Classifications

• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K38/00—Medicinal preparations containing peptides
  • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • A61K38/22—Hormones
  • A61K38/26—Glucagons
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K9/00—Medicinal preparations characterised by special physical form
  • A61K9/20—Pills, tablets, discs, rods
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K31/00—Medicinal preparations containing organic active ingredients
  • A61K31/185—Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
  • A61K31/19—Carboxylic acids, e.g. valproic acid
  • A61K31/195—Carboxylic acids, e.g. valproic acid having an amino group
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
  • A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
  • A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
  • A61K47/16—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
  • A61K47/18—Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K9/00—Medicinal preparations characterised by special physical form
  • A61K9/0012—Galenical forms characterised by the site of application
  • A61K9/0053—Mouth and digestive tract, i.e. intraoral and peroral administration
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K9/00—Medicinal preparations characterised by special physical form
  • A61K9/20—Pills, tablets, discs, rods
  • A61K9/2072—Pills, tablets, discs, rods characterised by shape, structure or size; Tablets with holes, special break lines or identification marks; Partially coated tablets; Disintegrating flat shaped forms
  • A61K9/2077—Tablets comprising drug-containing microparticles in a substantial amount of supporting matrix; Multiparticulate tablets
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
  • A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P15/00—Drugs for genital or sexual disorders; Contraceptives
  • A61P15/08—Drugs for genital or sexual disorders; Contraceptives for gonadal disorders or for enhancing fertility, e.g. inducers of ovulation or of spermatogenesis
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P25/00—Drugs for disorders of the nervous system
  • A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P3/00—Drugs for disorders of the metabolism
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P3/00—Drugs for disorders of the metabolism
  • A61P3/04—Anorexiants; Antiobesity agents
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P3/00—Drugs for disorders of the metabolism
  • A61P3/06—Antihyperlipidemics
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P3/00—Drugs for disorders of the metabolism
  • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
  • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P9/00—Drugs for disorders of the cardiovascular system
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K9/00—Medicinal preparations characterised by special physical form
  • A61K9/20—Pills, tablets, discs, rods
  • A61K9/2004—Excipients; Inactive ingredients
  • A61K9/2013—Organic compounds, e.g. phospholipids, fats

