WO2017019896A1 - Combination therapies comprising antibody molecules to pd-1 - Google Patents

Combination therapies comprising antibody molecules to pd-1 Download PDF

Info

Publication number
WO2017019896A1
WO2017019896A1 PCT/US2016/044547 US2016044547W WO2017019896A1 WO 2017019896 A1 WO2017019896 A1 WO 2017019896A1 US 2016044547 W US2016044547 W US 2016044547W WO 2017019896 A1 WO2017019896 A1 WO 2017019896A1
Authority
WO
WIPO (PCT)
Prior art keywords
cancer
amino acid
seq
acid sequence
combination
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/044547
Other languages
English (en)
French (fr)
Inventor
Glenn Dranoff
Gordon James FREEMAN
Arlene Helen SHARPE
Walter A. Blattler
Jennifer Marie Mataraza
Catherine Anne SABATOS-PEYTON
Hwai Wen Chang
Gerhard Johann Frey
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novartis AG
Dana Farber Cancer Institute Inc
Harvard University
Original Assignee
Novartis AG
Dana Farber Cancer Institute Inc
Harvard University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Novartis AG, Dana Farber Cancer Institute Inc, Harvard University filed Critical Novartis AG
Priority to CN201680056405.4A priority Critical patent/CN108025051B/zh
Priority to US15/747,873 priority patent/US20180222982A1/en
Priority to EP24154217.4A priority patent/EP4378957A3/en
Priority to EP16750330.9A priority patent/EP3328418A1/en
Priority to CN202111476281.4A priority patent/CN114272371A/zh
Priority to JP2018504697A priority patent/JP6878405B2/ja
Publication of WO2017019896A1 publication Critical patent/WO2017019896A1/en
Anticipated expiration legal-status Critical
Priority to US17/549,586 priority patent/US20230013364A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39541Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • T cells The ability of T cells to mediate an immune response against an antigen requires two distinct signaling interactions (Viglietta, V. et al. (2007) Neur other apeutics 4:666-675; Korman, A. J. et al. (2007) Adv. Immunol. 90:297-339).
  • APC antigen-presenting cells
  • TCR T cell receptor
  • the immune system is tightly controlled by a network of costimulatory and co- inhibitory ligands and receptors. These molecules provide the second signal for T cell activation and provide a balanced network of positive and negative signals to maximize immune responses against infection, while limiting immunity to self (Wang, L. et al. (Epub Mar. 7, 2011) /. Exp. Med. 208(3):577-92; Lepenies, B. et al. (2008) Endocrine, Metabolic & Immune Disorders— Drug Targets 8:279-288).
  • costimulatory signals include the binding between the B7.1 (CD80) and B7.2 (CD86) ligands of the APC and the CD28 and CTLA-4 receptors of the CD4 + T-lymphocyte (Sharpe, A. H. et al. (2002) Nature Rev.
  • B7 Superfamily a group of related B7 molecules, also known as the "B7 Superfamily" (Coyle, A. J. et al. (2001) Nature Immunol. 2(3):203-209; Sharpe, A. H. et al. (2002) Nature Rev. Immunol. 2: 116-126; Collins, M. et al. (2005) Genome Biol. 6:223.1-223.7; Korman, A. J. et al. (2007) Adv. Immunol. 90:297-339).
  • B7 Superfamily Several members of the B7 Superfamily are known, including B7.1 (CD80), B7.2 (CD86), the inducible co-stimulator ligand (ICOS-L), the programmed death- 1 ligand (PD-L1 ; B7- Hl), the programmed death-2 ligand (PD-L2; B7-DC), B7-H3, B7-H4 and B7-H6 (Collins, M. et al. (2005) Genome Biol. 6:223.1-223.7).
  • B7.1 CD80
  • B7.2 the inducible co-stimulator ligand
  • PD-L1 ; B7- Hl the programmed death-2 ligand
  • B7-DC programmed death-2 ligand
  • B7-H3, B7-H4 and B7-H6 Coldlins, M. et al. (2005) Genome Biol. 6:223.1-223.7.
  • the Programmed Death 1 (PD-1) protein is an inhibitory member of the extended CD28/CTLA-4 family of T cell regulators (Okazaki et al. (2002) Curr Opin Immunol 14: 391779-82; Bennett et al. (2003) /. Immunol. 170:711-8).
  • Other members of the CD28 family include CD28, CTLA-4, ICOS and BTLA.
  • PD-1 is suggested to exist as a monomer, lacking the unpaired cysteine residue characteristic of other CD28 family members. PD-1 is expressed on activated B cells, T cells, and monocytes.
  • the PD-1 gene encodes a 55 kDa type I transmembrane protein (Agata et al. (1996)
  • PD-1 Although structurally similar to CTLA-4, PD-1 lacks the MYPPY motif (SEQ ID NO: 236) that is important for B7-1 and B7-2 binding.
  • SEQ ID NO: 236 Two ligands for PD-1 have been identified, PD-L1 (B7-H1) and PD-L2 (B7-DC), that have been shown to downregulate T cell activation upon binding to PD-1 (Freeman et al. (2000) /. Exp. Med. 192: 1027-34; Carter et al. (2002) Eur. J. Immunol. 32:634-43).
  • Both PD-L1 and PD-L2 are B7 homologs that bind to PD-1, but do not bind to other CD28 family members.
  • PD-L1 is abundant in a variety of human cancers (Dong et al. (2002) Nat. Med. 8:787-9).
  • PD- 1 is known as an immunoinhibitory protein that negatively regulates TCR signals (Ishida, Y. et al. (1992) EMBO J. 11:3887-3895; Blank, C. et al. (Epub 2006 Dec. 29) Immunol. Immunother. 56(5):739-745).
  • the interaction between PD-1 and PD-L1 can act as an immune checkpoint, which can lead to, e.g., a decrease in tumor infiltrating lymphocytes, a decrease in T-cell receptor mediated proliferation, and/or immune evasion by cancerous cells (Dong et al. (2003) /. Mol. Med. 81:281-7; Blank et al. (2005) Cancer Immunol. Immunother.
  • Immune suppression can be reversed by inhibiting the local interaction of PD-1 with PD-Ll or PD-L2; the effect is additive when the interaction of PD- 1 with PD-L2 is blocked as well (Iwai et al. (2002) Proc. Natl Acad. Sci. USA 99: 12293-7; Brown et al. (2003) /. Immunol. 170: 1257- 66).
  • compositions comprising a combination of two, three or more therapeutic agents chosen from one, two, or all of the following categories (i)-(iii): (i) an agent that enhances antigen presentation (e.g., tumor antigen presentation); (ii) an agent that enhances an effector cell response (e.g., B cell and/or T cell activation and/or mobilization); or (iii) an agent that decreases tumor
  • the combination includes an inhibitor of Programmed Death 1 (PD-1) (e.g., an anti-PD-1 antibody molecule as described herein).
  • PD-1 Programmed Death 1
  • therapeutic approaches that enhance anti-tumor immunity work more effectively when the immune response is optimized by targeting multiple components at one or more stages of an immune response, e.g., an antitumor immune response.
  • approaches that enhance antigen presentation e.g., by activation and/or maturation of dendritic cells
  • approaches that enhance cellular and humoral immune responses e.g., by stimulating, e.g., disinhibiting, phagocytes and/or tumor infiltrating lymphocytes (e.g., NK cells and T cells)
  • tumor immunosuppressive signaling e.g., by increasing macrophage polarization, increasing T reg depletion and/or decreasing myeloid-derived suppressive cells (MDSCs)
  • MDSCs myeloid-derived suppressive cells
  • combination therapies that optimize one, two, or all of: (i) antigen presentation, e.g., increasing antigen presentation (e.g., by enhancing one or more of dendritic cell activity or maturation, antigen uptake, or antigen processing); (ii) effector cell response, e.g., increasing effector cell response (e.g., enhancing B cell and/or T cell activation and/or mobilization, e.g., in the lymph node); or (iii) tumor immunosuppression, e.g., decreasing tumor immunosuppression (e.g., increasing T cell infiltration and tumor cell killing).
  • antigen presentation e.g., increasing antigen presentation (e.g., by enhancing one or more of dendritic cell activity or maturation, antigen uptake, or antigen processing)
  • effector cell response e.g., increasing effector cell response (e.g., enhancing B cell and/or T cell activation and/or mobilization, e.g., in the lymph
  • the invention features a method of treating (e.g., inhibiting, reducing, ameliorating, or preventing) a disorder, e.g. , a hyperproliferative condition or disorder (e.g., a cancer) in a subject.
  • a disorder e.g. , a hyperproliferative condition or disorder (e.g., a cancer)
  • the method includes administering to the subject a combination of two, three or more therapeutic agents chosen from one, two or all of the following categories (i)-(iii): (i) an agent that enhances antigen (e.g., tumor antigen) presentation; (ii) an agent that enhances an effector cell response (e.g., B cell and/or T cell activation and/or mobilization); or (iii) an agent that decreases tumor immunosuppression, thereby treating the disorder, e.g. , the hyperproliferative condition or disorder (e.g., the cancer).
  • the combination includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
  • the cancer treated can be, e.g., a cancer described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, skin cancer, melanoma, nasopharyngeal cancer (e.g., differentiated or undifferentiated metastatic or locally recurrent nasopharyngeal carcinoma), kidney cancer, neuroendocrine tumor (NET), or breast cancer.
  • the cancer is a skin cancer, e.g., a Merkel cell carcinoma or a melanoma.
  • the cancer is a Merkel cell carcinoma.
  • the cancer is a Merkel cell carcinoma.
  • the cancer is a melanoma.
  • the cancer is a breast cancer, e.g., a triple negative breast cancer (TNBC).
  • the cancer is kidney cancer, e.g., a renal cell carcinoma (e.g., clear cell renal cell carcinoma).
  • the cancer is a thyroid cancer, e.g., an anaplastic thyroid carcinoma (ATC).
  • the cancer is a neuroendocrine tumor (NET), e.g., an atypical pulmonary carcinoid tumor.
  • the cancer is a lung cancer, e.g., a non-small cell lung cancer (NSCLC).
  • NSCLC non-small cell lung cancer
  • the invention features a method of reducing an activity (e.g., growth, survival, or viability, or all), of a hyperproliferative (e.g., a cancer) cell.
  • the method includes contacting the cell with a combination of two, three or more therapeutic agents chosen from one, two or all of the following categories (i)-(iii): (i) an agent that enhances antigen (e.g., tumor antigen) presentation; (ii) an agent that enhances an effector cell response (e.g., B cell and/or T cell activation and/or mobilization); or (iii) an agent that decreases tumor immunosuppression, thereby reducing an activity in the hyperproliferative cell.
  • an agent that enhances antigen e.g., tumor antigen
  • an effector cell response e.g., B cell and/or T cell activation and/or mobilization
  • an agent that decreases tumor immunosuppression thereby reducing an activity in the hyperproliferative cell.
  • the combination includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
  • the method can be performed in a subject, e.g., as part of a therapeutic protocol.
  • the cancer cell can be, e.g., a cell from a cancer described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, skin cancer, melanoma, nasopharyngeal cancer (e.g., differentiated or undifferentiated metastatic or locally recurrent nasopharyngeal carcinoma), kidney cancer, neuroendocrine tumor (NET), or breast cancer.
  • a cancer described herein such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, skin cancer, melanoma, nasopharyngeal cancer (e.
  • the cancer is a skin cancer, e.g., a Merkel cell carcinoma or a melanoma. In one embodiment, the cancer is a Merkel cell carcinoma. In other embodiments, the cancer is a melanoma. In other embodiments, the cancer is a breast cancer, e.g., a triple negative breast cancer (TNBC). In other embodiments, the cancer is kidney cancer, e.g., a renal cell carcinoma (e.g., clear cell renal cell carcinoma). In other embodiments, the cancer is a thyroid cancer, e.g., an anaplastic thyroid carcinoma (ATC). In other embodiments, the cancer is a neuroendocrine tumor (NET), e.g., an atypical pulmonary carcinoid tumor. In certain embodiments, the cancer is a lung cancer, e.g., a non-small cell lung cancer (NSCLC).
  • NSCLC neuroendocrine tumor
  • the cancer is a lung cancer, e.g., a non-small cell lung cancer (NSC
  • the method further includes determining the level of an immune cell (e.g., a T cell) infiltrate (e.g., the level of tumor infiltrating lymphocytes (TIL)) in the subject.
  • an immune cell e.g., a T cell
  • TIL tumor infiltrating lymphocytes
  • the level of the immune cell infiltrate is determined in vivo, e.g., non-invasively (e.g., by detecting an antibody to a T cell marker detectably labeled using a suitable imaging technique, e.g., positron emission tomography (PET) scan).
  • PET positron emission tomography
  • the level of the immune cell infiltrate is determined in a sample (e.g., a tumor biopsy) acquired from the subject (e.g., using immunohistochemical techniques).
  • one or more agents of categories (i) or (ii), or both (i) and (ii), is/are administered.
  • one or more agents of category (iii) is/are administered.
  • the detection steps can also be used, e.g., to monitor the effectiveness of a therapeutic agent described herein.
  • the detection step can be used to monitor the effectiveness of therapeutic agents of categories (i), (ii) and/or (iii).
  • the invention features a composition (e.g., one or more
  • compositions or dosage forms that includes a combination of two, three or more therapeutic agents chosen from one, two or all of the following categories (i)-(iii): (i) an agent that enhances antigen (e.g., tumor antigen) presentation; (ii) an agent that enhances an effector cell response (e.g., activation and/or mobilization of B cell and/or T cell); or (iii) an agent that decreases tumor immunosuppression.
  • the combination includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
  • the invention features a composition (e.g., one or more compositions or dosage forms as described hereom), for use in treating a disorder, e.g., a cancer.
  • the composition for use includes a combination of two, three or more therapeutic agents chosen from one, two or all of the following categories (i)-(iii): (i) an agent that enhances antigen (e.g., tumor antigen) presentation; (ii) an agent that enhances an effector cell response (e.g., activation and/or mobilization of B cell and/or T cell); or (iii) an agent that decreases tumor immunosuppression.
  • the combination used includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
  • the cancer can be, e.g., a cancer described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, skin cancer, melanoma, nasopharyngeal cancer (e.g., differentiated or undifferentiated metastatic or locally recurrent nasopharyngeal carcinoma), kidney cancer, neuroendocrine tumor (NET), or breast cancer.
  • the cancer is a skin cancer, e.g., a Merkel cell carcinoma or a melanoma.
  • the cancer is a Merkel cell carcinoma. In other embodiments, the cancer is a melanoma. In other embodiments, the cancer is a breast cancer, e.g., a triple negative breast cancer (TNBC). In other embodiments, the cancer is kidney cancer, e.g., a renal cell carcinoma (e.g., clear cell renal cell carcinoma). In other embodiments, the cancer is a thyroid cancer, e.g., an anaplastic thyroid carcinoma (ATC). In other embodiments, the cancer is a neuroendocrine tumor (NET), e.g., an atypical pulmonary carcinoid tumor. In certain embodiments, the cancer is a lung cancer, e.g., a non-small cell lung cancer (NSCLC).
  • NSCLC non-small cell lung cancer
  • Formulations e.g., dosage formulations, and kits, e.g., therapeutic kits, that include a combination of two, three or more therapeutic agents chosen from one, two or all of the following categories (i)-(iii): (i) an agent that enhances antigen (e.g., tumor antigen) presentation; (ii) an agent that enhances an effector cell response (e.g., activation and/or mobilization of B cell and/or T cell); or (iii) an agent that decreases tumor
  • an agent that enhances antigen e.g., tumor antigen
  • an agent that enhances an effector cell response e.g., activation and/or mobilization of B cell and/or T cell
  • the combination includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
  • a PD-1 inhibitor e.g., an anti-PD-1 antibody molecule as described herein.
  • the combinations of therapeutic agents disclosed herein include two or more therapeutic agents described herein.
  • the therapeutic agents in the combination can belong to the same category, e.g., two or more therapeutic agents of category (i), or can include at least one agent of two or more categories (e.g., a therapeutic agent of category (i) combined with a therapeutic agent of category (ii)), as described below.
  • Certain therapeutic agents can belong to two or more categories of categories (i)-(iii).
  • a therapeutic agent e.g., a GITR agonist, an IDO antagonist, a TGF-b inhibitor, among others
  • the combination includes one, two, three, four or more therapeutic agents that enhance antigen (e.g., tumor antigen) presentation (referred to herein as an "antigen-presentation combination").
  • the antigen presentation combination includes one or more of: an agent that enhances antigen presentation (e.g., a vaccine, e.g., a cell- or antigen-based vaccine); an agent that enhances lysis of tumor cells (e.g., an oncolytic virus); an agent that stimulates (e.g., disinhibits) a phagocyte, e.g., a Type I interferon (IFN) activator (e.g., a TLR agonist, a RIG-I-like receptor agonist (RLRs)), and/or an agent that activates and/or recruits a dendritic cell or a macrophage (e.g., a macrophage I), e.g., a bi- or tri-specific cell engager.
  • IFN Type I interferon
  • the antigen-presentation combination includes one, two, three, four, five or more therapeutic agents chosen from: (i) an agonist of Stimulator of Interferon Genes (a STING agonist), (ii) an agonist of a Toll-like receptor (TLR) (e.g., an agonist of TLR-3, -4, -5, -7, -8, or -9), (iii) a TIM-3 modulator (e.g., an anti-TIM-3 antibody molecule), (iv) a vascular endothelial growth factor receptor (VEGFR) inhibitor, (v) a c-Met inhibitor, (vi) a TGFb inhibitor (e.g., an anti-TGFb antibody), (vii) an IDO/TDO inhibitor, (viii) an A2AR antagonist, (ix) an oncolytic virus, (x) a vaccine (e.g., a scaffold vaccine), or (xi) a bi- or tri-specific cell engager.
  • TLR Toll-like receptor
  • the antigen- presentation combination includes a STING agonist.
  • the antigen-presentation combination includes a TLR agonist (e.g., a TLR7 agonist).
  • the antigen-presentation combination includes a STING agonist and a TLR agonist (e.g., a TLR7 agonist).
  • the antigen presentation combination is chosen from a STING agonist, a TLR agonist, an A2AR antagonist, or an oncolytic virus or a combination thereof, and optionally, one or more of (iii)-(vii) or (x)-(xi).
  • the antigen presentation combination is chosen from a STING agonist or a TLR agonist, or a combination of both, and optionally, one or more of (iii)-(xi).
  • the antigen-presentation combination includes a STING agonist, a TLR agonist (e.g., a TLR7 agonist) and a TIM-3 modulator (e.g., an anti-TIM-3 inhibitor).
  • the antigen-presentation combination includes a STING agonist, a TLR agonist (e.g., a TLR7 agonist) and a VEGFR inhibitor.
  • the antigen- presentation combination includes a STING agonist, a TLR agonist (e.g., a TLR7 agonist) and a c-MET inhibitor.
  • the antigen-presenting combination includes an oncolytic virus.
  • the antigen-presenting combination includes an oncolytic virus and a cytokine, e.g., an oncolytic virus expressing one or more of GM-CSF, or a CSF (e.g., CSF1, or CSF2).
  • the antigen-presenting combination includes a bi- or tri-specific cell engager, e.g., a bi- or tri-specific antibody molecule to CD47 and CD 19, with or without an Fc domain.
  • the antigen-presenting combination includes a TGFb inhibitor (e.g., an anti-TGFb antibody).
  • the antigen-presenting combination includes an IDO/TDO inhibitor.
  • the antigen-presenting combination includes an A2AR antagonist.
  • the antigen-presenting combination includes a vaccine (e.g., IL-2 in combination with MUC1, or a dendritic cell based vaccine (e.g., Provenge®)).
  • the antigen-presenting combination includes a vaccine and a TLR agonist (e.g., a TLR agonist as described herein).
  • the antigen-presentation combination includes a vaccine and a STING agonist.
  • the antigen- presentation combination includes a vaccine, a STING agonist and a TLR agonist.
  • the combination includes one, two, three, four, five or more therapeutic agents that enhance an effector cell response (referred to herein as an "effector cell combination").
  • the effector cell combination includes a lymphocyte activator, e.g., an NK cell activator and/or a T cell activator.
  • the effector cell combination activates (e.g., disinhibits) a tumor infiltrating lymphocyte (TIL), e.g., an NK cell or a T cell.
  • TIL tumor infiltrating lymphocyte
  • the effector cell combination includes an NK cell modulator chosen from a modulator (e.g., an antibody molecule) of an NK receptor (e.g., a modulator of one or more of NKG2A, KIR3DL, NKp46, MICA or CEACAM1); an interleukin or an interleukin variant (e.g., IL-2, IL-15, IL-21, IL- 13R or IL-12 cytokine or variant thereof, or a combination thereof); a bi- or tri-specific cell engager (e.g., a bispecific antibody molecule of NKG2A and CD138, or a bispecific antibody molecule of CD3 and TCR); an NK cell therapy; or a vaccine that includes NK cells and an antigen/
  • the effector cell combination includes an immunomodulator (e.g., one or more of: an activator of a costimulatory molecule or an inhibitor of an immune checkpoint molecule as described herein).
  • the effector cell combination includes a T cell modulator chosen from an inhibitor of a checkpoint inhibitor (e.g., an inhibitor of one or more of: PD-1, PD-L1, TIM-3, LAG-3, VISTA, DKG-a, B7-H3, B7-H4, TIGIT, CTLA-4, BTLA, CD160, TIM1, IDO, LAIR1, IL- 12, or a combination thereof, e.g., an inhibitor of PD-1 and TIM-3, or an inhibitor of PD-1 and LAG-3).
  • a checkpoint inhibitor e.g., an inhibitor of one or more of: PD-1, PD-L1, TIM-3, LAG-3, VISTA, DKG-a, B7-H3, B7-H4, TIGIT, CTLA-4, BTLA,
  • the inhibitor of the checkpoint inhibitor is an antibody molecule (e.g., a mono- or bispecific antibody or fragment thereof as described herein).
  • the inhibitor of the checkpoint inhibitor is an antibody molecule against PD-1, PD- Ll, TIM-3, LAG-3, VISTA, B7-H4, CTLA-4 or TIGIT, or any combination thereof (e.g. a combination as described herein).
  • the effector cell combination includes a T cell modulator chosen from an agonist or an activator of a costimulatory molecule.
  • the agonist of the costimulatory molecule is chosen from an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion) of GITR, OX40, ICOS, SLAM (e.g., SLAMF7), HVEM, LIGHT, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CDl la/CD18), ICOS (CD278), 4-1BB (CD137), CD30, CD40, BAFFR, CD7, NKG2C, NKp80, CD160, B7-H3, or CD83 ligand.
  • an agonist e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion
  • GITR e.g., OX40, ICOS
  • SLAM e.g., SLAMF7
  • HVEM e.g., SLAMF7
  • HVEM HVEM
  • LIGHT LIGHT
  • the effector cell combination includes a bispecific T cell engager (e.g., a bispecific antibody molecule that binds to CD3 and a tumor antigen (e.g., EGFR, PSCA, PSMA, EpCAM, HER2 among others).
  • a bispecific T cell engager e.g., a bispecific antibody molecule that binds to CD3 and a tumor antigen (e.g., EGFR, PSCA, PSMA, EpCAM, HER2 among others).
  • the effector cell combination includes one, two, three, four, five or more therapeutic agents chosen from: (i) a GITR modulator (e.g., a GITR agonist), (ii) a PD-1 inhibitor (e.g., an anti-PD- 1 antibody molecule as described herein), (iii) a PD-L1 inhibitor, (iv) an inhibitor of IAP (Inhibitor of Apoptosis Protein), (v) an inhibitor of EGFR (Epidermal Growth Factor Receptor), (vi) an inhibitor of target of rapamycin (mTOR), (vii) IL-15 or a variant thereof, (viii) a CTLA-4 inhibitor, (ix) a bispecific T cell engager (e.g., a bispecific antibody molecule that binds to CD3 and a tumor antigen (e.g., EGFR, PSCA, PSMA, EpCAM, HER2 among others), (x) a CD40 agonist (e.g., an GITR modul
  • the effector cell combination includes a GITR agonist.
  • the effector cell combination includes a PD- 1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
  • the effector cell combination includes a PD-L1 inhibitor.
  • the effector cell combination includes a GITR agonist and a PD- 1 inhibitor (e.g., an anti-PD- 1 antibody molecule as described herein).
  • the effector cell combination includes a GITR agonist and a PD-L1 inhibitor.
  • the effector cell combination includes a GITR agonist, a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein), and a PD-L1 inhibitor. In other embodiments, the effector cell combination includes a PD-1 inhibitor (e.g., an anti-PD- 1 antibody molecule as described herein), and a PD-L1 inhibitor. In one embodiment, the effector cell combination includes a GITR agonist and an inhibitor of IAP. In another embodiment, the effector cell combination includes a GITR agonist and an inhibitor of an EGFR inhibitor. In yet another embodiment, the effector cell combination includes a GITR agonist and an inhibitor of an mTOR inhibitor.
  • the effector cell combination includes IL- 15 or a variant thereof. In one embodiment, the effector cell combination includes a CTLA-4 inhibitor. In one embodiment, the effector cell combination includes a bispecific T cell engager (e.g., a bispecific antibody molecule that binds to CD3 and a tumor antigen (e.g., EGFR, PSCA, PSMA, EpCAM, HER2 among others). In one embodiment, the effector cell combination includes a CD40 agonist (e.g., an anti-CD40 antibody molecule). In one embodiment, the effector cell combination includes an OX40 agonist (e.g., an anti-OX40 antibody molecule).
  • a bispecific T cell engager e.g., a bispecific antibody molecule that binds to CD3 and a tumor antigen (e.g., EGFR, PSCA, PSMA, EpCAM, HER2 among others.
  • the effector cell combination includes a CD40 agonist (e.g., an anti-CD40 antibody molecule
  • the effector cell combination includes a CD27 agonist (e.g., an anti-CD27 antibody molecule).
  • the combination includes one, two, three, four, five or more therapeutic agents that decrease tumor immunosuppression (referred to herein as an "antitumor immunosuppression combination").
  • the combination modulates the activity or level of one or more of T reg , macrophage 2 or MDSCs.
  • the combination increases one or more of M2 polarization, T reg depletion, or T cell recruitment.
  • the anti-tumor immunosuppression combination includes one, two, three, four, five or more therapeutic agents chosen from: (i) an immunomodulator (e.g., one or more of: an activator of a costimulatory molecule (e.g., a GITR agonist), or an inhibitor of an immune checkpoint molecule (e.g., one or more of PD-1 , PD-L1, LAG- 3, TIM-3 or CTLA-4), as described herein), (ii) a CSF- 1/1R inhibitor (e.g., an inhibitor of macrophage colony- stimulating factor (M-CSF)), (iii) an IL-17 inhibitor, (iv) an IL- ⁇ ⁇ inhibitor, (v) a CXCR2 inhibitor, (vi) an inhibitor of a phosphoinositide 3-kinase (PI3K, e.g., PDKy or ⁇ 3 ⁇ ), (vii) a BAFF-R inhibitor, (viii) a MALT
  • the immunomodulator is an inhibitor of an immune checkpoint molecule (e.g., an inhibitor of PD- 1, PD-L1 , LAG- 3, TIM-3, CEACAM (e.g., CEACAM- 1, -3 and/or -5), or CTLA-4, or any combination thereof). Any combination of the aforesaid agents can be used in the tumor immunosuppression combination.
  • an immune checkpoint molecule e.g., an inhibitor of PD- 1, PD-L1 , LAG- 3, TIM-3, CEACAM (e.g., CEACAM- 1, -3 and/or -5), or CTLA-4, or any combination thereof.
  • CEACAM e.g., CEACAM- 1, -3 and/or -5
  • CTLA-4 CTLA-4
  • immunosuppression combination includes one, two, three, four, five or more therapeutic agents chosen from a PD-1 inhibitor (e.g., an anti-PD- 1 antibody molecule as described herein), a PD-L1 inhibitor, a LAG-3 inhibitor, a TIM-3 modulator (e.g., an anti-TIM-3 inhibitor), a GITR agonist, a CSF-1/1R inhibitor (e.g., an M-CSF inhibitor), an IL- 17 inhibitor, an IL- ⁇ ⁇ inhibitor, or a CXCR2 inhibitor.
  • a PD-1 inhibitor e.g., an anti-PD- 1 antibody molecule as described herein
  • a PD-L1 inhibitor e.g., an anti-PD- 1 antibody molecule as described herein
  • a PD-L1 inhibitor e.g., a PD-L1 inhibitor
  • LAG-3 inhibitor e.g., an anti-TIM-3 inhibitor
  • a TIM-3 modulator e.g., an anti-TIM
  • the anti-tumor immunosuppression combination includes one, two, or all of a CSF- 1/1R inhibitor (e.g., an M-CSF inhibitor), an IL- 17 inhibitor, an IL- ⁇ inhibitor.
  • the anti-tumor immunosuppression combination includes an IL- 17 inhibitor, a CXCR2 inhibitor, a CRTH2 inhibitor, an A2AR antagonist, or a PFKFB3 inhibitor, or a combination thereof.
  • the combination includes one or more therapeutic agents of the antigen-presentation combination. In other embodiments, the combination includes one or more therapeutic agents of the effector cell combination. In yet other embodiments, the combination includes one or more therapeutic agents of the anti-tumor immunosuppression combination. In other embodiments, the combination includes one or more therapeutic agents of the antigen-presentation combination and one or more therapeutic agents of the effector cell combination. In other embodiments, the combination includes one or more therapeutic agents of the antigen-presentation combination and one or more therapeutic agents of the anti-tumor immunosuppression combination. In other embodiments, the combination includes one or more therapeutic agents of the antigen-presentation
  • the combination includes one or more therapeutic agents of the antigen-presentation combination, one or more therapeutic agents of the effector cell combination and one or more therapeutic agents of the anti-tumor immunosuppression combination.
  • the combination includes:
  • one or more therapeutic agents of the antigen-presentation combination chosen from one, two or all of a STING agonist, a TLR agonist (e.g., a TLR7 agonist), or a TIM-3 modulator (e.g., a TIM-3 inhibitor);
  • one or more therapeutic agents of the effector cell combination chosen from one, two or all of a GITR modulator (e.g., a GITR agonist), a PD- 1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein), or a PD-L1 inhibitor;
  • a GITR modulator e.g., a GITR agonist
  • a PD- 1 inhibitor e.g., an anti-PD-1 antibody molecule as described herein
  • a PD-L1 inhibitor e.g., one or more therapeutic agents of the effector cell combination chosen from one, two or all of a GITR modulator (e.g., a GITR agonist), a PD- 1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein), or a PD-L1 inhibitor;
  • CSF- 1/1R inhibitor e.g., an M-CSF inhibitor
  • IL-17 IL-17 inhibitor
  • IL- ⁇ ⁇ inhibitor a CSF- 1/1R inhibitor
  • the combination can be used to treat a cancer as described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer
  • a cancer as described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer
  • the cancer is a skin cancer, e.g., a Merkel cell carcinoma or a melanoma.
  • the cancer is a Merkel cell carcinoma.
  • the cancer is a melanoma.
  • the cancer is a breast cancer, e.g., a triple negative breast cancer (TNBC).
  • the cancer is kidney cancer, e.g., a renal cell carcinoma (e.g., clear cell renal cell carcinoma).
  • the cancer is a thyroid cancer, e.g., an anaplastic thyroid carcinoma (ATC).
  • the cancer is a neuroendocrine tumor (NET), e.g., an atypical pulmonary carcinoid tumor.
  • the cancer is a lung cancer, e.g., a non-small cell lung cancer (NSCLC).
  • the combination includes a therapeutic agent from the antigen- presentation combination (e.g., one or more of a STING agonist, a TLR agonist, a vaccine or an oncolytic virus) in combination with a therapeutic agent from the effector cell and/or antitumor immunosuppression combination (e.g., an inhibitor of a checkpoint inhibitor, e.g., an inhibitor of PD-1, PD-L1, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), or CTLA-4, or any combination thereof.
  • a therapeutic agent from the antigen- presentation combination e.g., one or more of a STING agonist, a TLR agonist, a vaccine or an oncolytic virus
  • a therapeutic agent from the effector cell and/or antitumor immunosuppression combination e.g., an inhibitor of a checkpoint inhibitor, e.g., an inhibitor of PD-1, PD-L1, LAG-3, TIM-3
  • one or more of a STING agonist, a TLR agonist, a vaccine or an oncolytic virus is administered in combination with an anti- PD- 1 antibody molecule as described herein.
  • a STING agonist and/or a vaccine is administered in combination with an anti-PD- 1 antibody molecule as described herein.
  • an oncolytic virus is administered in combination with an anti- PD- 1 antibody molecule as described herein.
  • the combination can be used to treat a cancer as described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, skin cancer, melanoma (e.g., advanced melanoma), nasopharyngeal cancer, kidney cancer,
  • a cancer as described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer, skin cancer, melanoma (e.g., advanced melanoma), nasopharyngeal cancer, kidney cancer,
  • the cancer is a skin cancer, e.g., a Merkel cell carcinoma or a melanoma. In one embodiment, the cancer is a Merkel cell carcinoma. In other embodiments, the cancer is a melanoma. In other embodiments, the cancer is a breast cancer, e.g., a triple negative breast cancer (TNBC). In other embodiments, the cancer is kidney cancer, e.g., a renal cell carcinoma (e.g., clear cell renal cell carcinoma). In other embodiments, the cancer is a thyroid cancer, e.g., an anaplastic thyroid carcinoma (ATC).
  • ATC an anaplastic thyroid carcinoma
  • the cancer is a neuroendocrine tumor (NET), e.g., an atypical pulmonary carcinoid tumor.
  • the cancer is a lung cancer, e.g., a non-small cell lung cancer (NSCLC).
  • NSCLC non-small cell lung cancer
  • the combination includes a combination of therapeutic agents as provided in the section entitled "Exemplary Combinations of Antigen-Presentation Combinations, Effector Cell Combinations and Anti-tumor Immunosuppression
  • Combinations provided in the Detailed Description.
  • the combinations disclosed herein can be administered together in a single composition or administered separately in two or more different compositions, e.g., compositions or dosage forms as described herein.
  • the administration of the therapeutic agents can be in any order.
  • the first agent and the additional agents e.g., second, third agents
  • a first therapeutic agent can be administered concurrently with, prior to, or subsequent to, the additional agent.
  • a first agent is administered locally, e.g., a therapeutic agent of any of categories (i)-(iii) can be coupled to a tumor targeting agent, e.g., a tumor-targeting antibody (e.g., to form an antibody-drug conjugate), or any other delivery agent (e.g., a formulation such as a targeted formulation) such that administration of the first agent is localized to a desired site, e.g., a tumor site (e.g., a dendritic cell-enriched site).
  • a tumor targeting agent e.g., a tumor-targeting antibody (e.g., to form an antibody-drug conjugate)
  • any other delivery agent e.g., a formulation such as a targeted formulation
  • the therapeutic agent is an antigen (e.g., a vaccine, e.g., an in situ cancer vaccine), which is targeted to the tumor environment, thus resulting in activation of dendritic cells.
  • a vaccine e.g., an in situ cancer vaccine
  • the therapeutic agent also can be locally administered, e.g., injected, at a tumor site (e.g., intratumoral or peritumoral administration). Localized delivery or administration of the therapeutic agent can reduce one or more side effects or toxicities that would otherwise be associated with systemic administration of the therapeutic agent.
  • a therapeutic agent e.g., STING or a TLR
  • a tumor-binding antibody e.g., an antibody that binds to HER2
  • the first agent, the additional agent (e.g., second or third agent), or all can be administered in an amount or dose that is higher, lower or the same than the amount or dosage of each agent used individually, e.g., as a monotherapy.
  • the administered amount or dosage of the first agent, the additional agent (e.g., second or third agent), or all is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50%) than the amount or dosage of each agent used individually, e.g., as a monotherapy.
  • the amount or dosage of the first agent, the additional agent (e.g., second or third agent), or all, that results in a desired effect is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50% lower).
  • the combinations can be in the form of an antibody molecule, e.g., a bi- or tri-specific molecule, against one or more therapeutic agents chosen from the antigen-presentation combination, the effector cell combination, or the anti-tumor immunosuppression combination, or any combination thereof.
  • a bispecific molecule against two or more checkpoint inhibitors e.g., an anti-PD-1 and an anti-LAG-3 antibody molecule.
  • the combinations can be in the form of an antibody molecule, e.g., a bi- or tri-specific molecule, against one or more therapeutic agents chosen from two or all of the antigen-presentation combination, the effector cell combination, and/or the anti-tumor immunosuppression combination.
  • the antibody molecule is a full antibody or fragment thereof (e.g., a Fab, F(ab') 2 , Fv, or a single chain Fv fragment (scFv)).
  • the antibody molecule has a heavy chain constant region (Fc) chosen from, e.g., the heavy chain constant regions of IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE; particularly, chosen from, e.g., the heavy chain constant regions of IgGl, IgG2, IgG3, and IgG4, more particularly, the heavy chain constant region of IgGl or IgG4 (e.g., human IgGl or IgG4).
  • Fc heavy chain constant region
  • the heavy chain constant region is human IgGl or human IgG4.
  • the constant region is altered, e.g., mutated, to modify the properties of the antibody molecule (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
  • the antibody molecule is in the form of a bispecific or multispecific antibody molecule, e.g., a bispecific, trispecific antibody molecule as described herein. Certain exemplary therapeutic agents and combinations thereof are provided herein below. A more detailed description of the therapeutic agents used in the combinations is provided in the Detailed Description.
  • the immunomodulator used in the combinations disclosed herein is an inhibitor of an immune checkpoint molecule.
  • the immunomodulator is an inhibitor of PD-1, PD-L1, PD-L2, CTLA-4, TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and/or TGF beta.
  • the inhibitor of an immune checkpoint molecule inhibits PD-1, PD-Ll, LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), CTLA-4, or any combination thereof.
  • Inhibition of an inhibitory molecule can be performed at the DNA, RNA or protein level.
  • an inhibitory nucleic acid e.g., a dsRNA, siRNA or shRNA
  • a dsRNA, siRNA or shRNA can be used to inhibit expression of an inhibitory molecule.
  • the inhibitor of an inhibitory signal is, a polypeptide e.g., a soluble ligand (e.g., PD-l-Ig or CTLA-4 Ig), or an antibody or antigen-binding fragment thereof, that binds to the inhibitory molecule; e.g., an antibody or fragment thereof (also referred to herein as "an antibody molecule") that binds to PD-1, PD-Ll, PD-L2, CEACAM (e.g., CEACAM-1, -3 and/or -5), CTLA-4, TIM-3, LAG- 3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and/or TGF beta, or a combination thereof.
  • a polypeptide e.g., a soluble ligand (e.g., PD-l-Ig or CTLA-4 Ig), or an antibody or antigen-binding fragment thereof, that binds to the inhibitory molecule; e.g., an antibody
  • the antibody molecule is in the form of a bispecific or multispecific antibody molecule.
  • the bispecific antibody molecule has a first binding specificity to PD-1 or PD-Ll and a second binding specifity, e.g., a second binding specificity to TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), LAG-3, or PD-L2.
  • the bispecific antibody molecule binds to PD-1 or PD-Ll and TIM-3.
  • the bispecific antibody molecule binds to PD-1 or PD-Ll and LAG-3.
  • the bispecific antibody molecule binds to PD-1 or PD-Ll and CEACAM (e.g., CEACAM-1, -3 and/or -5). In another embodiment, the bispecific antibody molecule binds to PD-1 or PD-Ll and CEACAM-1. In still another embodiment, the bispecific antibody molecule binds to PD-1 or PD-Ll and CEACAM-3. In yet another embodiment, the bispecific antibody molecule binds to PD-1 or PD-Ll and CEACAM-5. In another embodiment, the bispecific antibody molecule binds to PD-1 or PD-Ll. In yet another embodiment, the bispecific antibody molecule binds to PD- 1 and PD-L2.
  • CEACAM e.g., CEACAM-1, -3 and/or -5.
  • the bispecific antibody molecule binds to TIM-3 and LAG-3. In another embodiment, the bispecific antibody molecule binds to CEACAM (e.g., CEACAM-1, -3 and/or -5) and LAG-3. In another embodiment, the bispecific antibody molecule binds to CEACAM (e.g., CEACAM-1, -3 and/or -5) and TIM-3.
  • CEACAM e.g., CEACAM-1, -3 and/or -5
  • CEACAM e.g., CEACAM-1, -3 and/or -5
  • any combination of the aforesaid molecules can be made in a multispecific antibody molecule, e.g., a trispecific antibody that includes a first binding specificity to PD-1 or PD-1, and a second and third binding specifities to two or more of: TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), LAG-3, or PD-L2.
  • a multispecific antibody molecule e.g., a trispecific antibody that includes a first binding specificity to PD-1 or PD-1, and a second and third binding specifities to two or more of: TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), LAG-3, or PD-L2.
  • the immunomodulator is an inhibitor of PD-1, e.g., human PD-1 (e.g., an antibody molecule as described herein).
  • the immunomodulator is an inhibitor of PD-L1, e.g., human PD-L1.
  • the inhibitor of PD-1 or PD-L1 is an antibody molecule to PD-1 or PD-L1.
  • the PD-1 or PD-L1 inhibitor can be administered alone, or in combination with other immunomodulators, e.g., in combination with an inhibitor of LAG-3, TIM-3, CEACAM (e.g., CEACAM-1, -3 and/or -5) or CTLA-4.
  • the inhibitor of PD-1 or PD-L1, e.g., the anti-PD- 1 or PD-L1 antibody molecule is administered in combination with a LAG-3 inhibitor, e.g., an anti-LAG-3 antibody molecule.
  • the inhibitor of PD-1 or PD-L1, e.g., the anti-PD-1 or PD-L1 antibody molecule is administered in combination with a TIM-3 inhibitor, e.g., an anti-TIM-3 antibody molecule.
  • the inhibitor of PD-1 or PD-L1, e.g., the anti-PD-1 or PD-L1 antibody molecule is administered in combination with a CEACAM inhibitor (e.g., CEACAM-1, -3 and/or -5 inhibitor), e.g., an anti-CEACAM antibody molecule.
  • a CEACAM inhibitor e.g., CEACAM-1, -3 and/or -5 inhibitor
  • the inhibitor of PD-1 or PD-L1 antibody molecule is administered in combination with a CEACAM-1 inhibitor, e.g., an anti-CEACAM- 1 antibody molecule.
  • the inhibitor of PD-1 or PD-L1, e.g., the anti-PD-1 or PD-L1 antibody molecule is administered in combination with a CEACAM-5 inhibitor, e.g., an anti-CEACAM-5 antibody molecule.
  • the inhibitor of PD-1 or PD-L1, e.g., the anti-PD-1 antibody molecule is administered in combination with a LAG-3 inhibitor, e.g., an anti- LAG-3 antibody molecule, and a TIM-3 inhibitor, e.g., an anti-TIM-3 antibody molecule.
  • immunomodulators with a PD-1 inhibitor (e.g., one or more of PD-L2, CTLA-4, TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), VISTA, BTLA,
  • a PD-1 inhibitor e.g., one or more of PD-L2, CTLA-4, TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, -3 and/or -5), VISTA, BTLA,
  • TIGIT, LAIR1, CD 160, 2B4 and/or TGF beta are also within the present invention.
  • Any of the antibody molecules known in the art or disclosed herein can be used in the aforesaid combinations of inhibitors of checkpoint molecule.
  • the immunomodulator is an inhibitor of CEACAM (e.g., CEACAM-1, -3 and/or -5), e.g., human CEACAM (e.g., CEACAM-1, -3 and/or -5).
  • the immunomodulator is an inhibitor of CEACAM-1, e.g., human CEACAM-1.
  • the immunomodulator is an inhibitor of CEACAM-3, e.g., human CEACAM-3.
  • the immunomodulator is an inhibitor of CEACAM-5, e.g., human CEACAM-5.
  • the inhibitor of CEACAM is an antibody molecule to CEACAM (e.g., CEACAM-1, -3 and/or -5).
  • the CEACAM (e.g., CEACAM-1, -3 and/or -5) inhibitor can be administered alone, or in combination with other immunomodulators, e.g., in combination with an inhibitor of LAG-3, TIM-3, PD-1, PD-L1 or CTLA-4.
  • the immunomodulator is an inhibitor of LAG-3, e.g., human
  • the inhibitor of LAG-3 is an antibody molecule to LAG-3.
  • the LAG-3 inhibitor can be administered alone, or in combination with other immunomodulators, e.g., in combination with an inhibitor of CEACAM (e.g., CEACAM-1, -3 and/or -5), TIM-3, PD-1, PD-Ll or CTLA-4.
  • CEACAM e.g., CEACAM-1, -3 and/or -5
  • TIM-3 e.g., PD-1, PD-Ll or CTLA-4.
  • the immunomodulator is an inhibitor of TIM-3, e.g., human
  • the inhibitor of TIM-3 is an antibody molecule to TIM-3.
  • the TIM-3 inhibitor can be administered alone, or in combination with other immunomodulators, e.g., in combination with an inhibitor of CEACAM (e.g., CEACAM-1, -3 and/or -5), LAG-3, PD-1, PD-Ll or CTLA-4.
  • CEACAM e.g., CEACAM-1, -3 and/or -5
  • LAG-3 e.g., PD-1, PD-Ll or CTLA-4.
  • the immunomodulator used in the combinations disclosed herein is an activator or agonist of a costimulatory molecule.
  • the agonist of the costimulatory molecule is chosen from an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion) of OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CDl la/CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, or CD83 ligand.
  • the immunomodulator is a GITR agonist.
  • the GITR agonist is an antibody molecule to GITR.
  • the GITR agonist can be administered alone, or in combination with other immunomodulators, e.g., in combination with an inhibitor of PD-1, PD-Ll, CTLA-4, CEACAM (e.g., CEACAM-1, -3 and/or -5), TIM-3 or LAG-3.
  • the anti-GITR antibody molecule is a bispecific antibody that binds to GITR and PD-1, PD-Ll, CTLA-4, CEACAM (e.g., CEACAM-1, -3 and/or -5), TIM-3 or LAG-3.
  • the anti-GITR antibody molecule is administered in combination with an anti-PD-1 antibody molecule (e.g., an anti-PD-1 molecule as described herein).
  • the GITR antibody molecule and the anti-PD-1 antibody molecule may be in the form of separate antibody composition, or as a bispecific antibody molecule.
  • a GITR agonist can be administered in combination with other costimulatory molecule, e.g., an agonist of OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1
  • CDl la/CD18 CDl la/CD18
  • ICOS CD278
  • 4-1BB CD137
  • CD30 CD40
  • BAFFR BAFFR
  • HVEM HVEM
  • CD7 LIGHT
  • NKG2C SLAMF7
  • NKp80 CD160
  • B7-H3 CD83 ligand.
  • the immunomodulator is an activator of a costimulatory molecule (e.g., an OX40 agonist).
  • the OX40 agonist is an antibody molecule to OX40.
  • the OX40 agonist can be administered alone, or in combination with other immunomodulators, e.g., in combination with an inhibitor of PD-1, PD-L1, CTLA-4, CEACAM (e.g., CEACAM-1, -3 and/or -5), TIM-3 or LAG-3.
  • the anti-OX40 antibody molecule is a bispecific antibody that binds to GITR and PD-1, PD-L1, CTLA-4, CEACAM (e.g., CEACAM-1, -3 and/or -5), TIM-3 or LAG-3.
  • an OX40 antibody molecule is administered in combination with an anti-PD-1 antibody molecule (e.g., an anti-PD-1 molecule as described herein).
  • the OX40 antibody molecule and the anti-PD-1 antibody molecule may be in the form of separate antibody composition, or as a bispecific antibody molecule.
  • the OX40 agonist can be administered in combination with other costimulatory molecule, e.g., an agonist of GITR, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CDl la/CD18), ICOS (CD278), 4-1BB (CD137), CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, or CD83 ligand.
  • costimulatory molecule e.g., an agonist of GITR, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CDl la/CD18), ICOS (CD278), 4-1BB (CD137), CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, or CD83 ligand.
  • the PD-1 inhibitor is an anti-PD-1 antibody molecule as described in U.S. Patent Application Publication No. 2015/0210769 (USSN 14/604,415), entitled “Antibody Molecules to PD- 1 and Uses Thereof," incorporated by reference in its entirety.
  • the anti-PD-1 antibody molecule comprises at least one antigen-binding region, e.g., a variable region or an antigen-binding fragment thereof, from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01,
  • the anti-PD-1 antibody molecule comprises at least one, two, three or four variable regions from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1; or a
  • the anti-PD-1 antibody molecule comprises at least one or two heavy chain variable regions from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049- hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049- humlO, BAP049-huml 1, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049- huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049- Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1 ; or a sequence
  • the anti-PD-1 antibody molecule comprises at least one or two light chain variable regions from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049- hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049- humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049- huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049- Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1 ; or
  • the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgG4, e.g., a human IgG4.
  • the human IgG4 includes a substitution at position 228 according to EU numbering (e.g., a Ser to Pro substitution).
  • the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgGl, e.g., a human IgGl.
  • the human IgGl includes a substitution at position 297 according to EU numbering (e.g., an Asn to Ala substitution).
  • the human IgGl includes a substitution at position 265 according to EU numbering, a substitution at position 329 according to EU numbering, or both (e.g., an Asp to Ala substitution at position 265 and/or a Pro to Ala substitution at position 329).
  • the human IgGl includes a substitution at position 234 according to EU numbering, a substitution at position 235 according to EU numbering, or both (e.g., a Leu to Ala substitution at position 234 and/or a Leu to Ala substitution at position 235).
  • the heavy chain constant region comprises an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
  • the anti-PD-1 antibody molecule includes a kappa light chain constant region, e.g., a human kappa light chain constant region.
  • the light chain constant region comprises an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
  • the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgG4, e.g., a human IgG4, and a kappa light chain constant region, e.g., a human kappa light chain constant region, e.g., a heavy and light chain constant region comprising an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
  • the human IgG4 includes a substitution at position 228 according to EU numbering (e.g., a Ser to Pro substitution).
  • the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgGl, e.g., a human IgGl, and a kappa light chain constant region, e.g., a human kappa light chain constant region, e.g., a heavy and light chain constant region comprising an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
  • the human IgGl includes a substitution at position 297 according to EU numbering (e.g., an Asn to Ala substitution).
  • the human IgGl includes a substitution at position 265 according to EU numbering, a substitution at position 329 according to EU numbering, or both (e.g., an Asp to Ala substitution at position 265 and/or a Pro to Ala substitution at position 329).
  • the human IgGl includes a substitution at position 234 according to EU numbering, a substitution at position 235 according to EU numbering, or both (e.g., a Leu to Ala substitution at position 234 and/or a Leu to Ala substitution at position 235).
  • the anti-PD- 1 antibody molecule includes a heavy chain variable domain and a constant region, a light chain variable domain and a constant region, or both, comprising the amino acid sequence of BAP049-Clone-A, BAP049-Clone-B, BAP049- Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
  • the anti-PD-1 antibody molecule optionally, comprises a leader sequence from a heavy chain, a light chain, or both, as showin in Table 4; or a sequence substantially identical thereto.
  • the anti-PD-1 antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049- Clone-E; or as described in Table 1, or encoded by
  • the anti-PD-1 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a heavy chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • the anti-PD-1 antibody molecule includes at least one, two, or three CDRs from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml 1, BAP049-huml2, BAP049-huml3,
  • the anti-PD-1 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • the anti-PD-1 antibody molecule includes a substitution in a light chain CDR, e.g., one or more substitutions in a CDR1, CDR2 and/or CDR3 of the light chain.
  • the anti-PD-1 antibody molecule includes a substitution in the light chain CDR3 at position 102 of the light variable region, e.g., a substitution of a cysteine to tyrosine, or a cysteine to serine residue, at position 102 of the light variable region according to Table 1 (e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74, or 78 for a modified sequence).
  • Table 1 e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74
  • the anti-PD- 1 antibody molecule includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • the anti-PD-1 antibody molecule includes all six CDRs from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049- hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049- hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049- huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049- Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1, or closely related CDRs, e
  • the anti-PD-1 antibody molecule may include any CDR described herein.
  • the anti-PD-1 antibody molecule includes a substitution in a light chain CDR, e.g., one or more substitutions in a CDR1, CDR2 and/or CDR3 of the light chain.
  • the anti-PD-1 antibody molecule includes a substitution in the light chain CDR3 at position 102 of the light variable region, e.g., a substitution of a cysteine to tyrosine, or a cysteine to serine residue, at position 102 of the light variable region according to Table 1 (e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74, or 78 for a modified sequence).
