT1299195B1 (it) * | 1998-06-25 | 2000-02-29 | Sigma Tau Healthscience Spa | Composizione ad attivita' neuroprotettiva per la prevenzione ed il trattamento delle alterazioni nervose e comportamentali legate a stati |
| IT1302365B1 (it) * | 1998-10-09 | 2000-09-05 | Sigma Tau Healthscience Spa | Uso di carnitine e resveratrolo per produrre una composizione per laprevenzione o il trattamento terapeutico di alterazioni cerebrali |
| WO2001032168A1 (en) * | 1999-11-03 | 2001-05-10 | Juvenon, Inc. | Method of treating benign forgetfulness |
| JP2003531857A (ja) * | 2000-05-01 | 2003-10-28 | アクセラ・インコーポレーテッド | アルツハイマー病およびニューロンの代謝の減少によって引き起こされる他の病気を治療および予防するための中鎖トリグリセリドの使用 |
| US6835750B1 (en) | 2000-05-01 | 2004-12-28 | Accera, Inc. | Use of medium chain triglycerides for the treatment and prevention of alzheimer's disease and other diseases resulting from reduced neuronal metabolism II |
| US20070179197A1 (en) * | 2000-05-01 | 2007-08-02 | Accera, Inc. | Compositions and methods for improving or preserving brain function |
| US20080009467A1 (en) * | 2000-05-01 | 2008-01-10 | Accera, Inc. | Combinations of medium chain triglycerides and therapeutic agents for the treatment and prevention of alzheimers disease and other diseases resulting from reduced neuronal metabolism |
| US20040171685A1 (en) * | 2001-05-29 | 2004-09-02 | Menotti Calvani | Use of an alkanoyl l-carnitine for the preparation of a medication to treat anhedonia |
| US20100010336A1 (en) * | 2002-02-07 | 2010-01-14 | Pettegrew Jay W | Method and system for diagnosis of neuropsychiatric disorders including attention deficit hyperactivity disorder (adhd), autism, and schizophrenia |
| US20050272812A1 (en) * | 2002-02-07 | 2005-12-08 | Pettegrew Jay W | Methor for use of acetyl-L-carnitine (ALCAR) for treatment of depressive disorders in humans |
| WO2003066041A1 (en) * | 2002-02-07 | 2003-08-14 | Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. | Carnitine in the treatment of geriatric depression |
| US7407778B2 (en) * | 2002-02-07 | 2008-08-05 | Pettegrew Jay W | Compounds, compositions and methods for treating neuropsychiatric disorders |
| US7700074B2 (en) * | 2002-02-07 | 2010-04-20 | Pettegrew Jay W | Method and system for diagnosis of neuropsychiatric disorders including chronic alcoholism |
| US8894973B2 (en) * | 2002-02-07 | 2014-11-25 | Jay W. Pettegrew | Method and system for differential diagnosis of chronic schizophrenia and chronic alcoholism |
| CN1795198B (zh) * | 2003-05-29 | 2011-08-17 | 杰伊·W·佩特格尤 | 对神经精神疾病进行医学成像所用的甘油磷酸胆碱及其衍生物 |
| US20060257842A1 (en) * | 2003-05-29 | 2006-11-16 | Pettegrew Jay W | Cryopreservation media and molecules |
| US20050232911A1 (en) * | 2004-04-19 | 2005-10-20 | Schreiber Brian D | Prevention and treatment of metabolic abnormalities associated with excess intramyocellular lipid |
| GB0420856D0 (en) * | 2004-09-20 | 2004-10-20 | Ketocytonyx Inc | Cns modulators |
| USD516320S1 (en) | 2004-07-15 | 2006-03-07 | The Procter & Gamble Company | Surface pattern of a paper product |
| EP1778213B1 (en) | 2004-07-16 | 2017-04-05 | BTG International Limited | A method for the synthesis of oligomeric compounds |
| WO2006020179A2 (en) * | 2004-07-20 | 2006-02-23 | Ketocytonyx Inc. | Oligomeric ketone compounds |