Definitions

• the present invention relates to solid compositions comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and their use in medicine.
• Human GLP-1 and analogues thereof have a low oral bioavailability. Exposure and bioavailability of human GLP-1 and analogues thereof is very low following oral administration. Human GLP-1 and analogues thereof can only be detected in plasma after oral administration if formulated with certain absorption enhancers in a specific amount. Steinert et al. (Am J Clin Nutr, Oct 2010; 92: 810 - 817) discloses oral administration of a tablet comprising GLP-l(7-36)amide and 150 mg sodium N-(8-(2- hydroxybenzoyl)amino)caprylate (SNAC). WO 2010/020978 dicloses an oral pharmaceutical composition comprising a protein and N-(8-[2-hydroxybenzoyl) amino)caprylate (SNAC).
• the invention relates to a solid composition for oral administration comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino) caprylic acid, wherein a) the amount of said salt of N-(8-(2-hydroxybenzoyl)amino) caprylic acid is at least 0.6 mmol or at least 0.8 mmol; and b) said GLP-1 agonist is GLP- 1 (7-37), GLP-1 (7-36)amide, exendin-4 or an analogue thereof, and wherein said GLP-1 agonist optionally comprises one substituent.
• the invention relates to the use of a composition as defined herein in medicine. DESCRIPTION OF THE INVENTION
• the present invention relates to solid compositions of a GLP-1 agonist and salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid.
• solid compositions comprising certain amounts of a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid, such as SNAC, are optimal for oral administration of GLP-1 agonists.
• the compositions provide improved exposure and/or bioavailability of the GLP-1 agonist.
• bioavailability refers to the fraction of an administered dose of an active pharmaceutical ingredient (API), such as a GLP-1 agonist as defined herein, which reaches the systemic circulation unchanged.
• API active pharmaceutical ingredient
• Absolute oral bioavailability is calculated as the relative exposure of the API in systemic circulation following oral administration (estimated as the area under the plas- ma concentration versus time curve, or AUC) compared to the exposure of the API following intravenous administration.
• GLP-1 agonist refers to a compound, which fully or partially activates the human GLP-1 receptor.
• the "GLP-1 agonist” binds to a GLP-1 receptor, e.g., with an affinity constant (K D ) or activate the receptor with a potency (EC 50 ) of below 1 ⁇ , e.g. below 100 nM as measured by methods known in the art (see e.g. WO 98/08871) and exhibits insulinotropic activity, where insulino- tropic activity may be measured in vivo or in vitro assays known to those of ordinary skill in the art.
• the GLP-1 agonist may be administered to an animal with increased blood glucose (e.g.
• IVGTT Intravenous Glucose Tolerance Test
• the GLP-1 agonist is a GLP-1 analogue, optionally comprising one substituent.
• analogue as used herein referring to a GLP-1 peptide (hereafter “peptide") means a peptide wherein at least one amino acid residue of the peptide has been substituted with another amino acid residue and/or wherein at least one amino acid residue has been deleted from the peptide and/or wherein at least one amino acid residue has been added to the peptide and/or wherein at least one amino acid residue of the peptide has been modified. Such addition or deletion of amino acid residues may take place at the N-terminal of the peptide and/or at the C-terminal of the peptide.
• GLP-1 agonist designates an analogue of GLP-l(7-37) wherein the natu- rally occurring Ala in position 8 has been substituted with Aib.
• the GLP-1 agonist comprises a maximum of twelve, such as a maximum of 10, 8 or 6, amino acids which have been alterered, e.g., by substitution, deletion, insertion and/or modification, compared to e.g. GLP-l(7-37).
• the analogue comprises up to 10 substitutions, deletions, additions and/or insertions, such as up to 9 substitutions, deletions, additions and/or insertions, up to 8 substitutions, deletions, additions and/or insertions, up to 7 substitutions, deletions, additions and/or insertions, up to 6 substitutions, deletions, additions and/or insertions, up to 5 substitutions, deletions, additions and/or insertions, up to 4 substitutions, deletions, additions and/or insertions or up to 3 substitutions, deletions, additions and/or insertions, compared to e.g. GLP-l(7-37). Unless otherwise stated the GLP-1 comprises only L-amino acids.
• GLP-1 analogue or “analogue of GLP-1” as used herein refers to a peptide, or a compound, which is a variant of the human Gluca- gon-Like Peptide-1 (GLP-l(7-37)).
• GLP-l(7-37) has the sequence HAEGTFTSDV
• variant refers to a compound which comprises one or more amino acid substitutions, deletions, additions and/or insertions.
• the GLP-1 agonist exhibits at least 60%, 65%, 70%, 80% or 90% sequence identity to GLP-l(7-37) over the entire length of GLP-l(7-37).
• sequence identity As an example of a method for determination of sequence identity between two analogues the two peptides [Aib8]GLP-l(7-37) and GLP-l(7-37) are aligned.
• the sequence identity of [Aib8]GLP-l(7-37) relative to GLP-l(7-37) is given by the number of aligned identical residues minus the number of different residues divided by the total number of residues in GLP-l(7-37). Accordingly, in said example the sequence identity is (31-1)/31.
• the C-terminal of the GLP-1 agonist is an amide.
• the GLP-1 agonist is GLP-l(7-37) or GLP-l(7-36)amide.
• the GLP-1 agonist is exendin-4, the sequence of which is HGEGT- FITSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID No: 2).
• the GLP-1 agonist comprises one substituent which is co- valently attached to the peptide.
• the substituent comprises a fatty acid or a fatty diacid.
• the substituent comprises a C16, C18 or C20 fatty acid.
• the substituent comprises a C16, C18 or C20 fatty diacid.
• the substituent comprises formula (X) (X), wherein n is at least 13, such as n is 13, 14, 15, 16, 17, 18 or 19.
• the substituent comprises formula (X), wherein n is in the range of 13 to 19, such as in the range of 13 to 17.
• the substituent comprises formula (X), wherein n is 13, 15 or 17.
• the substituent comprises formula (X), wherein n is 13. In some embodiments the substituent comprises formula (X), wherein n is 15. In some embodiments the substituent comprises formula (X), wherein n is 17. In some embodiments the substituent comprises one or more 8-amino-3,6-dioxaoctanoic acid (OEG), such as two OEG.