  • Table 1 e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74, or 78 for a modified sequence.
  • the anti-PD- 1 antibody molecule includes at least one, two, or three CDRs according to Kabat et al. (e.g., at least one, two, or three CDRs according to the Kabat definition as set out in Table 1) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP
  • the anti-PD- 1 antibody molecule includes at least one, two, or three CDRs according to Kabat et al. (e.g., at least one, two, or three CDRs according to the Kabat definition as set out in Table 1) from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP
  • the anti-PD- 1 antibody molecule includes at least one, two, three, four, five, or six CDRs according to Kabat et al. (e.g., at least one, two, three, four, five, or six CDRs according to the Kabat definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01 , BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049- hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049- humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049- huml5, BAP049-huml6, BAP049-Clone-A, BAP049-C
  • the anti-PD-1 antibody molecule includes all six CDRs according to Kabat et al. (e.g., all six CDRs according to the Kabat definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml 1, BAP049-huml2, BAP049-huml3,
  • the anti-PD-1 antibody molecule may include any CDR described herein.
  • the anti-PD- 1 antibody molecule includes at least one, two, or three Chothia hypervariable loops (e.g., at least one, two, or three hypervariable loops according to the Chothia definition as set out in Table 1) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP0
  • the anti-PD- 1 antibody molecule includes at least one, two, or three Chothia hypervariable loops (e.g., at least one, two, or three hypervairalbe loops according to the Chothia definition as set out in Table 1) of a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049- hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049- hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049- huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049- Clone-A, BAP049-Clone-B, BAP049-Clone-C
  • the anti-PD- 1 antibody molecule includes at least one, two, three, four, five, or six hypervariable loops (e.g., at least one, two, three, four, five, or six hypervariable loops according to the Chothia definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any of B AP049-hum01 , BAP049-hum02, B AP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B,
  • the anti-PD- 1 antibody molecule includes all six hypervariable loops (e.g., all six hypervariable loops according to the Chothia definition as set out in Table 1) of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml 1, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049- Clone-E, or closely related hypervari
  • the anti-PD-1 antibody molecule includes at least one, two, or three hypervariable loops that have the same canonical structures as the
  • an antibody described herein e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049- hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049- humlO, BAP049-huml 1, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049- huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049- Clone-D, or BAP049-Clone-E, e.g., the same canonical structures as at least loop 1 and/or loop 2 of the heavy and/or light chain variable domains of an antibody described herein.
  • the anti-PD- 1 antibody molecule includes a combination of CDRs or hypervariable loops defined according to the Kabat et al and Chothia et al
  • the anti-PD-1 antibody molecule includes at least one, two or three CDRs or hypervariable loops from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E, according to the Kabat and Chothia definition (e.
  • the anti-PD-1 antibody molecule can include VH CDR1 according to
  • the combination of Kabat and Chothia CDR of VH CDR1 comprises the amino acid sequence GYTFTTYWMH (SEQ ID NO: 224), or an amino acid sequence substantially identical thereto (e.g., having at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
  • the anti-PD-1 antibody molecule can further include, e.g., VH CDRs 2-3 according to Kabat et al.
  • framework regions are defined based on a combination of CDRs defined according to Kabat et al. and hypervariable loops defined according to Chothia et al.
  • the anti-PD-1 antibody molecule can include VH FR1 defined based on VH hypervariable loop 1 according to Chothia et al. and VH FR2 defined based on VH CDRs 1-2 according to Kabat et al. , e.g., as shown in Table 1.
  • the anti-PD-1 antibody molecule can further include, e.g., VH FRs 3-4 defined based on VH CDRs 2-3 according to Kabat et al. and VL FRs 1-4 defined based on VL CDRs 1-3 according to Kabat et al.
  • the anti-PD-1 antibody molecule can contain any combination of CDRs or hypervariable loops according to the Kabat and Chothia definitions.
  • the anti-PD-1 antibody molecule includes at least one, two or three CDRs from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone
  • the anti-PD-1 antibody molecule includes: (a) a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence of SEQ ID NO: 4, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a light chain variable region (VL) comprising a VLCDRl amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 33;
  • VH heavy chain variable region
  • VL light chain variable region
  • VH comprising a VHCDR1 amino acid sequence chosen from SEQ ID NO: 1 ;
  • VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224, a
  • VHCDR2 amino acid sequence of SEQ ID NO: 5 and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDRl amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 33; or
  • VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224;
  • the anti-PD-1 antibody molecule comprises (i) a heavy chain variable region (VH) comprising a VHCDR1 amino acid sequence chosen from SEQ ID NO: 1, SEQ ID NO: 4, or SEQ ID NO: 224; a VHCDR2 amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 5; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and (ii) a light chain variable region (VL) comprising a
  • VLCDRl amino acid sequence of SEQ ID NO: 10 or SEQ ID NO: 13 a VLCDR2 amino acid sequence of SEQ ID NO: 11 or SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 32 or SEQ ID NO: 33.
  • the antibody molecule is a monospecific antibody molecule, a bispecific antibody molecule, or is an antibody molecule that comprises an antigen binding fragment of an antibody, e.g., a half antibody or antigen binding fragment of a half antibody.
  • a CDR e.g., Chothia CDR or Kabat CDR
  • the antibody molecule is a monospecific antibody molecule, a bispecific antibody molecule, or is an antibody molecule that comprises an antigen binding fragment of an antibody, e.g., a half antibody or antigen binding fragment of a half antibody.
  • the antibody molecule is a bispecific antibody molecule having a first binding specificity for PD- 1 and a second binding specificity for TIM-3, LAG- 3, CEACAM (e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5), PD-L1 or PD-L2.
  • the bispecific antibody molecule binds to PD-1 and TIM-3.
  • the bispecific antibody molecule binds to PD-1 and LAG-3.
  • the bispecific antibody molecule binds to PD-1 and CEACAM (e.g., CEACAM-1, CEACAM-3, and/or CEACAM- 5).
  • the bispecific antibody molecule binds to PD-1 and CEACAM-1. In yet another embodiment, the bispecific antibody molecule binds to PD-1 and CEACAM-5. In another embodiment, the bispecific antibody molecule binds to PD-1 and PD-L1. In yet another embodiment, the bispecific antibody molecule binds to PD- 1 and PD-L2.
  • any combination of the aforesaid molecules can be made in a multispecific antibody molecule, e.g., a trispecific antibody that includes a first binding specificity to PD-1, and a second and third binding specificity to one or more of: TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, CEACAM-3, or CEACAM-5), PD-L1 or PD-L2.
  • a multispecific antibody molecule e.g., a trispecific antibody that includes a first binding specificity to PD-1, and a second and third binding specificity to one or more of: TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, CEACAM-3, or CEACAM-5), PD-L1 or PD-L2.
  • the anti-PD-1 antibody molecule is used in combination with a bispecific molecule comprising one or more of: TIM-3, LAG-3, CEACAM (e.g., CEACAM- 1, CEACAM-3, or CEACAM-5), PD-L1 or PD-L2.
  • the bispecific antibody molecule used in combination binds to CEACAM (e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5) and LAG-3.
  • the bispecific antibody molecule used in combination binds to CEACAM (e.g., CEACAM-1, CEACAM-3, and/or CEACAM- 5) and TIM-3.
  • the bispecific antibody molecule used in combination binds to LAG-3 and TIM-3.
  • the combinations disclosed herein can result in one or more of: an increase in antigen presentation, an increase in effector cell function (e.g., one or more of T cell proliferation, IFN- ⁇ secretion or cytolytic function), inhibition of regulatory T cell function, an effect on the activity of multiple cell types, such as regulatory T cell, effector T cells and NK cells), an increase in tumor infiltrating lymphocytes, an increase in T-cell receptor mediated proliferation, and a decrease in immune evasion by cancerous cells.
  • the use of a PD-1 inhibitor in the combinations inhibits, reduces or neutralizes one or more activities of PD-1, resulting in blockade or reduction of an immune checkpoint.
  • a method of modulating an immune response in a subject comprises administering to the subject a combination disclosed herein (e.g., a combination comprising a therapeutically effective amount of an anti-PD-1 antibody molecule), alone or in combination with one or more agents or procedures, such that the immune response in the subject is modulated.
  • a combination disclosed herein e.g., a combination comprising a therapeutically effective amount of an anti-PD-1 antibody molecule
  • the antibody molecule enhances, stimulates or increases the immune response in the subject.
  • the subject can be a mammal, e.g., a primate, preferably a higher primate, e.g., a human (e.g., a patient having, or at risk of having, a disorder described herein).
  • the subject is in need of enhancing an immune response.
  • the subject has, or is at risk of, having a disorder described herein, e.g., a cancer or an infectious disorder as described herein.
  • the subject is, or is at risk of being,
  • the subject is undergoing or has undergone a chemotherapeutic treatment and/or radiation therapy.
  • the subject is, or is at risk of being, immunocompromised as a result of an infection.
  • a method of treating e.g., one or more of reducing, inhibiting, or delaying progression
  • the method comprises administering to the subject a combination disclosed herein (e.g., a combination comprising a therapeutically effective amount of an anti-PD-1 antibody molecule).
  • the cancer treated with the combination includes but is not limited to, a solid tumor, a hematological cancer (e.g., leukemia, lymphoma, myeloma, e.g., multiple myeloma), and a metastatic lesion.
  • a hematological cancer e.g., leukemia, lymphoma, myeloma, e.g., multiple myeloma
  • a metastatic lesion e.g., leukemia, lymphoma, myeloma, e.g., multiple myeloma
  • the cancer is a solid tumor.
  • solid tumors include malignancies, e.g., sarcomas and carcinomas, e.g., adenocarcinomas of the various organ systems, such as those affecting the lung, breast, ovarian, lymphoid, gastrointestinal (e.g., colon), anal, genitals and genitourinary tract (e.g., renal, urothelial, bladder cells, prostate), pharynx, CNS (e.g., brain, neural or glial cells), head and neck, skin (e.g., melanoma or Merkel cell carcinoma), and pancreas, as well as adenocarcinomas which include malignancies such as colon cancers, rectal cancer, renal-cell carcinoma, liver cancer, non-small cell lung cancer, cancer of the small intestine and cancer of the esophagus.
  • the cancer may be at an early, intermediate, late stage or metastatic cancer.
  • the cancer is chosen from a lung cancer (e.g., a non-small cell lung cancer (NSCLC) (e.g., a NSCLC with squamous and/or non-squamous histology, or a NSCLC adenocarcinoma)), a skin cancer (e.g., a Merkel cell carcinoma or a melanoma (e.g., an advanced melanoma)), a kidney cancer (e.g., a renal cancer (e.g., a renal cell carcinoma), a liver cancer, a myeloma (e.g., a multiple myeloma), a prostate cancer, a breast cancer (e.g., a breast cancer that does not express one, two or all of estrogen receptor, progesterone receptor, or Her2/neu, e.g., a triple negative breast cancer), a colorectal cancer, a pancreatic cancer, a head and neck cancer (e.g., head and neck cancer
  • a glioblastoma an endometrial cancer, an anal cancer, a gastro-esophageal cancer, a thyroid cancer (e.g., anaplastic thyroid carcinoma), a cervical cancer, a neuroendocrine tumor (NET) (e.g., an atypical pulmonary carcinoid tumor), a lymphoproliferative disease (e.g., a post-transplant lymphoproliferative disease) or a hematological cancer, T-cell lymphoma, B- cell lymphoma, a non-Hogdkin lymphoma, or a leukemia (e.g., a myeloid leukemia or a lymphoid leukemia).
  • NET neuroendocrine tumor
  • NET e.g., an atypical pulmonary carcinoid tumor
  • a lymphoproliferative disease e.g., a post-transplant lymphoproliferative disease
  • a leukemia e.g., a
  • the cancer is chosen form a carcinoma (e.g., advanced or metastatic carcinoma), melanoma or a lung carcinoma, e.g., a non-small cell lung carcinoma.
  • a carcinoma e.g., advanced or metastatic carcinoma
  • melanoma e.g., a non-small cell lung carcinoma.
  • the cancer is a lung cancer, e.g., a non-small cell lung cancer or small cell lung cancer.
  • the cancer is a melanoma, e.g., an advanced melanoma. In one embodiment, the cancer is an advanced or unresectable melanoma that does not respond to other therapies. In other embodiments, the cancer is a melanoma with a BRAF mutation (e.g., a BRAF V600 mutation). In yet other embodiments, the combination disclosed herein (e.g., the combination comprising the anti-PD-1 antibody molecule) is administered after treatment with an anti-CTLA-4 antibody (e.g., ipilimumab) with or without a BRAF inhibitor (e.g., vemurafenib or dabrafenib).
  • an anti-CTLA-4 antibody e.g., ipilimumab
  • a BRAF inhibitor e.g., vemurafenib or dabrafenib.
  • the cancer is a hepatocarcinoma, e.g., an advanced hepatocarcinoma, with or without a viral infection, e.g., a chronic viral hepatitis.
  • a hepatocarcinoma e.g., an advanced hepatocarcinoma
  • a viral infection e.g., a chronic viral hepatitis.
  • the cancer is a prostate cancer, e.g., an advanced prostate cancer.
  • the cancer is a myeloma, e.g., multiple myeloma.
  • the cancer is a renal cancer, e.g., a renal cell carcinoma (RCC) (e.g., a metastatic RCC or clear cell renal cell carcinoma (CCRCC)).
  • RCC renal cell carcinoma
  • CCRCC clear cell renal cell carcinoma
  • the cancer is MSI-high (high microsatellite instability) cancer (e.g., an MSI-high endometrial cancer).
  • the cancer is an EBV+ cancer.
  • the cancer is a FoxP3-expressing cancer (e.g., a FoxP3- expressing non-small cell lung cancer or head and neck squamous cell carcinoma).
  • the cancer is EGFR mutated or cMET positive (e.g., an EGFR mutated or cMET positive non-small cell lung cancer).
  • the cancer has a KRAS mutation (e.g., a non-small cell lung cancer having a KRAS mutation).
  • a method of treating a cancer in a subject comprises administering to the subject a combination of two, three or more therapeutic agents chosen from two or all of the following categories (i)-(iii):
  • an agent that enhances tumor antigen presentation chosen from a STING agonist, a TLR agonist, an A2AR antagonist, or an oncolytic virus, or a combination therof, and, optionally, one or more of: a TIM-3 modulator, a vascular endothelial growth factor receptor (VEGFR) inhibitor, a c-Met inhibitor, a TGFb inhibitor, an IDO/TDO inhibitor, a vaccine, or a bi- or tri-specific cell engager;
  • a TIM-3 modulator a vascular endothelial growth factor receptor (VEGFR) inhibitor, a c-Met inhibitor, a TGFb inhibitor, an IDO/TDO inhibitor, a vaccine, or a bi- or tri-specific cell engager
  • an agent that enhances an effector cell response chosen chosen from one or more of: a GITR agonist, a PD- 1 inhibitor, a PD-L1 inhibitor, an inhibitor of IAP (Inhibitor of Apoptosis Protein), an inhibitor of EGFR (Epidermal Growth Factor Receptor), an inhibitor of target of rapamycin (mTOR), IL- 15 or a variant thereof, a CTLA-4 inhibitor, a bispecific antibody molecule that binds to CD3 and a tumor antigen, a CD40 agonist, an OX40 agonist, or a CD27 agonist; or
  • an agent that decreases tumor immunosuppression chosen an anti-PD-1 antibody molecule, and, optionally, one or more of: a GITR agonist, an inhibitor of an immune checkpoint molecule chosen from one or more of PD-L1, LAG-3, TIM-3 or CTLA-4, a CSF- 1/lR inhibitor, an IL- 17 inhibitor, an IL- ⁇ ⁇ inhibitor, a CXCR2 inhibitor, an inhibitor of PBKy or PI3K5), (vii) a BAFF-R inhibitor, a MALT-l/BTK inhibitor, a JAK inhibitor, a CRTH2 inhibitor, a VEGFR inhibitor, an IL-15 or a variant thereof, a CTLA-4 inhibitor, an IDO/TDO inhibitor, an A2AR antagonist, a TGFb inhibitor, or a PFKFB3 inhibitor,
  • a GITR agonist an inhibitor of an immune checkpoint molecule chosen from one or more of PD-L1, LAG-3, TIM-3 or CTLA-4, a C
  • anti-PD- 1 antibody molecule comprises:
  • VH heavy chain variable region
  • VL light chain variable region
  • a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 1 ; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32;
  • a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDRl amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 33;
  • VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDRl amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32.
  • the anti-PD-1 antibody molecule comprises:
  • a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 74;
  • the cancer is chosen from a cancer described herein, e.g., a lung cancer, a squamous cell lung cancer, a melanoma, a renal cancer, a liver cancer, a myeloma, a prostate cancer, a breast cancer, an ER+ breast cancer, an IM-TN breast cancer, a colorectal cancer, a colorectal cancer with high micros atellite instability, an EBV+ gastric cancer, a pancreatic cancer, a thyroid cancer, a hematological cancer, a non-Hogdkin' s lymphoma, or a leukemia, or a metastatic lesion of the cancer.
  • the cancer is chosen from a non-small cell lung cancer (NSCLC), a NSCLC adenocarcinoma, a NSCLC squamous cell carcinoma, or a hepatocellular carcinoma.
  • NSCLC non-small cell lung cancer
  • NSCLC non-small cell lung cancer
  • the cancer microenvironment has an elevated level of PD-Ll expression.
  • the cancer microenvironment can have increased IFNy and/or CD8 expression.
  • the subject has, or is identified as having, a tumor that has one or more of high PD-Ll level or expression, or as being Tumor Infiltrating Lymphocyte (TIL)+ (e.g., as having an increased number of TILs), or both.
  • TIL Tumor Infiltrating Lymphocyte
  • the subject has, or is identified as having, a tumor that has high PD-Ll level or expression and that is TIL+.
  • the methods described herein further include identifying a subject based on having a tumor that has one or more of high PD-Ll level or expression, or as being TIL+, or both.
  • the methods described herein further include identifying a subject based on having a tumor that has high PD-Ll level or expression and as being TIL+.
  • tumors that are TIL+ are positive for CD8 and IFNy.
  • the subject has, or is identified as having, a high percentage of cells that are positive for one, two or more of PD-Ll, CD8, and/or IFNy.
  • the subject has or is identified as having a high percentage of cells that are positive for all of PD- Ll, CD8, and IFNy.
  • the methods described herein further include identifying a subject based on having a high percentage of cells that are positive for one, two or more of PD-Ll, CD8, and/or IFNy. In certain embodiments, the methods described herein further include identifying a subject based on having a high percentage of cells that are positive for all of PD-Ll, CD8, and IFNy. In some embodiments, the subject has, or is identified as having, one, two or more of PD-Ll, CD8, and/or IFNy, and one or more of a lung cancer, e.g.
  • squamous cell lung cancer or lung adenocarcinoma e.g., an NSCLC
  • a head and neck cancer e.g., a squamous cell cervical cancer; a stomach cancer; an esophageal cancer; a thyroid cancer (e.g., anaplastic thyroid carcinoma); a skin cancer (e.g., a Merkel cell carcinoma or a melanoma), a breast cancer (e.g., an NTBC), and/or a nasopharyngeal cancer (NPC).
  • NSCLC nasopharyngeal cancer
  • the methods described herein further describe identifying a subject based on having one, two or more of PD-Ll, CD8, and/or IFNy, and one or more of a lung cancer, e.g. , squamous cell lung cancer or lung adenocarcinoma (e.g., an NSCLC); a head and neck cancer; a squamous cell cervical cancer; a stomach cancer; a thyroid cancer (e.g., anaplastic thyroid carcinoma); a skin cancer (e.g., a Merkel cell carcinoma or a melanoma), an neuroendocrine tumor, a breast cancer (e.g., an NTBC), and/or a nasopharyngeal cancer.
  • a lung cancer e.g. , squamous cell lung cancer or lung adenocarcinoma (e.g., an NSCLC); a head and neck cancer; a squamous cell cervical cancer; a stomach cancer; a thyroid cancer (
  • Methods and compositions disclosed herein are useful for treating metastatic lesions associated with the aforementioned cancers.
  • the invention provides a method of treating an infectious disease in a subject, comprising administering to a subject a combination as described herein, e.g., a combination comprising a therapeutically effective amount of an anti-PD- 1 antibody molecule described herein.
  • the infection disease is chosen from hepatitis (e.g., hepatis C infection), or sepsis.
  • the invention provides a method of enhancing an immune response to an antigen in a subject, comprising administering to the subject: (i) the antigen; and (ii) a combination as described herein, e.g., a combination comprising a therapeutically effective amount of an anti-PD-1 antibody molecule described herein, such that an immune response to the antigen in the subject is enhanced.
  • the antigen can be, for example, a tumor antigen, a viral antigen, a bacterial antigen or an antigen from a pathogen.
  • the anti-PD-1 antibody molecule is administered by injection (e.g., subcutaneously or intravenously) at a dose of about 1 to 30 mg/kg, e.g., about 5 to 25 mg/kg, about 10 to 20 mg/kg, about 1 to 5 mg/kg, or about 3 mg/kg.
  • the dosing schedule can vary from e.g., once a week to once every 2, 3, or 4 weeks.
  • the anti-PD-1 antibody molecule is administered at a dose from about 10 to 20 mg/kg every other week.
  • the anti-PD-1 antibody molecule is administered, alone or in combination (e.g., in combination with an anti-LAG-3 antibody molecule), at a dose of less than, or about, 5 mg/kg; less than, or about, 4 mg/kg; less than, or about, 3 mg/kg; less than, or about, 2 mg/kg; less than, or about, 1 mg/kg, every other week.
  • the anti-PD-1 antibody molecule is administered at a dose of 1 to 5 mg/kg every other week; 1 to 4 mg/kg every other week, 1 to 3 mg/kg every other week, or 1 to 2 mg/kg every other week.
  • the anti-LAG-3 antibody molecule is administered, alone or in combination (e.g., in combination with an anti-PD-1 antibody molecule) at a dose of 1 to 5 mg/kg every other week; 1 to 4 mg/kg every other week, 1 to 3 mg/kg every other week, or 1 to 2 mg/kg every other week.
  • antibody molecules described herein are preferred for use in the methods described herein, although other anti-PD- 1 antibodies can be used instead, or in combination with an anti-PD-1 antibody molecule of the invention.
  • the methods and combinations described herein can be used in combination with other agents or therapeutic modalities.
  • the methods described herein include administering to the subject a combination comprising an anti-PD-1 antibody molecule as described herein, in combination with an agent or therapeutic procedure or modality, in an amount effective to treat or prevent a disorder.
  • the anti-PD- 1 antibody molecule and the agent or therapeutic procedure or modality can be administered
  • any combination and sequence of the anti-PD-1 antibody molecules and other therapeutic agents, procedures or modalities can be used.
  • the antibody molecule and/or other therapeutic agents, procedures or modalities can be administered during periods of active disorder, or during a period of remission or less active disease.
  • the antibody molecule can be administered before the other treatment, concurrently with the treatment, post-treatment, or during remission of the disorder.
  • the methods and compositions described herein are administered in combination with one or more of other antibody molecules, chemotherapy, other anti-cancer therapy (e.g., targeted anti-cancer therapies, gene therapy, viral therapy, RNA therapy bone marrow transplantation, nanotherapy, or oncolytic drugs), cytotoxic agents, immune-based therapies (e.g., cytokines or cell-based immune therapies), surgical procedures (e.g., lumpectomy or mastectomy) or radiation procedures, or a combination of any of the foregoing.
  • the additional therapy may be in the form of adjuvant or neoadjuvant therapy.
  • the additional therapy is an enzymatic inhibitor (e.g. , a small molecule enzymatic inhibitor) or a metastatic inhibitor.
  • Exemplary cytotoxic agents that can be administered in combination with include antimicrotubule agents, topoisomerase inhibitors, anti-metabolites, mitotic inhibitors, alkylating agents, anthracyclines, vinca alkaloids, intercalating agents, agents capable of interfering with a signal transduction pathway, agents that promote apoptosis, proteosome inhibitors, and radiation (e.g., local or whole body irradiation (e.g., gamma irradiation).
  • the additional therapy is surgery or radiation, or a combination thereof.
  • the additional therapy is a therapy targeting one or more of PI3K/AKT/mTOR pathway, an HSP90 inhibitor, or a tubulin inhibitor.
  • the methods and compositions described herein can be administered in combination with one or more of: an immunomodulator (e.g., an activator of a costimulatory molecule or an inhibitor of an inhibitory molecule, e.g., an immune checkpoint molecule); a vaccine, e.g., a therapeutic cancer vaccine; or other forms of cellular immunotherapy.
  • an immunomodulator e.g., an activator of a costimulatory molecule or an inhibitor of an inhibitory molecule, e.g., an immune checkpoint molecule
  • a vaccine e.g., a therapeutic cancer vaccine
  • Exemplary non- limiting combinations and uses of the combinations disclosed herein, e.g., a combination comprising an anti-PD-1 antibody molecule, include the following.
  • the combination disclosed herein e.g., a combination comprising an anti-PD- 1 antibody molecule
  • a modulator of a costimulatory molecule or an inhibitory molecule e.g., a co-inhibitory ligand or receptor.
  • the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule
  • a modulator e.g., agonist
  • the agonist of the costimulatory molecule is chosen from an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion) of OX40, CD2, CD27, CDS, ICAM-1, LFA-1 (CDl la/CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3 or CD83 ligand.
  • an agonist e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion
  • OX40 e.g., CD2, CD27, CDS, ICAM-1, LFA-1 (CDl la/CD18), ICOS (CD27
  • the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule
  • an inhibitor of an inhibitory (or immune checkpoint) molecule chosen from PD-L1, PD-L2, CTLA-4, TIM-3, LAG- 3, CEACAM (e.g. , CEACAM-1, CEACAM-3, and/or CEACAM-5), VISTA, BTLA, TIGIT, LAIR1 , CD 160, 2B4 and/or TGF beta.
  • the inhibitor is a soluble ligand (e.g., a CTLA-4-Ig), or an antibody or antibody fragment that binds to PD-L1, PD-L2 or CTLA-4.
  • the anti-PD- 1 antibody molecule can be administered in combination with an anti-CTLA-4 antibody, e.g., ipilimumab, for example, to treat a cancer (e.g., a cancer chosen from: a melanoma, e.g., a metastatic melanoma; a lung cancer, e.g., a non-small cell lung carcinoma; or a prostate cancer).
  • a cancer e.g., a cancer chosen from: a melanoma, e.g., a metastatic melanoma; a lung cancer, e.g., a non-small cell lung carcinoma; or a prostate cancer.
  • the anti-PD-1 antibody molecule is administered after treatment with an anti-CTLA-4 antibody (e.g., ipilimumab) with or without a BRAF inhibitor (e.g., vemurafenib or dabrafenib).
  • the combination disclosed herein e.g.
  • the combination disclosed herein e.g., a combination comprising an anti-PD- 1 antibody molecule
  • the combination disclosed herein e.g., a combination comprising an anti-PD- 1 antibody molecule, is administered in combination with an anti- LAG-3 antibody and an anti-TIM-3 antibody (or antigen-binding fragments thereof).
  • the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule, is administered in combination with a
  • CEACAM inhibitor e.g., CEACAM-1 and/or CEACAM-5 inhibitor
  • an anti-CEACAM antibody molecule e.g., an anti-CEACAM antibody molecule.
  • the anti-PD-1 antibody molecule is administered in combination with a CEACAM-1 inhibitor, e.g., an anti-CEACAM- 1 antibody molecule.
  • the anti-PD- 1 antibody molecule is administered in combination with a CEACAM-5 inhibitor, e.g., an anti-CEACAM-5 antibody molecule.
  • the combination of antibodies recited herein can be administered separately, e.g., as separate antibodies or antigen-binding fragments thereof, or linked, e.g., as a bispecific or trispecific antibody molecule.
  • a bispecific antibody that includes an anti-PD-1 antibody molecule and an anti-TIM-3, anti-CEACAM (e.g., anti-CEACAM- 1, CEACAM-3, and/or anti-CEACAM-5), or anti-LAG-3 antibody, or an antigen-binding fragment thereof, is administered.
  • the combination of antibodies recited herein is used to treat a cancer, e.g., a cancer as described herein (e.g., a solid tumor or a hematologic malignancy).
  • the combination disclosed herein e.g., a combination comprising an anti-PD- 1 antibody molecule
  • a cytokine is administered in combination with a cytokine.
  • the cytokine can be administered as a fusion molecule to the anti-PD- 1 antibody molecule, or as separate compositions.
  • the anti-PD-1 antibody is administered in combination with one, two, three or more cytokines, e.g., as a fusion molecule or as separate compositions.
  • the cytokine is an interleukin (IL) chosen from one, two, three or more of IL-1, IL-2, IL-12, IL-15 or IL-21.
  • IL interleukin
  • a bispecific antibody molecule has a first binding specificity to a first target (e.g., to PD-1), a second binding specificity to a second target (e.g., LAG-3 or TIM-3), and is optionally linked to an interleukin (e.g., IL-12) domain e.g., full length IL-12 or a portion thereof.
  • a first target e.g., to PD-1
  • a second binding specificity to a second target e.g., LAG-3 or TIM-3
  • an interleukin e.g., IL-12 domain
  • the combination of anti-PD- 1 antibody molecule and the cytokine described herein is used to treat a cancer, e.g., a cancer as described herein (e.g., a solid tumor).
  • the combination disclosed herein e.g., a combination comprising an anti-PD- 1 antibody molecule
  • an antibody specific against an HLA C e.g., an antibody specific to Killer-cell Immunoglobulin- like Receptors (also referred to herein as an "anti-KIR antibody").
  • the combination of anti-PD- 1 antibody molecule and anti-KIR antibody is used to treat a cancer, e.g., a cancer as described herein (e.g., a solid tumor, e.g., an advanced solid tumor).
  • the combination disclosed herein e.g., a combination comprising an anti-PD- 1 antibody molecule, is administered in combination with a cellular
  • the combination of anti-PD- 1 antibody molecule, Provenge® and/or cyclophosphamide is used to treat a cancer, e.g., a cancer as described herein (e.g., a prostate cancer, e.g., an advanced prostate cancer).
  • a cancer e.g., a cancer as described herein (e.g., a prostate cancer, e.g., an advanced prostate cancer).
  • the combination disclosed herein is administered in combination with a vaccine, e.g., a cancer vaccine, (e.g., a dendritic cell renal carcinoma (DC-RCC) vaccine).
  • a vaccine e.g., a cancer vaccine, (e.g., a dendritic cell renal carcinoma (DC-RCC) vaccine).
  • the vaccine is peptide-based, DNA-based, RNA-based, or antigen-based, or a combination thereof.
  • the vaccine comprises one or more peptides, nucleic acids (e.g. , DNA or RNA), antigens, or a combination thereof.
  • the combination of anti-PD- 1 antibody molecule and the DC-RCC vaccine is used to treat a cancer, e.g., a cancer as described herein (e.g., a renal carcinoma, e.g., metastatic renal cell carcinoma (RCC) or clear cell renal cell carcinoma (CCRCC)).
  • a cancer e.g., a cancer as described herein (e.g., a renal carcinoma, e.g., metastatic renal cell carcinoma (RCC) or clear cell renal cell carcinoma (CCRCC)).
  • a cancer as described herein e.g., a renal carcinoma, e.g., metastatic renal cell carcinoma (RCC) or clear cell renal cell carcinoma (CCRCC)
  • the combination disclosed herein e.g., a combination comprising an anti-PD- 1 antibody molecule, is administered in combination with an adjuvant.
  • the combination disclosed herein e.g., a combination comprising an anti-PD- 1 antibody molecule, is administered in combination with
  • the anti-PD- 1 antibody molecule can be used to treat a myeloma, alone or in combination with one or more of: chemotherapy or other anti-cancer agents (e.g., thalidomide analogs, e.g., lenalidomide), an anti-TIM-3 antibody, tumor antigen-pulsed dendritic cells, fusions (e.g., electrofusions) of tumor cells and dendritic cells, or vaccination with immunoglobulin idiotype produced by malignant plasma cells.
  • the anti-PD- 1 antibody molecule is used in combination with an anti-TIM-3 antibody to treat a myeloma, e.g., a multiple myeloma.
  • the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule
  • a lung cancer e.g., non-small cell lung cancer.
  • the anti-PD-1 antibody molecule is used with standard lung, e.g., NSCLC, chemotherapy, e.g., platinum doublet therapy, to treat lung cancer.
  • the anti-PD-1 antibody molecule is used in combination with an indoleamine-pyrrole 2,3-dioxygenase (IDO) inhibitor (e.g., (4E)- 4-[(3-chloro-4-fluoroanilino)-nitrosomethylidene]-l,2,5-oxadiazol-3-amine (also known as INCB24360), indoximod (1-methyl-D-tryptophan), a-cyclohexyl-5H-Imidazo[5,l- a]isoindole-5-ethanol (also known as NLG919), etc.) in a subject with advanced or metastatic cancer (e.g. , a patient with metastic and recurrent NSCL cancer).
  • IDO indoleamine-pyrrole 2,3-dioxygenase
  • the combination disclosed herein is used in combination with one or more of: an immune-based strategy (e.g., interleukin-2 or interferon- a), a targeting agent (e.g., a VEGF inhibitor such as a monoclonal antibody to VEGF); a VEGF tyrosine kinase inhibitor such as sunitinib, sorafenib, axitinib and pazopanib; an RNAi inhibitor; or an inhibitor of a downstream mediator of VEGF signaling, e.g., an inhibitor of the mammalian target of rapamycin (mTOR), e.g., everolimus and temsirolimus.
  • mTOR mammalian target of rapamycin
  • Any of such combinations can be used to treat a renal cancer, e.g., renal cell carcinoma (RCC) (e.g., clear cell renal cell carcinoma (CCRCC)) or metastatic RCC.
  • RCC renal cell carcinoma
  • the combination disclosed herein e.g., a combination comprising an anti-PD- 1 antibody molecule
  • a MEK inhibitor e.g., a MEK inhibitor as described herein
  • the combination of the anti-PD-1 antibody and the MEK inhibitor is used to treat a cancer (e.g., a cancer described herein).
  • the cancer treated with the combination is chosen from a melanoma, a colorectal cancer, a non-small cell lung cancer, an ovarian cancer, a breast cancer, a prostate cancer, a pancreatic cancer, a hematological malignancy or a renal cell carcinoma.
  • the cancer includes a BRAF mutation (e.g., a BRAF V600E mutation), a BRAF wildtype, a KRAS wildtype or an activating KRAS mutation.
  • the cancer may be at an early, intermediate or late stage.
  • the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule
  • a combination is used in combination with one, two or all of oxaliplatin, leucovorin or 5-FU (e.g., a FOLFOX co-treatment).
  • combination further includes a VEGF inhibitor (e.g., a VEGF inhibitor as disclosed herein).
  • the combination of the anti-PD-1 antibody, the FOLFOX co-treatment, and the VEGF inhibitor is used to treat a cancer (e.g. , a cancer described herein).
  • the cancer treated with the combination is chosen from a melanoma, a colorectal cancer, a non-small cell lung cancer, an ovarian cancer, a breast cancer, a prostate cancer, a pancreatic cancer, a hematological malignancy or a renal cell carcinoma.
  • the cancer may be at an early, intermediate or late stage.
  • the combination disclosed herein e.g., a combination comprising an anti-PD- 1 antibody molecule
  • a tyrosine kinase inhibitor e.g., axitinib
  • the combination disclosed herein e.g., a combination comprising an anti-PD-1 antibody molecule
  • a 4- IBB receptor targeting agent e.g., an antibody that stimulates signaling through 4- IBB (CD- 137), e.g., PF-2566.
  • the anti-PD- 1 antibody molecule is administered in combination with a tyrosine kinase inhibitor (e.g., axitinib) and a 4- IBB receptor targeting agent.
  • the anti-PD-1 antibody molecule can be bound to a substance, e.g., a cytotoxic agent or moiety (e.g., a therapeutic drug; a compound emitting radiation; molecules of plant, fungal, or bacterial origin; or a biological protein (e.g., a protein toxin) or particle (e.g. , a recombinant viral particle, e.g., via a viral coat protein).
  • the antibody can be coupled to a radioactive isotope such as an ⁇ -, ⁇ -, or ⁇ -emitter, or a ⁇ -and ⁇ -emitter.
  • any combination and sequence of the anti-PD- 1 antibody molecules and other therapeutic agents, procedures or modalities can be used.
  • the antibody molecule and/or other therapeutic agents, procedures or modalities can be administered during periods of active disorder, or during a period of remission or less active disease.
  • the antibody molecule can be administered before the other treatment, concurrently with the treatment, post-treatment, or during remission of the disorder.
  • any of the combinations disclosed herein further includes one or more of the agents described in Table 7.
  • the additional therapeutic agent is chosen from one or more of: 1) a protein kinase C (PKC) inhibitor; 2) a heat shock protein 90 (HSP90) inhibitor; 3) an inhibitor of a phosphoinositide 3-kinase (PI3K) and/or target of rapamycin (mTOR); 4) an inhibitor of cytochrome P450 (e.g., a CYP17 inhibitor or a 17alpha-Hydroxylase/C17-20 Lyase inhibitor); 5) an iron chelating agent; 6) an aromatase inhibitor; 7) an inhibitor of p53, e.g.
  • PPC protein kinase C
  • HSP90 heat shock protein 90
  • PI3K phosphoinositide 3-kinase
  • mTOR target of rapamycin
  • cytochrome P450 e.g., a CYP17 inhibitor or a 17alpha-Hydroxylase/C17-20 Lyase inhibitor
  • an inhibitor of a p53/Mdm2 interaction an inhibitor of a p53/Mdm2 interaction; 8) an apoptosis inducer; 9) an angiogenesis inhibitor; 10) an aldosterone synthase inhibitor; 11) a smoothened (SMO) receptor inhibitor; 12) a prolactin receptor (PRLR) inhibitor; 13) a Wnt signaling inhibitor; 14) a CDK4/6 inhibitor; 15) a fibroblast growth factor receptor 2 (FGFR2)/fibroblast growth factor receptor 4 (FGFR4) inhibitor; 16) an inhibitor of macrophage colony- stimulating factor (M-CSF); 17) an inhibitor of one or more of c-KIT, histamine release, Flt3 (e.g.
  • VEGFR-2 e.g. , FLK-l/KDR
  • PDGFRbeta e.g., c-KIT
  • Raf kinase C e.g., a somatostatin agonist and/or a growth hormone release inhibitor
  • ALK an anaplastic lymphoma kinase
  • IGF-IR insulin-like growth factor 1 receptor
  • P- Glycoprotein 1 inhibitor a vascular endothelial growth factor receptor (VEGFR) inhibitor
  • BCR-ABL kinase inhibitor e.g.
  • an inhibitor of the HDM2-p53 interaction 28) an inhibitor of a tyrosine kinase; 29) an inhibitor of c-MET; 30) an inhibitor of JAK; 31) an inhibitor of DAC; 32) an inhibitor of ⁇ ⁇ -hydroxylase; 33) an inhibitor of IAP; 34) an inhibitor of PIM kinase; 35) an inhibitor of Porcupine; 36) an inhibitor of BRAF, e.g. , BRAF V600E or wild-type BRAF; 37) an inhibitor of HER3; 38) an inhibitor of MEK; or 39) an inhibitor of a lipid kinase, e.g., as described herein and in Table 7.
  • the additional therapeutic agent is chosen from one or more of: Compound A8, Compound A17, Compound A23, Compound A24, Compound A27, Compound A29, Compound A33, and Compound A13.
  • the additional therapeutic agent is chosen from one or more of:
  • the additional therapeutic agent is chosen from one or more of: Compound A9, Compound A16, Compound A17, Compound A21, Compound A22, Compound A25, Compound A28, Compound A48, and Compound 49.
  • the cancer is chosen from a lung cancer (e.g., a non-small cell lung cancer (NSCLC) (e.g., a NSCLC with squamous and/or non-squamous histology, or a NSCLC adenocarcinoma), or disclosed in a publication listed in Table 7.
  • NSCLC non-small cell lung cancer
  • Table 7 a publication listed in Table 7.
  • Additional embodiments provide a method of treating a cancer, comprising:
  • identifying in a subject or a sample e.g., a subject's sample comprising cancer cells and optionally immune cells such as TILs
  • the method can further include comparing the PD-Ll, CD8, and/or IFN- ⁇ values to a reference value, e.g., a control value. If the PD-Ll, CD8, and/or IFN- ⁇ values are greater than the reference value, e.g., the control values, administering a therapeutically effective amount of a combination as described herein (e.g.
  • the cancer may be, e.g., a cancer described herein, such as lung cancer (squamous), lung cancer (adenocarcinoma), head and neck cancer, cervical cancer (squamous), stomach cancer, thyroid cancer (e.g., anaplastic thyroid carcinoma), skin cancer (e.g., Merkel cell carcinoma or, melanoma), nasopharyngeal cancer, neuroendocrine tumor (e.g., an atypical pulmonary carcinoid tumor), or breast cancer, e.g. , TN breast cancer, e.g. , IM-TN breast cancer.
  • the cancer is ER+ breast cancer or pancreatic cancer.
  • Also provided is a method of treating a cancer comprising: testing a subject or a sample (e.g., a subject's sample comprising cancer cells) for the presence of PD-Ll, thereby identifying a PD-Ll value, comparing the PD-Ll value to a control value, and if the PD-Ll value is greater than the control value, administering a therapeutically effective amount of a combination as described herein (e.g. , a combination that includes an anti-PD-1 antibody described herein) to the subject, optionally in combination with one or more other agents, thereby treating the cancer.
  • a combination as described herein e.g. , a combination that includes an anti-PD-1 antibody described herein
  • the cancer may be, e.g., a cancer as described herein, such as cancer is non-small cell lung (NSCLC) adenocarcinoma (ACA), NSCLC squamous cell carcinoma (SCC), or hepatocellular carcinoma (HCC).
  • NSCLC non-small cell lung
  • ACA adenocarcinoma
  • SCC NSCLC squamous cell carcinoma
  • HCC hepatocellular carcinoma
  • the invention features diagnostic or therapeutic kits that include the antibody molecules described herein and instructions for use.
  • Figure 1 depicts the amino acid sequences of the light and heavy chain variable regions of murine anti-PD-1 mAb BAP049.
  • the upper and lower sequences were from two independent analyses.
  • the light and heavy chain CDR sequences based on Kabat numbering are underlined.
  • the light heavy chain CDR sequences based on Chothia numbering are shown in bold italics.
  • the unpaired Cys residue at position 102 of the light chain sequence is boxed. Sequences are disclosed as SEQ ID NOs: 8, 228, 16 and 229, respectively, in order of appearance.
  • Figure 2A depicts the amino acid sequences of the light and heavy chain variable regions of murine anti-PD-1 mAb BAP049 aligned with the germline sequences.
  • the upper and lower sequences are the germline (GL) and BAP049 (Mu mAb) sequences, respectively.
  • the light and heavy chain CDR sequences based on Kabat numbering are underlined.
  • the light heavy chain CDR sequences based on Chothia numbering are shown in bold italics.
  • "-" means identical amino acid residue. Sequences disclosed as SEQ ID NOs: 230, 8, 231 and 16, respectively, in order of appearance.
  • Figure 2B depicts the sequence of murine ⁇ J2 gene and the corresponding mutation in murine anti-PD-1 mAb BAP049.
  • "-" means identical nucleotide residue. Sequences disclosed as SEQ ID NOs: 233, 232, 234 and 235, respectively, in order of appearance.
  • FIGS 3A-3B depict the competition binding between fluorescently labeled murine anti-PD-1 mAb BAP049 (Mu mAb) and three chimeric versions of BAP049 (Chi mAb). Experiment was performed twice, and the results are shown in Figures 3A and 3B, respectively.
  • the three chimeric BAP049 antibodies (Chi mAb (Cys), Chi mAb (Tyr) and Chi mAb (Ser)) have Cys, Tyr and Ser residue at position 102 of the light chain variable region, respectively.
  • Chi mAb (Cys), Chi mAb (Tyr) and Chi mAb (Ser) are also known as BAP049-chi, BAP049-chi-Y, and BAP049-chi-S, respectively.
  • Figure 4 is a bar graph showing the results of FACS binding analysis for the sixteen humanized BAP049 clones (BAP049-hum01 to BAP049-huml6).
  • concentrations are 200, 100, 50, 25 and 12.5 ng/ml from the leftmost bar to the rightmost bar for each tested mAb.
  • Figure 5 depicts the structural analysis of the humanized BAP049 clones (a, b, c, d and e represent various types of framework region sequences). The concentrations of the mAbs in the samples are also shown.
  • Figure 6A-6B depicts the binding affinity and specificity of humanized B AP049 mAbs measured in a competition binding assay using a constant concentration of Alexa 488- labeled murine mAb BAP049, serial dilutions of the test antibodies, and PD-1 -expressing 300.19 cells. Experiment was performed twice, and the results are shown in Figures 6A and 6B, respectively.
  • Figure 7 depicts the ranking of humanized B AP049 clones based on FACS data, competition binding and structural analysis. The concentrations of the mAbs in the samples are also shown.
  • Figures 8A-8B depict blocking of ligand binding to PD-1 by selected humanized BAP049 clones. Blocking of PD-Ll-Ig and PD-L2-Ig binding to PD-1 is shown in Figire 8A. Blocking of PD-L2-Ig binding to PD-1 is shown in Figire 8B. BAP049-hum01, BAP049- hum05, BAP049-hum08, BAP049-hum09, BAP049-humlO, and B AP049-huml 1 were evaluated. Murine mAb BAP049 and chimeric mAb having Tyr at position 102 of the light chain variable region were also included in the analyses.
  • Figures 9A-9B depict the alignment of heavy chain variable domain sequences for the sixteen humanized BAP049 clones and BAP049 chimera (BAP049-chi).
  • Figure 9A all of the sequences are shown (SEQ ID NOs: 22, 38, 38, 38, 38, 38, 38, 38, 38, 38, 50, 50, 50, 50, 82, 82 and 86, respectively, in order of appearance).
  • Figure 9B only amino acid sequences that are different from mouse sequence are shown (SEQ ID NOs: 22, 38, 38, 38, 38, 38, 38, 38, 38, 38, 38, 38, 38, 38, 38, 50, 50, 50, 50, 82, 82 and 86, respectively, in order of appearance).
  • Figures 10A-10B depict the alignment of light chain variable domain sequences for the sixteen humanized BAP049 clones and BAP049 chimera (BAP049-chi).
  • Figure 10A all of the sequences are shown (SEQ ID NOs: 24, 66, 66, 66, 66, 70, 70, 70, 58, 62, 78, 74, 46, 46, 42, 54 and 54, respectively, in order of appearance).
  • Figure 10B only amino acid sequences that are different from mouse sequence are shown (SEQ ID NOs: 24, 66, 66, 66, 66, 70, 70, 70, 58, 62, 78, 74, 46, 46, 42, 54 and 54, respectively, in order of appearance).
  • Figure 11 shows exemplary cancers having relatively high proportions of patients that are triple-positive for PD-Ll/CD8/IFN-y.
  • Figure 12 shows exemplary ER+ breast cancer and pancreatic cancer having relatively low proportions for patients that are triple positive for PD-L1/CD8/IFN-Y.
  • Figure 13 shows the proportion of exemplary breast cancer patients that are triple positive for PD-Ll/CD8/IFN-y.
  • Figure 14 shows the proportion of exemplary colon cancer patients that are triple positive for PD-Ll/CD8/IFN-y.
  • FIG 15 shows a graphical representation of flow cytometry of PD-L1 surface expression in EBC-1 cells in vitro with or without Compound A17 treatment.
  • EBC-1 cells are non-small cell lung cancer cells with a cMET amplification.
  • Figure 16 shows a graphical representation of PD-L1 mRNA expression in Hs.746.T cells in a tumor xenograft model with or without Compound A17 treatment.
  • Hs.746.T cells are gastric cancer cells with a c-MET amplification and a c-MET mutation.
  • FIG 17 shows a graphical representation of PD-L1 mRNA expression in H3122 cells in vitro with or without Compound A23.
  • H3122 cells are non-small cell lung cancer (NSCLC) cells with an ALK translocation.
  • NSCLC non-small cell lung cancer
  • Figure 18 shows a graphical representation of PD-L1 mRNA expression in
  • LOXIMVl cells (BRAF mutant melanoma cells) in a tumor xenograft model with or without Compound A29 treatment.
  • Figure 19 shows a graphical representation of PD-L1 mRNA expression in HEYA8 cells (KRAS mutant ovarian cancer cells) in a tumor xenograft model with or without Compound A34 treatment.
  • Figure 20 shows a graphical representation of PD-L1 mRNA expression in UKE-1 cells (JAK2 V617F mutant myeloproliferative neoplasm cells) in a tumor xenograft model with or without Compound A18 treatment.
  • Figure 21 is a schematic diagram that outlines the antigen processing and presentation, effector cell responses and immunosuppression pathways targeted by the combination therapies disclosed herein.
  • MTD maximum- tolerated dose
  • NSCLC non-small cell lung cancer
  • RP2D recommended phase II dose
  • TNBC triple-negative breast cancer.
  • Figures 23A-23B depict the accumulation, time course and within subject variability of the model used to analyze pharmacokinetics.
  • the shaded areas represent 90% prediction interval; solid lines are the median of prediction at each time point; black dots represent observed pharmacokinetic data.
  • Figure 23C depicts the predicted Ctrough (Cmin) concentrations across the different weights for patients while receiving the same dose of an exemplary anti-PD-1 antibody molecule.
  • Cmin Ctrough
  • Figure 24 depicts the percent change in target lesions over time for each of the radiographic ally evaluable pateints treated with the anti-PD-1 antibody molecule in the phase I II study. Patients were treated at the following dosing schecules: lmg/kg q2w, 3 mg/kg q2w, 10 mg/kg q2w, 3 mg/kg q4w, or 5 mg/kg q4w (exemplary lines in the figure are indicated with the dosing schedules).
  • Figures 25A-25C depict the tumor assessments and immunohistochemical detection of CD8+ T lymphocytes in a patient having metastatic atypical pulmonary carcinoid tumor with clinical response to the anti-PD- 1 antibody molecule in the phase I/II study.
  • Figure 25A depicts CT scan images showing response in the patient.
  • the left panel shows liver metastasis prior to antibody treatment.
  • the middle panel shows pseudo- progression in the liver (accompanied by significant shrinkage of lung lesions not shown) in the first restaging.
  • the right panel shows response in all lesions in the second restaging.
  • Figure 25B depicts the reduction in metastatic atypical pulmonary carcinoid tumor burden (% change from baseline) and individual lesions (lesion size (nm)) in the patient.
  • Figure 25C depicts the images of immunohistochemistry staining showing high levels of CD8+ T lymphocytes in a tumor sample obtained from the patient during Cycle 2, Day 1.
  • Table 1 is a summary of the amino acid and nucleotide sequences for the murine, chimeric and humanized anti-PD-1 antibody molecules.
  • the antibody molecules include murine mAb BAP049, chimeric mAbs BAP049-chi and BAP049-chi-Y, and humanized mAbs BAP049-hum01 to BAP049-huml6 and BAP049-Clone-A to BAP049-Clone-E.
  • the amino acid and nucleotide sequences of the heavy and light chain CDRs, the amino acid and nucleotide sequences of the heavy and light chain variable regions, and the amino acid and nucleotide sequences of the heavy and light chains are shown in this Table.
  • Table 2 depicts the amino acid and nucleotide sequences of the heavy and light chain framework regions for humanized mAbs BAP049-hum01 to BAP049-huml6 and BAP049- Clone-A to BAP049-Clone-E.
  • Table 3 depicts the constant region amino acid sequences of human IgG heavy chains and human kappa light chain.
  • Table 4 shows the amino acid sequences of the heavy and light chain leader sequences for humanized mAbs BAP049-Clone-A to BAP049-Clone-E.
  • Table 5 is a summary of yield, titre, monomer content and endotoxin levels for selected humanized BAP049 mAbs expressed in CHO cells.
  • Table 6 shows the charge isoforms as detected by Novex IEF analysis for selected humanized BAP049 mAbs expressed in CHO cells.
  • Table 7 is a summary of selected therapeutic agents that can be administered in combination with the anti-PD-1 antibody molecules and other immunomodulators (e.g., one or more of: an activator of a costimulatory molecule and/or an inhibitor of an immune checkpoint molecule) described herein.
  • Table 7 provides from left to right the following: the Compound Designation of the second therapeutic agent, the Compound structure, and Patent publication(s) disclosing the Compound.
  • Table 8 provides an exemplary listing of the therapeutic agents from Antigen- Presentation Combinations (Category A), Effector Cell Combinations (Category B) and Antitumor Immunosuppression Combinations (Category C).
  • Table 9 is a summary of the objectives and endpoints in the phase I/II study.
  • Table 10 is a summary of the patient demographics and characteristics in the phase I/II study.