| US20070225252A1 (en) * | 2004-07-23 | 2007-09-27 | Gross Richard A | Ketogenic Saccharides |
| US20070197645A1 (en) * | 2004-09-21 | 2007-08-23 | Martin Keith F | Treatment of adhd |
| US20070281892A1 (en) * | 2004-09-21 | 2007-12-06 | Martin Keith F | Dopaminergic Mimetics |
| USD510665S1 (en) | 2004-09-29 | 2005-10-18 | The Procter & Gamble Company | Surface pattern for an embossed paper product |
| US20060252775A1 (en) * | 2005-05-03 | 2006-11-09 | Henderson Samuel T | Methods for reducing levels of disease associated proteins |
| US20070135376A1 (en) * | 2005-06-20 | 2007-06-14 | Accera, Inc. | Method to reduce oxidative damage and improve mitochondrial efficiency |
| KR101634083B1 (ko) * | 2006-04-03 | 2016-06-28 | 액세라인크 | 나이와 관련된 기억 손상의 치료를 위한 케톤 생성 조성물의 용도 |
| EP2650378B1 (en) | 2007-07-31 | 2015-09-16 | Accera, Inc. | Use of genomic testing and ketogenic compounds for treatment of reduced cognitive function |
| AU2009266869B2 (en) * | 2008-07-03 | 2016-07-07 | Cerecin Inc. | Monoglyceride of acetoacetate and derivatives for the treatment of neurological disorders |
| WO2011157642A1 (en) | 2010-06-16 | 2011-12-22 | Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. | Acetyl-carnitine for use in a method for increasing neurogenesis in neural tissue |
| MX2022012693A (es) | 2020-05-15 | 2022-11-07 | Alfasigma Spa | Composicion que comprende metilfolato. |
| IT202100020729A1 (it) | 2021-08-02 | 2023-02-02 | Univ Degli Studi Di Napoli Federico Ii | Preparazione combinata per il trattamento della malattia di Pompe |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| BE700864A (enExample) * | 1967-07-03 | 1967-12-18 | ||
| GB1256162A (en) * | 1968-08-16 | 1971-12-08 | Braun Fa B | Improvements in and relating to liquid products for intravenous administration |
| US3810994A (en) * | 1972-06-01 | 1974-05-14 | Ethyl Corp | Method and composition for treating obesity |
| JPS531812B2 (enExample) * | 1972-12-07 | 1978-01-23 | ||
| AU518617B2 (en) * | 1977-04-29 | 1981-10-08 | Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. | Therapeutic application of acetyl-d, 1-carnitine |
| IT1143611B (it) * | 1977-11-03 | 1986-10-22 | Sigma Tau Ind Farmaceuti | Applicazione della acetil-carnitina nella terapia delle affezioni cardiache di/tipo anossico,ischemico,cardiotossico e nelle sindromi aritmiche |
| FR2414914A1 (fr) * | 1978-01-18 | 1979-08-17 | Sigma Tau Ind Farmaceuti | Utilisations therapeutiques nouvelles de l'acetyl-1-carnitine et d'autres derives acyles de la 1-carnitine |
| IT1156741B (it) * | 1978-05-15 | 1987-02-04 | Sigma Tau Ind Farmaceuti | Applicazione terapeutica della carnitina e di alcuni derivati acilati della carnitina nell'emodialisi |
-
1980
- 1980-02-05 US US06/119,075 patent/US4346107A/en not_active Expired - Lifetime
- 1980-02-06 AU AU55267/80A patent/AU535518B2/en not_active Expired
- 1980-02-07 NL NL8000768A patent/NL8000768A/nl not_active Application Discontinuation
- 1980-02-08 CH CH102880A patent/CH641673A5/it not_active IP Right Cessation
- 1980-02-12 DE DE19803005208 patent/DE3005208A1/de active Granted
- 1980-02-12 GB GB8004602A patent/GB2046593A/en not_active Withdrawn