• OEG 8-amino-3,6-dioxaoctanoic acid
• the substituent is [2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4- (17-carboxyheptadecanoylamino) butyrylamino]ethoxy ⁇ ethoxy)acetylamino] eth- oxy ⁇ ethoxy)acetyl] .
• the substituent is [2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-)
• the GLP-1 agonist is semaglutide, also known as N- epsilon26-[2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-(17-carboxyheptadecanoylamino) bu- tyrylamino]ethoxy ⁇ ethoxy)acetylamino]ethoxy ⁇ ethoxy)acetyl] [Aib8,Arg34]GLP- 1(7-37), which may be prepared as described in WO2006/097537, Example 4.
• composition comprises the GLP-1 agonist or a pharmaceutically acceptable salt, amide, or ester thereof. In some embodiments the composition comprises the GLP-1 agonist one or more pharmaceutically acceptable counter ions.
• the dosage of GLP-1 is in the range of 0.01 mg to 100 mg.
• the composition comprises an amount of a GLP-1 agonist in the range of 0.1 to 40 mg or 1 to 20 mg.
• the composition comprises an amount of a GLP-1 agonist in the range of 5 to 20 mg, such as in the range of 5 to 15 mg, such as 5 mg, such as 10 mg, such as 15 mg, such as 20 mg.
• the composition comprises an amount of a GLP-1 agonist in the range of 0.05 to 25 ⁇ , such as in the range of 0.5 to 2.5 pmol.
• the GLP-1 agonist is selected from one or more of the GLP-1 agonists mentioned in W093/19175, W096/29342, WO98/08871, WO99/43707, WO99/43706, W099/43341, WO99/43708, WO2005/027978, WO2005/058954,
• the GLP-1 agonist is selected from the group consisting of N-epsilon37 ⁇ 2-[2-(2- ⁇ 2-[2-((R)-3-carboxy-3- ⁇ [l-(19-carboxynonadecanoyl) piperidine- 4-carbonyl]amino ⁇ propionylamino)ethoxy]ethoxy ⁇ acetylamino)ethoxy]ethoxy ⁇ acetyl [desaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-l(7-37)amide; N-epsilon26 ⁇ 2-[2-(2- ⁇ 2- [2-((R)-3-carboxy-3- ⁇ [l-(19-carboxynonadecanoyl) piperidine-4-carbonyl]amino ⁇ propionylamino)ethoxy]ethoxy ⁇ acetylamino)ethoxy] ethoxy ⁇ acetyl [desaminoHis7, Arg34
• Delivery agent salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid
• the delivery agent used in the present invention is a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid.
• the structural formula of N-(8-(2- hydroxybenzoyl)amino)caprylate is shown in formula (I),
• the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid comprises one monovalent cation, two monovalent cations or one divalent cation.
• the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is selected from the group consisting of the sodium salt, potassium salt and calcium salt of of N-(8- (2-hydroxybenzoyl)amino)caprylic acid. Salts of N-(8-(2-hydroxybenzoyl)amino)caprylate may be prepared using the method described in e.g. WO96/030036, WO00/046182, WO01/092206 or
• the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid may be crystalline and/or amorphous.
• the delivery agent comprises the anhydrate, monohydrate, dihydrate, trihydrate, a solvate or one third of a hydrate of the salt of N- (8-(2-hydroxybenzoyl)amino) caprylic acid as well as combinations thereof.
• the delivery agent is a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid as described in WO2007/121318.
• the delivery agent is sodium N-(8-(2- hydroxybenzoyl)amino)caprylate (referred to as "SNAC" herein), also known as sodium 8-(salicyloylamino) octanoate.
• SNAC sodium N-(8-(2- hydroxybenzoyl)amino)caprylate
• the amount of the salt of N-(8-(2-hydroxybenzoyl) ami- no)caprylic acid in the composition is at least 0.6 mmol, such as selected from the group consisting of at least 0.65 mmol, at least 0.7 mmol, at least 0.75 mmol, at least 0.8 mmol, at least 0.8 mmol, at least 0.9 mmol, at least 0.95 mmol and at least 1 mmol. In some embodiments the amount of the salt of N-(8-(2-hydroxybenzoyl) amino)caprylic acid in the composition is in the range of 0.6-2.1 mmol or 0.6-1.9 mmol.
• the amount of the salt of N-(8-(2-hydroxybenzoyl) amino)caprylic acid in the composition is in the range of 0.7-1.7 mmol or 0.8-1.3 mmol. In some embodiments the amount of the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid in the composition is up to 2.1 mmol, such as selected from the group consisting of up to 2.1 mmol, up to 2 mmol, up to 1.9 mmol, up to 1.8 mmol, up to 1.7 mmol, up to 1.6 mmol, up to 1.5 mmol, up to 1.4 mmol, up to 1.3 mmol, up to 1.2 mmol and up to 1.1 mmol. In some embodiments the amount of the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is 1 mmol, such as 1.08 mmol.
• the amount of SNAC in the composition is at least 175 mg, such as an amount selected from the group consisting of at least 200 mg, at least 210 mg, at least 220 mg, at least 230 mg, at least 240 mg, at least 250 mg, at least 260 mg, at least 270 mg and at least 280 mg. In some embodiments the amount of SNAC in the composition is in the range of 175-575 mg, such as 200-500 mg or 250-400 mg.
• the amount of SNAC in the composition is up to 575 mg, such as an amount selected from the group consisting of up to 550 mg, up to 525 mg, up to 500 mg, up to 475 mg, up to 450 mg, up to 425 mg, up to 400 mg, up to 375 mg, up to 350 mg and up to 325 mg. In some embodiments the amount of SNAC in the composition is 300 mg. In some embodiments the molar ratio between GLP-1 agonist and delivery agent in the composition is less than 10, such as less than 5 or less than 1.
• composition of the present invention is a solid composition and is administered by the oral route.
• the composition comprises at least one pharmaceutically acceptable excipient.
• excipient as used herein broadly refers to any component other than the active therapeutic ingredient(s).
• the excipient may be an inert sub- stance, an inactive substance, and/or a not medicinally active substance.
• the excipient may serve various purposes, e.g. as a carrier, vehicle, filler, binder, lubricant, glidant, disintegrant, flow control agents, crystallization retarders, solubilizers, stabilizer, colouring agent, flavouring agent, surfactant, emulsifier and/or to improve administration, and/or absorption of the active substance.
• a person skilled in the art may select one or more of the aforementioned excipients with respect to the particular desired properties of the solid oral dosage form by routine experimentation and without any undue burden.