  • Table 11 shows the patient disposition in the phase I/II study.
  • Table 12 shows the adverse events regardless of study drug relationship in the phase I/II study (any grad occurring in >20% of patients - safety set).
  • Table 13 shows the best overall response (based on investigator's assessment of disease status using RECIST vl.l criteria).
  • compositions comprising a combination of two, three or more therapeutic agents chosen from one, two, or all of the following categories (i)-(iii): (i) an agent that enhances antigen presentation (e.g., tumor antigen presentation) (e.g., by enhancing one or more of dendritic cell activity or maturation, antigen uptake, or antigen processing); (ii) an agent that enhances an effector cell response (e.g., an immune effector cell response, e.g., B cell and/or T cell activation and/or mobilization, e.g., in the lymph node); or (iii) an agent that decreases tumor
  • the combination includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein).
  • a PD-1 inhibitor e.g., an anti-PD-1 antibody molecule as described herein.
  • the articles “a” and “an” refer to one or to more than one (e.g., to at least one) of the grammatical object of the article.
  • “About” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values.
  • a combination or “in combination with,” it is not intended to imply that the therapy or the therapeutic agents must be administered at the same time and/or formulated for delivery together, although these methods of delivery are within the scope described herein.
  • the therapeutic agents in the combination can be administered concurrently with, prior to, or subsequent to, one or more other additional therapies or therapeutic agents.
  • the therapeutic agents or therapeutic protocol can be administered in any order. In general, each agent will be administered at a dose and/or on a time schedule determined for that agent.
  • the additional therapeutic agent utilized in this combination may be administered together in a single composition or administered separately in different compositions. In general, it is expected that additional therapeutic agents utilized in combination be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.
  • the additional therapeutic agent is administered at a therapeutic or lower-than therapeutic dose.
  • the concentration of the second therapeutic agent that is required to achieve inhibition, e.g., growth inhibition is lower when the second therapeutic agent is administered in combination with the first therapeutic agent, e.g., the anti-PD-1 antibody molecule, than when the second therapeutic agent is administered individually.
  • the concentration of the first therapeutic agent that is required to achieve inhibition, e.g., growth inhibition is lower when the first therapeutic agent is administered in combination with the second therapeutic agent than when the first therapeutic agent is administered individually.
  • the concentration of the second therapeutic agent that is required to achieve inhibition e.g.
  • the concentration of the first therapeutic agent that is required to achieve inhibition, e.g. , growth inhibition, is lower than the therapeutic dose of the first therapeutic agent as a monotherapy, e.g. , 10-20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, or 80-90% lower.
  • the concentration of the first therapeutic agent that is required to achieve inhibition, e.g. , growth inhibition is lower than the therapeutic dose of the first therapeutic agent as a monotherapy, e.g. , 10-20%, 20- 30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, or 80-90% lower.
  • inhibitor includes a reduction in a certain parameter, e.g., an activity, of a given molecule, e.g., an immune checkpoint inhibitor.
  • a certain parameter e.g., an activity, of a given molecule
  • an immune checkpoint inhibitor e.g., an enzyme that catalyzes azes the oxidation of a compound that has a reduced capacity.
  • inhibition of an activity e.g., a PD-1 or PD-L1 activity, of at least 5%, 10%, 20%, 30%, 40% or more is included by this term. Thus, inhibition need not be 100%.
  • activation includes an increase in a certain parameter, e.g., an activity, of a given molecule, e.g., a costimulatory molecule.
  • a certain parameter e.g., an activity, of a given molecule
  • a costimulatory molecule e.g., a costimulatory molecule
  • increase of an activity, e.g., a costimulatory activity, of at least 5%, 10%, 25%, 50%, 75% or more is included by this term.
  • anti-cancer effect refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of cancer cells, a decrease in the number of metastases, an increase in life expectancy, decrease in cancer cell proliferation, decrease in cancer cell survival, or amelioration of various physiological symptoms associated with the cancerous condition.
  • An "anti-cancer effect” can also be manifested by the ability of the peptides, polynucleotides, cells and antibodies in prevention of the occurrence of cancer in the first place.
  • anti-tumor effect refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of tumor cells, a decrease in tumor cell proliferation, or a decrease in tumor cell survival.
  • cancer refers to a disease characterized by the rapid and uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers are described herein and include but are not limited to, breast cancer (e.g., triple negative breast cancer), prostate cancer, ovarian cancer, cervical cancer, skin cancer (e.g., melanoma),
  • pancreatic cancer colorectal cancer, renal cancer (e.g., renal cell carcinoma), liver cancer (e.g., hepatocellular carcinoma), brain cancer (e.g., glioblastoma), head and neck cancer, endometrial cancer, nasopharyngeal cancer, bladder cancer, endocrine cancer, lymphoma, leukemia, lung cancer (e.g., non-small cell lung cancer), and the like.
  • renal cancer e.g., renal cell carcinoma
  • liver cancer e.g., hepatocellular carcinoma
  • brain cancer e.g., glioblastoma
  • head and neck cancer endometrial cancer
  • nasopharyngeal cancer e.g., endocrine cancer
  • lymphoma e.g., leukemia
  • lung cancer e.g., non-small cell lung cancer
  • lung cancer e.g., non-small cell lung cancer
  • cancer or tumor includes premalignant, as well as malignant cancers and tumors.
  • an immune system cell such as an accessory cell (e.g., a B-cell, a dendritic cell, and the like) that displays a foreign antigen complexed with major histocompatibility complexes (MHC's) on its surface.
  • MHC's major histocompatibility complexes
  • T-cells may recognize these complexes using their T-cell receptors (TCRs).
  • APCs process antigens and present them to T-cells.
  • costimulatory molecule refers to the cognate binding partner on a T cell that specifically binds with a costimulatory ligand, thereby mediating a costimulatory response by the T cell, such as, but not limited to, proliferation.
  • Costimulatory molecules are cell surface molecules other than antigen receptors or their ligands that are required for an efficient immune response.
  • Costimulatory molecules include, but are not limited to, an MHC class I molecule, TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), activating NK cell receptors, BTLA, a Toll ligand receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, CDS, ICAM-1, LFA-1 (CDl la/CD18), 4-1BB (CD137), B7-H3, CDS, ICAM-1, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRFl), NKp44, NKp30, NKp46, CD19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, I
  • CDl ld ITGAE, CD103, ITGAL, CDl la, LFA-1, ITGAM, CDl lb, ITGAX, CDl lc, ITGB l, CD29, ITGB2, CD 18, LFA-1, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Lyl08), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, CD19a, and a ligand that specifically binds with CD83.
  • DNAM1 CD226), SLAMF4 (
  • Immuno effector cell refers to a cell that is involved in an immune response, e.g., in the promotion of an immune effector response.
  • immune effector cells include T cells, e.g., alpha/beta T cells and gamma/delta T cells, B cells, natural killer (NK) cells, natural killer T (NKT) cells, mast cells, and myeloid-derived phagocytes.
  • Immuno effector or “effector” “function” or “response,” as that term is used herein, refers to function or response, e.g., of an immune effector cell, that enhances or promotes an immune attack of a target cell.
  • an immune effector function or response refers a property of a T or NK cell that promotes killing or the inhibition of growth or proliferation, of a target cell.
  • primary stimulation and co-stimulation are examples of immune effector function or response.
  • effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
  • the terms “treat”, “treatment” and “treating” refer to the reduction or amelioration of the progression, severity and/or duration of a disorder, e.g., a proliferative disorder, or the amelioration of one or more symptoms (preferably, one or more discernible symptoms) of the disorder resulting from the administration of one or more therapies.
  • the terms “treat,” “treatment” and “treating” refer to the amelioration of at least one measurable physical parameter of a proliferative disorder, such as growth of a tumor, not necessarily discernible by the patient.
  • compositions and methods of the present invention encompass polypeptides and nucleic acids having the sequences specified, or sequences substantially identical or similar thereto, e.g., sequences at least 85%, 90%, 95% identical or higher to the sequence specified.
  • amino acid sequences that contain a common structural domain having at least about 85%, 90%. 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a reference sequence, e.g., a sequence provided herein.
  • nucleotide sequence in the context of nucleotide sequence, the term "substantially identical" is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity.
  • the term "functional variant” refers to polypeptides that have a substantially identical amino acid sequence to the naturally-occurring sequence, or are encoded by a substantially identical nucleotide sequence, and are capable of having one or more activities of the naturally-occurring sequence.
  • the sequences are aligned for optimal comparison purposes (e.g. , gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
  • the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence.
  • the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
  • amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) /. Mol. Biol. 48:444-453 ) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
  • the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
  • a particularly preferred set of parameters are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
  • the percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4: 11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • nucleic acid and protein sequences described herein can be used as a "query sequence" to perform a search against public databases to, for example, identify other family members or related sequences.
  • Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) /. Mol. Biol. 215:403-10.
  • Gapped BLAST can be utilized as described in Altschul et al , (1997) Nucleic Acids Res. 25:3389-3402.
  • the default parameters of the respective programs e.g. , XBLAST and NBLAST
  • XBLAST and NBLAST See http://www.ncbi.nlm.nih.gov.
  • hybridizes under low stringency, medium stringency, high stringency, or very high stringency conditions describes conditions for hybridization and washing.
  • Guidance for performing hybridization reactions can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6, which is incorporated by reference. Aqueous and nonaqueous methods are described in that reference and either can be used.
  • Specific hybridization conditions referred to herein are as follows: 1) low stringency hybridization conditions in 6X sodium chloride/sodium citrate (SSC) at about 45°C, followed by two washes in 0.2X SSC, 0.1% SDS at least at 50°C (the temperature of the washes can be increased to 55°C for low stringency conditions); 2) medium stringency hybridization conditions in 6X SSC at about 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 60°C; 3) high stringency hybridization conditions in 6X SSC at about 45°C, followed by one or more washes in 0.2X SSC, 0.1 % SDS at 65°C; and preferably 4) very high stringency hybridization conditions are 0.5M sodium phosphate, 7% SDS at 65°C, followed by one or more washes at 0.2X SSC, 1 % SDS at 65°C. Very high stringency conditions (4) are the preferred conditions and the ones that should be used unless otherwise specified.
  • molecules of the present invention may have additional conservative or non-essential amino acid substitutions, which do not have a substantial effect on their functions.
  • amino acid is intended to embrace all molecules, whether natural or synthetic, which include both an amino functionality and an acid functionality and capable of being included in a polymer of naturally-occurring amino acids.
  • exemplary amino acids include naturally-occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and all stereoisomers of any of any of the foregoing.
  • amino acid includes both the D- or L- optical isomers and peptidomimetics.
  • a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • polypeptide polypeptide
  • peptide protein
  • protein protein
  • the terms “polypeptide”, “peptide” and “protein” (if single chain) are used interchangeably herein to refer to polymers of amino acids of any length.
  • the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
  • the polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.
  • nucleic acid refers to any organic acid sequence.
  • nucleotide sequence refers to any organic acid sequence.
  • polynucleotide sequence and “polynucleotide” are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonucleo tides or ribonucleotides, or analogs thereof.
  • the polynucleotide may be either single- stranded or double-stranded, and if single-stranded may be the coding strand or non-coding (antisense) strand.
  • polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
  • the sequence of nucleotides may be interrupted by non-nucleotide components.
  • a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
  • the nucleic acid may be a recombinant
  • polynucleotide or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a nonnatural arrangement.
  • isolated refers to material that is removed from its original or native environment (e.g. , the natural environment if it is naturally occurring).
  • a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated by human intervention from some or all of the co-existing materials in the natural system, is isolated.
  • Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a
  • composition and still be isolated in that such vector or composition is not part of the environment in which it is found in nature.
  • Exemplary combinations of therapeutic agents from two or more of the antigen- presentation category (A), effector cell category (B), and anti-tumor immunosuppression category (C) are provided herein.
  • Table 8 Listing of Therapeutic Agents in Categories (A)-(C)
  • the combinations of the present invention include one or more of the following:
  • Antibody Molecules A11B12C8, A11B 12C9, A11B 12C10, A11B 12C11, A11B 12C12, A11B 12C13, A11B12C14, A11B12C15, A11B 12C16, A11B 12C17, A11B12C18, A11B12C19, A11B12C20, or A11B12C21.
  • the antibody molecule binds to a mammalian, e.g., human, PD-1.
  • the antibody molecule binds specifically to an epitope, e.g., linear or conformational epitope, (e.g., an epitope as described herein) on PD-1.
  • antibody molecule refers to a protein, e.g. , an
  • an antibody molecule includes, for example, a monoclonal antibody (including a full length antibody which has an immunoglobulin Fc region). In an embodiment, an antibody molecule comprises a full length antibody, or a full length immunoglobulin chain. In an embodiment, an antibody molecule comprises an antigen binding or functional fragment of a full length antibody, or a full length immunoglobulin chain.
  • an antibody molecule is a multispecific antibody molecule, e.g., it comprises a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
  • a multispecific antibody molecule is a bispecific antibody molecule.
  • a bispecific antibody has specificity for no more than two antigens.
  • a bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second
  • immunoglobulin variable domain sequence that has binding specificity for a second epitope.
  • an antibody molecule is a monospecific antibody molecule and binds a single epitope.
  • a monospecific antibody molecule having a plurality of immunoglobulin variable domain sequences, each of which binds the same epitope.
  • an antibody molecule is a multispecific antibody molecule, e.g. , it comprises a plurality of immunoglobulin variable domains sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
  • the first and second epitopes are on the same antigen, e.g.
  • a multispecific antibody molecule comprises a third, fourth or fifth immunoglobulin variable domain.
  • a multispecific antibody molecule is a bispecific antibody molecule, a trispecific antibody molecule, or tetraspecific antibody molecule,
  • a multispecific antibody molecule is a bispecific antibody molecule.
  • a bispecific antibody has specificity for no more than two antigens.
  • a bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope.
  • the first and second epitopes are on the same antigen, e.g. , the same protein (or subunit of a multimeric protein).
  • the first and second epitopes overlap.
  • the first and second epitopes do not overlap.
  • the first and second epitopes are on different antigens, e.g.
  • a bispecific antibody molecule comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope.
  • a bispecific antibody molecule comprises a half antibody having binding specificity for a first epitope and a half antibody having binding specificity for a second epitope.
  • a bispecific antibody molecule comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope.
  • a bispecific antibody molecule comprises a scFv, or fragment thereof, have binding specificity for a first epitope and a scFv, or fragment thereof, have binding specificity for a second epitope.
  • the first epitope is located on PD-1 and the second epitope is located on a TIM-3, LAG-3, CEACAM (e.g., CEACAM-1 and/or CEACAM-5), PD-L1, or PD-L2.
  • an antibody molecule comprises a diabody, and a single-chain molecule, as well as an antigen-binding fragment of an antibody (e.g., Fab, F(ab')2, and Fv).
  • an antibody molecule can include a heavy (H) chain variable domain sequence (abbreviated herein as VH), and a light (L) chain variable domain sequence (abbreviated herein as VL).
  • VH heavy chain variable domain sequence
  • VL light chain variable domain sequence
  • an antibody molecule comprises or consists of a heavy chain and a light chain (referred to herein as a half antibody.
  • an antibody molecule in another example, includes two heavy (H) chain variable domain sequences and two light (L) chain variable domain sequence, thereby forming two antigen binding sites, such as Fab, Fab', F(ab')2, Fc, Fd, Fd', Fv, single chain antibodies (scFv for example), single variable domain antibodies, diabodies (Dab) (bivalent and bispecific), and chimeric (e.g. , humanized) antibodies, which may be produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies. These functional antibody fragments retain the ability to selectively bind with their respective antigen or receptor.
  • Antibodies and antibody fragments can be from any class of antibodies including, but not limited to, IgG, IgA, IgM, IgD, and IgE, and from any subclass (e.g. , IgGl, IgG2, IgG3, and IgG4) of antibodies.
  • the preparation of antibody molecules can be monoclonal or polyclonal.
  • An antibodymolecule can also be a human, humanized, CDR-grafted, or in vitro generated antibody.
  • the antibody can have a heavy chain constant region chosen from, e.g., IgGl, IgG2, IgG3, or IgG4.
  • the antibody can also have a light chain chosen from, e.g., kappa or lambda.
  • immunoglobulin (Ig) is used interchangeably with the term "antibody” herein.
  • antigen-binding fragments of an antibody molecule include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv), see e.g.
  • antibody includes intact molecules as well as functional fragments thereof. Constant regions of the antibodies can be altered, e.g. , mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
  • Antibody molecules can also be single domain antibodies.
  • Single domain antibodies can include antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies.
  • Single domain antibodies may be any of the art, or any future single domain antibodies.
  • Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, fish, shark, goat, rabbit, and bovine.
  • a single domain antibody is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 9404678, for example. For clarity reasons, this variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain
  • Such a VHH molecule can be derived from antibodies raised in
  • Camelidae species for example in camel, llama, dromedary, alpaca and guanaco.
  • Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention.
  • VH and VL regions can be subdivided into regions of hypervariability, termed “complementarity determining regions” (CDR), interspersed with regions that are more conserved, termed “framework regions” (FR or FW).
  • CDR complementarity determining regions
  • FR framework regions
  • CDR complementarity determining region
  • the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDRl), 50-65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDRl), 50-56 (LCDR2), and 89-97 (LCDR3).
  • the CDR amino acids in the VH are numbered 26-32 (HCDRl), 52-56 (HCDR2), and 95-102 (HCDR3); and the amino acid residues in VL are numbered 26-32 (LCDRl), 50-52 (LCDR2), and 91-96 (LCDR3).
  • the CDRs consist of amino acid residues 26-35 (HCDRl), 50-65 (HCDR2), and 95-102 (HCDR3) in human VH and amino acid residues 24-34 (LCDRl), 50-56 (LCDR2), and 89-97 (LCDR3) in human VL.
  • the anti-PD-1 antibody molecules can include any combination of one or more Kabat CDRs and/or Chothia hypervariable loops, e.g., described in Table 1.
  • the following definitions are used for the anti-PD- 1 antibody molecules described in Table 1: HCDRl according to the combined CDR definitions of both Kabat and Chothia, and HCCDRs 2-3 and LCCDRs 1-3 according the CDR definition of Kabat.
  • each VH and VL typically includes three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • an "immunoglobulin variable domain sequence” refers to an amino acid sequence which can form the structure of an immunoglobulin variable domain.
  • the sequence may include all or part of the amino acid sequence of a naturally- occurring variable domain.
  • the sequence may or may not include one, two, or more N- or C-terminal amino acids, or may include other alterations that are compatible with formation of the protein structure.
  • the term "antigen-binding site” refers to the part of an antibody molecule that comprises determinants that form an interface that binds to the PD- 1 polypeptide, or an epitope thereof.
  • the antigen-binding site typically includes one or more loops (of at least four amino acids or amino acid mimics) that form an interface that binds to the PD-1 polypeptide.
  • the antigen-binding site of an antibody molecule includes at least one or two CDRs and/or hypervariable loops, or more typically at least three, four, five or six CDRs and/or hypervariable loops.
  • Compet or “cross-compete” are used interchangeably herein to refer to the ability of an antibody molecule to interfere with binding of an anti-PD- 1 antibody molecule, e.g., an anti-PD- 1 antibody molecule provided herein, to a target, e.g., human PD- 1.
  • the interference with binding can be direct or indirect (e.g., through an allosteric modulation of the antibody molecule or the target).
  • the extent to which an antibody molecule is able to interfere with the binding of another antibody molecule to the target, and therefore whether it can be said to compete can be determined using a competition binding assay, for example, a FACS assay, an ELISA or BIACORE assay.
  • a competition binding assay is a quantitative competition assay.
  • a first anti-PD- 1 antibody molecule is said to compete for binding to the target with a second anti- PD- 1 antibody molecule when the binding of the first antibody molecule to the target is reduced by 10% or more, e.g., 20% or more, 30% or more, 40% or more, 50% or more, 55% or more, 60% or more, 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 98% or more, 99% or more in a competition binding assay (e.g., a competition assay described herein).
  • monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
  • a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
  • a monoclonal antibody can be made by hybridoma technology or by methods that do not use hybridoma technology (e.g. , recombinant methods).
  • An "effectively human" protein is a protein that does not evoke a neutralizing antibody response, e.g. , the human anti-murine antibody (HAMA) response.
  • HAMA can be problematic in a number of circumstances, e.g. , if the antibody molecule is administered repeatedly, e.g. , in treatment of a chronic or recurrent disease condition.
  • a HAMA response can make repeated antibody administration potentially ineffective because of an increased antibody clearance from the serum (see, e.g., Saleh et al ⁇ Cancer Immunol. Immunother. , 32: 180-190 (1990)) and also because of potential allergic reactions (see, e.g., LoBuglio et al,
  • the antibody molecule can be a polyclonal or a monoclonal antibody.
  • the antibody can be recombinantly produced, e.g., produced by phage display or by combinatorial methods.
  • Phage display and combinatorial methods for generating antibodies are known in the art (as described in, e.g., Ladner et al. U.S. Patent No. 5,223,409; Kang et al. International
  • the antibody is a fully human antibody (e.g., an antibody made in a mouse which has been genetically engineered to produce an antibody from a human immunoglobulin sequence), or a non-human antibody, e.g., a rodent (mouse or rat), goat, primate (e.g., monkey), camel antibody.
  • a rodent mouse or rat
  • the non-human antibody is a rodent (mouse or rat antibody).
  • Methods of producing rodent antibodies are known in the art.
  • Human monoclonal antibodies can be generated using transgenic mice carrying the human immunoglobulin genes rather than the mouse system. Splenocytes from these transgenic mice immunized with the antigen of interest are used to produce hybridomas that secrete human mAbs with specific affinities for epitopes from a human protein (see, e.g., Wood et al. International Application WO 91/00906, Kucherlapati et al. PCT publication WO 91/10741 ; Lonberg et al. International Application WO 92/03918; Kay et al.
  • An antibody can be one in which the variable region, or a portion thereof, e.g. , the
  • CDRs are generated in a non-human organism, e.g., a rat or mouse. Chimeric, CDR-grafted, and humanized antibodies are within the invention. Antibodies generated in a non-human organism, e.g. , a rat or mouse, and then modified, e.g. , in the variable framework or constant region, to decrease antigenicity in a human are within the invention.
  • Chimeric antibodies can be produced by recombinant DNA techniques known in the art (see Robinson et al. , International Patent Publication PCT/US86/02269; Akira, et al., European Patent Application 184, 187; Taniguchi, M., European Patent Application 171,496; Morrison et al., European Patent Application 173,494; Neuberger et al., International Application WO 86/01533; Cabilly et al. U.S. Patent No. 4,816,567; Cabilly et al. , European Patent Application 125,023; Better et al. (1988 Science 240: 1041-1043); Liu et al.
  • a humanized or CDR-grafted antibody will have at least one or two but generally all three recipient CDRs (of heavy and or light immuoglobulin chains) replaced with a donor CDR.
  • the antibody may be replaced with at least a portion of a non-human CDR or only some of the CDRs may be replaced with non-human CDRs. It is only necessary to replace the number of CDRs required for binding of the humanized antibody to PD-1.
  • the donor will be a rodent antibody, e.g., a rat or mouse antibody
  • the recipient will be a human framework or a human consensus framework.
  • the immunoglobulin providing the CDRs is called the "donor” and the immunoglobulin providing the framework is called the “acceptor.”
  • the donor immunoglobulin is a non-human (e.g., rodent).
  • the acceptor framework is a naturally-occurring (e.g., a human) framework or a consensus framework, or a sequence about 85% or higher, preferably 90%, 95%, 99% or higher identical thereto.
  • the term "consensus sequence” refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related sequences (See e.g. , Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987). In a family of proteins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence.
  • a “consensus framework” refers to the framework region in the consensus immunoglobulin sequence. An antibody can be humanized by methods known in the art (see e.g., Morrison, S. L.,
  • Humanized or CDR-grafted antibodies can be produced by CDR-grafting or CDR substitution, wherein one, two, or all CDRs of an immunoglobulin chain can be replaced.
  • CDR-grafting or CDR substitution wherein one, two, or all CDRs of an immunoglobulin chain can be replaced.
  • humanized antibodies in which specific amino acids have been substituted, deleted or added. Criteria for selecting amino acids from the donor are described in US 5,585,089, e.g. , columns 12-16 of US 5,585,089, e.g., columns 12-16 of US 5,585,089, the contents of which are hereby incorporated by reference. Other techniques for humanizing antibodies are described in Padlan et al. EP 519596 Al, published on December 23, 1992.
  • the antibody molecule can be a single chain antibody.
  • a single-chain antibody (scFV) may be engineered (see, for example, Colcher, D. et al. (1999) Ann N Y Acad Sci 880:263-80; and Reiter, Y. (1996) Clin Cancer Res 2:245-52).
  • the single chain antibody can be dimerized or multimerized to generate multivalent antibodies having specificities for different epitopes of the same target protein.
  • the antibody molecule has a heavy chain constant region chosen from, e.g., the heavy chain constant regions of IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE; particularly, chosen from, e.g., the (e.g., human) heavy chain constant regions of IgGl, IgG2, IgG3, and IgG4.
  • the antibody molecule has a light chain constant region chosen from, e.g., the (e.g., human) light chain constant regions of kappa or lambda.
  • the constant region can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function).
  • the antibody has: effector function; and can fix complement.
  • the antibody does not; recruit effector cells; or fix complement.
  • the antibody has reduced or no ability to bind an Fc receptor. For example, it is a isotype or subtype, fragment or other mutant, which does not support binding to an Fc receptor, e.g. , it has a mutagenized or deleted Fc receptor binding region.
  • Antibodies with altered function e.g. altered affinity for an effector ligand, such as FcR on a cell, or the CI component of complement can be produced by replacing at least one amino acid residue in the constant portion of the antibody with a different residue (see e.g., EP 388,151 Al, U.S. Pat. No. 5,624,821 and U.S. Pat. No. 5,648,260, the contents of all of which are hereby incorporated by reference). Similar type of alterations could be described which if applied to the murine, or other species immunoglobulin would reduce or eliminate these functions.
  • an antibody molecule can be derivatized or linked to another functional molecule (e.g., another peptide or protein).
  • a "derivatized" antibody molecule is one that has been modified. Methods of derivatization include but are not limited to the addition of a fluorescent moiety, a radionucleotide, a toxin, an enzyme or an affinity ligand such as biotin. Accordingly, the antibody molecules of the invention are intended to include derivatized and otherwise modified forms of the antibodies described herein, including immunoadhesion molecules.
  • an antibody molecule can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bispecific antibody or a diabody), a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
  • another antibody e.g., a bispecific antibody or a diabody
  • detectable agent e.g., a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
  • One type of derivatized antibody molecule is produced by crosslinking two or more antibodies (of the same type or of different types, e.g., to create bispecific antibodies).
  • Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g. , disuccinimidyl suberate).
  • an appropriate spacer e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester
  • homobifunctional e.g. , disuccinimidyl suberate
  • Exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, 5dimethylamine-l-napthalenesulfonyl chloride, phycoerythrin and the like.
  • An antibody may also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, ⁇ -galactosidase, acetylcholinesterase, glucose oxidase and the like.
  • detectable enzymes such as alkaline phosphatase, horseradish peroxidase, ⁇ -galactosidase, acetylcholinesterase, glucose oxidase and the like.
  • detectable enzymes such as alkaline phosphatase, horseradish peroxidase, ⁇ -galactosidase, acetylcholinesterase, glucose oxidase and the like.
  • an antibody is derivatized with a detectable enzyme, it is detected by adding additional reagents that the enzyme uses to produce a detectable reaction product.
  • the detectable agent horseradish peroxidase is present, the addition of hydrogen peroxide and diaminobenzidine leads to a
  • an antibody may be derivatized with biotin, and detected through indirect measurement of avidin or streptavidin binding.
  • suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; and examples of bioluminescent materials include luciferase, luciferin, and aequorin.
  • Labeled antibody molecule can be used, for example, diagnostically and/or experimentally in a number of contexts, including (i) to isolate a predetermined antigen by standard techniques, such as affinity chromatography or immunoprecipitation; (ii) to detect a predetermined antigen (e.g. , in a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the protein; (iii) to monitor protein levels in tissue as part of a clinical testing procedure, e.g. , to determine the efficacy of a given treatment regimen.
  • a predetermined antigen e.g. , in a cellular lysate or cell supernatant
  • An antibody molecules may be conjugated to another molecular entity, typically a label or a therapeutic (e.g., a cytotoxic or cytostatic) agent or moiety.
  • Radioactive isotopes can be used in diagnostic or therapeutic applications.
  • the invention provides radiolabeled antibody molecules and methods of labeling the same.
  • a method of labeling an antibody molecule is disclosed. The method includes contacting an antibody molecule, with a chelating agent, to thereby produce a conjugated antibody.
  • the antibody molecule can be conjugated to a therapeutic agent.
  • Therapeutically active radioisotopes have already been mentioned.
  • examples of other therapeutic agents include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicine, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1- dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin, maytansinoids, e.g., maytansinol (see U.S.
  • Therapeutic agents include, but are not limited to, antimetabolites (e.g. , methotrexate, 6-mercaptopurine, 6- thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g.,
  • anti-mitotic agents e.g. , vincristine, vinblastine, taxol and maytansinoids.
  • the invention features a method of providing a target binding molecule that specifically binds to a target disclosed herein, e.g., PD-1 receptor.
  • the target binding molecule is an antibody molecule.
  • the method includes: providing a target protein that comprises at least a portion of non-human protein, the portion being homologous to (at least 70, 75, 80, 85, 87, 90, 92, 94, 95, 96, 97, 98% identical to) a corresponding portion of a human target protein, but differing by at least one amino acid (e.g., at least one, two, three, four, five, six, seven, eight, or nine amino acids); obtaining an antibody molecule that specifically binds to the antigen; and evaluating efficacy of the binding agent in modulating activity of the target protein.
  • the method can further include administering the binding agent (e.g., antibody molecule) or a derivative (e.g., a humanized antibody molecule) to a human subject.
  • the antibody molecule is a multi-specific (e.g., a bispecific or a trispecific) antibody molecule.
  • Protocols for generating bispecific or heterodimeric antibody molecules are known in the art; including but not limited to, for example, the "knob in a hole" approach described in, e.g., US 5731168; the electrostatic steering Fc pairing as described in, e.g., WO 09/089004, WO 06/106905 and WO 2010/129304; Strand Exchange Engineered Domains (SEED) heterodimer formation as described in, e.g., WO 07/110205; Fab arm exchange as described in, e.g., WO 08/119353, WO 2011/131746, and WO
  • SEED Strand Exchange Engineered Domains
  • double antibody conjugate e.g., by antibody cross-linking to generate a bispecific structure using a heterobifunctional reagent having an amine-reactive group and a sulfhydryl reactive group as described in, e.g., US 4433059; bispecific antibody determinants generated by recombining half antibodies (heavy-light chain pairs or Fabs) from different antibodies through cycle of reduction and oxidation of disulfide bonds between the two heavy chains, as described in, e.g., US 4444878; Afunctional antibodies, e.g., three Fab' fragments cross-linked through sulfhdryl reactive groups, as described in, e.g., US5273743; biosynthetic binding proteins, e.g., pair of scFvs cross-linked through C-terminal tails preferably through disulfide or amine-reactive chemical cross-linking, as described in, e.g., US5534254;
  • bifunctional antibodies e.g., Fab fragments with different binding specificities dimerized through leucine zippers (e.g., c-fos and c-jun) that have replaced the constant domain, as described in, e.g., US5582996; bispecific and oligospecific mono-and oligovalent receptors, e.g., VH-CH1 regions of two antibodies (two Fab fragments) linked through a polypeptide spacer between the CHI region of one antibody and the VH region of the other antibody typically with associated light chains, as described in, e.g., US5591828; bispecific DNA- antibody conjugates, e.g., crosslinking of antibodies or Fab fragments through a double stranded piece of DNA, as described in, e.g., US5635602; bispecific fusion proteins, e.g., an expression construct containing two scFvs with a hydrophilic helical peptide linker between them and a full constant region,
  • bispecific/multivalent molecules as described in, e.g., US5837821; VH and VL domains linked with a short peptide linker (e.g., 5 or 10 amino acids) or no linker at all in either orientation, which can form dimers to form bispecific diabodies; trimers and tetramers, as described in, e.g., US5844094; String of VH domains (or VL domains in family members) connected by peptide linkages with crosslinkable groups at the C-terminus futher associated with VL domains to form a series of FVs (or scFvs), as described in, e.g., US5864019; and single chain binding polypeptides with both a VH and a VL domain linked through a peptide linker are combined into multivalent structures through non-covalent or chemical
  • crosslinking to form, e.g., homobivalent, heterobivalent, trivalent, and tetravalent structures using both scFV or diabody type format, as described in, e.g., US5869620.
  • Additional exemplary multispecific and bispecific molecules and methods of making the same are found, for example, in US5910573, US5932448, US5959083, US5989830, US6005079,
  • the anti-PD-1 antibody molecule (e.g. , a monospecific, bispecific, or multispecific antibody molecule) is covalently linked, e.g. , fused, to another partner e.g. , a protein e.g., one, two or more cytokines, e.g., as a fusion molecule for example a fusion protein.
  • the fusion molecule comprises one or more proteins, e.g., one, two or more cytokines.
  • the cytokine is an interleukin (IL) chosen from one, two, three or more of IL-1, IL-2, IL-12, IL-15 or IL-21.
  • IL interleukin
  • a bispecific antibody molecule has a first binding specificity to a first target (e.g. , to PD-1), a second binding specificity to a second target (e.g. , LAG-3 or TIM-3), and is optionally linked to an interleukin (e.g. , IL-12) domain e.g. , full length IL-12 or a portion thereof.
  • a first target e.g. , to PD-1
  • a second binding specificity to a second target e.g. , LAG-3 or TIM-3
  • an interleukin e.g. IL-12 domain
  • a “fusion protein” and a “fusion polypeptide” refer to a polypeptide having at least two portions covalently linked together, where each of the portions is a polypeptide having a different property.
  • the property may be a biological property, such as activity in vitro or in vivo.
  • the property can also be simple chemical or physical property, such as binding to a target molecule, catalysis of a reaction, etc.
  • the two portions can be linked directly by a single peptide bond or through a peptide linker, but are in reading frame with each other.
  • This invention provides an isolated nucleic acid molecule encoding the above antibody molecule, vectors and host cells thereof.
  • the nucleic acid molecule includes but is not limited to RNA, genomic DNA and cDNA.
  • compositions that include a combination of one or more of: (i) an agent that enhances antigen (e.g., tumor antigen) presentation; (ii) an agent that enhances an effector cell response (e.g., B cell and/or T cell activation and/or mobilization); or (iii) an agent that decreases tumor immunosuppression, thereby treating the disorder, e.g. , the hyperproliferative condition or disorder (e.g., the cancer).
  • the combination includes a PD-1 inhibitor (e.g., an anti-PD-1 antibody molecule as described herein). Exemplary agents that can be used in these combinations are provided herein.
  • the combination includes a STING agonist.
  • the combination is used to treat a cancer, e.g., a cancer described herein e.g., a solid tumor (e.g., a breast cancer, a squamous cell carcinoma, a melanoma, a lung cancer
  • a cancer e.g., a cancer described herein e.g., a solid tumor (e.g., a breast cancer, a squamous cell carcinoma, a melanoma, a lung cancer
  • a non-small cell lung cancer e.g., a non-small cell lung cancer
  • an ovarian cancer e.g., a fallopian tube carcinoma, a peritoneal carcinoma, a soft tissue sarcoma, an esophageal cancer, a head and neck cancer, an endometrial cancer, a cervical cancer, or a basal cell carcinoma
  • a hematologic malignancy e.g., a leukemia (e.g., a chronic lymphocytic leukemia (CLL), or a lymphoma
  • a marginal zone B-cell lymphoma e.g., a marginal zone B-cell lymphoma, a small lymphocytic lymphoma, a follicular lymphoma, Hodgkin lymphoma, non-Hodgkin lymphoma
  • a marginal zone B-cell lymphoma e.g., a marginal zone B-cell lymphoma, a small lymphocytic lymphoma, a follicular lymphoma, Hodgkin lymphoma, non-Hodgkin lymphoma
  • the STING agonist is cyclic dinucleotide, e.g., a cyclic dinucleotide comprising purine or pyrimidine nucleobases (e.g., adenosine, guanine, uracil, thymine, or cytosine nucleobases).
  • the nucleobases of the cyclic dinucleotide comprise the same nucleobase or different nucleobases.
  • the STING agonist comprises an adenosine or a guanosine nucleobase. In some embodiments, the STING agonist comprises one adenosine nucleobase and one guanosine nucleobase. In some embodiments, the STING agonist comprises two adenosine nucleobases or two guanosine nucleobases.
  • the STING agonist comprises a modified cyclic dinucleotide, e.g., comprising a modified nucleobase, a modified ribose, or a modified phosphate linkage.
  • the modified cyclic dinucleotide comprises a modified phosphate linkage, e.g., a thiophosphate.
  • the STING agonist comprises a cyclic dinucleotide (e.g., a modified cyclic dinucleotide) with 2' , 5' or 3', 5' phosphate linkages. In some embodiments, the STING agonist comprises a cyclic dinucleotide (e.g., a modified cyclic dinucleotide) with Rp or Sp stereochemistry around the phosphate linkages.
  • the STING agonist is Rp,Rp dithio 2', 3' c-di-AMP (e.g., Rp,Rp-dithio c-[A(2',5')pA(3',5')p]), or a cyclic dinucleotide analog thereof.
  • the STING agonist is a compound depicted in U.S. Patent Publication No. US2015/0056224 (e.g., a compound in Figure 2c, e.g., compound 21 or compound 22).
  • the STING agonist is c-[G(2',5')pG(3',5')p], a dithio ribose O-substituted derivative thereof, or a compound depicted in Fig. 4 of PCT Publication Nos. WO
  • the STING agonist is c- [A(2',5')pA(3',5')p] or a dithio ribose O-substitued derivative thereof, or is a compound depicted in Fig. 5 of PCT Publication Nos. WO 2014/189805 and WO 2014/189806. In some embodiments, the STING agonist is
  • the STING agonist is 2'-0-propargyl-cyclic-[A(2',5')pA(3',5')p] (2'-0- propargyl- ML-CDA) or a compound depicted in Fig. 7 of PCT Publication No. WO
  • STING agonists are disclosed, e.g., in PCT Publication Nos. WO 2014/189805 and WO 2014/189806, and U.S. Publication No. 2015/0056225.
  • a combination described herein includes a Toll- like receptor
  • the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor (e.g., a breast cancer, a squamous cell carcinoma, a melanoma, an ovarian cancer, a fallopian tube carcinoma, a peritoneal carcinoma, a soft tissue sarcoma, an esophageal cancer, a head and neck cancer, an endometrial cancer, a cervical cancer, a colon cancer (e.g. , a metastatic mismatch repair-proficient (MRP) colon cancer), a kidney cancer (e.g.
  • a cancer described herein e.g., a solid tumor (e.g., a breast cancer, a squamous cell carcinoma, a melanoma, an ovarian cancer, a fallopian tube carcinoma, a peritoneal carcinoma, a soft tissue sarcoma, an esophageal cancer, a head and neck cancer,
  • a renal cell carcinoma e.g., a renal cell carcinoma), or a basal cell carcinoma
  • a hematologic malignancy e.g., a leukemia (e.g., a chronic lymphocytic leukemia (CLL), or a lymphoma (e.g., a marginal zone B-cell lymphoma, a small lymphocytic lymphoma, a follicular lymphoma, Hodgkin lymphoma, non-Hodgkin lymphoma)).
  • a hematologic malignancy e.g., a leukemia (e.g., a chronic lymphocytic leukemia (CLL), or a lymphoma (e.g., a marginal zone B-cell lymphoma, a small lymphocytic lymphoma, a follicular lymphoma, Hodgkin lymphoma, non-Hodgkin lymphoma)
  • TLRs are a family of pattern recognition receptors that were initially identified as sensors of the innate immune system that recognize microbial pathogens.
  • the TLRs include TLR-1, TLR-2, TLR-3, TLR-4, TLR-5, TLR-6, TLR-7, TLR-8, TLR-9, and TLR-10.
  • TLR-1, -2, -4, -5, and -6, are expressed on the surface of cells and TLR-3, -7/8, and -9 are expressed with the ER compartment.
  • Human dendritic cell subsets can be identified on the basis of distinct TLR expression patterns.
  • the myeloid or "conventional" subset of human dendritic cells express TLRs 1-8 and the plasmacytoid subset of dendritic cells express only TLR-7 and TLR-9.
  • Ligand binding to TLRs invokes a cascade of intra-cellular signaling pathways that induce the production of factors involved in inflammation and immunity.
  • the myeloid subset and the plasmacytoid subset of human dendritic cells result in antigen-specific CD4+ and CD8+ T cell priming and activation of NK cells and T-cells, respectively.
  • the TLR agonist is chosen from one or more of a TLR-1 agonist, a TLR-2 agonist, a TLR-3 agonist, a TLR-4 agonist, a TLR-5 agonist, a TLR-6 agonist, a TLR-7 agonist, a TLR-8 agonist, a TLR-9 agonist, a TLR-10 agonist, a TLR- 1/2 agonist, a TLR- 2/6 agonist, or a TLR- 7/8 agonist.
  • the TLR agonist is a TLR7 agonist.
  • the TLR agonist is imiquimod or 3-(2-Methylpropyl)-3,5,8- triazatricyclo[7.4.0.02,6]trideca-l(9),2(6),4,7,10,12-hexaen-7-amine. Imiquimod or 3-(2-Methylpropyl)-3,5,8- triazatricyclo[7.4.0.02,6]trideca-l(9),2(6),4,7,10,12-hexaen-7-amine. Imiquimod or 3-(2-
  • Methylpropyl)-3,5,8-triazatricyclo[7.4.0.02,6]trideca-l(9),2(6),4,7,10,12-hexaen-7-amine can bind to and activate TLR-7 and/or TLR-8.
  • the TLR agonist is 852A.
  • 852A is disclosed, e.g., in Inglefield et al. J Interferon Cytokine Res. 2008; 28(4):253-63. 852A can bind to and activate TLR-7 and/or TLR-8.
  • the TLR agonist is Bacille Calmette-Guerin (BCG). BCG can bind to and activate TLR-9.
  • the TLR agonist is EMD 120108.
  • EMD 120108 is a synthetic oligonucleotide containing phosphorothioate oligodeoxynucleotide.
  • EMD 1201081 can bind to and activate TLR-9, e.g, in monocytes/macrophages, plasmacytoid dendritic cells (DCs) and B cells, initiating immune signaling pathways, activating B cells and inducing T-helper cell cytokine production.
  • the TLR agonist is IMO-2055.
  • IMO-2055 is a synthetic oligonucleotide containing unmethylated CpG dinucleotides. Mimicking unmethylated CpG sequences in bacterial DNA, IMO-2055 can bind to and activate TLR-9, e.g., in
  • monocytes/macrophages monocytes/macrophages, plasmacytoid dendritic cells (DCs) and B cells, initiating immune signaling pathways and activating B cells and DCs and inducing T-helper cell cytokine production.
  • DCs plasmacytoid dendritic cells
  • B cells B cells
  • TLR agonists that can be used in the combination include, e.g., TLR-1/2 agonists (e.g., Pam3Cys), TLR-2 agonists (e.g., CFA, MALP2, Pam2Cys, FSL-1, or Hib-OMPC), TLR-3 agonists (e.g., polyribosome :polyribocytidic acid (Poly I:C),
  • TLR-1/2 agonists e.g., Pam3Cys
  • TLR-2 agonists e.g., CFA, MALP2, Pam2Cys, FSL-1, or Hib-OMPC
  • TLR-3 agonists e.g., polyribosome :polyribocytidic acid (Poly I:C)
  • polyadenosine-polyuridylic acid poly AU
  • polyinosinic-polycytidylic acid stabilized with poly-L-lysine and carboxymethylcellulose Hiltonol®
  • TLR-4 agonists e.g., TLR-4 agonists
  • TLR-5 agonists e.g., bacterial flagellin
  • TLR-7 agonists e.g., imiquimod
  • TLR-7/8 agonists e.g., resiquimod or loxoribine
  • TLR-9 agonists e.g., unmethylated CpG dinucleotide (CpG-ODN)
  • the TLR agonist is used in combination with a GITR agonist, e.g., as described in WO2004/060319, and International Publication No.: WO2014/012479.
  • a combination described herein includes a vascular endothelial growth factor (VEGF) receptor inhibitor (e.g., an inhibitor of one or more of VEGFR (e.g., VEGFR-1, VEGFR-2, VEGFR-3) or VEGF).
  • VEGF vascular endothelial growth factor
  • the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor (e.g., a melanoma, a breast cancer, a colon cancer, an esophageal cancer, a gastrointestinal stromal tumor (GIST), a kidney cancer (e.g., a renal cell cancer), a liver cancer, a non-small cell lung cancer
  • a cancer described herein e.g., a solid tumor (e.g., a melanoma, a breast cancer, a colon cancer, an esophageal cancer, a gastrointestinal stromal tumor (GIST), a
  • NSCLC neurotrophic hematologic malignancy
  • the VEGFR inhibitor is vatalanib succinate (Compound A47) or a compound disclosed in EP 296122.
  • the VEGFR inhibitor is an inhibitor of one or more of VEGFR- 2, PDGFRbeta, KIT or Raf kinase C, l-methyl-5-((2-(5-(trifluoromethyl)-lH-imidazol-2- yl)pyridin-4-yl)oxy)-N-(4-(trifluoromethyl)phenyl)-lH-benzo[d]imidazol-2-amine
  • VEGFR pathway inhibitors that can be used in the combinations disclosed herein include, e.g., bevacizumab (AVASTIN®), axitinib (INLYTA®); brivanib alaninate (BMS-582664, (S)-((R)-l-(4-(4-Fluoro-2-methyl-lH-indol-5-yloxy)-5- methylpyrrolo[2,l-f][l,2,4]triazin-6-yloxy)propan-2-yl)2-aminopropanoate); sorafenib (NEXAVAR®); pazopanib (VOTRIENT®); sunitinib malate (SUTENT®); cediranib (AZD2171, CAS 288383-20-1); vargatef (BIBF1120, CAS 928326-83-4); Foretinib (GSK1363089); telatinib (BAY57-9352,
  • WO 02/066470 dovitinib dilactic acid (TKI258, CAS 852433-84-2); linfanib (ABT869, CAS 796967-16-3); cabozantinib (XL184, CAS 849217-68-1); lestaurtinib (CAS 111358-88-4); N-[5-[[[5-(l,l- dimethylethyl)-2-oxazolyl]methyl]thio]-2-thiazolyl]-4-piperidinecarboxamide (BMS38703, CAS 345627-80-7); (3R,4R)-4-amino-l-((4-((3-methoxyphenyl)amino)pyrrolo[2,l- f][l,2,4]triazin-5-yl)methyl)piperidin-3-ol (BMS690514); N-(3,4-Dichloro-2-fluorophenyl)- 6-methoxy-7-
  • anti-VEGF antibodies that can be used in the combinations disclosed herein include, e.g., a monoclonal antibody that binds to the same epitope as the monoclonal anti-VEGF antibody A4.6.1 produced by hybridoma ATCC HB 10709; a recombinant humanized anti-VEGF monoclonal antibody generated according to Presta et al. (1997) Cancer Res. 57:4593-4599.
  • the anti-VEGF antibody is Bevacizumab (BV), also known as rhuMAb VEGF or AVASTIN®.
  • antibodies include those that bind to a functional epitope on human VEGF comprising of residues F17, Ml 8, D19, Y21, Y25, Q89, 191 , Kl 01, El 03, and C104 or, alternatively, comprising residues F17, Y21, Q22, Y25, D63, 183 and Q89.
  • a combination described herein includes an inhibitor of c-MET.
  • the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor (e.g., a non-small cell lung cancer, a pancreatic cancer, a liver cancer (e.g., a hepatocellular carcinoma, e.g., a c-MET overexpressing hepatocellular carcinoma), a thyroid cancer (e.g., anaplastic thyroid carcinoma), a brain tumor (e.g., a glioblastoma), a kidney cancer (e.g., a renal cell carcinoma), a head and neck cancer (e.g., a head and neck squamous cell carcinoma).
  • a cancer described herein e.g., a solid tumor (e.g., a non-small cell lung cancer, a pancreatic cancer, a liver cancer (e.g., a hepatocellular carcinoma, e.g.,
  • the c-MET inhibitor is Compound A17 or a compound described in U.S. Patent Nos. 7,767,675 and 8,420,645).
  • c-MET a receptor tyrosine kinase overexpressed or mutated in many tumor cell types, plays key roles in tumor cell proliferation, survival, invasion, metastasis, and tumor angiogenesis. Inhibition of c-MET may induce cell death in tumor cells overexpressing c-MET protein or expressing constitutively activated c-MET protein.