- 1980-02-12 FR FR8003015A patent/FR2448348A1/fr active Pending
- 1980-02-12 BE BE0/199368A patent/BE881680A/fr not_active IP Right Cessation
Also Published As
| Publication number | Publication date |
|---|---|
| US4346107A (en) | 1982-08-24 |
| GB2046593A (en) | 1980-11-19 |
| AU5526780A (en) | 1980-08-21 |
| BE881680A (fr) | 1980-05-30 |
| AU535518B2 (en) | 1984-03-29 |
| CH641673A5 (it) | 1984-03-15 |
| NL8000768A (nl) | 1980-08-14 |
| FR2448348A1 (fr) | 1980-09-05 |
| DE3005208A1 (de) | 1980-08-21 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DE3005208C2 (enExample) | ||
| DE69028542T2 (de) | Felbamat zur Behandlung der Lennox-Gastaut syndrome | |
| DE2911670A1 (de) | Arzneimittel zur therapeutischen behandlung von peripheren vaskularen erkrankungen | |
| DE3780618T2 (de) | Verwendung von buspiron zur verbesserung des kurzzeitgedaechtnisses. | |
| CH653891A5 (de) | Mittel fuer die orale verabreichung an einen menschen und/oder ein saeugetier. | |
| DE3247062A1 (de) | Verwendung eines chelatbildners als arzneimittel zur behandlung der alzheimer-krankheit | |
| DE69201660T2 (de) | Verwendung von Acetyl L-Carnitin zur therapeutischen Behandlung von Coma. | |
| DE69605531T2 (de) | Carnitinderivat als Arzneimittel zur Behandlung von Arteriosklerose obliterans | |
| DE4232899C2 (de) | Verwendung von NADH und NADPH zur Behandlung von Morbus Alzheimer | |
| CH695983A5 (de) | Tetraiodthyropropionsäure oder Tetraiodthyroessigsäure zur Herstellung eines dermatologischen Präparates. | |
| DE3639378A1 (de) | Acyloxyalkanoylcholin-salze zur linderung und therapie von dementia | |
| DE4214953A1 (de) | Arzneimittel zur Erhöhung des Testosteronspiegels | |
| DE3530767C2 (enExample) | ||
| CH670952A5 (enExample) | ||
| DE69829290T2 (de) | Verwendung von alkanoylcarnitinderivaten zur behandlung von hyperaktivität mit aufmerksamkeitsstörungen | |
| WO2003099265A2 (de) | Pharmazeutische wirkstoffkombination sowie deren verwendung | |
| DE3344173C2 (de) | Verwendung von alkanoyl-l-carnitin zur behandlung von myopathien oder muskulaeren dystrophien | |
| EP1001756B1 (de) | Synergistisch wirkende zusammensetzungen zur selektiven bekämpfung von tumorgewebe | |
| DE60305534T2 (de) | Verwendung von docosahexaensäure als wirkstoff bei der behandlung von lipodystrophie | |
| DE602004003173T2 (de) | Verwendung von konjugierter Linolsäure zur Behandlung der Erkältung | |
| DE69821970T2 (de) | Verwendung von CITICOLINE ZUR BEHANDLUNG VON MULTIPLER SKLEROSE | |
| DE2611976A1 (de) | Pharmazeutisches praeparat zur besserung und wiederherstellung bei verminderten bewusstseinszustaenden | |
| DE19629802A1 (de) | Arzneimittel zur Behandlung von Neuropathien | |
| DE60109799T2 (de) | Verwendung von quetiapin für aufmerksamkeitsmangel-hyperaktivitätsstörungen oder verhaltensstörungen | |
| DE60012183T2 (de) | Verwendung einer makrolid-verbindung zur herstellung eines medikaments zur behandlung von gehirnschäden aufgrund von ischämie oder blutungen |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 8110 | Request for examination paragraph 44 | ||
| 8125 | Change of the main classification |
Ipc: A61K 31/205 |
|
| D2 | Grant after examination | ||
| 8364 | No opposition during term of opposition |