• the amount of each excipient used may vary within ranges conventional in the art. Techniques and excipients which may be used to formulate oral dosage forms are described in Handbook of Pharmaceutical Excipients, 6th edition, Rowe et al., Eds., American Pharma- ceuticals Association and the Pharmaceutical Press, publications department of the Royal Pharmaceutical Society of Great Britain (2009); and Remington : the Science and Practice of Pharmacy, 21th edition, Gennaro, Ed., Lippincott Williams & Wilkins (2005).
• the excipients may be selected from binders, such as polyvinyl pyrrolidone (povidone), etc. ; fillers such as cellulose powder, microcrystalline cellulose, cellulose de- rivatives like hydroxymethylcellulose, hydroxyethylcellulose, hydroxypropylcellulose and hydroxy-propylmethylcellulose, dibasic calcium phosphate, corn starch, pregelatinized starch, etc. ; lubricants and/or glidants such as stearic acid, magnesium stearate, sodium stearylfumarate, glycerol tribehenate, etc. ; flow control agents such as colloidal silica, talc, etc.
• binders such as polyvinyl pyrrolidone (povidone), etc.
• fillers such as cellulose powder, microcrystalline cellulose, cellulose de- rivatives like hydroxymethylcellulose, hydroxyethylcellulose, hydroxypropylcellulose and hydroxy-propylmethylcellulose, dibas
• the composition comprises at least 60% (w/w) delivery agent, less than 10% (w/w) binder, 5-40% (w/w) filler, and less than 10% (w/w) lubricant or glidant.
• the composition comprises at least 60% (w/w), such as at least 70% (w/w) or at least 75% (w/w), delivery agent.
• the composition comprises 0.1-10% (w/w), such as 0.2- 4% (w/w) or 0.5-3% (w/w), of binder. In some embodiments the composition comprises 1% (w/w) or 2% (w/w) of binder.
• the composition may comprise a binder, such as povidone; starches; celluloses and derivatives thereof, such as microcrystalline cellulose, e.g., AVICEL PH from FMC (Philadelphia, PA), hydroxypropyl cellulose hydroxylethyl cellulose and hydroxylpropylmethyl cellulose METHOCEL from Dow Chemical Corp. (Midland, MI); sucrose; dextrose; corn syrup; polysaccharides; and gelatin.
• a binder such as povidone; starches; celluloses and derivatives thereof, such as microcrystalline cellulose, e.g., AVICEL PH from FMC (Philadelphia, PA), hydroxypropyl cellulose hydroxylethyl cellulose
• the binder may be selected from the group consisting of dry binders and/or wet granulation binders.
• Suitable dry binders are, e.g., cellulose powder and microcrystalline cellulose, such as Avicel PH 102 and Avicel PH 200.
• the composition comprises avicel, such as avicel PH 102.
• Suitable binders for wet granulation or dry granulation are corn starch, polyvinyl pyrrolidone (povidon), vinylpyrrolidone-vinylacetate copolymer (copovidone) and cellulose derivatives like hydroxymethylcellulose, hydroxyethylcellulose, hydroxypro- pylcellulose and hydroxyl-propylmethylcellulose.
• the composition comprises povidone.
• the composition comprises 5-40% (w/w), such as 10-30% (w/w) or 5-25% (w/w), of filler. In some embodiments the composition comprises 10.9% (w/w) or 18%(w/w) of filler, or comprises 19.5% (w/w) or 20.5 (w/w) of filler.
• the filler may be selected from lactose, mannitol, erythritol, sucrose, sorbitol, calcium phosphate, such as calciumhydrogen phosphate, microcrystalline cellulose, powdered cellulose, confectioner's sugar, compressible sugar, dextrates, dextrin and dextrose. In some embodiments the composition comprises microcrystalline cellulose, such as Avicel PH 102 or Avicel PH 200.
• the composition comprises 0.1-10% (w/w) or 0.5-5% (w/w), such as 1-3.5% (w/w) or 1% (w/w), of lubricant and/or a glidant.
• the composition comprises a lubricant and/or a glidant, such as talc, magnesium stearate, calcium stearate, zinc stearate, glyceryl behenate, polyethylene oxide polymers, sodium lauryl sulfate, magnesium lauryl sulfate, sodium oleate, sodium stearyl fumarate, stearic acid, hydrogenated vegetable oils, silicon dioxide and/or polyethylene glycol.
• the composition comprises magnesium stearate.
• the composition comprises a disintegrant, such as sodium starch glycolate, polacrilin potassium, sodium starch glycolate, crospovidon, croscarmel- lose, sodium carboxymethylcellulose or dried corn starch.
• the composition may comprise one or more surfactants, for example a surfac- tant, at least one surfactant, or two different surfactants.
• surfactant refers to any molecules or ions that are comprised of a water-soluble (hydrophilic) part, and a fat- soluble (lipophilic) part.
• the surfactant may e.g. be selected from the group consisting of anionic surfactants, cationic surfactants, nonionic surfactants, and/or zwitterionic surfactants.
• composition may be formulated as is known in the art of oral formulations of insulinotropic compounds, e.g. using any one or more of the formulations described in WO 2008/145728.
• a composition may also be used in the formulation of site specific, controlled, sustained, protracted, prolonged, delayed, pulsatile, retarded, and/or slow release drug delivery systems.
• composition of the invention may be prepared as is known in the art.
• the composition may be administered in several dosage forms, for example as a tablet; a coated tablet; a chewing gum; a capsule such as hard or soft gelatine capsules or a powder.
• the composition may further be compounded in a drug carrier or drug de- livery system, e.g. in order to improve stability and/or solubility or further improve bioavailability.
• the composition may be a freeze-dried or spray-dried composition.
• the composition may be in the form of a tablet.
• the weight of the tablet is in the range of 175 mg to 1000 mg, such as in the range of 175- 250 mg, 300-500 mg or 500-900 mg, or such as about 200 mg, about 400 mg or about 700 mg.
• the weight of the tablet is in the range of 200 mg to 1000 mg, such as in the range of 500-700 mg or 600-1000 mg, or such as about 200 mg, about 400 mg, about 600 mg or about 800 mg.
• the composition may be granulated prior to being compacted.
• the composition may comprise an intragranular part and an extragranular part, wherein the intragranular part has been granulated and the extragranular part has been added after granulation.
• the intragranular part may comprise the GLP-1 agonist, the delivery agent and a binder.
• the intragranular part comprises povidone.
• the extragranular part may comprise a filler, a lubricant and/or a glidant.