  • the c-MET inhibitor is JNJ-38877605.
  • JNJ-38877605 is an orally available, small molecule inhibitor of c-Met. JNJ-38877605 selectively binds to c- MET, thereby inhibiting c-MET phosphorylation and disrupting c-Met signal transduction pathways.
  • the c-Met inhibitor is AMG 208.
  • AMG 208 is a selective small-molecule inhibitor of c-MET. AMG 208 inhibits the ligand-dependent and ligand- independent activation of c-MET, inhibiting its tyrosine kinase activity, which may result in cell growth inhibition in tumors that overexpress c-Met.
  • the c-Met inhibitor is AMG 337.
  • AMG 337 is an orally bioavailable inhibitor of c-Met.
  • AMG 337 selectively binds to c-MET, thereby disrupting c- MET signal transduction pathways.
  • the c-Met inhibitor is LY2801653.
  • LY2801653 is an orally available, small molecule inhibitor of c-Met. LY2801653 selectively binds to c-MET, thereby inhibiting c-MET phosphorylation and disrupting c-Met signal transduction pathways.
  • c-Met inhibitor is MSC2156119J.
  • MSC2156119J is an orally bioavailable inhibitor of c-Met.
  • MSC2156119J selectively binds to c-MET, which inhibits c- MET phosphorylation and disrupts c-Met-mediated signal transduction pathways.
  • the c-MET inhibitor is capmatinib.
  • Capmatinib is also known as INCB028060.
  • Capmatinib is an orally bioavailable inhibitor of c-MET.
  • Capmatinib selectively binds to c-Met, thereby inhibiting c-Met phosphorylation and disrupting c-Met signal transduction pathways.
  • the c-MET inhibitor is crizotinib.
  • Crizotinib is also known as
  • Crizotinib is an orally available aminopyridine -based inhibitor of the receptor tyrosine kinase anaplastic lymphoma kinase (ALK) and the c-Met/hepatocyte growth factor receptor (HGFR). Crizotinib, in an ATP-competitive manner, binds to and inhibits ALK kinase and ALK fusion proteins. In addition, crizotinib inhibits c-Met kinase, and disrupts the c-Met signaling pathway. Altogether, this agent inhibits tumor cell growth.
  • ALK receptor tyrosine kinase anaplastic lymphoma kinase
  • HGFR c-Met/hepatocyte growth factor receptor
  • the c-MET inhibitor is golvatinib.
  • Golvatinib is an orally bioavailable dual kinase inhibitor of c-MET and VEGFR-2 with potential antineoplastic activity. Golvatinib binds to and inhibits the activities of both c-MET and VEGFR-2, which may inhibit tumor cell growth and survival of tumor cells that overexpress these receptor tyrosine kinases.
  • the c-MET inhibitor is tivantinib.
  • Tivantinib is also known as ARQ 197.
  • Tivantinib is an orally bioavailable small molecule inhibitor of c-MET. Tivantinib binds to the c-MET protein and disrupts c-Met signal transduction pathways, which may induce cell death in tumor cells overexpressing c-MET protein or expressing consitutively activated c-Met protein.
  • a combination described herein includes a transforming growth factor beta (TGF- ⁇ ) inhibitor.
  • the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor (e.g., a brain cancer (e.g., a glioma), a melanoma, a kidney cancer (e.g., a renal cell carcinoma), a pleural malignant mesothelioma (e.g., a relapsed pleural malignant mesothelioma), or a breast cancer (e.g., a metastatic breast cancer)).
  • the TGF- ⁇ inhibitor is fresolimumab (CAS Registry Number:
  • Fresolimumab is also known as GC1008.
  • Fresolimumab is a human monoclonal antibody that binds to and inhibits TGF-beta isoforms 1, 2 and 3.
  • the heavy chain of fresolimumab has the amino acid sequence of:
  • Fresolimumab is disclosed, e.g., in WO 2006/086469, US 8,383,780, and US
  • the TGF- ⁇ inhibitor is XOMA 089.
  • XOMA 089 is also known as XPA.42.089.
  • XOMA 089 is a fully human monoclonal antibody that specifically binds and neutralizes TGF-beta 1 and 2 ligands.
  • the heavy chain variable region of XOMA 089 has the amino acid sequence of: QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGT AN Y AQKFQGRVTITADESTST A YMELS S LRS EDT A V YYC ARGLWE VR ALPS V YWG QGTLVTVSS (SEQ ID NO: 240) (disclosed as SEQ ID NO: 6 in WO 2012/167143).
  • the light chain variable region of XOMA 089 has the amino acid sequence of:
  • SYELTQPPSVSVAPGQTARITCGANDIGSKSVHWYQQKAGQAPVLVVSEDIIRPSGIP ERISGSNSGNTATLTISRVEAGDEADYYCQVWDRDSDQYVFGTGTKVTVLG (SEQ ID NO: 241) (disclosed as SEQ ID NO: 8 in WO 2012/167143).
  • a combination described herein includes an inhibitor of indoleamine 2,3-dioxygenase (IDO) and/or tryptophan 2,3-dioxygenase (TDO).
  • the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor (e.g., melanoma, non-small cell lung cancer, colon cancer, squamous cell head and neck cancer, ovarian cancer, peritoneal cancer, fallopian tube cancer, breast cancer (e.g., metastatic or HER2-negative breast cancer)), e.g., a hematologic malignancy (e.g., a lymphoma, e.g., a non-Hodgkin's lymphoma or a Hodgkin's lymphoma (e.g., a diffuse large B-cell lymphoma (DLBCL))).
  • a cancer described herein e.g.,
  • the IDO/TDO inhibitor is chosen from (4E)-4-[(3-chloro-4- fluoroanilino)-nitrosomethylidene]-l,2,5-oxadiazol-3-amine (also known as INCB24360), indoximod (1 -methyl-D- tryptophan), or a-cyclohexyl-5H-Imidazo[5, l-a]isoindole-5-ethanol (also known as NLG919).
  • the IDO/TDO inhibitor is epacadostat (CAS Registry Number:
  • Epacadostat is also known as INCB24360 or INCB024360 (Incyte).
  • Epacadostat is a potent and selective indoleamine 2,3-dioxygenase (IDOl) inhibitor with IC50 of 10 nM, highly selective over other related enzymes such as ID02 or tryptophan 2,3- dioxygenase (TDO).
  • IDOl indoleamine 2,3-dioxygenase
  • TDO tryptophan 2,3- dioxygenase
  • the IDO/TDO inhibitor is indoximod (New Link Genetics).
  • Indoximod the D isomer of 1-methyl-tryptophan, is an orally administered small-molecule indoleamine 2,3-dioxygenase (IDO) pathway inhibitor that disrupts the mechanisms by which tumors evade immune-mediated destruction.
  • IDO indoleamine 2,3-dioxygenase
  • the IDO/TDO inhibitor is NLG919 (New Link Genetics).
  • NLG919 is a potent IDO (indoleamine-(2,3)-dioxygenase) pathway inhibitor with Ki/EC50 of 7 nM/75 nM in cell-free assays.
  • the IDO/TDO inhibitor is F001287 (Flexus/BMS).
  • F001287 is a small molecule inhibitor of indoleamine 2,3-dioxygenase 1 (IDOl).
  • IDOl indoleamine 2,3-dioxygenase 1
  • a combination described herein includes an adenosine A2a receptor (A2aR) antagonist (e.g., an inhibitor of A2aR pathway, e.g., an adenosine inhibitor, e.g., an inhibitor of A2aR or CD-73).
  • A2aR adenosine A2a receptor
  • the combination is used to treat a cancer, e.g., a cancer described herein.
  • the cancer is a lung cancer, e.g., a non-small cell lung cancer.
  • the A2aR antagonist is istradefylline (CAS Registry Number: 155270-99-8).
  • Istradefylline is also known as KW-6002 or 8-[(E)-2-(3,4- dimethoxyphenyl)vinyl]-l,3-diethyl-7-methyl-3 ,7-dihydro-lH-purine-2,6-dione.
  • Istradefylline is disclosed, e.g., in LeWitt et al. (2008) Annals of Neurology 63 (3): 295-302).
  • the A2aR antagonist is tozadenant (Biotie). Tozadenant is also known as SYN115 or 4-hydroxy-N-(4-methoxy-7-morpholin-4-yl-l,3-benzothiazol-2-yl)-4- methylpiperidine-l-carboxamide. Tozadenant blocks the effect of endogenous adenosine at the A2a receptors, resulting in the potentiation of the effect of dopamine at the D2 receptor and inhibition of the effect of glutamate at the mGluR5 receptor. In some embodiments, the A2aR antagonist is preladenant (CAS Registry Number: 377727-87-2).
  • Preladenant is also known as SCH 420814 or 2-(2-Furanyl)-7-[2-[4-[4-(2-methoxyethoxy)phenyl]-l- piperazinyl]ethyl]7H-pyrazolo[4,3-e][l,2,4]triazolo[l,5-c]pyrimidine-5-amine.
  • Preladenant was developed as a drug that acted as a potent and selective antagonist at the adenosine A2A receptor.
  • the A2aR antagonist is vipadenan.
  • Vipadenan is also known as BIIB014, V2006, or 3-[(4-amino-3-methylphenyl)methyl]-7-(furan-2-yl)triazolo[4,5- d]pyrimidin-5-amine. e.g., ⁇ n some embodiments, the A2aR antagonist is PBF-509
  • the A2aR antagonist e.g., PBF-509 is administered at a daily dose of about 80 mg, 160 mg, or 240 mg.
  • A2aR antagonists include, e.g., ATL-444, MSX-3, SCH-58261, SCH-412,348, SCH-442,416, VER-6623, VER-6947, VER-7835, CGS-15943, or ZM- 241,385.
  • the A2aR antagonist is an A2aR pathway antagonist (e.g., a
  • CD-73 inhibitor e.g., an anti-CD73 antibody
  • MEDI9447 is a monoclonal antibody specific for CD73. Targeting the extracellular production of adenosine by CD73 may reduce the immunosuppressive effects of adenosine.
  • MEDI9447 was reported to have a range of activities, e.g., inhibition of CD73 ectonucleotidase activity, relief from AMP- mediated lymphocyte suppression, and inhibition of syngeneic tumor growth.
  • MEDI9447 can drive changes in both myeloid and lymphoid infiltrating leukocyte populations within the tumor microenvironment. These changes include, e.g., increases in CD8 effector cells and activated macrophages, as well as a reduction in the proportions of myeloid-derived suppressor cells (MDSC) and regulatory T lymphocytes.
  • MDSC myeloid-derived suppressor cells
  • a combination as described herein includes an oncolytic virus.
  • oncolytic viruses are capable of selectively replicating in and triggering the death of or slowing the growth of a cancer cell. In some cases, oncolytic viruses have no effect or a minimal effect on non-cancer cells.
  • An oncolytic virus includes but is not limited to an oncolytic adenovirus, oncolytic Herpes Simplex Viruses, oncolytic retrovirus, oncolytic parvovirus, oncolytic vaccinia virus, oncolytic Sindbis virus, oncolytic influenza virus, or oncolytic RNA virus (e.g., oncolytic reovirus, oncolytic Newcastle Disease Virus (NDV), oncolytic measles virus, or oncolytic vesicular stomatitis virus (VSV)).
  • the combination is used to treat a cancer, e.g., a cancer described herein.
  • the cancer is a brain cancer, e.g., a glioblastoma.
  • the oncolytic virus is a virus, e.g., recombinant oncolytic virus, described in US2010/0178684 Al, which is incorporated herein by reference in its entirety.
  • a recombinant oncolytic virus comprises, or comprises a nucleic acid sequence (e.g., heterologous nucleic acid sequence) encoding, an inhibitor of an immune or inflammatory response, e.g., as described in US2010/0178684 Al, incorporated herein by reference in its entirety.
  • the recombinant oncolytic virus comprises, or comprises a nucleic acid sequence encoding a pro-apoptotic protein (e.g., apoptin), a cytokine (e.g., GM-CSF, CSF, interferon-gamma, interleukin-2 (IL- 2), tumor necrosis factor-alpha), an immunoglobulin (e.g., an antibody against ED-B firbonectin), a tumor associated antigen, a bispecific adapter protein (e.g., bispecific antibody or antibody fragment directed against NDV HN protein and a T cell co- stimulatory receptor, such as CD3 or CD28; or a fusion protein between human IL-2 and single chain antibody directed against NDV HN protein).
  • a pro-apoptotic protein e.g., apoptin
  • a cytokine e.g., GM-CSF, CSF, interferon-gamma, interleukin-2 (IL-
  • the oncolytic virus is a chimeric oncolytic NDV described in US 8591881 B2, US 2012/0122185 Al, or US 2014/0271677 Al, each of which is incorporated herein by reference in their entireties.
  • the oncolytic virus comprises a conditionally replicative adenovirus (CRAd), which is designed to replicate exclusively in cancer cells. See, e.g., Alemany et al. Nature Biotechnol. 18(2000):723-27.
  • CRAd conditionally replicative adenovirus
  • an oncolytic adenovirus comprises one described in Table 1 on page 725 of Alemany et al. , incorporated herein by reference in its entirety.
  • Exemplary oncolytic viruses include but are not limited to the following:
  • Oncolytic Adenovirus Cold-Adl (PsiOxus Therapeutics Ltd.) (see, e.g., Clinical Trial Identifier: NCT02053220); ONCOS-102 (previously called CGTG-102), which is an adenovirus comprising granulocyte-macrophage colony stimulating factor (GM-CSF) (Oncos Therapeutics) (see, e.g., Clinical Trial Identifier: NCT01598129);
  • GM-CSF granulocyte-macrophage colony stimulating factor
  • VCN-01 which is a genetically modified oncolytic human adenovirus encoding human PH20 hyaluronidase (VCN Biosciences, S.L.) (see, e.g., Clinical Trial
  • Conditionally Replicative Adenovirus ICOVIR-5 which is a virus derived from wild- type human adenovirus serotype 5 (Had5) that has been modified to selectively replicate in cancer cells with a deregulated retinoblastoma/E2F pathway (Institut Catala d'Oncologia) (see, e.g., Clinical Trial Identifier: NCT01864759);
  • Celyvir which comprises bone marrow-derived autologous mesenchymal stem cells
  • CG0070 which is a conditionally replicating oncolytic serotype 5 adenovirus (Ad5) in which human E2F-1 promoter drives expression of the essential Ela viral genes, thereby restricting viral replication and cytotoxicity to Rb pathway-defective tumor cells (Cold Genesys, Inc.) (see, e.g., Clinical Trial Identifier: NCT02143804); or
  • DNX-2401 (formerly named Delta- 24-RGD), which is an adenovirus that has been engineered to replicate selectively in retinoblastoma (Rb)-pathway deficient cells and to infect cells that express certain RGD-binding integrins more efficiently (Clinica Universidad de Navarra, Universidad de Navarra/ DNAtrix, Inc.) (see, e.g., Clinical Trial
  • an oncolytic virus described herein is administering by injection, e.g., subcutaneous, intra-arterial, intravenous, intramuscular, intrathecal, or intraperitoneal injection. In embodiments, an oncolytic virus described herein is
  • Exemplary vaccines e.g., Scaffold vaccines
  • a combination described herein includes a vaccine, e.g., a scaffold vaccine.
  • the combination is used to treat a cancer, e.g., a cancer described herein.
  • Cancer vaccines are disclosed, e.g., in PCT Publication Nos. WO 2007/070660 and
  • WO 2012/167230 EP 1960009 Bl
  • U.S. Patent Nos. US 8,067,237 and US 8,932,583, and U.S. Publication No. US 2011/0020216 The components that can be used within cancer vaccines (e.g., implantable scaffold materials) are disclosed, e.g., in PCT Publication Nos. WO 2009/102465 and WO 2013/106852. Methods that can be used for administration of cancer vaccines are disclosed, e.g., in PCT Publication Nos. WO 2013/158673, WO
  • the cancer vaccine includes a macroporous scaffold comprising (i) cells or a cell recruitment composition, and (ii) a deployment signal capable of inducing or promoting migration of cells, and (iii) a bioactive composition coated or seeded onto/into the scaffold, which causes cells recruited into the scaffold be modified. Migration of the modified cells can be promoted by the open, interconnected macropores and the deployment signal.
  • the cancer vaccine induces an endogenous immune response to a cancer target via administration of a porous scaffold bearing a recruitment composition and a target antigen composition, wherein an endogenous antigen presenting cell is recruited into the scaffold to encounter antigen and where said cell resides until a deployment signal induces egress to a lymph node tissue outside the scaffold, thereby stimulating an endogenous immune response to said cancer target.
  • the cancer vaccine is used to remove a target cell from a mammal using a scaffold composition.
  • an in situ cancer vaccine is generated via recruitment of cancer cells to an implanted scaffold and destruction of the cells using a cytotoxic agent.
  • a cytosine-guanosine oligonucleotide (CpG-ODN) is used as a component of a scaffold, which can effectively reprogram and deploy dendritic cells recruited to the scaffold, and generate an effective anti-tumor response.
  • polyinosine-polycytidylic acid (poly I:C) and/or CpG ODN are used to exert a synergistic effect on tumor inhibition.
  • porous rods comprising an immune cell recruitment compound (e.g. GM-CSF) and an immune cell activation compound (e.g. CpG ODN), and optionally comprising an antigen such as a tumor lysate, are used, e.g., to elicit an immune response to a vaccine antigen.
  • an immune cell recruitment compound e.g. GM-CSF
  • an immune cell activation compound e.g. CpG ODN
  • an antigen such as a tumor lysate
  • pores that facilitate recruitment or release of cells are formed in situ within hydrogels following hydrogel injection.
  • injectable shape memory porous hydrogel polymer is used for administration.
  • the combinations disclosed herein include a cancer or tumor vaccine.
  • Non-limiting examples of tumor vaccines that can be used include peptides of melanoma antigens, such as peptides of gplOO, MAGE antigens, Trp-2, MARTI and/or tyrosinase, tumor cells transfected to express the cytokine GM-CSF, DNA-based vaccines, RNA-based vaccines, and viral transduction-based vaccines.
  • the cancer vaccine may be prophylactic or therapeutic.
  • a vaccine is prepared using autologous or allogeneic tumor cells. These cellular vaccines have been shown to be most effective when the tumor cells are transduced to express GM-CSF. GM-CSF has been shown to be a potent activator of antigen
  • the combinations disclosed herein can be used in conjunction with a collection of recombinant proteins and/or peptides expressed in a tumor in order to generate an immune response to these proteins.
  • These proteins are normally viewed by the immune system as self antigens and are therefore tolerant to them.
  • the tumor antigen may also include the protein telomerase, which is required for the synthesis of telomeres of chromosomes and which is expressed in more than 85% of human cancers and in only a limited number of somatic tissues (Kim, N et al. (1994) Science 266: 2011-2013). (These somatic tissues may be protected from immune attack by various means).
  • Tumor antigen may also be "neo-antigens" expressed in cancer cells because of somatic mutations that alter protein sequence or create fusion proteins between two unrelated sequences (ie. bcr-abl in the Philadelphia chromosome), or idiotype from B cell tumors.
  • tumor vaccines may include the proteins from viruses implicated in human cancers such a Human Papilloma Viruses (HPV), Hepatitis Viruses (HBV and HCV), Kaposi's Herpes Sarcoma Virus (KHSV), and Epstein-Barr virus (EBV).
  • HPV Human Papilloma Viruses
  • HBV and HCV Hepatitis Viruses
  • KHSV Kaposi's Herpes Sarcoma Virus
  • EBV Epstein-Barr virus
  • Another form of tumor specific antigen which may be used in conjunction with PD-1 blockade is purified heat shock proteins (HSP) isolated from the tumor tissue itself. These heat shock proteins contain fragments of proteins from the tumor cells and these HSPs are highly efficient at delivery to antigen presenting cells for eliciting tumor immunity (Suot, R & Srivastava, P (1995) Science 269: 1585-1588; Tamura, Y. et al. (1997) Science 278: 117
  • DCs Dendritic cells
  • DCs are potent antigen presenting cells that can be used to prime antigen-specific responses.
  • DCs can be produced ex vivo and loaded with various protein and peptide antigens as well as tumor cell extracts (Nestle, F. et al. (1998) Nature Medicine 4: 328-332).
  • DCs may also be transduced by genetic means to express these tumor antigens as well.
  • DCs have also been fused directly to tumor cells for the purposes of immunization (Kugler, A. et al. (2000) Nature Medicine 6:332-336).
  • DC immunization may be effectively combined with other agent, e.g., PD-1 blockade, to activate more potent anti-tumor responses.
  • a combination described herein includes a bispecific T-cell engager.
  • the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor (e.g., a gastrointestinal cancer, a melanoma, or a lung cancer) or a hematologic malignancy (e.g., a lymphoma (e.g., non-Hodgkin' s lymphoma) or a leukemia (e.g., an acute lymphoblastic leukemia).
  • a cancer e.g., a cancer described herein, e.g., a solid tumor (e.g., a gastrointestinal cancer, a melanoma, or a lung cancer) or a hematologic malignancy (e.g., a lymphoma (e.g., non-Hodgkin' s lymphoma) or a leukemia (e.g., an acute lympho
  • Bi-specific T-cell engagers are a class of artificial bispecific monoclonal antibodies that can direct a host's immune system, e.g., the T cells' cytotoxic activity, against cancer cells.
  • Bi-specific T-cell engagers can form a link between T cells and tumor cells, which causes T cells to exert cytotoxic activity on tumor cells by producing proteins like perforin and granzymes, independently of the presence of MHC I or co-stimulatory molecules. These proteins enter tumor cells and initiate the cell's apoptosis. This action mimics physiological processes observed during T cell attacks against tumor cells.
  • the bi-specific T-cell engager is a fusion protein comprising two single-chain variable fragments (scFvs) of different antibodies.
  • one of the scFvs binds to T cells, e.g., via the CD3 receptor, and the other to a tumor cell, e.g., via a tumor specific molecule.
  • the bi-specific T-cell engager is a bispecific antibody molecule of NKG2A and CD138, or a bispecific antibody molecule of CD3 and TCR. In some embodiments, the bispecific T-cell engager is a bispecific antibody molecule that binds to
  • the bi-specific T-cell engager is blinatumomab (CAS Registry
  • Blinatumomab is also known as MT103. Blinatumomab specifically targets a CD3 site for T cells and a CD 19 site for B cells.
  • the bi-specific T-cell engager is MT110.
  • MT110 is a single- chain antibody that targets EpCAM and CD3.
  • MT110 is disclosed, e.g., in Amann et al. J Immunother. 2009;32(5):452-64.
  • the bi-specific T-cell engager targets melanoma-associated chondroitin sulfate proteoglycan (MCSP). In some embodiments, the bi-specific T-cell engager targets CD33. In some embodiments the bi-specific T-cell engager comprises trastuzumab (targeting HER2/neu), cetuximab, or panitumumab (both targeting the EGF receptor), a functional fragment thereof. In some embodiments, the bi-specific T-cell engager targets CD66e and EphA2.
  • a combination described herein includes a GITR agonist.
  • the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor or a hematologic malignancy.
  • the cancer is a lung cancer (e.g., a non-small cell lung cancer), a head and neck cancer, or a FoxP3-expressing cancer.
  • Exemplary GITR agonists include, e.g., GITR fusion proteins and anti-GITR antibodies (e.g., bivalent anti-GITR antibodies), such as, a GITR fusion protein described in U.S. Patent No.: 6,111,090, European Patent No.: 0920505B1, U.S Patent No.: 8,586,023, PCT Publication Nos.: WO 2010/003118 and 2011/090754, or an anti-GITR antibody described, e.g., in U.S. Patent No.: 7,025,962, European Patent No.: 1947183B1, U.S. Patent No.: 7,812,135, U.S. Patent No.: 8,388,967, U.S.
  • anti-GITR antibodies e.g., bivalent anti-GITR antibodies
  • the GITR agonist is used in combination with a PD-1 inhibitor, e.g., as described in WO2015/026684.
  • the GITR agonist is used in combination with a TLR agonist, e.g., as described in WO2004/060319, and International Publication No.: WO2014/012479.
  • a TLR agonist e.g., as described in WO2004/060319, and International Publication No.: WO2014/012479.
  • PD-1 is a CD28/CTLA-4 family member expressed, e.g., on activated CD4 + and CD8 + T cells, T regS , and B cells. It negatively regulates effector T cell signaling and function. PD-1 is induced on tumor- infiltrating T cells, and can result in functional exhaustion or dysfunction (Keir et al. (2008) Annu. Rev. Immunol. 26:677-704; Pardoll et al. (2012) Nat Rev Cancer 12(4):252-64). PD-1 delivers a coinhibitory signal upon binding to either of its two ligands, Programmed Death-Ligand 1 (PD-L1) or Programmed Death-Ligand 2 (PD-L2).
  • PD-L1 Programmed Death-Ligand 1
  • PD-L2 Programmed Death-Ligand 2
  • PD-L1 is expressed on a number of cell types, including T cells, natural killer (NK) cells, macrophages, dendritic cells (DCs), B cells, epithelial cells, vascular endothelial cells, as well as many types of tumors.
  • NK natural killer
  • DCs dendritic cells
  • B cells epithelial cells
  • vascular endothelial cells as well as many types of tumors.
  • High expression of PD-L1 on murine and human tumors has been linked to poor clinical outcomes in a variety of cancers (Keir et al. (2008) Annu. Rev.
  • Blockade of the PD-1 pathway has been pre-clinically and clinically validated for cancer immunotherapy. Both preclinical and clinical studies have demonstrated that anti-PD-1 blockade can restore activity of effector T cells and results in robust anti-tumor response.
  • blockade of PD- 1 pathway can restore exhausted/dysfunctional effector T cell function (e.g., proliferation, IFN- ⁇ secretion, or cytolytic function) and/or inhibit T reg cell function (Keir et al. (2008) Annu. Rev. Immunol.
  • Blockade of the PD- 1 pathway can be effected with an antibody, an antigen binding fragment thereof, an immunoadhesin, a fusion protein, or oligopeptide of PD-1, PD-L1 and/or PD-L2.
  • PD-1 Programmed Death 1
  • isoforms mammalian, e.g., human PD-1, species homologs of human PD-1, and analogs comprising at least one common epitope with PD-1.
  • the amino acid sequence of PD-1, e.g., human PD-1 is known in the art, e.g., Shinohara T et al. (1994) Genomics 23(3):704-6; Finger LR, et al. Gene (1997) 197(1-2): 177-87.
  • the combinations described herein include a PD- 1 inhibitor, e.g., an anti-PD-1 antibody molecule (e.g., humanized antibody molecules) as described herein.
  • the anti-PD-1 antibody molecule e.g., an isolated or recombinant antibody molecule
  • PD-1 e.g., human PD-1
  • high affinity e.g., with an affinity constant of at least about 10 7 M "1 , typically about 10 8 M “1 , and more typically, about 10 9 M "1 to 10 10 M " 1 or stronger;
  • PD-1 ligand e.g., PD-L1 or PD-L2, or both;
  • (iv) binds specifically to an epitope on PD-1, e.g., the same or similar epitope as the epitope recognized by murine monoclonal antibody BAP049 or a chimeric antibody BAP049, e.g., BAP049-chi or BAP049-chi-Y;
  • (v) shows the same or similar binding affinity or specificity, or both, as any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E;
  • (vii) shows the same or similar binding affinity or specificity, or both, as an antibody molecule (e.g., an heavy chain variable region and light chain variable region) having an amino acid sequence shown in Table 1 ;
  • an antibody molecule e.g., an heavy chain variable region and light chain variable region having an amino acid sequence shown in Table 1 ;
  • (viii) shows the same or similar binding affinity or specificity, or both, as an antibody molecule (e.g., an heavy chain variable region and light chain variable region) encoded by the nucleotide sequence shown in Table 1 ;
  • an antibody molecule e.g., an heavy chain variable region and light chain variable region
  • (ix) inhibits, e.g., competitively inhibits, the binding of a second antibody molecule to PD-1, wherein the second antibody molecule is an antibody molecule described herein, e.g., an antibody molecule chosen from, e.g., any of BAP049-hum01, BAP049-hum02, BAP049- hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049- hum08, B AP049-hum09, B AP049-humlO, B AP049-huml 1 , B AP049-huml2, BAP049- huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049- Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049
  • the second antibody molecule is an antibody molecule described herein, e.g., an antibody molecule chosen from, e.g., any of BAP049-hum01, BAP049-hum02, BAP049- hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049- hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049- huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049- Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E;
  • an antibody molecule chosen from, e.g., any of BAP049-hum01, BAP049-
  • (xi) competes for binding, and/or binds the same epitope, with a second antibody molecule to PD-1, wherein the second antibody molecule is an antibody molecule described herein, e.g., an antibody molecule chosen from, e.g., any of BAP049-hum01, BAP049- hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049- hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049- huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049- Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-C
  • (xii) has one or more biological properties of an antibody molecule described herein, e.g., an antibody molecule chosen from, e.g., any of BAP049-hum01, BAP049-hum02,
  • (xiii) has one or more pharmacokinetic properties of an antibody molecule described herein, e.g., an antibody molecule chosen from, e.g., any of BAP049-hum01, BAP049- hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049- huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049- Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E;
  • an antibody molecule chosen from, e.g., any of BAP049
  • (xiv) inhibits one or more activities of PD-1, e.g., results in one or more of: an increase in tumor infiltrating lymphocytes, an increase in T-cell receptor mediated proliferation, or a decrease in immune evasion by cancerous cells;
  • (xvi) binds to one or more residues within the C strand, CC loop, C strand, or FG loop of PD-1, or a combination two, three or all of the C strand, CC loop, C strand or FG loop of PD-1, e.g., wherein the binding is assayed using ELISA or Biacore; or
  • the antibody molecule binds to PD-1 with high affinity, e.g., with a K D that is about the same, or at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90% higher or lower than the KD of a murine or chimeric anti-PD-1 antibody molecule, e.g., a murine or chimeric anti-PD-1 antibody molecule described herein.
  • the KD of the murine or chimeric anti-PD-1 antibody molecule is less than about 0.4, 0.3, 0.2, 0.1, or 0.05 nM, e.g., measured by a Biacore method. In some embodiments, the KD of the murine or chimeric anti-PD-1 antibody molecule is less than about 0.2 nM, e.g., about 0.135 nM. In other embodiments, the KD of the murine or chimeric anti PD-1 antibody molecule is less than about 10, 5, 3, 2, or 1 nM, e.g., measured by binding on cells expressing PD-1 (e.g., 300.19 cells). In some embodiments, the KD of the murine or chimeric anti PD-1 antibody molecule is less than about 5 nM, e.g., about 4.60 nM (or about 0.69 ⁇ g/mL).
  • the anti-PD-1 antibody molecule binds to PD-1 with a K OFF slower than 1 X 10 "4 , 5 X 10 "5 , or 1 X 10 "5 s "1 , e.g., about 1.65 X 10 "5 s 1 . In some embodiments, the the anti-PD-1 antibody molecule binds to PD-1 with a K ON faster than 1 X 10 4 , 5 X 10 4 , 1 X 10 5 , or 5 X 10 5 M ' V 1 , e.g., about 1.23 X 10 5 M ' V 1 .
  • the expression level of the antibody molecule is higher, e.g., at least about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10-fold higher, than the expression level of a murine or chimeric antibody molecule, e.g., a murine or chimeric anti-PD-1 antibody molecule described herein.
  • the antibody molecule is expressed in CHO cells.
  • the anti-PD-1 antibody molecule reduces one or more PD-1- associated activities with an IC 50 (concentration at 50% inhibition) that is about the same or lower, e.g., at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90% lower, than the IC 50 of a murine or chimeric anti-PD-1 antibody molecule, e.g., a murine or chimeric anti- PD-1 antibody molecule described herein.
  • the IC 50 of the murine or chimeric anti-PD-1 antibody molecule is less than about 6, 5, 4, 3, 2, or 1 nM, e.g., measured by binding on cells expressing PD-1 (e.g., 300.19 cells).
  • the IC 50 of the murine or chimeric anti-PD-1 antibody molecule is less than about 4 nM, e.g., about 3.40 nM (or about 0.51 ⁇ g/mL).
  • the PD-l-associated activity reduced is the binding of PD-L1 and/or PD-L2 to PD-1.
  • the anti-PD-1 antibody molecule binds to peripheral blood mononucleated cells (PBMCs) activated by PBMCs.
  • PBMCs peripheral blood mononucleated cells
  • the anti-PD-1 antibody molecule increases the expression of IL-2 on whole blood activated by SEB.
  • the anti-PD-1 antibody increases the expression of IL-2 by at least about 2, 3, 4, or 5-fold, compared to the expression of IL-2 when an isotype control (e.g., IgG4) is used.
  • an isotype control e.g., IgG4
  • the anti-PD-1 antibody molecule has improved stability, e.g., at least about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10-fold more stable in vivo or in vitro, than a murine or chimeric anti-PD-1 antibody molecule, e.g., a murine or chimeric anti-PD-1 antibody molecule described herein.
  • the anti PD- 1 antibody molecule is a humanized antibody molecule and has a risk score based on T cell epitope analysis of 300 to 700, 400 to 650, 450 to 600, or a risk score as described herein.
  • the anti-PD- 1 antibody molecule comprises at least one antigen-binding region, e.g., a variable region or an antigen-binding fragment thereof, from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049- Clone-E; or as described in Table 1,
  • the anti-PD-1 antibody molecule comprises at least one, two, three or four variable regions from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1; or a
  • the anti-PD-1 antibody molecule comprises at least one or two heavy chain variable regions from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01 , BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049- hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049- humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049- huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049- Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1 ; or
  • the anti-PD-1 antibody molecule comprises at least one or two light chain variable regions from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01 , BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049- hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049- humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049- huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049- Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1 ; or
  • the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgG4, e.g., a human IgG4.
  • the human IgG4 includes a substitution at position 228 according to EU numbering (e.g., a Ser to Pro substitution).
  • the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgGl, e.g., a human IgGl.
  • the human IgGl includes a substitution at position 297 according to EU numbering (e.g., an Asn to Ala substitution).
  • the human IgGl includes a substitution at position 265 according to EU numbering, a substitution at position 329 according to EU numbering, or both (e.g., an Asp to Ala substitution at position 265 and/or a Pro to Ala substitution at position 329).
  • the human IgGl includes a substitution at position 234 according to EU numbering, a substitution at position 235 according to EU numbering, or both (e.g., a Leu to Ala substitution at position 234 and/or a Leu to Ala substitution at position 235).
  • the heavy chain constant region comprises an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
  • the anti-PD-1 antibody molecule includes a kappa light chain constant region, e.g., a human kappa light chain constant region.
  • the light chain constant region comprises an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
  • the anti-PD- 1 antibody molecule includes a heavy chain constant region for an IgG4, e.g., a human IgG4, and a kappa light chain constant region, e.g., a human kappa light chain constant region, e.g., a heavy and light chain constant region comprising an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
  • the human IgG4 includes a substitution at position 228 according to EU numbering (e.g., a Ser to Pro substitution).
  • the anti-PD-1 antibody molecule includes a heavy chain constant region for an IgGl, e.g., a human IgGl, and a kappa light chain constant region, e.g., a human kappa light chain constant region, e.g., a heavy and light chain constant region comprising an amino sequence set forth in Table 3, or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) thereto.
  • the human IgGl includes a substitution at position 297 according to EU numbering (e.g., an Asn to Ala substitution).
  • the human IgGl includes a substitution at position 265 according to EU numbering, a substitution at position 329 according to EU numbering, or both (e.g., an Asp to Ala substitution at position 265 and/or a Pro to Ala substitution at position 329).
  • the human IgGl includes a substitution at position 234 according to EU numbering, a substitution at position 235 according to EU numbering, or both (e.g., a Leu to Ala substitution at position 234 and/or a Leu to Ala substitution at position 235).
  • the anti-PD- 1 antibody molecule includes a heavy chain variable domain and a constant region, a light chain variable domain and a constant region, or both, comprising the amino acid sequence of BAP049-Clone-A, BAP049-Clone-B, BAP049- Clone-C, B AP049-Clone-D, or B AP049-Clone-E; or as described in Table 1 , or encoded by the nucleotide sequence in Table 1; or a sequence substantially identical (e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical) to any of the aforesaid sequences.
  • the anti-PD-1 antibody molecule optionally, comprises a leader sequence from a heavy chain, a light chain, or both, as showin in Table 4; or a sequence substantially identical thereto.
  • the anti-PD-1 antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml 1, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049- Clone-E; or as described in Table 1, or encoded by the nuclearity
  • the anti-PD-1 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a heavy chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • the anti-PD-1 antibody molecule includes at least one, two, or three CDRs from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence
  • the anti-PD-1 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • the anti-PD-1 antibody molecule includes a substitution in a light chain CDR, e.g., one or more substitutions in a CDR1, CDR2 and/or CDR3 of the light chain.
  • the anti-PD-1 antibody molecule includes a substitution in the light chain CDR3 at position 102 of the light variable region, e.g., a substitution of a cysteine to tyrosine, or a cysteine to serine residue, at position 102 of the light variable region according to Table 1 (e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74, or 78 for a modified sequence).
  • Table 1 e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74
  • the anti-PD- 1 antibody molecule includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • the anti-PD-1 antibody molecule includes all six CDRs from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049- hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049- hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049- huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049- Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1, or encoded by the nucleotide sequence in Table 1, or closely related CDRs, e
  • the anti-PD-1 antibody molecule may include any CDR described herein.
  • the anti-PD-1 antibody molecule includes a substitution in a light chain CDR, e.g., one or more substitutions in a CDR1, CDR2 and/or CDR3 of the light chain.
  • the anti-PD-1 antibody molecule includes a substitution in the light chain CDR3 at position 102 of the light variable region, e.g., a substitution of a cysteine to tyrosine, or a cysteine to serine residue, at position 102 of the light variable region according to Table 1 (e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74, or 78 for a modified sequence).
  • Table 1 e.g., SEQ ID NO: 16 or 24 for murine or chimeric, unmodified; or any of SEQ ID NOs: 34, 42, 46, 54, 58, 62, 66, 70, 74, or 78 for a modified sequence.
  • the anti-PD- 1 antibody molecule includes at least one, two, or three CDRs according to Kabat et al. (e.g., at least one, two, or three CDRs according to the Kabat definition as set out in Table 1) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml 1, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049
  • the anti-PD-1 antibody molecule includes at least one, two, or three CDRs according to Kabat et al. (e.g., at least one, two, or three CDRs according to the Kabat definition as set out in Table 1) from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml 1, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-
  • the anti-PD-1 antibody molecule includes at least one, two, three, four, five, or six CDRs according to Kabat et al. (e.g., at least one, two, three, four, five, or six CDRs according to the Kabat definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049- hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049- humlO, BAP049-huml 1, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049- huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B
  • the anti-PD-1 antibody molecule includes all six CDRs according to Kabat et al. (e.g., all six CDRs according to the Kabat definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml 1, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D,
  • the anti-PD- 1 antibody molecule includes at least one, two, or three Chothia hypervariable loops (e.g., at least one, two, or three hypervariable loops according to the Chothia definition as set out in Table 1) from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP0
  • the anti-PD- 1 antibody molecule includes at least one, two, or three Chothia hypervariable loops (e.g., at least one, two, or three hypervairalbe loops according to the Chothia definition as set out in Table 1) of a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049- hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049- hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049- huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049- Clone-A, BAP049-Clone-B, BAP049-Clone-C
  • the anti-PD-1 antibody molecule includes at least one, two, three, four, five, or six hypervariable loops (e.g., at least one, two, three, four, five, or six hypervariable loops according to the Chothia definition as set out in Table 1) from the heavy and light chain variable regions of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049
  • the anti-PD-1 antibody molecule includes all six hypervariable loops (e.g., all six hypervariable loops according to the Chothia definition as set out in Table 1) of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049- Clone-E, or closely related hyper
  • the anti-PD-1 antibody molecule may include any hypervariable loop described herein.
  • the anti-PD- 1 antibody molecule includes at least one, two, or three hypervariable loops that have the same canonical structures as the
  • an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049- hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049- humlO, BAP049-huml 1, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049- huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049- Clone-D, or BAP049-Clone-E, e.g.
  • the same canonical structures as at least loop 1 and/or loop 2 of the heavy and/or light chain variable domains of an antibody described herein. See, e.g., Chothia et al. , (1992) /. Mol. Biol. 227:799-817; Tomlinson et al. , (1992) /. Mol. Biol. 227:776-798 for descriptions of hypervariable loop canonical structures. These structures can be determined by inspection of the tables described in these references.
  • the anti-PD- 1 antibody molecule includes a combination of CDRs or hypervariable loops defined according to the Kabat et al. and Chothia et al.
  • the anti-PD- 1 antibody molecule includes at least one, two or three CDRs or hypervariable loops from a heavy chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E, according to the Kabat and Chothia definition (e.g.
  • the anti-PD- 1 antibody molecule can include VH CDR1 according to Kabat et al. or VH hypervariable loop 1 according to Chothia et al. , or a combination thereof, e.g., as shown in Table 1.
  • the combination of Kabat and Chothia CDR of VH CDR1 comprises the amino acid sequence GYTFTTYWMH (SEQ ID NO: 224), or an amino acid sequence substantially identical thereto (e.g., having at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions)).
  • the anti-PD-1 antibody molecule can further include, e.g., VH CDRs 2-3 according to Kabat et al. and VL CDRs 1-3 according to Kabat et al., e.g., as shown in Table 1. Accordingly, in some embodiments, framework regions are defined based on a combination of CDRs defined according to Kabat et al. and hypervariable loops defined according to Chothia et al.
  • the anti-PD-1 antibody molecule can include VH FR1 defined based on VH hypervariable loop 1 according to Chothia et al. and VH FR2 defined based on VH CDRs 1-2 according to Kabat et al. , e.g., as shown in Table 1.
  • the anti-PD-1 antibody molecule can further include, e.g., VH FRs 3-4 defined based on VH CDRs 2-3 according to Kabat et al. and VL FRs 1-4 defined based on VL CDRs 1-3 according to Kabat et al.
  • the anti-PD-1 antibody molecule can contain any combination of CDRs or hypervariable loops according to the Kabat and Chothia definitions.
  • the anti-PD-1 antibody molecule includes at least one, two or three CDRs from a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone
  • the antibody molecule is a monospecific antibody molecule, a bispecific antibody molecule, or is an antibody molecule that comprises an antigen binding fragment of an antibody, e.g., a half antibody or antigen binding fragment of a half antibody.
  • a CDR e.g., Chothia CDR or Kabat CDR
  • the antibody molecule is a monospecific antibody molecule, a bispecific antibody molecule, or is an antibody molecule that comprises an antigen binding fragment of an antibody, e.g., a half antibody or antigen binding fragment of a half antibody.
  • the antibody molecule is a bispecific antibody molecule having a first binding specificity for PD- 1 and a second binding specificity for TIM-3, LAG- 3, CEACAM (e.g., CEACAM-1 and/or CEACAM-5), PD-L1 or PD-L2.
  • a bispecific antibody molecule having a first binding specificity for PD- 1 and a second binding specificity for TIM-3, LAG- 3, CEACAM (e.g., CEACAM-1 and/or CEACAM-5), PD-L1 or PD-L2.
  • the anti-PD-1 antibody molecule includes:
  • VH heavy chain variable region
  • VL light chain variable region
  • VH comprising a VHCDR1 amino acid sequence chosen from SEQ ID NO: 1; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDRl amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32;
  • a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDRl amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 33;
  • VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDRl amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32.
  • the anti-PD-1 antibody molecule comprises a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 4, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDRl amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 33.
  • the anti-PD-1 antibody molecule comprises a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 1; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDRl amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32.
  • the anti-PD-1 antibody molecule comprises a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224, a VHCDR2 amino acid sequence of SEQ ID NO: 5, and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDRl amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 33.
  • the anti-PD-1 antibody molecule comprises a VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224; a VHCDR2 amino acid sequence of SEQ ID NO: 2; and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 10, a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32.
  • the antibody molecule is a humanized antibody molecule. In another embodiment, the antibody molecule is a monospecific antibody molecule. In yet another embodiment, the antibody molecule is a bispecific antibody molecule.
  • the anti-PD-1 antibody molecule includes:
  • VH heavy chain variable region
  • VL light chain variable region
  • SEQ ID NO: 10 a VLCDR2 amino acid sequence of SEQ ID NO: 11, and a VLCDR3 amino acid sequence of SEQ ID NO: 32.
  • the anti-PD-1 antibody molecule includes:
  • VH heavy chain variable region
  • VL light chain variable region
  • the anti-PD-1 antibody molecule comprises the VHCDRl amino acid sequence of SEQ ID NO: 1. In another embodiment, the anti-PD-1 antibody molecule comprises the VHCDRl amino acid sequence of SEQ ID NO: 4. In yet another embodiment, the anti-PD-1 antibody molecule comprises the VHCDRl amino acid sequence of SEQ ID NO: 224.
  • the light or the heavy chain variable framework (e.g., the region encompassing at least FR1, FR2, FR3, and optionally FR4) of the anti-PD-1 antibody molecule can be chosen from: (a) a light or heavy chain variable framework including at least 80%, 85%, 87% 90%, 92%, 93%, 95%, 97%, 98%, or preferably 100% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, or a human consensus sequence; (b) a light or heavy chain variable framework including from 20% to 80%, 40% to 60%, 60% to 90%, or 70% to 95% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, or a human consensus sequence; (c) a non-human framework (e.g., a rodent framework); or
  • the light or heavy chain variable framework region includes a light or heavy chain variable framework sequence at least 70, 75, 80, 85, 87, 88, 90, 92, 94, 95, 96, 97, 98, 99% identical or identical to the frameworks of a VL or VH segment of a human germline gene.
  • the anti-PD- 1 antibody molecule comprises a heavy chain variable domain having at least one, two, three, four, five, six, seven, ten, fifteen, twenty or more changes, e.g., amino acid substitutions or deletions, from an amino acid sequence of BAP049-chi-HC, e.g., the amino acid sequence of the FR region in the entire variable region, e.g., shown in FIGs. 9A-9B, or SEQ ID NO: 18, 20, 22 or 30.
  • the anti- PD- 1 antibody molecule comprises a heavy chain variable domain having one or more of: E at position 1, V at position 5, A at position 9, V at position 11, K at position 12, K at position 13, E at position 16, L at position 18, R at position 19, 1 or V at position 20, G at position 24, I at position 37, A or S at position 40, T at position 41, S at position 42, R at position 43, M or L at position 48, V or F at position 68, T at position 69, 1 at position 70, S at position 71, A or R at position 72, K or N at position 74, T or K at position 76, S or N at position 77, L at position 79, L at position 81, E or Q at position 82, M at position 83, S or N at position 84, R at position 87, A at position 88, or T at position 91 of amino acid sequence of BAP049-chi- HC, e.g., the amino acid sequence of the FR in the entire variable region, e.g.
  • the anti-PD- 1 antibody molecule comprises a light chain variable domain having at least one, two, three, four, five, six, seven, ten, fifteen, twenty or more amino acid changes, e.g., amino acid substitutions or deletions, from an amino acid sequence of BAP049-chi-LC, e.g., the amino acid sequence shown in FIGs. 10A-10B, or SEQ ID NO: 24 or 26.
  • the anti-PD- 1 antibody molecule comprises a heavy chain variable domain having one or more of: E at position 1, V at position 2, Q at position 3, L at position 4, T at position 7, D or L or A at position 9, F or T at position 10, Q at position 11, S or P at position 12, L or A at position 13, S at position 14, P or L or V at position 15, K at position 16, Q or D at position 17, R at position 18, A at position 19, S at position 20, 1 or L at position 21, T at position 22, L at position 43, K at position 48, A or S at position 49, R or Q at position 51 , Y at position 55, 1 at position 64, S or P at position 66, S at position 69, Y at position 73, G at position 74, E at position 76, F at position 79, N at position 82, N at position 83, L or I at position 84, E at position 85, S or P at position 86, D at position 87, A or F or I at position 89, T or Y at position 91, F at
  • the anti-PD-1 antibody molecule includes one, two, three, or four heavy chain framework regions (e.g., a VHFW amino acid sequence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2), or a sequence substantially identical thereto.
  • heavy chain framework regions e.g., a VHFW amino acid sequence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2
  • the anti-PD- 1 antibody molecule includes one, two, three, or four light chain framework regions (e.g., a VLFW amino acid sequence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2), or a sequence substantially identical thereto.
  • light chain framework regions e.g., a VLFW amino acid sequence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2
  • the anti-PD-1 antibody molecule includes one, two, three, or four heavy chain framework regions (e.g., a VHFW amino acid sequence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2), or a sequence substantially identical thereto; and one, two, three, or four light chain framework regions (e.g., a VLFW amino acid equence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2), or a sequence substantially identical thereto.
  • heavy chain framework regions e.g., a VHFW amino acid sequence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2
  • light chain framework regions e.g., a VLFW amino acid equence shown in Table 2, or encoded by the nucleotide sequence shown in Table 2
  • the anti-PD-1 antibody molecule comprises the heavy chain framework region 1 (VHFWl) of BAP049-hum01 , BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 147).
  • the antibody molecule comprises the heavy chain framework region 1 (VHFWl) of BAP049- huml4 or BAP
  • the anti-PD-1 antibody molecule comprises the heavy chain framework region 2 (VHFW2) of BAP049-hum01 , BAP049-hum02, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum09, BAP049-huml 1, BAP049-huml2, BAP049-huml3, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, or BAP049- Clone-E (e.g., SEQ ID NO: 153).
  • VHFW2 heavy chain framework region 2
  • the antibody molecule comprises the heavy chain framework region 2 (VHFW2) of BAP049-hum03, BAP049-hum04, BAP049-hum08, BAP049-humlO, BAP049-huml4, BAP049-huml5, or BAP049-Clone-D (e.g., SEQ ID NO: 157).
  • the antibody molecule comprises the heavy chain framework region 2 (VHFW2) of BAP049-huml6 (e.g., SEQ ID NO: 160).
  • the anti-PD-1 antibody molecule comprises the heavy chain framework region 3 (VHFW3) of BAP049-hum01 , BAP049-hum02, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum09, BAP049-huml 1, BAP049-huml2, BAP049-huml3, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, or BAP049- Clone-E (e.g., SEQ ID NO: 162).
  • VHFW3 heavy chain framework region 3
  • the antibody molecule comprises the heavy chain framework region 3 (VHFW3) of BAP049-hum03, BAP049-hum04, BAP049-hum08, BAP049-humlO, BAP049-huml4, BAP049-huml5, BAP049-huml6, or BAP049-Clone-D (e.g., SEQ ID NO: 166).
  • VHFW3 heavy chain framework region 3
  • the anti-PD-1 antibody molecule comprises the heavy chain framework region 4 (VHFW4) of BAP049-hum01 , BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 169).
  • VHFW4 heavy chain framework region 4
  • the anti-PD-1 antibody molecule comprises the light chain framework region 1 (VLFWl) of BAP049-hum08, BAP049-hum09, BAP049-huml5, BAP049-huml6, or BAP049-Clone-C (e.g., SEQ ID NO: 174).
  • VLFWl light chain framework region 1
  • the antibody molecule comprises the light chain framework region 1 (VLFWl) of BAP049- humOl, BAP049-hum04, BAP049-hum05, BAP049-hum07, BAP049-humlO, BAP049- huml l, BAP049-huml4, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 177).
  • the antibody molecule comprises the light chain framework region 1 (VLFWl) of BAP049-hum06 (e.g., SEQ ID NO: 181).
  • the antibody molecule comprises the light chain framework region 1 (VLFWl) of BAP049-huml3 (e.g., SEQ ID NO: 183). In some embodiments, the antibody molecule comprises the light chain framework region 1 (VLFWl) of BAP049-hum02, BAP049-hum03, or BAP049-huml2 (e.g., SEQ ID NO: 185).
  • the anti-PD-1 antibody molecule comprises the light chain framework region 2 (VLFW2) of BAP049-hum01 , BAP049-hum02, BAP049-hum03, BAP049-hum06, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 187).
  • VLFW2 light chain framework region 2
  • the antibody molecule comprises the light chain framework region 2 (VLFW2) of BAP049- hum04, BAP049-hum05, BAP049-hum07, BAP049-huml3, or BAP049-Clone-C (e.g., SEQ ID NO: 191).
  • the antibody molecule comprises the light chain framework region 2 (VLFW2) of BAP049-huml2 (e.g., SEQ ID NO: 194).
  • the anti-PD-1 antibody molecule comprises the light chain framework region 3 (VLFW3) of BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 196).
  • VLFW3 light chain framework region 3
  • the antibody molecule comprises the light chain framework region 3 (VLFW3) of BAP049-hum02 or BAP049- hum03 (e.g., SEQ ID NO: 200). In some embodiments, the antibody molecule comprises the light chain framework region 3 (VLFW3) of BAP049-hum01 or BAP049-Clone-A (e.g., SEQ ID NO: 202). In some embodiments, the antibody molecule comprises the light chain framework region 3 (VLFW3) of BAP049-hum04, BAP049-hum05, or BAP049-Clone-B (e.g., SEQ ID NO: 205).
  • the anti-PD-1 antibody molecule comprises the light chain framework region 4 (VLFW4) of BAP049-hum01 , BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 208).
  • VLFW4 light chain framework region 4
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum01, BAP049-hum02, BAP049-hum05, BAP049- hum06, BAP-hum07, BAP049-hum09, BAP049-huml l , BAP049-huml2, BAP049-huml3, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, or BAP049-Clone-E (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)).
  • VHFWl SEQ ID NO: 147
  • VHFW2 SEQ ID NO: 153
  • VHFW3 SEQ ID NO: 162
  • the antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum03, BAP049-hum04, BAP049-hum08, BAP049-humlO, or BAP049-Clone-D (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)).
  • the antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-huml4 or BAP049-huml5 (e.g., SEQ ID NO: 151 (VHFWl), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)).
  • the antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-huml6 (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 160 (VHFW2), and SEQ ID NO: 166 (VHFW3)).
  • BAP049-huml6 e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 160 (VHFW2), and SEQ ID NO: 166 (VHFW3).
  • the antibody molecule further comprises the heavy chain framework region 4 (VHFW4) of BAP049-hum01 , BAP049-hum02, BAP049- hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049- hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l , BAP049-huml2, BAP049- huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049- Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 169).
  • VHFW4 heavy chain framework region 4
  • the anti-PD-1 antibody molecule comprises the light chain framework regions 1-3 of BAP049-hum01 or BAP049-Clone-A (e.g., SEQ ID NO: 177 (VLFWl), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 202 (VLFW3)).
  • the antibody molecule comprises the light chain framework regions 1-3 of BAP049-hum02 or BAP049-hum03 (e.g., SEQ ID NO: 185 (VLFWl), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 200 (VLFW3)).
  • the antibody molecule comprises the light chain framework regions 1-3 of B AP049-hum04, BAP049-hum05, or BAP049-Clone-B (e.g., SEQ ID NO: 177 (VLFWl), SEQ ID NO: 191 (VLFW2), and SEQ ID NO: 205 (VLFW3)).
  • the antibody molecule comprises the light chain framework regions 1-3 of BAP049-hum06 (e.g., SEQ ID NO: 181 (VLFWl), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • the antibody molecule comprises the light chain framework regions 1-3 of BAP049-hum07 (e.g., SEQ ID NO: 177 (VLFWl), SEQ ID NO: 191 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • the antibody molecule comprises the light chain framework regions 1-3 of BAP049-hum08, BAP049-hum09, BAP049-huml5, BAP049-huml6, or BAP049-Clone-C (e.g., SEQ ID NO: 174 (VLFWl), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • the antibody molecule comprises the light chain framework regions 1-3 of BAP049-humlO, BAP049-huml l , BAP049-huml4, BAP049- Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 177 (VLFWl), SEQ ID NO: 187
  • the antibody molecule comprises the light chain framework regions 1-3 of BAP049-huml2 (e.g., SEQ ID NO: 185 (VLFWl), SEQ ID NO: 194 (VLFW2), and SEQ ID NO: 196 (VLFW3)). In some embodiments, the antibody molecule comprises the light chain framework regions 1-3 of BAP049-huml3 (e.g., SEQ ID NO: 183 (VLFWl), SEQ ID NO: 191 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • the antibody molecule further comprises the light chain framework region 4 (VLFW4) of BAP049-hum01, BAP049-hum02, BAP049- hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049- hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l , BAP049-huml2, BAP049- huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049- Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 208).
  • VLFW4 light chain framework region 4
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum01 or BAP049-Clone-A (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049-hum01 or BAP049-Clone-A (e.g., SEQ ID NO: 177 (VLFW1), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 202 (VLFW3)).
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of B AP049-hum02 (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049-hum02 (e.g., SEQ ID NO: 185 (VLFWl), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 200 (VLFW3)).
  • BAP049-hum02 e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)
  • VHFW3 the heavy chain framework regions 1-3 of BAP049-hum02
  • VLFWl SEQ ID NO: 185
  • VLFW2 SEQ ID NO: 187
  • VLFW3 SEQ ID NO: 200
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of B AP049-hum03 (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)) and the light chain framework regions 1-3 of BAP049-hum03 (e.g., SEQ ID NO: 185 (VLFWl), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 200 (VLFW3)).
  • BAP049-hum03 e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)
  • VHFW3 the heavy chain framework regions 1-3 of BAP049-hum03
  • VLFWl SEQ ID NO: 185
  • VLFW2 SEQ ID NO: 187
  • SEQ ID NO: 200 VLFW3
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of B AP049-hum04 (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)) and the light chain framework regions 1-3 of BAP049-hum04 (e.g., SEQ ID NO: 177 (VLFWl), SEQ ID NO: 191 (VLFW2), and SEQ ID NO: 205 (VLFW3)).
  • BAP049-hum04 e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)
  • VHFW3 the heavy chain framework regions 1-3 of BAP049-hum04
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of B AP049-hum05 or BAP049-Clone-B (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049-hum05 or BAP049-Clone-B (e.g., SEQ ID NO: 177 (VLFWl), SEQ ID NO: 191 (VLFW2), and SEQ ID NO: 205 (VLFW3)).
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of B AP049-hum06 (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049-hum06 (e.g., SEQ ID NO: 181 (VLFWl), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • BAP049-hum06 e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)
  • VHFW3 the heavy chain framework regions 1-3 of BAP049-hum06
  • VLFWl SEQ ID NO: 181
  • VLFW2 SEQ ID NO: 187
  • VLFW3 SEQ ID NO: 196
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of B AP049-hum07 (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049-hum07 (e.g., SEQ ID NO: 177 (VLFW1), SEQ ID NO: 191 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • BAP049-hum07 e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)
  • VHFW3 the heavy chain framework regions 1-3 of BAP049-hum07
  • VLFW1 SEQ ID NO: 177
  • SEQ ID NO: 191 VLFW2
  • VLFW3 SEQ ID NO: 196
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of B AP049-hum08 (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)) and the light chain framework regions 1-3 of BAP049-hum08 (e.g., SEQ ID NO: 174 (VLFWl), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • BAP049-hum08 e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-hum09 or BAP049-Clone-C (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049-hum09 or BAP049-Clone-C (e.g., SEQ ID NO: 174 (VLFWl), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • SEQ ID NO: 147 VHFWl
  • SEQ ID NO: 153 VHFW2
  • VHFW3 SEQ ID NO: 162
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-humlO or BAP049-Clone-D (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)) and the light chain framework regions 1-3 of BAP049-humlO or BAP049-Clone-D (e.g., SEQ ID NO: 177 (VLFWl), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • SEQ ID NO: 147 VHFWl
  • SEQ ID NO: 157 VHFW2
  • VHFW3 SEQ ID NO: 166
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of B AP049-huml 1 or BAP049-Clone-E (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of B AP049-huml 1 or BAP049-Clone-E (e.g., SEQ ID NO: 177 (VLFWl), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-huml2 (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049-huml2 (e.g., SEQ ID NO: 185 (VLFWl), SEQ ID NO: 194 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • BAP049-huml2 e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)
  • VHFW3 the heavy chain framework regions 1-3 of BAP049-huml2
  • VLFWl SEQ ID NO: 185
  • VLFW2 SEQ ID NO: 194
  • VLFW3 SEQ ID NO: 196
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-huml3 (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)) and the light chain framework regions 1-3 of BAP049-huml3 (e.g., SEQ ID NO: 183 (VLFWl), SEQ ID NO: 191 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • BAP049-huml3 e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 153 (VHFW2), and SEQ ID NO: 162 (VHFW3)
  • VHFW3 the heavy chain framework regions 1-3 of BAP049-huml3
  • VLFWl SEQ ID NO: 183
  • SEQ ID NO: 191 VLFW2
  • SEQ ID NO: 196 VLFW3
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-huml4 (e.g., SEQ ID NO: 151 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)) and the light chain framework regions 1-3 of BAP049-huml4 (e.g., SEQ ID NO: 177 (VLFWl), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • BAP049-huml4 e.g., SEQ ID NO: 151 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)
  • VHFW3 the heavy chain framework regions 1-3 of BAP049-huml4
  • VLFWl the light chain framework regions 1-3 of BAP049-huml4
  • VLFWl SEQ ID NO: 177
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-huml5 (e.g., SEQ ID NO: 151 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)) and the light chain framework regions 1-3 of BAP049-huml5 (e.g., SEQ ID NO: 174 (VLFWl), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • BAP049-huml5 e.g., SEQ ID NO: 151 (VHFW1), SEQ ID NO: 157 (VHFW2), and SEQ ID NO: 166 (VHFW3)
  • VHFW3 the heavy chain framework regions 1-3 of BAP049-huml5
  • VLFWl the light chain framework regions 1-3 of BAP049-huml5
  • VLFWl SEQ ID NO: 174
  • VLFW2 SEQ
  • the anti-PD-1 antibody molecule comprises the heavy chain framework regions 1-3 of BAP049-huml6 (e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 160 (VHFW2), and SEQ ID NO: 166 (VHFW3)) and the light chain framework regions 1-3 of BAP049-huml6 (e.g., SEQ ID NO: 174 (VLFWl), SEQ ID NO: 187 (VLFW2), and SEQ ID NO: 196 (VLFW3)).
  • BAP049-huml6 e.g., SEQ ID NO: 147 (VHFWl), SEQ ID NO: 160 (VHFW2), and SEQ ID NO: 166 (VHFW3)
  • the anti-PD-1 antibody molecule further comprises the heavy chain framework region 4 (VHFW4) of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E (e.g., SEQ ID NO: 169) and the light chain framework region 4 (VLFW4) of BAP049-hum01, BAP049-hum02,
  • the anti-PD-1 antibody molecule comprises a heavy chain framework region having a combination of framework regions FWl, FW2 and FW3 as showin in FIGs. 5 or 7.
  • the antibody molecule comprises a light chain framework region having a combination of framework regions FWl, FW2 and FW3 as showin in FIGs. 5 or 7.
  • the antibody molecule comprises a heavy chain framework region having a combination of framework regions FWl, FW2 and FW3 as showin in FIGs. 5 or 7, and a light chain framework region having a combination of framework regions FWl, FW2 and FW3 as showin in FIGs. 5 or 7.
  • 1 antibody molecule includes an amino acid sequence, which is substantially identical to an amino acid disclosed herein, e.g., at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical to a variable region of an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049- hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049- humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049- huml5, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049
  • the heavy or light chain variable region, or both, of the anti-PD- 1 antibody molecule includes an amino acid sequence encoded by a nucleic acid sequence described herein or a nucleic acid that hybridizes to a nucleic acid sequence described herein (e.g., a nucleic acid sequence as shown in Tables 1 and 2) or its complement, e.g., under low stringency, medium stringency, or high stringency, or other hybridization condition described herein.
  • the anti-PD- 1 antibody molecule comprises at least one, two, three, or four antigen-binding regions, e.g., variable regions, having an amino acid sequence as set forth in Table 1, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the sequences shown in Table 1.
  • the anti-PD- 1 antibody molecule includes a VH and/or VL domain encoded by a nucleic acid having a nucleotide sequence as set forth in Table 1, or a sequence
  • substantially identical thereto e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 3, 6, 15, 30, or 45 nucleotides from the sequences shown in Table 1.
  • the anti-PD- 1 antibody molecule comprises at least one, two, or three CDRs from a heavy chain variable region having an amino acid sequence as set forth in Table 1, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one, two, three or more substitutions, insertions or deletions, e.g., conserved substitutions).
  • the anti-PD- 1 antibody molecule comprises at least one, two, or three CDRs from a light chain variable region having an amino acid sequence as set forth in Table 1, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one, two, three or more substitutions, insertions or deletions, e.g., conserved substitutions).
  • the anti-PD-1 antibody molecule comprises at least one, two, three, four, five or six CDRs from heavy and light chain variable regions having an amino acid sequence as set forth in Table 1), or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one, two, three or more substitutions, insertions or deletions, e.g., conserved substitutions).
  • the anti-PD-1 antibody molecule comprises at least one, two, or three CDRs and/or hypervariable loops from a heavy chain variable region having an amino acid sequence of an antibody described herein, e.g., an antibody chosen from any of BAP049- humOl, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049- hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049- huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049- huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E,
  • the anti-PD- 1 antibody molecule comprises at least one, two, or three CDRs and/or hypervariable loops from a light chain variable region having an amino acid sequence of of an antibody described herein, e.g., an antibody chosen from any of BAP049- humOl, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049- hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049- huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml
  • the anti-PD-1 antibody molecule comprises all six CDRs and/or hypervariable loops described herein, e.g., described in Table 1.
  • the anti-PD-1 antibody molecule has a variable region that is identical in sequence, or which differs by 1, 2, 3, or 4 amino acids from a variable region described herein (e.g. , an FR region disclosed herein).
  • the anti-PD-1 antibody molecule is a full antibody or fragment thereof (e.g., a Fab, F(ab') 2 , Fv, or a single chain Fv fragment (scFv)).
  • a Fab, F(ab') 2 , Fv, or a single chain Fv fragment (scFv) e.g., a Fab, F(ab') 2 , Fv, or a single chain Fv fragment (scFv)
  • the anti-PD-1 antibody molecule is a monoclonal antibody or an antibody with single specificity.
  • the anti-PD- 1 antibody molecule can also be a humanized, chimeric, camelid, shark, or an in vz ' iro-generated antibody molecule.
  • the anti-PD- 1 antibody molecule thereof is a humanized antibody molecule.
  • the heavy and light chains of the anti-PD-1 antibody molecule can be full-length (e.g., an antibody can include at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains) or can include an antigen-binding fragment (e.g., a Fab, F(ab')2, Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific antibody or fragment thereof, a single domain variant thereof, or a camelid antibody).
  • an antibody can include at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains
  • an antigen-binding fragment e.g., a Fab, F(ab')2, Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent antibody, or bispecific antibody or fragment thereof, a single domain variant thereof, or a camelid antibody.
  • the anti-PD-1 antibody molecule has a heavy chain constant region (Fc) chosen from, e.g., the heavy chain constant regions of IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE; particularly, chosen from, e.g., the heavy chain constant regions of IgGl, IgG2, IgG3, and IgG4, more particularly, the heavy chain constant region of IgGl or IgG2 (e.g., human IgGl, IgG2 or IgG4).
  • the heavy chain constant region is human IgGl.
  • the anti-PD-1 antibody molecule has a light chain constant region chosen from, e.g., the light chain constant regions of kappa or lambda, preferably kappa (e.g., human kappa).
  • the constant region is altered, e.g., mutated, to modify the properties of the anti-PD-1 antibody molecule (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
  • the constant region is mutated at positions 296 (M to Y), 298 (S to T), 300 (T to E), 477 (H to K) and 478 (N to F) to alter Fc receptor binding (e.g., the mutated positions correspond to positions 132 (M to Y), 134 (S to T), 136 (T to E), 313 (H to K) and 314 (N to F) of SEQ ID NOs: 212 or 214; or positions 135 (M to Y), 137 (S to T), 139 (T to E), 316 (H to K) and 317 (N to F) of SEQ ID NOs: 215, 216, 217 or 218).
  • the mutated positions correspond to positions 132 (M to Y), 134 (S to T), 136 (T to E), 313 (H to K) and 314 (N to F) of SEQ ID NOs: 212 or 214; or positions 135 (M to Y), 137 (S to T), 139 (T to
  • the heavy chain constant region of an IgG4, e.g., a human IgG4, is mutated at position 228 according to EU numbering (e.g., S to P), e.g., as shown in Table 3.
  • the anti-PD-1 antibody molecules comprises a human IgG4 mutated at position 228 according to EU numbering (e.g., S to P), e.g., as shown in Table 3; and a kappa light chain constant region, e.g., as shown in Table 3.
  • the heavy chain constant region of an IgGl is mutated at one or more of position 297 according to EU numbering (e.g., N to A), position 265 according to EU numbering (e.g., D to A), position 329 according to EU numbering (e.g., P to A), position 234 according to EU numbering (e.g., L to A), or position 235 according to EU numbering (e.g., L to A), e.g., as shown in Table 3.
  • the anti-PD-1 antibody molecules comprises a human IgGl mutated at one or more of the aforesaid positions, e.g., as shown in Table 3; and a kappa light chain constant region, e.g., as shown in Table 3.
  • the anti-PD-1 antibody molecule is isolated or recombinant. In one embodiment, the anti-PD-1 antibody molecule is a humanized antibody molecule.
  • the anti-PD-1 antibody molecule has a risk score based on T cell epitope analysis of less than 700, 600, 500, 400 or less.
  • the anti-PD-1 antibody molecue is a humanized antibody molecule and has a risk score based on T cell epitope analysis of 300 to 700, 400 to 650, 450 to 600, or a risk score as described herein.
  • the anti-PD-1 antibody molecule includes:
  • VH heavy chain variable region
  • VL light chain variable region
  • VH comprising a VHCDR1 amino acid sequence chosen from SEQ ID NO: 1 ;
  • VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224, a
  • VHCDR2 amino acid sequence of SEQ ID NO: 5 and a VHCDR3 amino acid sequence of SEQ ID NO: 3; and a VL comprising a VLCDR1 amino acid sequence of SEQ ID NO: 13, a VLCDR2 amino acid sequence of SEQ ID NO: 14, and a VLCDR3 amino acid sequence of SEQ ID NO: 33; or
  • VH comprising a VHCDR1 amino acid sequence of SEQ ID NO: 224;
  • the anti-PD-1 antibody molecule comprises:
  • VH heavy chain variable region
  • VL light chain variable region
  • the anti-PD-1 antibody molecule comprises:
  • VH heavy chain variable region
  • VL light chain variable region
  • the VHCDRl comprises the amino acid sequence of SEQ ID NO: 1. In other embodiments, the VHCDRl comprises the amino acid sequence of SEQ ID NO: 4. In yet other embodiments, the VHCDRl amino acid sequence of SEQ ID NO: 224.
  • the aforesaid antibody molecules have a heavy chain variable region comprising at least one framework (FW) region comprising the amino acid sequence of any of SEQ ID NOs: 147, 151, 153, 157, 160, 162, 166, or 169, or an amino acid sequence at least 90% identical thereto, or having no more than two amino acid substitutions, insertions or deletions compared to the amino acid sequence of any of SEQ ID NOs: 147, 151, 153, 157, 160, 162, 166, or 169.
  • FW framework
  • the aforesaid antibody molecules have a heavy chain variable region comprising at least one framework region comprising the amino acid sequence of any of SEQ ID NOs: 147, 151, 153, 157, 160, 162, 166, or 169.
  • the aforesaid antibody molecules have a heavy chain variable region comprising at least two, three, or four framework regions comprising the amino acid sequences of any of SEQ ID NOs: 147, 151, 153, 157, 160, 162, 166, or 169.
  • the aforesaid antibody molecules comprise a VHFW1 amino acid sequence of SEQ ID NO: 147 or 151, a VHFW2 amino acid sequence of SEQ ID NO: 153, 157, or 160, and a VHFW3 amino acid sequence of SEQ ID NO: 162 or 166, and, optionally, further comprising a VHFW4 amino acid sequence of SEQ ID NO: 169.
  • the aforesaid antibody molecules have a light chain variable region comprising at least one framework region comprising the amino acid sequence of any of SEQ ID NOs: 174, 177, 181, 183, 185, 187, 191, 194, 196, 200, 202, 205, or 208, or an amino acid sequence at least 90% identical thereto, or having no more than two amino acid substitutions, insertions or deletions compared to the amino acid sequence of any of 174, 177, 181, 183, 185, 187, 191, 194, 196, 200, 202, 205, or 208.
  • the aforesaid antibody molecules have a light chain variable region comprising at least one framework region comprising the amino acid sequence of any of SEQ ID NOs: 174, 177, 181, 183, 185, 187, 191, 194, 196, 200, 202, 205, or 208.
  • the aforesaid antibody molecules have a light chain variable region comprising at least two, three, or four framework regions comprising the amino acid sequences of any of SEQ ID NOs: 174, 177, 181, 183, 185, 187, 191, 194, 196, 200, 202, 205, or 208.
  • the aforesaid antibody molecules comprise a VLFW1 amino acid sequence of SEQ ID NO: 174, 177, 181, 183, or 185, a VLFW2 amino acid sequence of SEQ ID NO: 187, 191, or 194, and a VLFW3 amino acid sequence of SEQ ID NO: 196, 200, 202, or 205, and, optionally, further comprising a VLFW4 amino acid sequence of SEQ ID NO: 208.
  • the aforesaid antibodies comprise a heavy chain variable domain comprising an amino acid sequence at least 85% identical to any of SEQ ID NOs: 38, 50, 82, or 86.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38, 50, 82, or 86.
  • the aforesaid antibody molecules comprise a light chain variable domain comprising an amino acid sequence at least 85% identical to any of SEQ ID NOs: 42, 46, 54, 58, 62, 66, 70, 74, or 78.
  • the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 42, 46, 54, 58, 62, 66, 70, 74, or 78.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38. In other embodiments, the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 91.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 50.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 52 or SEQ ID NO: 102.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 82.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 84.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 86.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 88.
  • the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 42.
  • the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 44.
  • the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 46.
  • the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 48.
  • the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 54.
  • the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 56.
  • the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 58.
  • the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 60.
  • the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 62. In other embodiments, the aforesaid antibodies comprise a light chain comprising the amino acid sequence of SEQ ID NO: 64.
  • the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 66.
  • the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 68.
  • the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 70.
  • the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 72.
  • the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 74.
  • the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 76.
  • the aforesaid antibody molecules comprise a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 78.
  • the aforesaid antibody molecules comprise a light chain comprising the amino acid sequence of SEQ ID NO: 80.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 42.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 66.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 70.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 50 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 70.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 46. In other embodiments, the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 50 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 46.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 50 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 54.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 54.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 58.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 62.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 50 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 66.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 74.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 38 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 78.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 82 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 70.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 82 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 66.
  • the aforesaid antibody molecules comprise a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO: 86 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 66. In other embodiments, the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 91 and a light chain comprising the amino acid sequence of SEQ ID NO: 44.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 91 and a light chain comprising the amino acid sequence of SEQ ID NO: 56.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 91 and a light chain comprising the amino acid sequence of SEQ ID NO: 68.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 91 and a light chain comprising the amino acid sequence of SEQ ID NO: 72.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 102 and a light chain comprising the amino acid sequence of SEQ ID NO: 72.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 44.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 48.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 52 and a light chain comprising the amino acid sequence of SEQ ID NO: 48.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 52 and a light chain comprising the amino acid sequence of SEQ ID NO: 56.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 56.
  • the aforesaid antibodies comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 60.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 64.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 52 and a light chain comprising the amino acid sequence of SEQ ID NO: 68.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 68.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 52 and a light chain comprising the amino acid sequence of SEQ ID NO: 72.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 72.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 76.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 40 and a light chain comprising the amino acid sequence of SEQ ID NO: 80.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 84 and a light chain comprising the amino acid sequence of SEQ ID NO: 72.
  • the aforesaid antibodies comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 84 and a light chain comprising the amino acid sequence of SEQ ID NO: 68.
  • the aforesaid antibody molecules comprise a heavy chain comprising the amino acid sequence of SEQ ID NO: 88 and a light chain comprising the amino acid sequence of SEQ ID NO: 68.
  • the aforesaid antibody molecules are chosen from a Fab
  • F(ab')2, Fv, or a single chain Fv fragment scFv.
  • the aforesaid antibody molecules comprise a heavy chain constant region selected from IgGl, IgG2, IgG3, and IgG4. In other embodiments, the aforesaid antibody molecules comprise a light chain constant region chosen from the light chain constant regions of kappa or lambda.
  • the aforesaid antibody molecules comprise a human IgG4 heavy chain constant region with a mutation at position 228 according to EU numbering or position 108 of SEQ ID NO: 212 or 214 and a kappa light chain constant region.
  • the aforesaid antibody molecules comprise a human IgG4 heavy chain constant region with a Serine to Proline mutation at position 228 according to EU numbering or position 108 of SEQ ID NO: 212 or 214 and a kappa light chain constant region.
  • the aforesaid antibody molecules comprise a human IgGl heavy chain constant region with an Asparagine to Alanine mutation at position 297 according to EU numbering or position 180 of SEQ ID NO: 216 and a kappa light chain constant region.
  • the aforesaid antibody molecules comprise a human IgGl heavy chain constant region with an Aspartate to Alanine mutation at position 265 according to EU numbering or position 148 of SEQ ID NO: 217, and Proline to Alanine mutation at position 329 according to EU numbering or position 212 of SEQ ID NO: 217 and a kappa light chain constant region.
  • the aforesaid antibody molecules comprise a human IgGl heavy chain constant region with a Leucine to Alanine mutation at position 234 according to EU numbering or position 117 of SEQ ID NO: 218, and Leucine to Alanine mutation at position 235 according to EU numbering or position 118 of SEQ ID NO: 218 and a kappa light chain constant region.
  • the aforesaid antibody molecules are capable of binding to human PD-1 with a dissociation constant (KD) of less than about 0.2 nM.
  • the aforesaid antibody molecules bind to human PD-1 with a
  • K D of less than about 0.2 nM, 0.15 nM, 0.1 nM, 0.05 nM, or 0.02 nM, e.g., about 0.13 nM to
  • nM 0.03 nM, e.g., about 0.077 nM to 0.088 nM, e.g., about 0.083 nM, e.g., as measured by a
  • the aforesaid antibody molecules bind to cynomolgus PD- 1 with a K D of less than about 0.2 nM, 0.15 nM, 0.1 nM, 0.05 nM, or 0.02 nM, e.g., about 0.11 nM to 0.08 nM, e.g., about 0.093 nM, e.g., as measured by a Biacore method.
  • the aforesaid antibody molecules bind to both human PD-1 and cynomolgus PD-1 with similar KD, e.g., in the nM range, e.g., as measured by a Biacore method. In some embodiments, the aforesaid antibody molecules bind to a human PD-l-Ig fusion protein with a K D of less than about 0.1 nM, 0.075 nM, 0.05 nM, 0.025 nM, or 0.01 nM, e.g., about 0.04 nM, e.g., as measured by ELISA.
  • the aforesaid antibody molecules bind to Jurkat cells that express human PD-1 (e.g., human PD-1 -transfected Jurkat cells) with a KD of less than about 0.1 nM, 0.075 nM, 0.05 nM, 0.025 nM, or 0.01 nM, e.g., about 0.06 nM, e.g., as measured by FACS analysis.
  • human PD-1 e.g., human PD-1 -transfected Jurkat cells
  • the aforesaid antibody molecules bind to cynomolgus T cells with a K D of less than about InM, 0.75 nM, 0.5 nM, 0.25 nM, or 0.1 nM, e.g., about 0.4 nM, e.g., as measured by FACS analysis.
  • the aforesaid antibody molecules bind to cells that express cynomolgus PD-1 (e.g., cells transfected with cynomolgus PD-1) with a KD of less than about InM, 0.75 nM, 0.5 nM, 0.25 nM, or 0.01 nM, e.g., about 0.6 nM, e.g., as measured by FACS analysis.
  • cynomolgus PD-1 e.g., cells transfected with cynomolgus PD-1
  • KD a KD of less than about InM, 0.75 nM, 0.5 nM, 0.25 nM, or 0.01 nM, e.g., about 0.6 nM, e.g., as measured by FACS analysis.
  • the aforesaid antibody molecules are not cross-reactive with mouse or rat PD-1.
  • the aforesaid antibodies are cross-reactive with rhesus PD-1.
  • the cross-reactivity can be measured by a Biacore method or a binding assay using cells that expresses PD-1 (e.g., human PD-1 -expressing 300.19 cells).
  • the aforesaid antibody molecules bind an extracellular Ig-like domain of PD-1.
  • the aforesaid antibody molecules are capable of reducing binding of PD-1 to PD-L1, PD-L2, or both, or a cell that expresses PD-L1, PD-L2, or both.
  • the aforesaid antibody molecules reduce (e.g., block) PD-L1 binding to a cell that expresses PD-1 (e.g., human PD-1 -expressing 300.19 cells) with an IC50 of less than about 1.5 nM, 1 nM, 0.8 nM, 0.6 nM, 0.4 nM, 0.2 nM, or 0.1 nM, e.g., between about 0.79 nM and about 1.09 nM, e.g., about 0.94 nM, or about 0.78 nM or less, e.g., about 0.3 nM.
  • the aforesaid antibodies reduce (e.g., block) PD-L2 binding to a cell that expresses PD-1 (e.g., human PD-1 -expressing 300.19 cells) with an IC50 of less than about 2 nM, 1.5 nM, 1 nM, 0.5 nM, or 0.2 nM, e.g., between about 1.05 nM and about 1.55 nM, or about 1.3 nM or less, e.g., about 0.9 nM.
  • PD-1 e.g., human PD-1 -expressing 300.19 cells
  • an IC50 of less than about 2 nM, 1.5 nM, 1 nM, 0.5 nM, or 0.2 nM, e.g., between about 1.05 nM and about 1.55 nM, or about 1.3 nM or less, e.g., about 0.9 nM.
  • the aforesaid antibody molecules are capable of enhancing an antigen-specific T cell response.
  • the antibody molecule is a monospecific antibody molecule or a bispecific antibody molecule.
  • the antibody molecule has a first binding specificity for PD-1 and a second binding specifity for TIM-3, LAG-3, CEACAM (e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5), PD-L1 or PD-L2.
  • the antibody molecule comprises an antigen binding fragment of an antibody, e.g. , a half antibody or antigen binding fragment of a half antibody.
  • the aforesaid antibody molecules increase the expression of IL-2 from cells activated by Staphylococcal enterotoxin B (SEB) (e.g., at 25 ⁇ g/mL) by at least about 2, 3, 4, 5-fold, e.g., about 2 to 3-fold, e.g., about 2 to 2.6-fold, e.g., about 2.3-fold, compared to the expression of IL-2 when an isotype control (e.g., IgG4) is used, e.g., as measured in a SEB T cell activation assay or a human whole blood ex vivo assay.
  • SEB Staphylococcal enterotoxin B
  • the aforesaid antibody molecules increase the expression of IFN- ⁇ from T cells stimulated by anti-CD3 (e.g., at 0.1 ⁇ g/mL) by at least about 2, 3, 4, 5- fold, e.g., about 1.2 to 3.4-fold, e.g., about 2.3-fold, compared to the expression of IFN- ⁇ when an isotype control (e.g., IgG4) is used, e.g., as measured in an IFN- ⁇ activity assay.
  • an isotype control e.g., IgG4
  • the aforesaid antibody molecules increase the expression of IFN- ⁇ from T cells activated by SEB (e.g., at 3 pg/mL) by at least about 2, 3, 4, 5-fold, e.g., about 0.5 to 4.5-fold, e.g., about 2.5-fold, compared to the expression of IFN- ⁇ when an isotype control (e.g., IgG4) is used, e.g., as measured in an IFN- ⁇ activity assay.
  • an isotype control e.g., IgG4
  • the aforesaid antibody molecules increase the expression of IFN- ⁇ from T cells activated with an CMV peptide by at least about 2, 3, 4, 5-fold, e.g., about 2 to 3.6-fold, e.g., about 2.8-fold, compared to the expression of IFN- ⁇ when an isotype control (e.g., IgG4) is used, e.g., as measured in an IFN- ⁇ activity assay.
  • an isotype control e.g., IgG4
  • an isotype control e.g., IgG4
  • the aforesaid antibody molecules has a Cmax between about 100 ⁇ g/mL and about 500 ⁇ g/mL, between about 150 ⁇ g/mL and about 450 ⁇ g/mL, between about 250 ⁇ g/mL and about 350 ⁇ g/mL, or between about 200 ⁇ g/mL and about 400 ⁇ g/mL, e.g., about 292.5 ⁇ g/mL, e.g., as measured in monkey.
  • the aforesaid antibody molecules has a Ti 2 between about
  • the aforesaid antibody molecules bind to PD-1 with a Kd slower than 5 X 10 "4 , 1 X 10 "4 , 5 X 10 "5 , or 1 X 10 "5 s "1 , e.g., about 2.13 X 10 "4 s "1 , e.g. , as measured by a Biacore method.
  • the aforesaid antibody molecules bind to PD-1 with a Ka faster than 1 X 10 4 , 5 X 10 4 , 1 X 10 5 , or 5 X 10 5 M ' V 1 , e.g., about 2.78 X 10 5 M ' V 1 , e.g. , as measured by a Biacore method.
  • the aforesaid anti-PD-1 antibody molecules bind to one or more residues within the C strand, CC loop, C strand and FG loop of PD-1.
  • the domain structure of PD-1 is described, e.g., in Cheng et al , "Structure and Interactions of the Human Programmed Cell Death 1 Receptor” /. Biol. Chem. 2013, 288: 11771-11785.
  • the C strand comprises residues F43-M50
  • the CC loop comprises S51-N54
  • the C strand comprises residues Q55-F62
  • the FG loop comprises residues L108-I114 (amino acid numbering according to Chang et al. supra). Accordingly, in some
  • an anti-PD-1 antibody as described herein binds to at least one residue in one or more of the ranges F43-M50, S51-N54, Q55-F62, and L108-I114 of PD-1. In some embodiments, an anti-PD-1 antibody as described herein binds to at least one residue in two, three, or all four of the ranges F43-M50, S51-N54, Q55-F62, and L108-I114 of PD-1. In some embodiments, the anti-PD-1 antibody binds to a residue in PD-1 that is also part of a binding site for one or both of PD-L1 and PD-L2.
  • the invention provides an isolated nucleic acid molecule encoding any of the aforesaid antibody molecules, vectors and host cells thereof.
  • An isolated nucleic acid encoding the antibody heavy chain variable region or light chain variable region, or both, of any the aforesaid antibody molecules is also provided.
  • the isolated nucleic acid encodes heavy chain CDRs 1-3, wherein said nucleic acid comprises a nucleotide sequence of SEQ ID NO: 108-112, 223, 122-126, 133-137, or 144-146.
  • the isolated nucleic acid encodes light chain CDRs 1-3, wherein said nucleic acid comprises a nucleotide sequence of SEQ ID NO: 113-120, 127- 132, or 138-143.
  • the aforesaid nucleic acid further comprises a nucleotide sequence encoding a heavy chain variable domain, wherein said nucleotide sequence is at least 85% identical to any of SEQ ID NO: 39, 51, 83, 87, 90, 95, or 101.
  • the aforesaid nucleic acid further comprises a nucleotide sequence encoding a heavy chain variable domain, wherein said nucleotide sequence comprises any of SEQ ID NO: 39, 51, 83, 87, 90, 95, or 101.
  • the aforesaid nucleic acid further comprises a nucleotide sequence encoding a heavy chain, wherein said nucleotide sequence is at least 85% identical to any of SEQ ID NO: 41, 53, 85, 89, 92, 96, or 103.
  • the aforesaid nucleic acid further comprises a nucleotide sequence encoding a heavy chain, wherein said nucleotide sequence comprises any of SEQ ID NO: 41, 53, 85, 89, 92, 96, or 103.
  • the aforesaid nucleic acid further comprises a nucleotide sequence encoding a light chain variable domain, wherein said nucleotide sequence is at least 85% identical to any of SEQ ID NO: 43, 47, 55, 59, 63, 67, 71, 75, 79, 93, 97, 99, 104, or 106.
  • the aforesaid nucleic acid further comprises a nucleotide sequence encoding a light chain variable domain, wherein said nucleotide sequence comprises any of SEQ ID NO: 43, 47, 55, 59, 63, 67, 71, 75, 79, 93, 97, 99, 104, or 106.
  • the aforesaid nucleic acid further comprises a nucleotide sequence encoding a light chain, wherein said nucleotide sequence is at least 85% identical to any of SEQ ID NO: 45, 49, 57, 61, 65, 69, 73, 77, 81, 94, 98, 100, 105 or 107.
  • the aforesaid nucleic acid further comprises a nucleotide sequence encoding a light chain, wherein said nucleotide sequence comprises any of SEQ ID NO: 45, 49, 57, 61, 65, 69, 73, 77, 81, 94, 98, 100, 105 or 107.
  • one or more expression vectors and host cells comprising the aforesaid nucleic acids are provided.
  • a method of producing an antibody molecule or fragment thereof, comprising culturing the host cell as described herein under conditions suitable for gene expression is also provided.
  • the invention features a method of providing an antibody molecule described herein.
  • the method includes: providing a PD-1 antigen (e.g., an antigen comprising at least a portion of a PD-1 epitope); obtaining an antibody molecule that specifically binds to the PD-1 polypeptide; and evaluating if the antibody molecule specifically binds to the PD- 1 polypeptide, or evaluating efficacy of the antibody molecule in modulating, e.g., inhibiting, the activity of the PD-1.
  • the method can further include administering the antibody molecule to a subject, e.g., a human or non-human animal.
  • the invention provides, compositions, e.g., pharmaceutical compositions, which include a pharmaceutically acceptable carrier, excipient or stabilizer, and at least one of the therapeutic agents, e.g., anti-PD-1 antibody molecules described herein.
  • the composition e.g., the pharmaceutical composition, includes a combination of the antibody molecule and one or more agents, e.g., a therapeutic agent or other antibody molecule, as described herein.
  • the antibody molecule is conjugated to a label or a therapeutic agent. Additional Inhibitors ofPD-1 and Other Immune Checkpoint Molecules
  • the PD-1 inhibitor is an inhibitor, e.g., an anti-PD-1 antibody molecule, other than the anti-PD-1 antibody molecule of Table 1.
  • the PD-1 inhibitor comprises an anti-PD-1 antibody molecule of Table 1 and an anti-PD-1 antibody molecule other than the antibody molecule of Table 1.
  • the PD-1 inhibitor is an anti-PD-1 antibody chosen from Nivolumab, Pembrolizumab or Pidilizumab.
  • the anti-PD-1 antibody is Nivolumab.
  • Alternative names for Nivolumab include MDX-1106, MDX- 1106-04, ONO-4538, or BMS-936558.
  • the anti-PD- 1 antibody is Nivolumab (CAS Registry Number: 946414-94-4).
  • Nivolumab is a fully human IgG4 monoclonal antibody which specifically blocks
  • Nivolumab (clone 5C4) and other human monoclonal antibodies that specifically bind to PD1 are disclosed in US 8,008,449 and WO2006/121168.
  • the inhibitor of PD-1 is Nivolumab, and having a sequence disclosed herein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
  • the heavy and light chain amino acid sequences of Nivolumab are as follows:
  • the anti-PD-1 antibody is Pembrolizumab.
  • Pembrolizumab Pembrolizumab
  • Pembrolizumab (also referred to as Lambrolizumab, MK-3475, MK03475, SCH-900475 or KEYTRUDA®; Merck) is a humanized IgG4 monoclonal antibody that binds to PD-1.
  • Pembrolizumab and other humanized anti-PD-1 antibodies are disclosed in Hamid, O. et al. (2013) New England Journal of Medicine 369 (2): 134-44, US 8,354,509 and WO2009/114335.
  • the heavy and light chain amino acid sequences of Pembrolizumab are as follows:
  • the inhibitor of PD-1 is Pembrolizumab disclosed in, e.g., US 8,354,509 and WO 2009/114335, and having a sequence disclosed herein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
  • the anti-PD-1 antibody is Pidilizumab.
  • Pidilizumab (CT-011 ; Cure Tech) is a humanized IgGlk monoclonal antibody that binds to PDl.
  • Pidilizumab and other humanized anti-PD-1 monoclonal antibodies are disclosed in WO2009/101611.
  • anti-PDl antibodies include AMP 514 (Amplimmune), among others, e.g., anti PDl antibodies disclosed in US 8,609,089, US 2010028330, and/or US 20120114649.
  • the PD-1 inhibitor is an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an immunoadhesin (e.g., an
  • the PD-1 inhibitor is AMP- 224 (B7-DCIg; Amplimmune; e.g., disclosed in WO2010/027827 and WO2011/066342), is a PD-L2 Fc fusion soluble receptor that blocks the interaction between PD-1 and B7-H1.
  • a combination described herein includes a PD-L1 or PD-L2 inhibitor.
  • the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor or a hematologic malignancy.
  • the cancer is a thyroid cancer (e.g. , an anaplastic thyroid cancer), a lung cancer (e.g., a non-small cell lung cancer), a breast cancer (e.g., a triple negative breast cancer), an endometrial cancer, an MSI-high cancer, or a lymphoma.
  • the anti-PD-Ll antibody molecule includes at least one or two heavy chain variable domain (optionally including a constant region), at least one or two light chain variable domain (optionally including a constant region), or both, comprising the amino acid sequence of any of BAP058-hum01, BAP058-hum02, BAP058-hum03, BAP058- hum04, BAP058-hum05, BAP058-hum06, BAP058-hum07, BAP058-hum08, BAP058- hum09, BAP058-huml0, BAP058-huml l, BAP058-huml2, BAP058-huml3, BAP058- huml4, BAP058-huml5, BAP058-huml6, BAP058-huml7, BAP058-Clone-K, BAP058- Clone-L, BAP058-Clone-M, BAP058-Clone-N, or BAP058-
  • the anti-PD-Ll antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region and/or a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of BAP058-hum01, BAP058-hum02, BAP058-hum03, BAP058-hum04, BAP058-hum05, BAP058-hum06, BAP058-hum07, BAP058-hum08, BAP058-hum09, BAP058-huml0, BAP058-huml l, BAP058-huml2, BAP058-huml3, BAP058-huml4, BAP058-huml5, BAP058-huml6, BAP058-huml7, BAP058-Clone-K, BAP058-Clone-L, BAP058-Clone-M, BAP058-Clone-N, or
  • the anti-PD-Ll antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a heavy chain variable region comprising an amino acid sequence shown in Table 1 of US 2016/0108123, or encoded by a nucleotide sequence shown in Table 1.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • the anti-PD-Ll antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Table 1 of US 2016/0108123, or encoded by a nucleotide sequence shown in Table 1.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • the anti-PD-Ll antibody molecule includes a substitution in a light chain CDR, e.g., one or more
  • the anti-PD-Ll antibody molecule includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region comprising an amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1 of US 2016/0108123.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • the anti-PD-Ll antibody molecule includes:
  • VH heavy chain variable region
  • the anti-PD-Ll antibody molecule includes:
  • VH heavy chain variable region
  • VL light chain variable region
  • SEQ ID NO: 12 a VLCDR2 amino acid sequence of SEQ ID NO: 13, and a VLCDR3 amino acid sequence of SEQ ID NO: 14, each disclosed in Table 1 of US 2016/0108123.
  • the anti-PD-Ll antibody molecule comprises the VHCDR1 amino acid sequence of SEQ ID NO: 1. In another embodiment, the anti-PD-Ll antibody molecule comprises the VHCDR1 amino acid sequence of SEQ ID NO: 4. In yet another embodiment, the anti-PD-Ll antibody molecule comprises the VHCDR1 amino acid sequence of SEQ ID NO: 195, each disclosed in Table 1 of US 2016/0108123.
  • the PD-L1 inhibitor is an antibody molecule.
  • the anti-PD-Ll inhibitor is chosen from YW243.55.S70, MPDL3280A, MEDI- 4736, MSB-0010718C, or MDX-1105.
  • the anti-PD-Ll antibody is MSB0010718C.
  • MSB0010718C also referred to as A09-246-2; Merck Serono
  • A09-246-2 Merck Serono
  • Pembrolizumab and other humanized anti-PD-Ll antibodies are disclosed in
  • the heavy and light chain amino acid sequences of MSB0010718C include at least the following:
  • the PD-L1 inhibitor is YW243.55.S70.
  • the YW243.55.S70 antibody is an anti-PD-Ll antibody described in WO 2010/077634 (heavy and light chain variable region sequences shown in SEQ ID Nos. 20 and 21, respectively), and having a sequence disclosed therein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
  • the PD-L1 inhibitor is MDX-1105.
  • MDX-1105 also known as BMS-936559, is an anti-PD-Ll antibody described in WO2007/005874, and having a sequence disclosed therein (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
  • the PD-L1 inhibitor is MDPL3280A (Genentech / Roche).
  • MDPL3280A is a human Fc optimized IgGl monoclonal antibody that binds to PD-L1.
  • MDPL3280A and other human monoclonal antibodies to PD-L1 are disclosed in U.S. Patent No.: 7,943,743, PCT Publication No. WO 2013/019906, and U.S Publication No.:
  • MDPL3280A can include a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:24, as disclosed in WO 2013/019906, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 21, as disclosed in WO 2013/019906 (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
  • the PD-L1 inhibitor is MEDI-4736 (also known as durvalumab).
  • MEDI-4736 is described in WO 2011/066389 and WO 2015/036499.
  • MEDI- 4736 can include a light chain variable region comprising the amino acid sequence of SEQ ID NO: 1, as disclosed in WO 2015/036499, and a heavy chain variable region comprising the amino acid sequence of SEQ ID N0:2, as disclosed in WO 2015/036499 (or a sequence substantially identical or similar thereto, e.g., a sequence at least 85%, 90%, 95% identical or higher to the sequence specified).
  • the PD-L2 inhibitor is AMP-224.
  • AMP-224 is a PD-L2 Fc fusion soluble receptor that blocks the interaction between PD1 and B7-H1 (B7-DCIg; Amplimmune; e.g., disclosed in WO2010/027827 and WO2011/066342).
  • a combination described herein includes a LAG-3 inhibitor.
  • the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor or a hematologic malignancy.
  • the cancer is a lung cancer (e.g., a non-small cell lung cancer), a skin cancer (e.g., a melanoma), or a renal cancer (e.g., a renal cell carcinoma).
  • a combination described herein includes a LAG-3 inhibitor.
  • the combination is used to treat a cancer, e.g., a cancer described herein, e.g., a solid tumor or a hematologic malignancy.
  • the LAG-3 inhibitor is an anti-LAG-3 antibody or fragment thereof.
  • the anti-LAG-3 antibody or fragment thereof is an anti-LAG3 antibody molecule as described in U.S. Patent Application Publication No. 2015/0259420 (USSN 14/657260), entitled “Antibody Molecules to LAG3 and Uses Thereof,” incorporated by reference in its entirety.
  • the anti-LAG-3antibody molecule includes at least one or two heavy chain variable domain (optionally including a constant region), at least one or two light chain variable domain (optionally including a constant region), or both, comprising the amino acid sequence of any of BAP050-hum01, BAP050-hum02, BAP050-hum03, BAP050- hum04, BAP050-hum05, BAP050-hum06, BAP050-hum07, BAP050-hum08, BAP050- hum09, BAP050-huml0, BAP050-huml l, BAP050-huml2, BAP050-huml3, BAP050- huml4, BAP050-huml5, BAP050-huml6, BAP050-huml7, BAP050-huml8, BAP050- huml9, BAP050-hum20, huBAP050(Ser) (e.g., BAP050-hum01-Ser, BAP050-hum02-Ser, BAP050-hum03
  • the anti-LAG-3 antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region and/or a light chain variable region of an antibody described herein, e.g., an antibody chosen from any of B AP050-hum01 , BAP050-hum02, B AP050-hum03, BAP050-hum04, BAP050-hum05, BAP050-hum06, BAP050-hum07, BAP050-hum08, BAP050-hum09, BAP050-huml0, BAP050-huml l, BAP050-huml2, BAP050-huml3, BAP050-huml4, BAP050-huml5, BAP050-huml6, BAP050-huml7, BAP050-huml8, BAP050-huml9, BAP050-hum20, huBAP050(Ser) (e.g., BAP050-hum01-Ser, BAP050-hum02-Ser, B
  • the anti-LAG-3 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a heavy chain variable region comprising an amino acid sequence shown in Table 1 of US 2015/0259420, or encoded by a nucleotide sequence shown in Table 1.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • the anti-LAG-3 antibody molecule includes at least one, two, or three CDRs (or collectively all of the CDRs) from a light chain variable region comprising an amino acid sequence shown in Table 1 of US 2015/0259420, or encoded by a nucleotide sequence shown in Table 1.
  • one or more of the CDRs (or collectively all of the CDRs) have one, two, three, four, five, six or more changes, e.g., amino acid substitutions or deletions, relative to the amino acid sequence shown in Table 1, or encoded by a nucleotide sequence shown in Table 1.
  • the anti-PD-Ll antibody molecule includes a substitution in a light chain CDR, e.g., one or more