• the extragranular part comprises microcrystalline cellulose, such as avicel, e.g. avicel PH 120 or avicel PH200.
• the extragranular part comprises magnesium stearate.
• granules are to be used in the tabletting material, granules may be produced in a manner known to a person skilled in the art, for example using wet granulation methods known for the production of "built-up" granules or "broken-down" granules.
• Methods for the formation of built-up granules may operate continuously and comprise, for example simultaneously spraying the granulation mass with granulation solution and drying, for example in a drum granulator, in pan granulators, on disc granulators, in a fluidized bed, by spray-drying or spray-solidifying, or operate discontinuously, for example in a fluidized bed, in a rotary fluid bed, in a batch mixer, such as a high shear mixer or a low shear mixer, or in a spray-drying drum.
• Methods for the production of broken- down granules which may be carried out discontinuously and in which the granulation mass first forms a wet aggregate with the granulation solution, which is subsequently comminuted or by other means formed into granules of the desired size and the granules may then be dried.
• Suitable equipment for the granulation step are planetary mixers, low shear mixers, high shear mixers, extruders and spheronizers, such as an apparatus from the companies Loedige, Glatt, Diosna, Fielder, Collette, Aeschbach, Alexanderwerk, Ytron, Wyss & Probst, Werner & Pfleiderer, HKD, Loser, Fuji, Nica, Caleva and Gabler.
• Granules may be also formed by dry granulation techniques in which the pharmaceutically active agent is compressed with the excipients to form relatively large moldings, for example slugs or ribbons, which are comminuted by grinding, and the ground material serves as the tabletting material to be later compacted.
• Suitable equipment for dry granulation is roller compaction equipment from Gerteis, such as Gerteis MINI-PACTOR.
• a tablet press may be used to compact the tabletting material into a solid oral dosage form, for example a tablet.
• a tabletting press the tabletting material is filled (e.g. force fed or gravity fed) into a die cavity.
• the tabletting material is then compacted by a punch with pressure.
• the resulting compact, or tablet is ejected from the tabletting press.
• compaction process is subsequently referred to herein as the "compaction process”.
• Suitable tablet presses include, but are not limited to, rotary tablet presses and eccentric tablet presses.
• tablet presses include, but are not limited to, the Fette 102i (Fette GmbH), the Korsch XL100, the Korsch PH 106 rotary tablet press (Korsch AG, Germany), the Korsch EK-0 eccentric tabletting press (Korsch AG, Germany) and the Manesty F-Press (Manesty Machines Ltd., United Kingdom).
• the method of preparation of the tablet comprises a) wet granulation of a mixture comprising the GLP-1 agonist, the delivery agent and a binder; b) optionally drying the wet granulate; c) blending of the dried wet granulates with at least a filler and at least a lubricant or a glidant, and then d) compression of the blend into tablets.
• the granulation may be a wet granulation or a dry granulation.
• Disintegration time In some embodiments the disintegration time of the tablet is in the range of 7 minutes to 15 minutes, such as in the range of 8 minutes to 13 minutes. Disintegration time may be determined using a Pharma Test PTZ AUTO disintegration test apparatus.
• the disintegration apparatus consists of a basket rack holding 2 x 6 plastic tubes, open at the top and bottom, the bottom of the tube is covered by a screen. Tablets are placed in the tubes and on top of the tablets are placed discs for automated disintegration detection.
• the basket is immersed in 800 ml purified water maintained at 37°C, in a 1L beaker. Time for complete disintegration is measured. Furthermore, tablets may be observed visually for surface eroding behaviour during the disintegration test.
• the tablet of the invention co-releases the active ingredients and the delivery agent by surface erosion; hence, the tablets becomes smaller and smaller with time by dissolution primarily from the surface from non-disintegrated tablets.
• Concurrent release In some embodiments the compositions show concurrent release of the GLP-1 agonist and the delivery agent from the surface of the tablet. This can be tested by visual inspection during the disintegration test; the tablets do not have concurrent release of the GLP-1 agonist and the delivery agent from the surface of the tablet if the tablet breaks into smaller parts during the first 8 minutes of the disintegration test.
• Dissolution test Another test for concurrent release of the GLP-1 agonist and the delivery agent is the dissolution test. Here, the rate of appearance (in percentage) of the GLP-1 agonist and the delivery agent is measured.
• the dissolution test may be carried out as described in the following : Dissolution is performed on a Varian 705 DS. The analysis is based on the pharmacopeia method Ph Eur 2.9.3, Apparatus 2 (Paddle apparatus). 100 ml mini vessel with mini-paddles is used, and paddle speed is 75 rpm. After 120 minutes, the paddle speed is changed to 250 rpm.
• the dissolution medium used for the dissolution test is 100 ml of 200 mM KH2P04 (containing 0.07% Tween 80 to avoid the GLP-1 agonist from sticking to the wall of the bath and to the paddle), with pH 6.8. Samples are taken after 5, 15, 30, 45, 60, 120 and 135 minutes. The volume of the sample is 2 ml, and the sample is taken with a disposable syringe. After each sample is taken, the same volume (2 ml) of the dissolution medium is added to the bath, in order to keep the total volume of 100 ml constant. The sample is pressed through a 0.22 pm Millex®-GV filter. Finally, the samples are analysed for concentration of the GLP-1 agonist and for concentration of the delivery agent by UPLC.
• Hardness test The hardness of the tablets is measured with a Pharma Test (33AA02), which measures the force required to disrupt the tablet, and the test is based on the pharmacopeia method Ph Eur 2.9.8.
• the treatment with a composition according to the present invention may also be combined with one or more additional pharmacologically active substances, e.g. selected from antidiabetic agents, antiobesity agents, appetite regulating agents, antihypertensive agents, agents for the treatment and/or prevention of complications resulting from or associated with diabetes and agents for the treatment and/or prevention of complications and disorders resulting from or associated with obesity.