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Engineering & Computer Science (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2016/044547 2015-07-29 2016-07-28 Combination therapies comprising antibody molecules to pd-1 Ceased WO2017019896A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
CN201680056405.4A CN108025051B (zh) 2015-07-29 2016-07-28 包含抗pd-1抗体分子的联合疗法
US15/747,873 US20180222982A1 (en) 2015-07-29 2016-07-28 Combination therapies comprising antibody molecules to pd-1
EP24154217.4A EP4378957A3 (en) 2015-07-29 2016-07-28 Combination therapies comprising antibody molecules to pd-1
EP16750330.9A EP3328418A1 (en) 2015-07-29 2016-07-28 Combination therapies comprising antibody molecules to pd-1
CN202111476281.4A CN114272371A (zh) 2015-07-29 2016-07-28 包含抗pd-1抗体分子的联合疗法
JP2018504697A JP6878405B2 (ja) 2015-07-29 2016-07-28 Pd−1に対する抗体分子を含む組み合わせ治療
US17/549,586 US20230013364A1 (en) 2015-07-29 2021-12-13 Combination therapies comprising antibody molecules to pd-1

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201562198476P 2015-07-29 2015-07-29
US62/198,476 2015-07-29
US201662344731P 2016-06-02 2016-06-02
US62/344,731 2016-06-02

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/747,873 A-371-Of-International US20180222982A1 (en) 2015-07-29 2016-07-28 Combination therapies comprising antibody molecules to pd-1
US17/549,586 Continuation US20230013364A1 (en) 2015-07-29 2021-12-13 Combination therapies comprising antibody molecules to pd-1

Publications (1)

Publication Number Publication Date
WO2017019896A1 true WO2017019896A1 (en) 2017-02-02

Family

ID=56618272

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/044547 Ceased WO2017019896A1 (en) 2015-07-29 2016-07-28 Combination therapies comprising antibody molecules to pd-1

Country Status (5)

Country Link
US (2) US20180222982A1 (cg-RX-API-DMAC7.html)
EP (2) EP3328418A1 (cg-RX-API-DMAC7.html)
JP (2) JP6878405B2 (cg-RX-API-DMAC7.html)
CN (2) CN108025051B (cg-RX-API-DMAC7.html)
WO (1) WO2017019896A1 (cg-RX-API-DMAC7.html)

Cited By (69)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9815898B2 (en) 2014-01-24 2017-11-14 Novartis Ag Antibody molecules to PD-1 and uses thereof
WO2017220988A1 (en) 2016-06-20 2017-12-28 Kymab Limited Multispecific antibodies for immuno-oncology
US9884913B2 (en) 2014-01-31 2018-02-06 Novartis Ag Antibody molecules to TIM-3 and uses thereof
US9908936B2 (en) 2014-03-14 2018-03-06 Novartis Ag Antibody molecules to LAG-3 and uses thereof
US9988452B2 (en) 2014-10-14 2018-06-05 Novartis Ag Antibody molecules to PD-L1 and uses thereof
WO2018115380A1 (en) 2016-12-22 2018-06-28 Boehringer Ingelheim International Gmbh Novel benzylamino substituted quinazolines and derivatives as sos1 inhibitors
WO2018178250A1 (en) 2017-03-31 2018-10-04 Boehringer Ingelheim International Gmbh Anticancer combination therapy
WO2018185135A1 (en) 2017-04-05 2018-10-11 Boehringer Ingelheim International Gmbh Anticancer combination therapy
WO2018220169A1 (en) 2017-06-02 2018-12-06 Boehringer Ingelheim International Gmbh Anti-cancer combination therapy
WO2018235056A1 (en) * 2017-06-22 2018-12-27 Novartis Ag IL-1BETA BINDING ANTIBODIES FOR USE IN THE TREATMENT OF CANCER
WO2019027857A1 (en) * 2017-08-04 2019-02-07 Merck Sharp & Dohme Corp. COMBINATIONS OF PD-1 ANTAGONISTS AND STING BENZO [B] THIOPHENIC AGONISTS FOR THE TREATMENT OF CANCER
WO2019063802A1 (en) 2017-09-29 2019-04-04 Boehringer Ingelheim International Gmbh ANTICANCER ANTI-IGF POLY THERAPY, ANTI PD-1
US10251922B2 (en) 2013-03-14 2019-04-09 Icahn School Of Medicine At Mount Sinai Newcastle disease viruses and uses thereof
US10287353B2 (en) 2016-05-11 2019-05-14 Huya Bioscience International, Llc Combination therapies of HDAC inhibitors and PD-1 inhibitors
WO2019036031A3 (en) * 2017-08-17 2019-05-16 Nektar Therapeutics Immunotherapeutic tumor treatment method
US10308913B2 (en) 2005-12-02 2019-06-04 Icahn School Of Medicine At Mount Sinai Chimeric viruses presenting non-native surface proteins and uses thereof
EP3505188A1 (en) * 2017-12-29 2019-07-03 Invivogen Pro-cyclic dinucleotide conjugates for cytokine induction
US10385131B2 (en) 2016-05-11 2019-08-20 Huya Bioscience International, Llc Combination therapies of HDAC inhibitors and PD-L1 inhibitors
WO2019162323A1 (en) 2018-02-21 2019-08-29 Boehringer Ingelheim International Gmbh New benzimidazole compounds and derivatives as egfr inhibitors
WO2019180576A1 (en) * 2018-03-20 2019-09-26 Novartis Ag Pharmaceutical combinations
EP3569618A1 (en) 2018-05-19 2019-11-20 Boehringer Ingelheim International GmbH Antagonizing cd73 antibody
CN110570907A (zh) * 2019-09-04 2019-12-13 北京橡鑫生物科技有限公司 建立检测微卫星不稳定的基线及模型的方法与应用
US10513558B2 (en) 2015-07-13 2019-12-24 Cytomx Therapeutics, Inc. Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof
US10570204B2 (en) 2013-09-26 2020-02-25 The Medical College Of Wisconsin, Inc. Methods for treating hematologic cancers
KR20200038889A (ko) * 2017-05-19 2020-04-14 수퍼브 위즈덤 리미티드 레시퀴모드의 유도체
WO2020080979A1 (en) * 2018-10-15 2020-04-23 Gero Discovery Limited Liability Company Pfkfb3 inhibitors and their uses
US10675358B2 (en) 2016-07-07 2020-06-09 The Board Of Trustees Of The Leland Stanford Junior University Antibody adjuvant conjugates
JP2020517700A (ja) * 2017-04-28 2020-06-18 ノバルティス アーゲー Stingアゴニストを含む抗体コンジュゲート
WO2020152306A1 (en) 2019-01-25 2020-07-30 Boehringer Ingelheim International Gmbh Recombinant rhabdovirus encoding for ccl21
CN111727057A (zh) * 2018-02-16 2020-09-29 克雷森多生物制剂有限公司 与lag3和pd1结合的治疗分子
WO2020192709A1 (en) * 2019-03-27 2020-10-01 Wuxi Biologics (Shanghai) Co., Ltd. Novel bispecific polypeptide complexes
WO2020223121A1 (en) * 2019-04-30 2020-11-05 Dana-Farber Cancer Institute, Inc. Methods for treating cancer using combinations of anti-cx3cr1 and immune checkpoint blockade agents
WO2020260252A1 (en) 2019-06-24 2020-12-30 Boehringer Ingelheim International Gmbh New macrocyclic compounds and derivatives as egfr inhibitors
US10919962B2 (en) 2012-02-13 2021-02-16 Agency For Science, Technology And Research Method of reducing tumor growth with IL-1beta neutralizing human monoclonal antibodies
WO2021042171A1 (en) * 2019-09-04 2021-03-11 Ena Therapeutics Pty Ltd Cancer immunotherapy
WO2021042174A1 (en) * 2019-09-04 2021-03-11 Ena Therapeutics Pty Ltd Cancer treatment
US10980825B2 (en) 2016-12-01 2021-04-20 Takeda Pharmaceutical Company Limited Cyclic dinucleotide
US20210121563A1 (en) * 2015-12-17 2021-04-29 Novartis Ag Combination of c-met inhibitor with antibody molecule to pd-1 and uses thereof
US11008391B2 (en) 2015-08-11 2021-05-18 WuXi Biologics Ireland Limited Anti-PD-1 antibodies
CN112955464A (zh) * 2018-06-20 2021-06-11 因赛特公司 抗pd-1抗体及其用途
WO2021113500A3 (en) * 2019-12-03 2021-07-15 Board Of Regents, The University Of Texas System Combination therapies for the treatment of cancer
JP2021523949A (ja) * 2018-05-17 2021-09-09 ナンジン リーズ バイオラブズ カンパニー リミテッド Pd−1に結合する抗体及びその使用
WO2021236658A1 (en) 2020-05-19 2021-11-25 Boehringer Ingelheim International Gmbh Binding molecules for the treatment of cancer
WO2021245111A1 (en) 2020-06-03 2021-12-09 Boehringer Ingelheim International Gmbh Recombinant rhabdovirus encoding for a cd80 extracellular domain fc-fusion protein
WO2022053703A1 (en) 2020-09-14 2022-03-17 Boehringer Ingelheim International Gmbh Heterologous prime boost vaccine
US11285131B2 (en) 2017-08-04 2022-03-29 Merck Sharp & Dohme Corp. Benzo[b]thiophene STING agonists for cancer treatment
US11285143B2 (en) * 2017-03-08 2022-03-29 Johnpro Biotech Inc. Use of mTOR inhibitor and chloroquine for treating cancer
US11344620B2 (en) 2014-09-13 2022-05-31 Novartis Ag Combination therapies
US11400164B2 (en) 2019-03-15 2022-08-02 Bolt Biotherapeutics, Inc. Immunoconjugates targeting HER2
WO2022254227A1 (en) 2021-06-04 2022-12-08 Kymab Limited Treatment of pd-l1 negative or low expressing cancer with anti-icos antibodies
US11542293B2 (en) 2017-11-10 2023-01-03 Takeda Pharmaceutical Company Limited Sting modulator compounds, and methods of making and using
US20230048888A1 (en) * 2019-12-26 2023-02-16 Zhejiang Vimgreen Pharmaceuticals, Ltd. Use of triazolotriazine derivative in treatment of diseases
US11725024B2 (en) 2020-11-09 2023-08-15 Takeda Pharmaceutical Company Limited Antibody drug conjugates
WO2023246247A1 (zh) * 2022-06-22 2023-12-28 中山康方生物医药有限公司 药物组合物及其用途
TWI828626B (zh) * 2017-06-30 2024-01-11 日商小野藥品工業股份有限公司 併用包含溶血性鏈球菌之菌體的製劑的療法
US12017979B2 (en) 2019-06-26 2024-06-25 Ena Respiratory Pty Ltd Molecules
US12042534B2 (en) 2017-05-12 2024-07-23 Icahn School Of Medicine At Mount Sinai Newcastle disease viruses and uses thereof
WO2024153768A1 (en) 2023-01-20 2024-07-25 Boehringer Ingelheim International Gmbh Il-12 fc fusion proteins
WO2024160721A1 (en) 2023-01-30 2024-08-08 Kymab Limited Antibodies
WO2025003694A1 (en) 2023-06-28 2025-01-02 Sevenless Therapeutics Limited New treatments for pain
US12195557B2 (en) 2017-12-21 2025-01-14 Axelia Oncology Pty Ltd Optimised compounds
US12214045B2 (en) * 2017-01-10 2025-02-04 Nektar Therapeutics Multi-arm polymer conjugates of TLR agonist compounds and related immunotherapeutic treatment methods
WO2025062157A1 (en) 2023-09-21 2025-03-27 Sevenless Therapeutics Limited New treatments for pain
WO2025083426A1 (en) 2023-10-20 2025-04-24 Sevenless Therapeutics Limited New treatments for pain
WO2025132695A1 (en) 2023-12-19 2025-06-26 Boehringer Ingelheim International Gmbh Recombinant rhabdovirus encoding for a gasdermin
WO2025146548A1 (en) 2024-01-04 2025-07-10 Sevenless Therapeutics Limited Sos1 inhibitors useful to treat pain and cancer
US12391957B2 (en) 2018-08-17 2025-08-19 Icahn School Of Medicine At Mount Sinai Recombinant Newcastle disease viruses and uses thereof for the prevention of RSV disease or human metapneumovirus disease
US12569431B2 (en) 2010-09-22 2026-03-10 Ena Respiratory Pty Ltd Immunostimulatory method
US12600777B2 (en) 2015-07-29 2026-04-14 Novartis Ag Combination therapies comprising antibody molecules to LAG-3

Families Citing this family (43)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2611861C (en) * 2005-06-08 2017-11-28 The Brigham And Women's Hospital, Inc. Methods and compositions for the treatment of persistent infections
US10182988B2 (en) 2013-12-03 2019-01-22 Northwestern University Liposomal particles, methods of making same and uses thereof
MX373318B (es) * 2015-08-11 2020-05-21 Novartis Ag 5-bromo-2,6-di-(1h-pirazol-1-il) pirimidin-4-amina-para su uso en el tratamiento del cáncer.
ES2892972T3 (es) * 2015-11-02 2022-02-07 Univ Texas Métodos de activación de CD40 y bloqueo de punto de control inmunitario
EP4101447A1 (en) * 2016-06-30 2022-12-14 Nant Holdings IP, LLC Nant cancer vaccine
WO2018039629A2 (en) 2016-08-25 2018-03-01 Northwestern University Micellar spherical nucleic acids from thermoresponsive, traceless templates
US11696954B2 (en) 2017-04-28 2023-07-11 Exicure Operating Company Synthesis of spherical nucleic acids using lipophilic moieties
MX2020000387A (es) 2017-07-13 2020-08-17 Univ Northwestern Método general y directo para preparar nanopartículas de estructura organometálica funcionalizadas con oligonucleotidos.
KR20220068272A (ko) * 2017-08-15 2022-05-25 난트셀, 인크. Hank 세툭시맙 조합 및 방법
EP3801617A1 (en) * 2018-06-01 2021-04-14 Novartis Ag Dosing of a bispecific antibody that bind cd123 and cd3
WO2020052551A1 (en) * 2018-09-10 2020-03-19 Genesail Biotech (Shanghai) Co. Ltd. A modified oncolytic virus, composition and use thereof
US12331320B2 (en) 2018-10-10 2025-06-17 The Research Foundation For The State University Of New York Genome edited cancer cell vaccines
TWI855000B (zh) 2018-10-11 2024-09-11 日商小野藥品工業股份有限公司 Sting促效化合物
GB201816825D0 (en) * 2018-10-16 2018-11-28 Phoremost Ltd Target for anti-cancer therapy
EP3880198A4 (en) 2018-11-14 2022-08-10 The Broad Institute, Inc. ARYHYDROCARBON RECEPTOR (AHR) ACTIVATOR COMPOUNDS AS CANCER THERAPEUTICS
US11596692B1 (en) 2018-11-21 2023-03-07 Incyte Corporation PD-L1/STING conjugates and methods of use
CN111494432A (zh) * 2019-01-31 2020-08-07 惠君生物医药科技(杭州)有限公司 一种用于治疗肿瘤或癌症的药物组合物及其应用
MX2021010560A (es) * 2019-03-06 2021-11-12 Regeneron Pharma Inhibidores de la via il-4/il-13 para una eficacia aumentada en el tratamiento de cancer.
US20220184087A1 (en) * 2019-03-28 2022-06-16 The Penn State Research Foundation Methods and compositions relating to treatment of cancer
JP2022530496A (ja) * 2019-04-26 2022-06-29 ウーシー バイオロジクス アイルランド リミテッド Pd-1およびlag-3に対する二重特異性抗体
CN110179977A (zh) * 2019-05-22 2019-08-30 华中科技大学同济医学院附属同济医院 用于治疗黑色素瘤、肺癌或结直肠癌的组合药物制剂
US20220332825A1 (en) 2019-08-08 2022-10-20 Ono Pharmaceutical Co., Ltd. Bispecific protein
US12319711B2 (en) 2019-09-20 2025-06-03 Northwestern University Spherical nucleic acids with tailored and active protein coronae
EP4034569A4 (en) * 2019-09-26 2023-11-01 Wuxi Biologics Ireland Limited NOVEL BISPECIFIC ANTI-PD-L1/ANTI-LAG-3 ANTIBODY AND ITS USES
US12378560B2 (en) 2019-10-29 2025-08-05 Northwestern University Sequence multiplicity within spherical nucleic acids
WO2021088846A1 (en) * 2019-11-04 2021-05-14 Cstone Pharmaceuticals (Suzhou) Co., Ltd. Fgfr4/pd-1 combination treatments
US20220390455A1 (en) * 2019-11-05 2022-12-08 Bristol-Myers Squibb Company M-protein assays and uses thereof
CN112574309B (zh) * 2019-12-05 2023-06-16 启愈生物技术(上海)有限公司 一种抗pd-l1纳米抗体及其用途
TW202200136A (zh) * 2020-04-10 2022-01-01 日商小野藥品工業股份有限公司 癌治療方法
WO2021262484A1 (en) 2020-06-24 2021-12-30 Pmv Pharmaceuticals, Inc. Combination therapy for treatment of cancer
US12545732B2 (en) 2020-07-16 2026-02-10 Harbour Biomed (Shanghai) Co., Ltd. PD-1 antigen-binding protein and use thereof
CN114685674B (zh) * 2020-12-29 2023-09-29 瑞阳(苏州)生物科技有限公司 一种抗体融合蛋白及其应用
CN117222413A (zh) * 2021-02-10 2023-12-12 同润生物医药(上海)有限公司 治疗肿瘤的方法和组合
CN115120598A (zh) * 2021-03-29 2022-09-30 药捷安康(南京)科技股份有限公司 多激酶抑制剂的联合应用
WO2022242737A1 (zh) * 2021-05-21 2022-11-24 天津立博美华基因科技有限责任公司 药物组合及其用途
WO2023274275A1 (zh) * 2021-07-01 2023-01-05 天津立博美华基因科技有限责任公司 药物组合及其用途
CN115607678A (zh) * 2021-07-13 2023-01-17 杭州阿诺生物医药科技有限公司 用于治疗癌症的组合疗法
CN114796495A (zh) * 2022-03-22 2022-07-29 北京汇睿微免科技有限公司 雄激素剥夺在抑制雄激素非依赖性肿瘤生长中的应用
CN114736880B (zh) * 2022-06-09 2022-09-27 中国农业科学院北京畜牧兽医研究所 酸稳定性提高葡萄糖氧化酶GoxM10的突变体D497N及其衍生突变体和应用
CN115881296B (zh) * 2023-02-09 2023-05-26 杭州市第一人民医院 一种甲状腺乳头状癌(ptc)风险辅助分层系统
WO2025212557A1 (en) * 2024-04-01 2025-10-09 The Johns Hopkins University Delivery of aurora kinase inhibitors using nano-scale drug delivery platforms by covalent conjugation
CN118745227A (zh) * 2024-06-06 2024-10-08 北京磊顿生物科技有限公司 一种包含免疫细胞的药物组合物及其在制备治疗肿瘤药物中的应用
CN119792537B (zh) * 2025-01-22 2025-10-21 常州大学 利巴韦林与pd-1抑制剂联合用药物组合物及其应用

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013043647A1 (en) * 2011-09-19 2013-03-28 The Johns Hopkins University Cancer immunotherapy
WO2014022138A2 (en) * 2012-07-30 2014-02-06 Alex Wah Hin Yeung Live and in-vivo tumor specific cancer vaccine system developed by co-administration of either at least two or all three of the following components such as tumor cells, an oncolytic virus vector with transgenic expression of gm-csf and an immune checkpoint modulator
WO2014047350A1 (en) * 2012-09-20 2014-03-27 Morningside Technology Ventures Ltd. Oncolytic virus encoding pd-1 binding agents and uses of the same
WO2014189805A1 (en) * 2013-05-18 2014-11-27 Auro Biotech, Inc. Compositions and methods for activating "stimulator of interferon gene"-dependent signalling
WO2015112900A1 (en) * 2014-01-24 2015-07-30 Dana-Farber Cancer Institue, Inc. Antibody molecules to pd-1 and uses thereof