• additional pharmacologically active substances e.g. selected from antidiabetic agents, antiobesity agents, appetite regulating agents, antihypertensive agents, agents for the treatment and/or prevention of complications resulting from or associated with diabetes and agents for the treatment and/or prevention of complications and disorders resulting from or associated with obesity.
• Examples of these pharmacologically active substances are: Insulin, sulphonylureas, biguanides, meglitinides, glucosidase inhibitors, glucagon antagonists, DPP-IV (dipeptidyl peptidase-IV) inhibitors, inhibitors of hepatic enzymes involved in stimulation of gluconeogenesis and/or glycogenolysis, glu- cose uptake modulators, compounds modifying the lipid metabolism such as antihyperlip- idemic agents as HMG CoA inhibitors (statins), Gastric Inhibitory Polypeptides (GIP analogs), compounds lowering food intake, RXR agonists and agents acting on the ATP- dependent potassium channel of the ⁇ -cells; Cholestyramine, colestipol, clofibrate, gemfibrozil, lovastatin, pravastatin, simvastatin, probucol, dextrothyroxine, neteglinide, re- paglini
• compositions of the invention are described in the section headed "particular embodiments" before the experimental section.
• the present invention also relates to a composition of the invention for use as a medicament.
• the composition of the invention may be used for the following medical treatments, all preferably relating one way or the other to diabetes:
• diabetes prevention and/or treatment of all forms of diabetes, such as hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes, non-insulin dependent diabetes, MODY (maturity onset diabetes of the young), gestational diabetes, and/or for re-duction of HbAlC;
• diabetes such as hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes, non-insulin dependent diabetes, MODY (maturity onset diabetes of the young), gestational diabetes, and/or for re- duction of HbAlC;
• diabetes delaying or preventing diabetic disease progression, such as progression in type 2 diabetes, delaying the progression of impaired glucose tolerance (IGT) to insulin requiring type 2 diabetes, and/or delaying the progression of non-insulin requiring type 2 diabetes to insulin requiring type 2 diabetes;
• ITT impaired glucose tolerance
• eating disorders such as obesity, e.g. by decreasing food intake, reducing body weight, suppressing appetite, inducing satiety; treat- ing or preventing binge eating disorder, bulimia nervosa, and/or obesity induced by administration of an antipsychotic or a steroid; reduction of gastric motility; and/or delaying gastric emptying;
• diabetes prevention and/or treatment of diabetic complications, such as neuropathy, including peripheral neuropathy; nephropathy; or retinopathy;
• lipid parameters such as prevention and/or treatment of dyslipi- demia, lowering total serum lipids; lowering HDL; lowering small, dense LDL; lowering VLDL: lowering triglycerides; lowering cholesterol; increasing HDL; lowering plasma levels of lipoprotein a (Lp(a)) in a human; inhibiting generation of apolipoprotein a (apo(a)) in vitro and/or in vivo;
• Atherosclerosis myocardial infarction; coronary heart disease; stroke, cerebral ische- mia; an early cardiac or early cardiovascular disease, such as left ventricular hypertrophy; coronary artery disease; essential hypertension; acute hypertensive emergency; cardiomyopathy; heart insufficiency; exercise tolerance; chronic heart failure; arrhythmia; cardiac dysrhythmia; syncopy; atheroschlerosis; mild chronic heart failure; angina pectoris; cardiac bypass reocclusion; intermittent claudication (atheroschlerosis oblitter- ens); diastolic dysfunction; and/or systolic dysfunction;
• x prevention and/or treatment of critical illness, such as treatment of a critically ill patient, a critical illness poly-nephropathy (CIPNP) patient, and/or a potential CIPNP patient; prevention of critical illness or development of CIPNP; prevention, treatment and/or cure of systemic inflammatory response syndrome (SIRS) in a patient; and/or for the prevention or reduction of the likelihood of a patient suffering from bacte- raemia, septicaemia, and/or septic shock during hospitalisation; and/or
• CIPNP critical illness poly-nephropathy
• SIRS systemic inflammatory response syndrome
• the indication is selected from the group consisting of (i)-(iii) and (v)-(iix), such as indications (i), (ii), and/or (iii); or indication (v), indication (vi), indication (vii), and/or indication (iix).
• the indication is (i).
• the indication is (v).
• the indication is (iix).
• the indications are type 2 diabetes and/or obesity.
• a solid composition for oral administration comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid, wherein the amount of said salt of N- (8-(2-hydroxybenzoyl)amino)caprylic acid is at least 0.6 mmol.
• a solid composition for oral administration comprising a GLP-1 agonist and a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid, wherein the amount of said salt of N- (8-(2-hydroxybenzoyl)amino)caprylic acid is at least 0.8 mmol.
• compositions according to any one of the preceding embodiments wherein said composition is in the form of a tablet.
• composition according to any one of the preceding embodiments wherein the tablet has a weight in the range of 175-1000 mg. 5. A composition according to any one of the preceding embodiments, wherein the tablet has a weight in the range of 200-800 mg.
• composition according to any one of the preceding embodiments, wherein said salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid comprises one monovalent cation, two monovalent cations or one divalent cation.
• composition according to any one of the preceding embodiments, wherein said salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is selected from the group consisting of the sodium salt, potassium salt and calcium salt of of N-(8-(2- hydroxybenzoyl)amino)caprylic acid.
• composition according to any one of the preceding embodiments, wherein said salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is sodium N-(8-(2- hydroxybenzoyl)amino)caprylate (SNAC).
• amount of said salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is in the range of 0.6-2.1 mmol, such as 0.6-1.9 mmol, 0.7-1.7 mmol or 0.8-1.3 mmol.