Family Cites Families (296)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4433059A (en) 1981-09-08 1984-02-21 Ortho Diagnostic Systems Inc. Double antibody conjugate
US4444878A (en) 1981-12-21 1984-04-24 Boston Biomedical Research Institute, Inc. Bispecific antibody determinants
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
JPS6147500A (ja) 1984-08-15 1986-03-07 Res Dev Corp Of Japan キメラモノクロ−ナル抗体及びその製造法
EP0173494A3 (en) 1984-08-27 1987-11-25 The Board Of Trustees Of The Leland Stanford Junior University Chimeric receptors by dna splicing and expression
GB8422238D0 (en) 1984-09-03 1984-10-10 Neuberger M S Chimeric proteins
JPS61134325A (ja) 1984-12-04 1986-06-21 Teijin Ltd ハイブリツド抗体遺伝子の発現方法
US4978672A (en) 1986-03-07 1990-12-18 Ciba-Geigy Corporation Alpha-heterocyclc substituted tolunitriles
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
GB8607679D0 (en) 1986-03-27 1986-04-30 Winter G P Recombinant dna product
US5869620A (en) 1986-09-02 1999-02-09 Enzon, Inc. Multivalent antigen-binding proteins
JP3101690B2 (ja) 1987-03-18 2000-10-23 エス・ビィ・2・インコーポレイテッド 変性抗体の、または変性抗体に関する改良
DE3884470T2 (de) 1987-06-17 1994-03-10 Sandoz Ag Cyclosporine und deren Benutzung als Arzneimittel.
JPH021556A (ja) 1988-06-09 1990-01-05 Snow Brand Milk Prod Co Ltd ハイブリッド抗体及びその作製方法
EP0436597B1 (en) 1988-09-02 1997-04-02 Protein Engineering Corporation Generation and selection of recombinant varied binding proteins
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
GB8905669D0 (en) 1989-03-13 1989-04-26 Celltech Ltd Modified antibodies
DE3920358A1 (de) 1989-06-22 1991-01-17 Behringwerke Ag Bispezifische und oligospezifische, mono- und oligovalente antikoerperkonstrukte, ihre herstellung und verwendung
WO1991000906A1 (en) 1989-07-12 1991-01-24 Genetics Institute, Inc. Chimeric and transgenic animals capable of producing human antibodies
WO1991003493A1 (en) 1989-08-29 1991-03-21 The University Of Southampton Bi-or trispecific (fab)3 or (fab)4 conjugates
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
DE69120146T2 (de) 1990-01-12 1996-12-12 Cell Genesys Inc Erzeugung xenogener antikörper
US5273743A (en) 1990-03-09 1993-12-28 Hybritech Incorporated Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent
US5427908A (en) 1990-05-01 1995-06-27 Affymax Technologies N.V. Recombinant library screening methods
GB9012995D0 (en) 1990-06-11 1990-08-01 Celltech Ltd Multivalent antigen-binding proteins
GB9015198D0 (en) 1990-07-10 1990-08-29 Brien Caroline J O Binding substance
DK0585287T3 (da) 1990-07-10 2000-04-17 Cambridge Antibody Tech Fremgangsmåde til fremstilling af specifikke bindingsparelementer
DE69133557D1 (de) 1990-08-29 2007-03-15 Pharming Intellectual Pty Bv Homologe rekombination in säugetier-zellen
ATE158021T1 (de) 1990-08-29 1997-09-15 Genpharm Int Produktion und nützung nicht-menschliche transgentiere zur produktion heterologe antikörper
CA2095633C (en) 1990-12-03 2003-02-04 Lisa J. Garrard Enrichment method for variant proteins with altered binding properties
US5582996A (en) 1990-12-04 1996-12-10 The Wistar Institute Of Anatomy & Biology Bifunctional antibodies and method of preparing same
EP1820858B1 (en) 1991-03-01 2009-08-12 Dyax Corporation Chimeric protein comprising micro-protein having two or more disulfide bonds and embodiments thereof
US6582959B2 (en) 1991-03-29 2003-06-24 Genentech, Inc. Antibodies to vascular endothelial cell growth factor
US20030206899A1 (en) 1991-03-29 2003-11-06 Genentech, Inc. Vascular endothelial cell growth factor antagonists
ATE414768T1 (de) 1991-04-10 2008-12-15 Scripps Research Inst Bibliotheken heterodimerer rezeptoren mittels phagemiden
EP0519596B1 (en) 1991-05-17 2005-02-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
DE4118120A1 (de) 1991-06-03 1992-12-10 Behringwerke Ag Tetravalente bispezifische rezeptoren, ihre herstellung und verwendung
US6511663B1 (en) 1991-06-11 2003-01-28 Celltech R&D Limited Tri- and tetra-valent monospecific antigen-binding proteins
WO1994004679A1 (en) 1991-06-14 1994-03-03 Genentech, Inc. Method for making humanized antibodies
US5637481A (en) 1993-02-01 1997-06-10 Bristol-Myers Squibb Company Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell
DE4122599C2 (de) 1991-07-08 1993-11-11 Deutsches Krebsforsch Phagemid zum Screenen von Antikörpern
US5932448A (en) 1991-11-29 1999-08-03 Protein Design Labs., Inc. Bispecific antibody heterodimers
DE69309472T2 (de) 1992-01-23 1997-10-23 Merck Patent Gmbh, 64293 Darmstadt Fusionsproteine von monomeren und dimeren von antikörperfragmenten
CA2372813A1 (en) 1992-02-06 1993-08-19 L.L. Houston Biosynthetic binding protein for cancer marker
EP0563475B1 (en) 1992-03-25 2000-05-31 Immunogen Inc Cell binding agent conjugates of derivatives of CC-1065
EP0640130B1 (en) 1992-05-08 1998-04-15 Creative Biomolecules, Inc. Chimeric multivalent protein analogues and methods of use thereof
DK1621554T4 (da) 1992-08-21 2012-12-17 Univ Bruxelles Immunoglobuliner blottet for lette kæder
US6005079A (en) 1992-08-21 1999-12-21 Vrije Universiteit Brussels Immunoglobulins devoid of light chains
US5844094A (en) 1992-09-25 1998-12-01 Commonwealth Scientific And Industrial Research Organization Target binding polypeptide
GB9221657D0 (en) 1992-10-15 1992-11-25 Scotgen Ltd Recombinant bispecific antibodies
AU687727B2 (en) 1992-10-28 1998-03-05 Genentech Inc. Vascular endothelial cell growth factor antagonists
EP0627932B1 (en) 1992-11-04 2002-05-08 City Of Hope Antibody construct
GB9323648D0 (en) 1992-11-23 1994-01-05 Zeneca Ltd Proteins
ES2156149T3 (es) 1992-12-04 2001-06-16 Medical Res Council Proteinas de union multivalente y multiespecificas, su fabricacion y su uso.
US6476198B1 (en) 1993-07-13 2002-11-05 The Scripps Research Institute Multispecific and multivalent antigen-binding polypeptide molecules
US5635602A (en) 1993-08-13 1997-06-03 The Regents Of The University Of California Design and synthesis of bispecific DNA-antibody conjugates
WO1995009917A1 (en) 1993-10-07 1995-04-13 The Regents Of The University Of California Genetically engineered bispecific tetravalent antibodies
EP0787185A2 (en) 1994-10-20 1997-08-06 MorphoSys AG Targeted hetero-association of recombinant proteins to multi-functional complexes
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
IL117645A (en) 1995-03-30 2005-08-31 Genentech Inc Vascular endothelial cell growth factor antagonists for use as medicaments in the treatment of age-related macular degeneration
CA2222055A1 (en) 1995-05-23 1996-11-28 Morphosys Gesellschaft Fur Proteinoptimierung Mbh Multimeric proteins
US5811097A (en) 1995-07-25 1998-09-22 The Regents Of The University Of California Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling
BR9606706A (pt) 1995-10-16 1999-04-06 Unilever Nv Análogo de fragmento de anticorpo biespecífico ou bivalente uso processo para produzir o mesmo
WO1997038102A1 (en) 1996-04-04 1997-10-16 Unilever Plc Multivalent and multispecific antigen-binding protein
MY129541A (en) 1996-06-25 2007-04-30 Novartis Ag Substituded 3,5-diphenyl-1,2,4-triazoles and their use as pharmaceutical metal chelators
ES2308787T3 (es) 1996-08-16 2008-12-01 Schering Corporation Antigenos de superficie de celular de mamiferos; reactivos relacionados.
US6111090A (en) 1996-08-16 2000-08-29 Schering Corporation Mammalian cell surface antigens; related reagents
US6884879B1 (en) 1997-04-07 2005-04-26 Genentech, Inc. Anti-VEGF antibodies
US20020032315A1 (en) 1997-08-06 2002-03-14 Manuel Baca Anti-vegf antibodies
PT971959E (pt) 1997-04-07 2006-05-31 Genentech Inc Anticorpos humanizados e metodos para formar anticorpos humanizados
KR100816621B1 (ko) 1997-04-07 2008-03-24 제넨테크, 인크. 항-vegf 항체
EP0979102A4 (en) 1997-04-30 2005-11-23 Enzon Inc DETAILED POLYPEPTIDE MODIFIED BY POLYALKYLENE OXIDE
US20030207346A1 (en) 1997-05-02 2003-11-06 William R. Arathoon Method for making multispecific antibodies having heteromultimeric and common components
US20020062010A1 (en) 1997-05-02 2002-05-23 Genentech, Inc. Method for making multispecific antibodies having heteromultimeric and common components
WO1998056906A1 (en) 1997-06-11 1998-12-17 Thoegersen Hans Christian Trimerising module
CO4940418A1 (es) 1997-07-18 2000-07-24 Novartis Ag Modificacion de cristal de un derivado de n-fenil-2- pirimidinamina, procesos para su fabricacion y su uso
JP2001520039A (ja) 1997-10-21 2001-10-30 ヒューマン ジノーム サイエンシーズ, インコーポレイテッド ヒト腫瘍壊死因子レセプター様タンパク質、tr11,tr11sv1およびtr11sv2
US6689607B2 (en) 1997-10-21 2004-02-10 Human Genome Sciences, Inc. Human tumor, necrosis factor receptor-like proteins TR11, TR11SV1 and TR11SV2
DK1027439T3 (da) 1997-10-27 2010-05-10 Bac Ip Bv Multivalente antigenbindende proteiner
PT1049787E (pt) 1998-01-23 2005-04-29 Vlaams Interuniv Inst Biotech Derivados de anticorpos multipropositos
AU2591599A (en) 1998-02-09 1999-08-23 Genentech Inc. Novel tumor necrosis factor receptor homolog and nucleic acids encoding the same
CZ121599A3 (cs) 1998-04-09 1999-10-13 Aventis Pharma Deutschland Gmbh Jednořetězcová molekula vázající několik antigenů, způsob její přípravy a léčivo obsahující tuto molekulu
ES2246567T3 (es) 1998-04-15 2006-02-16 Brigham & Womens Hospital Composiciones para receptores inhibidores de celulas t y usos de las mismas.
DE19819846B4 (de) 1998-05-05 2016-11-24 Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts Multivalente Antikörper-Konstrukte
GB9812545D0 (en) 1998-06-10 1998-08-05 Celltech Therapeutics Ltd Biological products
AU5728999A (en) 1998-07-28 2000-02-21 Micromet Ag Heterominibodies
US6333396B1 (en) 1998-10-20 2001-12-25 Enzon, Inc. Method for targeted delivery of nucleic acids
US6703020B1 (en) 1999-04-28 2004-03-09 Board Of Regents, The University Of Texas System Antibody conjugate methods for selectively inhibiting VEGF
US7534866B2 (en) 2005-10-19 2009-05-19 Ibc Pharmaceuticals, Inc. Methods and compositions for generating bioactive assemblies of increased complexity and uses
US7527787B2 (en) 2005-10-19 2009-05-05 Ibc Pharmaceuticals, Inc. Multivalent immunoglobulin-based bioactive assemblies
WO2001003720A2 (en) 1999-07-12 2001-01-18 Genentech, Inc. Promotion or inhibition of angiogenesis and cardiovascularization by tumor necrosis factor ligand/receptor homologs
GB0018891D0 (en) 2000-08-01 2000-09-20 Novartis Ag Organic compounds
JP2003531588A (ja) 2000-04-11 2003-10-28 ジェネンテック・インコーポレーテッド 多価抗体とその用途
CA2409991A1 (en) 2000-05-24 2001-11-29 Imclone Systems Incorporated Bispecific immunoglobulin-like antigen binding proteins and method of production
CA2410551A1 (en) 2000-06-30 2002-01-10 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw (Vib) Heterodimeric fusion proteins
WO2002008293A2 (en) 2000-07-25 2002-01-31 Immunomedics Inc. Multivalent target binding protein
GB0020685D0 (en) 2000-08-22 2000-10-11 Novartis Ag Organic compounds
US20040242847A1 (en) 2000-10-20 2004-12-02 Naoshi Fukushima Degraded agonist antibody
US6995162B2 (en) 2001-01-12 2006-02-07 Amgen Inc. Substituted alkylamine derivatives and methods of use
US7829084B2 (en) 2001-01-17 2010-11-09 Trubion Pharmaceuticals, Inc. Binding constructs and methods for use thereof
WO2002072635A2 (en) 2001-03-13 2002-09-19 University College London Specific binding members
DK1399484T3 (da) 2001-06-28 2010-11-08 Domantis Ltd Dobbelt-specifik ligand og anvendelse af denne
US6833441B2 (en) 2001-08-01 2004-12-21 Abmaxis, Inc. Compositions and methods for generating chimeric heteromultimers
EP1293514B1 (en) 2001-09-14 2006-11-29 Affimed Therapeutics AG Multimeric single chain tandem Fv-antibodies
DE60213842T2 (de) 2001-10-30 2007-09-06 Novartis Ag Staurosporin-derivate als hemmer der flt3-rezeptor-tyrosinkinase-wirkung
AU2002357072A1 (en) 2001-12-07 2003-06-23 Centocor, Inc. Pseudo-antibody constructs
PT1478648E (pt) 2002-02-01 2014-07-15 Ariad Pharma Inc Compostos contendo fósforo e suas utilizações
JP2006502091A (ja) 2002-03-01 2006-01-19 イミューノメディクス、インコーポレイテッド クリアランス速度を高めるための二重特異性抗体点変異
KR100984595B1 (ko) 2002-03-13 2010-09-30 어레이 바이오파마 인크. Mek 억제제로서의 n3 알킬화 벤즈이미다졸 유도체
WO2003087163A1 (en) 2002-04-15 2003-10-23 Chugai Seiyaku Kabushiki Kaisha METHOD OF CONSTRUCTING scDb LIBRARY
US7495090B2 (en) 2002-05-23 2009-02-24 The Regents Of The University Of California Nucleic acids encoding chimeric CD154 polypeptides
GB0215676D0 (en) 2002-07-05 2002-08-14 Novartis Ag Organic compounds
US20040047858A1 (en) 2002-09-11 2004-03-11 Blumberg Richard S. Therapeutic anti-BGP(C-CAM1) antibodies and uses thereof
DE60332483D1 (de) 2002-11-15 2010-06-17 Novartis Vaccines & Diagnostic Methoden zur verhinderung und behandlung von krebs-metastasierung und mit krebs-metastasierung einhergehendem knochenverlust
CN101899114A (zh) 2002-12-23 2010-12-01 惠氏公司 抗pd-1抗体及其用途
GB0230203D0 (en) 2002-12-27 2003-02-05 Domantis Ltd Fc fusion
EP2572714A1 (en) 2002-12-30 2013-03-27 3M Innovative Properties Company Immunostimulatory Combinations
SI1611112T1 (sl) 2003-02-11 2012-12-31 Vernalis (R&D) Limited Izoksazolne spojine kot inhibitorji vroäśinskih ĺ ok proteinov
GB0305702D0 (en) 2003-03-12 2003-04-16 Univ Birmingham Bispecific antibodies
WO2004094613A2 (en) 2003-04-22 2004-11-04 Ibc Pharmaceuticals Polyvalent protein complex
US7618632B2 (en) 2003-05-23 2009-11-17 Wyeth Method of treating or ameliorating an immune cell associated pathology using GITR ligand antibodies
UA101945C2 (uk) 2003-05-30 2013-05-27 Дженентек, Инк. Лікування злоякісного новоутворення за допомогою бевацизумабу
NZ544924A (en) 2003-06-27 2009-03-31 Biogen Idec Inc Modified binding molecules comprising connecting peptides
KR20060041205A (ko) 2003-07-01 2006-05-11 이뮤노메딕스, 인코오포레이티드 양특이성 항체들의 다가 담체들
WO2005007190A1 (en) 2003-07-11 2005-01-27 Schering Corporation Agonists or antagonists of the clucocorticoid-induced tumour necrosis factor receptor (gitr) or its ligand for the treatment of immune disorders, infections and cancer
US7696322B2 (en) 2003-07-28 2010-04-13 Catalent Pharma Solutions, Inc. Fusion antibodies
WO2005044853A2 (en) 2003-11-01 2005-05-19 Genentech, Inc. Anti-vegf antibodies
US20050106667A1 (en) 2003-08-01 2005-05-19 Genentech, Inc Binding polypeptides with restricted diversity sequences
JPWO2005035586A1 (ja) 2003-10-08 2007-11-22 協和醗酵工業株式会社 融合蛋白質組成物
EP1682103A1 (en) 2003-10-27 2006-07-26 Novartis AG Indolyl-pyrroledione derivatives for the treatment of neurological and vascular disorders related to beta-amyloid generation and/or aggregation
WO2005055808A2 (en) 2003-12-02 2005-06-23 Genzyme Corporation Compositions and methods to diagnose and treat lung cancer
EP1697748A4 (en) 2003-12-22 2007-07-04 Centocor Inc METHODS FOR GENERATING MULTIMEDIA MOLECULES
GB0329825D0 (en) 2003-12-23 2004-01-28 Celltech R&D Ltd Biological products
US20050266425A1 (en) 2003-12-31 2005-12-01 Vaccinex, Inc. Methods for producing and identifying multispecific antibodies
SI2311873T1 (sl) 2004-01-07 2018-12-31 Novartis Vaccines And Diagnostics, Inc. M-CSF-specifična monoklonska protitelesa in njihova uporaba
JP2007518823A (ja) 2004-01-23 2007-07-12 アムゲン インコーポレイテッド キノリン、キナゾリン、ピリジン、及びピリミジン化合物と炎症、血管新生、及び癌に対する治療におけるそれら化合物の用途
US8383575B2 (en) 2004-01-30 2013-02-26 Paul Scherrer Institut (DI)barnase-barstar complexes
GB0409799D0 (en) 2004-04-30 2004-06-09 Isis Innovation Method of generating improved immune response
WO2005113556A1 (en) 2004-05-13 2005-12-01 Icos Corporation Quinazolinones as inhibitors of human phosphatidylinositol 3-kinase delta
US20060002932A1 (en) 2004-06-04 2006-01-05 Duke University Methods and compositions for enhancement of immunity by in vivo depletion of immunosuppressive cell activity
SI1761528T1 (sl) 2004-06-11 2008-06-30 Japan Tobacco Inc 5-amino-2,4,7-triokso-3,4,7,8-tetrahidro-2H-pirido(2,3-D)pirimidinski derivati in sorodne spojine za zdravljenje raka
GB0512324D0 (en) 2005-06-16 2005-07-27 Novartis Ag Organic compounds
US20060009360A1 (en) 2004-06-25 2006-01-12 Robert Pifer New adjuvant composition
EP1786918A4 (en) 2004-07-17 2009-02-11 Imclone Systems Inc NEW BISPECIFIC ANTIBODY TETRAVALENT
GB0417487D0 (en) 2004-08-05 2004-09-08 Novartis Ag Organic compound
WO2006028936A2 (en) 2004-09-02 2006-03-16 Genentech, Inc. Heteromultimeric molecules
TR201901929T4 (tr) 2005-02-08 2019-03-21 Genzyme Corp TGFBeta'ya antikorlar.
PT2343320T (pt) 2005-03-25 2018-01-23 Gitr Inc Anticorpos anti-gitr e as suas utilizações
AU2006232287B2 (en) 2005-03-31 2011-10-06 Chugai Seiyaku Kabushiki Kaisha Methods for producing polypeptides by regulating polypeptide association
CA2604032C (en) 2005-04-06 2017-08-22 Ibc Pharmaceuticals, Inc. Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses
ES2971647T3 (es) 2005-04-15 2024-06-06 Macrogenics Inc Diacuerpos covalentes y usos de los mismos
DK1877090T3 (da) 2005-05-06 2014-04-14 Providence Health System Trimert ox40-immunoglobulin-fusionsprotein og fremgangsmåder til anvendelse heraf
DK2439273T3 (da) 2005-05-09 2019-06-03 Ono Pharmaceutical Co Humane monoklonale antistoffer til programmeret død-1(pd-1) og fremgangsmåder til behandling af cancer ved anvendelse af anti-pd-1- antistoffer alene eller i kombination med andre immunterapeutika
GB0510390D0 (en) 2005-05-20 2005-06-29 Novartis Ag Organic compounds
US20060263367A1 (en) 2005-05-23 2006-11-23 Fey Georg H Bispecific antibody devoid of Fc region and method of treatment using same
PT1907424E (pt) 2005-07-01 2015-10-09 Squibb & Sons Llc Anticorpos monoclonais humanos para o ligando 1 de morte programada (pd-l1)
WO2007004415A1 (ja) 2005-07-01 2007-01-11 Murata Manufacturing Co., Ltd. 多層セラミック基板およびその製造方法ならびに多層セラミック基板作製用複合グリーンシート
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
GT200600381A (es) 2005-08-25 2007-03-28 Compuestos organicos
ATE452913T1 (de) 2005-08-26 2010-01-15 Pls Design Gmbh Bivalente igy antikörperkonstrukte für diagnostische und therapeutische anwendungen
TWI387592B (zh) 2005-08-30 2013-03-01 Novartis Ag 經取代之苯并咪唑及其作為與腫瘤形成相關激酶之抑制劑之方法
WO2007044887A2 (en) 2005-10-11 2007-04-19 Transtarget, Inc. Method for producing a population of homogenous tetravalent bispecific antibodies
EP1777294A1 (en) 2005-10-20 2007-04-25 Institut National De La Sante Et De La Recherche Medicale (Inserm) IL-15Ralpha sushi domain as a selective and potent enhancer of IL-15 action through IL-15Rbeta/gamma, and hyperagonist (IL15Ralpha sushi -IL15) fusion proteins
EP1962961B1 (en) 2005-11-29 2013-01-09 The University Of Sydney Demibodies: dimerisation-activated therapeutic agents
PL2251034T3 (pl) 2005-12-02 2018-07-31 Icahn School Of Medicine At Mount Sinai Chimeryczne wirusy prezentujące nienatywne białka powierzchniowe i zastosowania tych wirusów
EP1963368B3 (en) 2005-12-13 2020-06-10 Eli Lilly And Company Anti-il-17 antibodies
SG10202003901UA (en) 2005-12-13 2020-05-28 Incyte Holdings Corp Heteroaryl substituted pyrrolo[2,3-b]pyridines and pyrrolo[2,3-b]pyrimidines as janus kinase inhibitors
WO2007070660A2 (en) 2005-12-13 2007-06-21 President And Fellows Of Harvard College Scaffolds for cell transplantation
WO2007133822A1 (en) 2006-01-19 2007-11-22 Genzyme Corporation Gitr antibodies for the treatment of cancer
JO2660B1 (en) 2006-01-20 2012-06-17 نوفارتيس ايه جي Pi-3 inhibitors and methods of use
MX2008010561A (es) 2006-02-15 2009-03-02 Imclone Systems Inc Anticuerpos funcionales.
CA2646508A1 (en) 2006-03-17 2007-09-27 Biogen Idec Ma Inc. Stabilized polypeptide compositions
PT1999154E (pt) 2006-03-24 2013-01-24 Merck Patent Gmbh Domínios proteicos heterodiméricos modificados
WO2007112362A2 (en) 2006-03-24 2007-10-04 The Regents Of The University Of California Construction of a multivalent scfv through alkyne-azide 1,3-dipolar cycloaddition
EP2009101B1 (en) 2006-03-31 2017-10-25 Chugai Seiyaku Kabushiki Kaisha Antibody modification method for purifying bispecific antibody
CA2649288C (en) 2006-04-19 2015-11-24 Novartis Ag 6-o-substituted benzoxazole and benzothiazole compounds and methods of inhibiting csf-1r signaling
UA93548C2 (uk) 2006-05-05 2011-02-25 Айерем Елелсі Сполуки та композиції як модулятори хеджхогівського сигнального шляху
ES2469676T3 (es) 2006-05-25 2014-06-18 Bayer Intellectual Property Gmbh Complejos moleculares dim�ricos
US20070274985A1 (en) 2006-05-26 2007-11-29 Stefan Dubel Antibody
NZ573646A (en) 2006-06-12 2012-04-27 Wyeth Llc Single-chain multivalent binding proteins with effector function
PE20110220A1 (es) 2006-08-02 2011-04-11 Novartis Ag DERIVADOS DE 2-OXO-ETIL-AMINO-PROPIONAMIDA-PIRROLIDIN-2-IL-SUSTITUIDOS COMO INHIBIDORES DEL ENLACE DE LA PROTEINA Smac AL INHIBIDOR DE LA PROTEINA DE APOPTOSIS
US8759297B2 (en) 2006-08-18 2014-06-24 Armagen Technologies, Inc. Genetically encoded multifunctional compositions bidirectionally transported between peripheral blood and the cns
AR064801A1 (es) 2006-08-18 2009-04-29 Xoma Technology Ltd Anticuerpo especifico prlr (receptor de prolactina) y sus usos
AU2007286808B2 (en) 2006-08-21 2012-12-06 Genentech, Inc. Aza-benzofuranyl compounds and methods of use
WO2008027236A2 (en) 2006-08-30 2008-03-06 Genentech, Inc. Multispecific antibodies
US7767206B2 (en) 2006-10-02 2010-08-03 Amgen Inc. Neutralizing determinants of IL-17 Receptor A and antibodies that bind thereto
GB0620894D0 (en) 2006-10-20 2006-11-29 Univ Southampton Human immune therapies using a CD27 agonist alone or in combination with other immune modulators
KR20090105913A (ko) 2006-11-02 2009-10-07 다니엘 제이 카폰 이동 부분을 갖는 하이브리드 면역글로불린
RS54510B1 (sr) 2006-11-22 2016-06-30 Incyte Holdings Corporation Imidazotriazini i imidazopirimidini kao inhibitori kinaze
US20080318886A1 (en) 2006-12-05 2008-12-25 Prussak Charles E Methods of Increasing Cancer Sensitivity to Chemotherapeutic Agents Using Chimeric ISF35
EA017405B9 (ru) 2006-12-08 2014-05-30 АйАрЭм ЭлЭлСи Соединения и композиции в качестве ингибиторов протеинкиназы
US20100178684A1 (en) 2006-12-21 2010-07-15 Woo Savio L C Transgenic oncolytic viruses and uses thereof
ES2593484T3 (es) 2007-03-29 2016-12-09 Genmab A/S Anticuerpos biespecíficos y métodos de producción de los mismos
EP2144930A1 (en) 2007-04-18 2010-01-20 ZymoGenetics, Inc. Single chain fc, methods of making and methods of treatment
BR122017025062B8 (pt) 2007-06-18 2021-07-27 Merck Sharp & Dohme anticorpo monoclonal ou fragmento de anticorpo para o receptor de morte programada humano pd-1, polinucleotídeo e composição compreendendo o referido anticorpo ou fragmento
US9770535B2 (en) 2007-06-21 2017-09-26 President And Fellows Of Harvard College Scaffolds for cell collection or elimination
NZ599338A (en) 2007-06-27 2013-11-29 Marinepolymer Tech Inc Complexes of il-15 and il-15ralpha and uses thereof
US8591886B2 (en) 2007-07-12 2013-11-26 Gitr, Inc. Combination therapies employing GITR binding molecules
KR20100058509A (ko) 2007-07-31 2010-06-03 메디뮨 엘엘씨 다중특이적 에피토프 결합 단백질 및 이의 용도
CA2696263C (en) 2007-08-15 2017-06-13 Bing Liu Monospecific and multispecific antibodies and method of use
EP2650311A3 (en) 2007-11-27 2014-06-04 Ablynx N.V. Amino acid sequences directed against heterodimeric cytokines and/or their receptors and polypeptides comprising the same
US20090148905A1 (en) 2007-11-30 2009-06-11 Claire Ashman Antigen-binding constructs
JP5421925B2 (ja) 2007-12-19 2014-02-19 ジェネンテック, インコーポレイテッド 5−アニリノイミダゾピリジン及び使用の方法
US9266967B2 (en) 2007-12-21 2016-02-23 Hoffmann-La Roche, Inc. Bivalent, bispecific antibodies
US8227577B2 (en) 2007-12-21 2012-07-24 Hoffman-La Roche Inc. Bivalent, bispecific antibodies
US20090162359A1 (en) 2007-12-21 2009-06-25 Christian Klein Bivalent, bispecific antibodies
US8242247B2 (en) 2007-12-21 2012-08-14 Hoffmann-La Roche Inc. Bivalent, bispecific antibodies
JP6157046B2 (ja) 2008-01-07 2017-07-05 アムジェン インコーポレイテッド 静電的ステアリング(electrostaticsteering)効果を用いた抗体Fcヘテロ二量体分子を作製するための方法
CN101970499B (zh) 2008-02-11 2014-12-31 治疗科技公司 用于肿瘤治疗的单克隆抗体
CN102006891B (zh) 2008-02-13 2017-04-26 哈佛学院董事会 连续的细胞程序化装置
EP2262837A4 (en) 2008-03-12 2011-04-06 Merck Sharp & Dohme PD-1 BINDING PROTEINS
EP2252293B1 (en) 2008-03-14 2018-06-27 Intellikine, LLC Kinase inhibitors and methods of use
PE20091628A1 (es) 2008-03-19 2009-11-19 Novartis Ag Formas cristalinas y dos formas solvatadas de sales de acido lactico de 4-amino-5-fluoro-3-[5-(4-metilpiperazin-1-il)-1h-benzimidazol-2-il]quinolin-2(1h)-ona
TWI472529B (zh) 2008-05-21 2015-02-11 Incyte Corp 2-氟-N-甲基-4-〔7-(喹啉-6-基-甲基)-咪唑并〔1,2-b〕〔1,2,4〕三-2-基〕苯甲醯胺之鹽類及其相關製備方法
ES2554513T3 (es) 2008-05-23 2015-12-21 Novartis Ag Derivados de quinolinas y quinoxalinas como inhibidores de la proteína tirosina quinasa
PE20100087A1 (es) 2008-06-25 2010-02-08 Irm Llc Compuestos y composiciones como inhibidores de cinasa
NZ590667A (en) 2008-07-02 2013-01-25 Emergent Product Dev Seattle Tgf-b antagonist multi-target binding proteins
BRPI0915231A2 (pt) 2008-07-08 2018-06-12 Intellikine Inc compostos inibidores de quinase e métodos de uso
SI2315780T1 (sl) 2008-07-17 2015-11-30 Novartis Ag Sestavki in postopki uporabe za terapevtska protitelesa
US20100041663A1 (en) 2008-07-18 2010-02-18 Novartis Ag Organic Compounds as Smo Inhibitors
AR072999A1 (es) 2008-08-11 2010-10-06 Medarex Inc Anticuerpos humanos que se unen al gen 3 de activacion linfocitaria (lag-3) y los usos de estos
ES2522346T3 (es) 2008-08-22 2014-11-14 Novartis Ag Compuestos de pirrolopirimidina como inhibidores de CDK
AU2009288730B2 (en) 2008-08-25 2013-06-20 Amplimmune, Inc. Compositions of PD-1 antagonists and methods of use
JP2012500855A (ja) 2008-08-25 2012-01-12 アンプリミューン、インコーポレーテッド Pd−1アンタゴニストおよび感染性疾患を処置するための方法
PL2344474T3 (pl) 2008-09-02 2016-03-31 Novartis Ag Pochodne pikolinamidu jako inhibitory kinaz
UA104147C2 (uk) 2008-09-10 2014-01-10 Новартис Аг Похідна піролідиндикарбонової кислоти та її застосування у лікуванні проліферативних захворювань
CN102149820B (zh) 2008-09-12 2014-07-23 国立大学法人三重大学 能够表达外源gitr配体的细胞
CA2738429C (en) 2008-09-26 2016-10-25 Intellikine, Inc. Heterocyclic kinase inhibitors
MA32934B1 (fr) 2008-11-28 2012-01-02 Novartis Ag Combinaisons inhibitrices hsp90
EP3255060A1 (en) 2008-12-09 2017-12-13 F. Hoffmann-La Roche AG Anti-pd-l1 antibodies and their use to enhance t-cell function
EP2987856B1 (en) 2009-02-05 2018-07-25 Icahn School of Medicine at Mount Sinai Chimeric newcastle disease viruses and uses thereof
JP5844159B2 (ja) 2009-02-09 2016-01-13 ユニヴェルシテ デクス−マルセイユUniversite D’Aix−Marseille Pd−1抗体およびpd−l1抗体ならびにその使用
UA103918C2 (en) 2009-03-02 2013-12-10 Айерем Элелси N-(hetero)aryl, 2-(hetero)aryl-substituted acetamides for use as wnt signaling modulators
WO2010129304A2 (en) 2009-04-27 2010-11-11 Oncomed Pharmaceuticals, Inc. Method for making heteromultimeric molecules
KR20180077322A (ko) 2009-04-30 2018-07-06 텔 하쇼머 메디컬 리서치 인프라스트럭쳐 앤드 서비시스 리미티드. 항-ceacam1 항체들과 이를 이용하는 방법들
WO2010149755A1 (en) 2009-06-26 2010-12-29 Novartis Ag 1, 3-disubstituted imidazolidin-2-one derivatives as inhibitors of cyp 17
AR077975A1 (es) 2009-08-28 2011-10-05 Irm Llc Derivados de pirazol pirimidina y composiciones como inhibidores de cinasa de proteina
KR101790802B1 (ko) 2009-09-03 2017-10-27 머크 샤프 앤드 돔 코포레이션 항-gitr 항체
IT1395574B1 (it) 2009-09-14 2012-10-16 Guala Dispensing Spa Dispositivo di erogazione
GB0919054D0 (en) 2009-10-30 2009-12-16 Isis Innovation Treatment of obesity
WO2011066342A2 (en) 2009-11-24 2011-06-03 Amplimmune, Inc. Simultaneous inhibition of pd-l1/pd-l2
PL2504364T3 (pl) 2009-11-24 2017-12-29 Medimmune Limited Ukierunkowane środki wiążące przeciwko B7-H1
US8440693B2 (en) 2009-12-22 2013-05-14 Novartis Ag Substituted isoquinolinones and quinazolinones
CA2785907A1 (en) 2009-12-29 2011-07-28 Emergent Product Development Seattle, Llc Ron binding constructs and methods of use thereof
UY33227A (es) 2010-02-19 2011-09-30 Novartis Ag Compuestos de pirrolopirimidina como inhibidores de la cdk4/6
EP2542256B1 (en) * 2010-03-04 2019-05-22 MacroGenics, Inc. Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof
HRP20241208T1 (hr) 2010-04-20 2024-11-22 Genmab A/S Heterodimerni proteini koji sadrže fc fragment protutijela i postupci za njihovu proizvodnju
AU2011262758B8 (en) 2010-06-11 2014-09-04 Kyowa Kirin Co., Ltd. Anti-tim-3 antibody
AU2011275749C1 (en) 2010-07-09 2015-09-17 Aduro Biotech Holdings, Europe B.V. Agonistic antibody to CD27
AU2011290672B2 (en) 2010-08-20 2015-07-09 Novartis Ag Antibodies for epidermal growth factor receptor 3 (HER3)
CA2809089C (en) 2010-08-23 2018-12-18 Board Of Regents, The University Of Texas System Anti-ox40 antibodies and methods of using the same
US8507222B2 (en) 2010-09-21 2013-08-13 Altor Bioscience Corporation Multimeric IL-15 soluble fusion molecules and methods of making and using same
CN107648668B (zh) 2010-10-06 2021-06-18 哈佛学院董事会 用于基于材料的细胞疗法的可注射的成孔水凝胶
US10045947B2 (en) 2011-04-28 2018-08-14 President And Fellows Of Harvard College Injectable preformed macroscopic 3-dimensional scaffolds for minimally invasive administration
EP2714073B1 (en) 2011-06-03 2021-03-10 President and Fellows of Harvard College In situ antigen-generating cancer vaccine
WO2012177624A2 (en) 2011-06-21 2012-12-27 The Johns Hopkins University Focused radiation for augmenting immune-based therapies against neoplasms
MX368257B (es) 2011-08-01 2019-09-26 Genentech Inc Antagonistas de unión al eje pd-1e inhibidores de mek y sus usos en el tratamiento de cáncer.
WO2013039954A1 (en) 2011-09-14 2013-03-21 Sanofi Anti-gitr antibodies
WO2013054320A1 (en) 2011-10-11 2013-04-18 Tel Hashomer Medical Research Infrastructure And Services Ltd. Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
SG11201401422VA (en) 2011-10-27 2014-09-26 Genmab As Production of heterodimeric proteins
KR101764096B1 (ko) 2011-11-28 2017-08-02 메르크 파텐트 게엠베하 항-pd-l1 항체 및 그의 용도
US9556271B2 (en) 2011-12-01 2017-01-31 The Brigham And Women's Hospital, Inc. Anti-CEACAM1 recombinant antibodies for cancer therapy
CN104411331B (zh) 2012-01-13 2018-08-21 哈佛学院董事会 在结构聚合装置中tlr激动剂的控制传递
UY34591A (es) 2012-01-26 2013-09-02 Novartis Ag Compuestos de imidazopirrolidinona
UY34632A (es) 2012-02-24 2013-05-31 Novartis Ag Compuestos de oxazolidin- 2- ona y usos de los mismos
CN106074368B (zh) 2012-03-29 2019-01-22 先进癌症治疗有限责任公司 Pfkfb3抑制剂和用作抗癌治疗剂的方法
DK2838515T3 (da) 2012-04-16 2020-02-24 Harvard College Mesoporøse siliciumdioxidsammensætninger til modulering af immunresponser
FI2838548T3 (fi) 2012-04-17 2023-10-02 Univ Washington Through Its Center For Commercialization HLA:n luokan II puutteelliset solut, HLA:n luokan II puutteelliset solut, jotka kykenevät ilmentämään HLA:n luokan II proteiineja, ja niiden käytöt
WO2013171642A1 (en) 2012-05-15 2013-11-21 Novartis Ag Benzamide derivatives for inhibiting the activity of abl1, abl2 and bcr-abl1
PE20161416A1 (es) 2012-05-15 2017-01-08 Novartis Ag Derivados de benzamida para la inhibicion de la actividad abl1, abl2 y bcr-abl1
CN104379574B (zh) 2012-05-15 2017-03-01 诺华股份有限公司 用于抑制abl1、abl2和bcr‑abl1的活性的苯甲酰胺衍生物
CA2870339C (en) 2012-05-15 2020-06-02 Novartis Ag Compounds and compositions for inhibiting the activity of abl1, abl2 and bcr-abl1
JO3300B1 (ar) 2012-06-06 2018-09-16 Novartis Ag مركبات وتركيبات لتعديل نشاط egfr
KR101566539B1 (ko) 2012-06-08 2015-11-05 국립암센터 신규한 Th2 세포 전환용 에피토프 및 이의 용도
UY34887A (es) 2012-07-02 2013-12-31 Bristol Myers Squibb Company Una Corporacion Del Estado De Delaware Optimización de anticuerpos que se fijan al gen de activación de linfocitos 3 (lag-3) y sus usos
CN112587671A (zh) 2012-07-18 2021-04-02 博笛生物科技有限公司 癌症的靶向免疫治疗
WO2014022332A1 (en) 2012-07-31 2014-02-06 The Brigham And Women's Hospital, Inc. Modulation of the immune response
US20150359853A1 (en) 2012-10-24 2015-12-17 Admune Therapeutics Llc Il-15r alpha forms, cells expressing il-15r alpha forms, and therapeutic uses of il-15r alpha and il-15/il-15r alpha complexes
JP2015536964A (ja) 2012-11-08 2015-12-24 ノバルティス アーゲー B−raf阻害剤とヒストン脱アセチル化酵素阻害剤を含む医薬組合せおよび増殖性疾患の治療におけるそれらの使用
EP2925365A1 (en) 2012-11-28 2015-10-07 Novartis AG Combination therapy
LT2953969T (lt) 2013-02-08 2019-12-10 Novartis Ag Anti-il-17a antikūnai ir jų panaudojimas autoimuninių ir uždegiminių ligų gydymui
US9498532B2 (en) 2013-03-13 2016-11-22 Novartis Ag Antibody drug conjugates
EP2968525A4 (en) 2013-03-14 2016-10-26 Icahn School Med Mount Sinai MORBUS NEWCASTLE VIRUSES AND USES THEREOF
US9242969B2 (en) 2013-03-14 2016-01-26 Novartis Ag Biaryl amide compounds as kinase inhibitors
JP6387360B2 (ja) 2013-03-14 2018-09-05 ノバルティス アーゲー 変異idhの阻害薬としての3−ピリミジン−4−イル−オキサゾリジン−2−オン
WO2014189806A1 (en) 2013-05-18 2014-11-27 Aduro Biotech, Inc. Compositions and methods for inhibiting "stimulator of interferon gene" dependent signalling
AR097306A1 (es) 2013-08-20 2016-03-02 Merck Sharp & Dohme Modulación de la inmunidad tumoral
WO2015036499A1 (en) 2013-09-11 2015-03-19 Medimmune Limited Anti-b7-h1 antibodies for treating tumors
WO2015048312A1 (en) * 2013-09-26 2015-04-02 Costim Pharmaceuticals Inc. Methods for treating hematologic cancers
AP2016009099A0 (en) 2013-11-01 2016-03-31 Novartis Ag Aminoheteroaryl benzamides as kinase inhibitors
US9512084B2 (en) 2013-11-29 2016-12-06 Novartis Ag Amino pyrimidine derivatives
GB201322583D0 (en) 2013-12-19 2014-02-05 Alligator Bioscience Ab Antibodies
HUE045065T2 (hu) 2014-01-31 2019-12-30 Novartis Ag TIM-3 antitest molekulák és felhasználásaik
KR102442436B1 (ko) 2014-03-14 2022-09-15 노파르티스 아게 Lag-3에 대한 항체 분자 및 그의 용도
EP4245376A3 (en) 2014-10-14 2023-12-13 Novartis AG Antibody molecules to pd-l1 and uses thereof

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013043647A1 (en) * 2011-09-19 2013-03-28 The Johns Hopkins University Cancer immunotherapy
WO2014022138A2 (en) * 2012-07-30 2014-02-06 Alex Wah Hin Yeung Live and in-vivo tumor specific cancer vaccine system developed by co-administration of either at least two or all three of the following components such as tumor cells, an oncolytic virus vector with transgenic expression of gm-csf and an immune checkpoint modulator
WO2014047350A1 (en) * 2012-09-20 2014-03-27 Morningside Technology Ventures Ltd. Oncolytic virus encoding pd-1 binding agents and uses of the same
WO2014189805A1 (en) * 2013-05-18 2014-11-27 Auro Biotech, Inc. Compositions and methods for activating "stimulator of interferon gene"-dependent signalling
WO2015112900A1 (en) * 2014-01-24 2015-07-30 Dana-Farber Cancer Institue, Inc. Antibody molecules to pd-1 and uses thereof

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
AMGEN: "A Phase 1b/3, Multicenter, Open-label Trial of Talimogene Laherparepvec in Combination With Pembrolizumab (MK-3475) for Treatment of Unresected,Stage IIIB to IVM1c Melanoma (MASTERKEY-265)", 22 June 2015 (2015-06-22), XP002762393, Retrieved from the Internet <URL:https://clinicaltrials.gov/archive/NCT02263508/2015_06_22> [retrieved on 20160928] *
B. ALLARD ET AL: "Targeting CD73 Enhances the Antitumor Activity of Anti-PD-1 and Anti-CTLA-4 mAbs", CLINICAL CANCER RESEARCH, vol. 19, no. 20, 15 October 2013 (2013-10-15), pages 5626 - 5635, XP055216360, ISSN: 1078-0432, DOI: 10.1158/1078-0432.CCR-13-0545 *
NATIONAL CANCER INSTITUTE (NCI): "Randomized Phase II/III Study of Nivolumab Plus Ipilimumab Plus Sargramostim Versus Nivolumab Plus Ipilimumab in Patients With Unresectable Stage III or Stage IV Melanoma", 9 April 2015 (2015-04-09), XP002762394, Retrieved from the Internet <URL:https://clinicaltrials.gov/archive/NCT02339571/2015_04_09> [retrieved on 20160928] *

Cited By (115)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10308913B2 (en) 2005-12-02 2019-06-04 Icahn School Of Medicine At Mount Sinai Chimeric viruses presenting non-native surface proteins and uses thereof
US12569431B2 (en) 2010-09-22 2026-03-10 Ena Respiratory Pty Ltd Immunostimulatory method
US10919962B2 (en) 2012-02-13 2021-02-16 Agency For Science, Technology And Research Method of reducing tumor growth with IL-1beta neutralizing human monoclonal antibodies
US11702471B2 (en) 2012-02-13 2023-07-18 Agency For Science, Technology And Research IL-1β neutralizing human monoclonal antibodies
US11780913B2 (en) 2012-02-13 2023-10-10 Agency For Science, Technology And Research IL-1β neutralizing human monoclonal antibodies
US11912761B2 (en) 2012-02-13 2024-02-27 Agency For Science, Technology And Research IL-1β neutralizing human monoclonal antibodies
US10251922B2 (en) 2013-03-14 2019-04-09 Icahn School Of Medicine At Mount Sinai Newcastle disease viruses and uses thereof
US11708412B2 (en) 2013-09-26 2023-07-25 Novartis Ag Methods for treating hematologic cancers
US10570204B2 (en) 2013-09-26 2020-02-25 The Medical College Of Wisconsin, Inc. Methods for treating hematologic cancers
US11827704B2 (en) 2014-01-24 2023-11-28 Novartis Ag Antibody molecules to PD-1 and uses thereof
US10752687B2 (en) 2014-01-24 2020-08-25 Novartis Ag Antibody molecules to PD-1 and uses thereof
US9815898B2 (en) 2014-01-24 2017-11-14 Novartis Ag Antibody molecules to PD-1 and uses thereof
US9884913B2 (en) 2014-01-31 2018-02-06 Novartis Ag Antibody molecules to TIM-3 and uses thereof
US11155620B2 (en) 2014-01-31 2021-10-26 Novartis Ag Method of detecting TIM-3 using antibody molecules to TIM-3
US10472419B2 (en) 2014-01-31 2019-11-12 Novartis Ag Antibody molecules to TIM-3 and uses thereof
US10981990B2 (en) 2014-01-31 2021-04-20 Novartis Ag Antibody molecules to TIM-3 and uses thereof
US10711060B2 (en) 2014-03-14 2020-07-14 Novartis Ag Antibody molecules to LAG-3 and uses thereof
US12252535B2 (en) 2014-03-14 2025-03-18 Novartis Ag Antibody molecules to LAG-3 and uses thereof
US9908936B2 (en) 2014-03-14 2018-03-06 Novartis Ag Antibody molecules to LAG-3 and uses thereof
US11344620B2 (en) 2014-09-13 2022-05-31 Novartis Ag Combination therapies
US9988452B2 (en) 2014-10-14 2018-06-05 Novartis Ag Antibody molecules to PD-L1 and uses thereof
US10851165B2 (en) 2014-10-14 2020-12-01 Novartis Ag Antibody molecules to PD-L1 and methods of treating cancer
US10513558B2 (en) 2015-07-13 2019-12-24 Cytomx Therapeutics, Inc. Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof
US12600777B2 (en) 2015-07-29 2026-04-14 Novartis Ag Combination therapies comprising antibody molecules to LAG-3
US11643465B2 (en) 2015-08-11 2023-05-09 WuXi Biologics Ireland Limited Anti-PD-1 antibodies
US11008391B2 (en) 2015-08-11 2021-05-18 WuXi Biologics Ireland Limited Anti-PD-1 antibodies
US20210121563A1 (en) * 2015-12-17 2021-04-29 Novartis Ag Combination of c-met inhibitor with antibody molecule to pd-1 and uses thereof
US10385131B2 (en) 2016-05-11 2019-08-20 Huya Bioscience International, Llc Combination therapies of HDAC inhibitors and PD-L1 inhibitors
US12122833B2 (en) 2016-05-11 2024-10-22 Huyabio International, Llc Combination therapies of HDAC inhibitors and PD-1 inhibitors
US10385130B2 (en) 2016-05-11 2019-08-20 Huya Bioscience International, Llc Combination therapies of HDAC inhibitors and PD-1 inhibitors
US10287353B2 (en) 2016-05-11 2019-05-14 Huya Bioscience International, Llc Combination therapies of HDAC inhibitors and PD-1 inhibitors
US11535670B2 (en) 2016-05-11 2022-12-27 Huyabio International, Llc Combination therapies of HDAC inhibitors and PD-L1 inhibitors
WO2017220988A1 (en) 2016-06-20 2017-12-28 Kymab Limited Multispecific antibodies for immuno-oncology
WO2017220990A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 antibodies
WO2017220989A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
US11110178B2 (en) 2016-07-07 2021-09-07 The Board Of Trustees Of The Leland Standford Junior University Antibody adjuvant conjugates
US10675358B2 (en) 2016-07-07 2020-06-09 The Board Of Trustees Of The Leland Stanford Junior University Antibody adjuvant conjugates
US11547761B1 (en) 2016-07-07 2023-01-10 The Board Of Trustees Of The Leland Stanford Junior University Antibody adjuvant conjugates
US11666594B2 (en) 2016-12-01 2023-06-06 Takeda Pharmaceutical Company Limited Antibody-drug conjugates comprising a cyclic dinucleotide
US12171777B2 (en) 2016-12-01 2024-12-24 Takeda Pharmaceutical Company Limited Methods of making a cyclic dinucleotide
US10980825B2 (en) 2016-12-01 2021-04-20 Takeda Pharmaceutical Company Limited Cyclic dinucleotide
WO2018115380A1 (en) 2016-12-22 2018-06-28 Boehringer Ingelheim International Gmbh Novel benzylamino substituted quinazolines and derivatives as sos1 inhibitors
US12214045B2 (en) * 2017-01-10 2025-02-04 Nektar Therapeutics Multi-arm polymer conjugates of TLR agonist compounds and related immunotherapeutic treatment methods
US11285143B2 (en) * 2017-03-08 2022-03-29 Johnpro Biotech Inc. Use of mTOR inhibitor and chloroquine for treating cancer
WO2018178250A1 (en) 2017-03-31 2018-10-04 Boehringer Ingelheim International Gmbh Anticancer combination therapy
WO2018185135A1 (en) 2017-04-05 2018-10-11 Boehringer Ingelheim International Gmbh Anticancer combination therapy
EP4368200A2 (en) 2017-04-05 2024-05-15 Boehringer Ingelheim International GmbH Anticancer combination therapy
JP2020517700A (ja) * 2017-04-28 2020-06-18 ノバルティス アーゲー Stingアゴニストを含む抗体コンジュゲート
US12042534B2 (en) 2017-05-12 2024-07-23 Icahn School Of Medicine At Mount Sinai Newcastle disease viruses and uses thereof
KR20200038889A (ko) * 2017-05-19 2020-04-14 수퍼브 위즈덤 리미티드 레시퀴모드의 유도체
JP2020520993A (ja) * 2017-05-19 2020-07-16 スパーブ ウィズダム リミテッド レシキモドの誘導体
US12077535B2 (en) 2017-05-19 2024-09-03 Superb Wisdom Limited Derivatives of resiquimod
JP7228574B2 (ja) 2017-05-19 2023-02-24 スパーブ ウィズダム リミテッド レシキモドの誘導体
KR102650538B1 (ko) * 2017-05-19 2024-03-21 수퍼브 위즈덤 리미티드 레시퀴모드의 유도체
WO2018220169A1 (en) 2017-06-02 2018-12-06 Boehringer Ingelheim International Gmbh Anti-cancer combination therapy
WO2018235056A1 (en) * 2017-06-22 2018-12-27 Novartis Ag IL-1BETA BINDING ANTIBODIES FOR USE IN THE TREATMENT OF CANCER
WO2018234879A1 (en) * 2017-06-22 2018-12-27 Novartis Ag USE OF IL-1β BINDING ANTIBODIES IN THE TREATMENT OF CANCER
CN110831967A (zh) * 2017-06-22 2020-02-21 诺华股份有限公司 用于治疗癌症的IL-1β结合抗体
TWI828626B (zh) * 2017-06-30 2024-01-11 日商小野藥品工業股份有限公司 併用包含溶血性鏈球菌之菌體的製劑的療法
WO2019027857A1 (en) * 2017-08-04 2019-02-07 Merck Sharp & Dohme Corp. COMBINATIONS OF PD-1 ANTAGONISTS AND STING BENZO [B] THIOPHENIC AGONISTS FOR THE TREATMENT OF CANCER
US11312772B2 (en) 2017-08-04 2022-04-26 Merck Sharp & Dohme Corp. Combinations of PD-1 antagonists and benzo [b] thiophene STING agonists for cancer treatment
US11285131B2 (en) 2017-08-04 2022-03-29 Merck Sharp & Dohme Corp. Benzo[b]thiophene STING agonists for cancer treatment
WO2019036031A3 (en) * 2017-08-17 2019-05-16 Nektar Therapeutics Immunotherapeutic tumor treatment method
AU2018316694B2 (en) * 2017-08-17 2025-07-10 Nektar Therapeutics Immunotherapeutic tumor treatment method
US12030940B2 (en) 2017-08-17 2024-07-09 Nektar Therapeutics Immunotherapeutic tumor treatment method
WO2019063802A1 (en) 2017-09-29 2019-04-04 Boehringer Ingelheim International Gmbh ANTICANCER ANTI-IGF POLY THERAPY, ANTI PD-1
US12054512B2 (en) 2017-11-10 2024-08-06 Takeda Pharmaceutical Company Limited Sting modulator compounds, and methods of making and using
US11542293B2 (en) 2017-11-10 2023-01-03 Takeda Pharmaceutical Company Limited Sting modulator compounds, and methods of making and using
US12195557B2 (en) 2017-12-21 2025-01-14 Axelia Oncology Pty Ltd Optimised compounds
EP3505188A1 (en) * 2017-12-29 2019-07-03 Invivogen Pro-cyclic dinucleotide conjugates for cytokine induction
US11730817B2 (en) 2017-12-29 2023-08-22 Invivogen Pro-cyclic dinucleotides and pro-cyclic dinucleotide conjugates for cytokine induction
WO2019129880A1 (en) * 2017-12-29 2019-07-04 Invivogen Pro-cyclic dinucleotides and pro-cyclic dinucleotide conjugates for cytokine induction
CN111727057A (zh) * 2018-02-16 2020-09-29 克雷森多生物制剂有限公司 与lag3和pd1结合的治疗分子
WO2019162323A1 (en) 2018-02-21 2019-08-29 Boehringer Ingelheim International Gmbh New benzimidazole compounds and derivatives as egfr inhibitors
JP2021518348A (ja) * 2018-03-20 2021-08-02 ノバルティス アーゲー 医薬併用
US20210363254A1 (en) * 2018-03-20 2021-11-25 Novartis Ag Pharmaceutical combinations
CN111868088A (zh) * 2018-03-20 2020-10-30 诺华股份有限公司 药物组合
WO2019180576A1 (en) * 2018-03-20 2019-09-26 Novartis Ag Pharmaceutical combinations
AU2019240200B2 (en) * 2018-03-20 2022-07-21 Novartis Ag Pharmaceutical combinations
JP2021523949A (ja) * 2018-05-17 2021-09-09 ナンジン リーズ バイオラブズ カンパニー リミテッド Pd−1に結合する抗体及びその使用
JP7535503B2 (ja) 2018-05-17 2024-08-16 ナンジン リーズ バイオラブズ カンパニー リミテッド Pd-1に結合する抗体及びその使用
US11312785B2 (en) 2018-05-19 2022-04-26 Boehringer Ingelheim International Gmbh Antagonizing CD73 antibody
WO2019224025A2 (en) 2018-05-19 2019-11-28 Boehringer Ingelheim International Gmbh Antagonizing cd73 antibody
EP3569618A1 (en) 2018-05-19 2019-11-20 Boehringer Ingelheim International GmbH Antagonizing cd73 antibody
CN112955464A (zh) * 2018-06-20 2021-06-11 因赛特公司 抗pd-1抗体及其用途
US12448448B2 (en) 2018-06-20 2025-10-21 Incyte Corporation Anti-PD-1 antibodies and uses thereof
US12391957B2 (en) 2018-08-17 2025-08-19 Icahn School Of Medicine At Mount Sinai Recombinant Newcastle disease viruses and uses thereof for the prevention of RSV disease or human metapneumovirus disease
WO2020080979A1 (en) * 2018-10-15 2020-04-23 Gero Discovery Limited Liability Company Pfkfb3 inhibitors and their uses
WO2020152306A1 (en) 2019-01-25 2020-07-30 Boehringer Ingelheim International Gmbh Recombinant rhabdovirus encoding for ccl21
US11400164B2 (en) 2019-03-15 2022-08-02 Bolt Biotherapeutics, Inc. Immunoconjugates targeting HER2
WO2020192709A1 (en) * 2019-03-27 2020-10-01 Wuxi Biologics (Shanghai) Co., Ltd. Novel bispecific polypeptide complexes
WO2020223121A1 (en) * 2019-04-30 2020-11-05 Dana-Farber Cancer Institute, Inc. Methods for treating cancer using combinations of anti-cx3cr1 and immune checkpoint blockade agents
WO2020260252A1 (en) 2019-06-24 2020-12-30 Boehringer Ingelheim International Gmbh New macrocyclic compounds and derivatives as egfr inhibitors
US12017979B2 (en) 2019-06-26 2024-06-25 Ena Respiratory Pty Ltd Molecules
WO2021042171A1 (en) * 2019-09-04 2021-03-11 Ena Therapeutics Pty Ltd Cancer immunotherapy
WO2021042174A1 (en) * 2019-09-04 2021-03-11 Ena Therapeutics Pty Ltd Cancer treatment
CN114364378A (zh) * 2019-09-04 2022-04-15 阿克塞利阿肿瘤学私人有限公司 癌症免疫疗法
CN110570907A (zh) * 2019-09-04 2019-12-13 北京橡鑫生物科技有限公司 建立检测微卫星不稳定的基线及模型的方法与应用
WO2021113500A3 (en) * 2019-12-03 2021-07-15 Board Of Regents, The University Of Texas System Combination therapies for the treatment of cancer
US20230048888A1 (en) * 2019-12-26 2023-02-16 Zhejiang Vimgreen Pharmaceuticals, Ltd. Use of triazolotriazine derivative in treatment of diseases
US12146000B2 (en) 2020-05-19 2024-11-19 Boehringer Ingelheim International Gmbh Bispecific and tetravalent CD137 and FAP molecules for the treatment of cancer
WO2021236658A1 (en) 2020-05-19 2021-11-25 Boehringer Ingelheim International Gmbh Binding molecules for the treatment of cancer
WO2021245111A1 (en) 2020-06-03 2021-12-09 Boehringer Ingelheim International Gmbh Recombinant rhabdovirus encoding for a cd80 extracellular domain fc-fusion protein
WO2022053703A1 (en) 2020-09-14 2022-03-17 Boehringer Ingelheim International Gmbh Heterologous prime boost vaccine
US12221460B2 (en) 2020-11-09 2025-02-11 Takeda Pharmaceutical Company Limited Antibody drug conjugates
US11725024B2 (en) 2020-11-09 2023-08-15 Takeda Pharmaceutical Company Limited Antibody drug conjugates
WO2022254227A1 (en) 2021-06-04 2022-12-08 Kymab Limited Treatment of pd-l1 negative or low expressing cancer with anti-icos antibodies
WO2023246247A1 (zh) * 2022-06-22 2023-12-28 中山康方生物医药有限公司 药物组合物及其用途
WO2024153768A1 (en) 2023-01-20 2024-07-25 Boehringer Ingelheim International Gmbh Il-12 fc fusion proteins
WO2024160721A1 (en) 2023-01-30 2024-08-08 Kymab Limited Antibodies
WO2025003694A1 (en) 2023-06-28 2025-01-02 Sevenless Therapeutics Limited New treatments for pain
WO2025062157A1 (en) 2023-09-21 2025-03-27 Sevenless Therapeutics Limited New treatments for pain
WO2025083426A1 (en) 2023-10-20 2025-04-24 Sevenless Therapeutics Limited New treatments for pain
WO2025132695A1 (en) 2023-12-19 2025-06-26 Boehringer Ingelheim International Gmbh Recombinant rhabdovirus encoding for a gasdermin
WO2025146548A1 (en) 2024-01-04 2025-07-10 Sevenless Therapeutics Limited Sos1 inhibitors useful to treat pain and cancer

Also Published As

Publication number Publication date
JP2021119167A (ja) 2021-08-12
EP4378957A3 (en) 2024-08-07
CN108025051A (zh) 2018-05-11
CN114272371A (zh) 2022-04-05
EP4378957A2 (en) 2024-06-05
EP3328418A1 (en) 2018-06-06
JP2018522027A (ja) 2018-08-09
CN108025051B (zh) 2021-12-24
JP6878405B2 (ja) 2021-05-26
US20230013364A1 (en) 2023-01-19
US20180222982A1 (en) 2018-08-09

Similar Documents

Publication Publication Date Title
US12600777B2 (en) Combination therapies comprising antibody molecules to LAG-3
US20240343808A1 (en) Antibody molecules to pg-l1 and methods of treating cancer and infectious diseases
US20230013364A1 (en) Combination therapies comprising antibody molecules to pd-1
JP7569166B2 (ja) Pd-1に対する抗体分子およびその使用
AU2020204366A1 (en) Antibody molecules to PD-1 and uses thereof
WO2017019897A1 (en) Combination therapies comprising antibody molecules to tim-3
RU2788092C2 (ru) Молекулы антител к pd-1 и их применения
HK40102321A (en) Antibody molecules to pd-l1 and uses thereof
CA3007671C (en) Antibody molecules to pd-1 and uses thereof
EA040861B1 (ru) Молекулы антител к pd-l1 и их применение
HK1234676B (en) Antibody molecules to pd-l1 and uses thereof
HK1234676A1 (en) Antibody molecules to pd-l1 and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16750330

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 15747873

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2018504697

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2016750330

Country of ref document: EP