• amount of said salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is at least 0.6 mmol, such as selected from the group consisting of at least 0.65 mmol, at least 0.7 mmol, at least 0.75 mmol, at least 0.8 mmol, at least 0.8 mmol, at least 0.9 mmol, at least 0.95 mmol and at least 1 mmol.
• amount of said salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is up to 2.1 mmol, such as selected from the group consisting of up to 2.1 mmol, up to 2 mmol, up to 1.9 mmol, up to 1.8 mmol, up to 1.7 mmol, up to 1.6 mmol, up to 1.5 mmol, up to 1.4 mmol, up to 1.3 mmol, up to 1.2 mmol and up to 1.1 mmol. 14.
• compositions according to any one of the preceding embodiments, wherein said composition comprises at least 60% (w/w), such as at least 70% (w/w) or at least
• amount of the GLP-1 agonist is in the range of 0.01 mg to 100 mg.
• n is at least 13, such as n is 13, 14, 15, 16, 17, 18 or 19. 25.
• said substituent comprises one or more 8-amino-3,6-dioxaoctanoic acid (OEG), such as two OEG.
• OEG 8-amino-3,6-dioxaoctanoic acid
• GLP-1 agonist optionally comprises one substituent.
• amount of the GLP-1 agonist is in the range of 1 to 20 mg, such as in the range of 5 to 20 mg, such as in the range of 5 to 15 mg, such as 10 mg.
• GLP-1 is in the range of 0.05 to 25 ⁇ , such as in the range of 0.5 to
• composition according to any one of the preceding embodiments wherein said composition comprises at least one additional pharmaceutically acceptable excipient.
• said excipient is selected from one or more from the group consisting of binders, fillers, dis- integrants and lubricants and/or glidants.
• said composition comprises 0.1-10% (w/w), such as 0.2-4% (w/w) or 0.5-3% (w/w), of binder.
• composition according to any one of the preceding embodiments, wherein said composition comprises 1% (w/w) or 2% (w/w) of binder.
• composition according to any one of the preceding embodiments wherein said composition comprises 5-40% (w/w), such as 10-30% (w/w) or 5-25% (w/w), of fill er.
• composition according to any one of the preceding embodiments, wherein said composition comprises 10.9% (w/w) or 18%(w/w) of filler, or comprises 19.5% (w/w) or 20.5 (w/w) of filler.
• composition according to any one of the preceding embodiments wherein said composition comprises 0.1-10% (w/w) or 0.5-5% (w/w) lubricant and/or a glidant.
• composition according to any one of the preceding embodiments wherein said composition comprises 1-3.5% (w/w) or 1% (w/w) lubricant and/or a glidant.
• composition according to any one of the preceding embodiments, wherein said composition comprises at least 60% (w/w) delivery agent, less than 10% (w/w) binder, 5-40% (w/w) filler, and less than 10% (w/w) lubricant and/or glidant.
• composition according to any one of the preceding embodiments, wherein the composition is administered orally.
• composition according to any one of the preceding embodiments wherein said tab let has co-release of the GLP-1 agonist and the delivery agent as determined by the concurrent release test described herein.
• said tablet has a disintegration time in the range of 7-15 minutes as determined by the disintegration test described herein.
• composition according to any one of the preceding embodiments, wherein said tab- let has a hardness of at least 50 N as determined by the hardness test described herein.
• composition as defined in any one of the preceding embodiments in medi- cine.
• compositions as defined in any one of the preceding embodiments for treatment of type 2 diabetes or obesity.
• a method for the treatment of type 2 diabetes or obesity comprising administering a composition as defined in any one of the preceding embodiments.
• the objective of the present study was to evaluate the oral bioavailability in beagle dogs of a series of compositions comprising semaglutide and SNAC.
• Plasma samples were collected into test tubes containing EDTA for stabilisation and kept on ice until centnfugation. Plasma was separated from whole blood by centrifu- gation and the plasma was stored at -20°C or lower until analysis. Analysis of Plasma Samples
• the plasma was analyzed for semaglutide using a Luminescence Oxygen Channeling Immunoassay (LOCI).
• LOCI Luminescence Oxygen Channeling Immunoassay
• the LOCI assay employs donor beads coated with strepta- vidin and acceptor beads conjugated with a monoclonal antibody binding to a mid- molecular region of semaglutide.
• the three reactants were combined with the semaglutide which form a two-sited immuno-complex. Illumination of the complex releases singlet oxygen atoms from the donor beads which channels into the acceptor beads and trigger chemiluminescence which was measured in the EnVision plate reader.
• the amount of light was proportional to the concentration of semaglutide and the lower limit of quantification (LLOQ) in plasma was 100 pM.
• the amount of semaglutide and SNAC in the composition were assayed using a reversed-phase HPLC method, with UV detection at 230 nm, a linear gradient of mobile phases made up of deionised H20:trifluoroacetic acid (TFA) (1000: 1) (v/v) (A), and ace- tonitrile:TFA (1000 : 1) (v/v) (B).
• TFA deionised H20:trifluoroacetic acid
• B ace- tonitrile:TFA
• Semaglutide plasma concentration data were subjected to non-compartmental pharmacokinetic analysis using the PC based software WinNonlin, v. 5.2 (Pharsight,
• compositions Tablets with different amounts of SNAC (150, 300 and 600 mg) and semaglutide (5, 10, 15 and 20 mg) were prepared.
• the composition of the tablets is shown in Table 1.
• Semaglutide was prepared according to the method described in
• SNAC was prepared according to the method described in WO2008/028859. The compositions were prepared using the following manufacturing process:
• povidone was dissolved in water and the resulting solution was used to granulate the blend of semaglutide and SNAC;
• the tablet hardness of was more than 50 N as determined by the Pharma Test
• Table 2 summarises the pharmacokinetic parameters for semaglutide from single dosing of the tablets shown in Table 1.
• Table 7 Summary of pharmacokinetic parameters for semaglutide from single dosing of composition comprising 300 mg SNAC in combination with 5, 10, 15 or 20 mg semaglu- tide.
• tablets comprising 300 mg SNAC showed improved bioavailability the current study compared to tablets comprising 150 mg or 600 mg SNAC.

Landscapes

• Health & Medical Sciences (AREA)
• Life Sciences & Earth Sciences (AREA)
• Chemical & Material Sciences (AREA)
• Public Health (AREA)
• Animal Behavior & Ethology (AREA)
• Veterinary Medicine (AREA)
• General Health & Medical Sciences (AREA)
• Medicinal Chemistry (AREA)
• Pharmacology & Pharmacy (AREA)
• Engineering & Computer Science (AREA)
• Bioinformatics & Cheminformatics (AREA)
• Epidemiology (AREA)
• Chemical Kinetics & Catalysis (AREA)
• General Chemical & Material Sciences (AREA)
• Organic Chemistry (AREA)
• Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
• Endocrinology (AREA)
• Diabetes (AREA)
• Proteomics, Peptides & Aminoacids (AREA)
• Zoology (AREA)
• Immunology (AREA)
• Gastroenterology & Hepatology (AREA)
• Obesity (AREA)
• Hematology (AREA)
• Molecular Biology (AREA)
• Biophysics (AREA)
• Reproductive Health (AREA)
• Neurosurgery (AREA)
• Neurology (AREA)
• Biomedical Technology (AREA)
• Oil, Petroleum & Natural Gas (AREA)
• Physiology (AREA)
• Nutrition Science (AREA)
• Child & Adolescent Psychology (AREA)
• Cardiology (AREA)
• Heart & Thoracic Surgery (AREA)
• Hospice & Palliative Care (AREA)
• Emergency Medicine (AREA)
• Gynecology & Obstetrics (AREA)
• Pregnancy & Childbirth (AREA)

Priority Applications (29)

Applications Claiming Priority (4)

Related Child Applications (2)

Publications (1)

Family

ID=43903993

Family Applications (1)

Country Status (21)

Cited By (63)

Families Citing this family (19)

Citations (27)

Family Cites Families (165)

• 2011
  • 2011-12-16 PL PL17204363T patent/PL3326620T3/pl unknown
  • 2011-12-16 EP EP11805824.7A patent/EP2651398B1/en active Active
  • 2011-12-16 WO PCT/EP2011/073060 patent/WO2012080471A1/en not_active Ceased
  • 2011-12-16 CA CA2821886A patent/CA2821886A1/en not_active Withdrawn
  • 2011-12-16 MX MX2013006171A patent/MX345501B/es active IP Right Grant
  • 2011-12-16 HU HUE11805824A patent/HUE036066T2/hu unknown
  • 2011-12-16 PL PL11805824T patent/PL2651398T3/pl unknown
  • 2011-12-16 SI SI201131885T patent/SI3326620T1/sl unknown
  • 2011-12-16 DK DK17204363.0T patent/DK3326620T3/da active
  • 2011-12-16 MX MX2017001485A patent/MX377589B/es unknown
  • 2011-12-16 JP JP2013543814A patent/JP5902194B2/ja active Active
  • 2011-12-16 KR KR1020137017719A patent/KR101925620B1/ko active Active
  • 2011-12-16 DK DK11805824.7T patent/DK2651398T3/en active
  • 2011-12-16 AU AU2011343190A patent/AU2011343190B2/en active Active
  • 2011-12-16 RS RS20200612A patent/RS60321B1/sr unknown
  • 2011-12-16 EP EP20160668.8A patent/EP3730127A1/en active Pending
  • 2011-12-16 PT PT118058247T patent/PT2651398T/pt unknown
  • 2011-12-16 CN CN201610420028.XA patent/CN105963685B/zh active Active
  • 2011-12-16 ES ES11805824.7T patent/ES2661676T3/es active Active
  • 2011-12-16 BR BR112013014942A patent/BR112013014942B1/pt active IP Right Grant
  • 2011-12-16 RS RS20180295A patent/RS56998B1/sr unknown
  • 2011-12-16 SI SI201131427T patent/SI2651398T1/en unknown
  • 2011-12-16 RU RU2013131913A patent/RU2600440C3/ru active Protection Beyond IP Right Term
  • 2011-12-16 HR HRP20180425TT patent/HRP20180425T1/hr unknown
  • 2011-12-16 LT LTEP11805824.7T patent/LT2651398T/lt unknown
  • 2011-12-16 EP EP17204363.0A patent/EP3326620B1/en active Active
  • 2011-12-16 US US13/994,262 patent/US9278123B2/en active Active
  • 2011-12-16 CN CN2011800604631A patent/CN103260608A/zh active Pending
  • 2011-12-16 SM SM20180117T patent/SMT201800117T1/it unknown
• 2016
  • 2016-02-09 US US15/019,412 patent/US10086047B2/en active Active
  • 2016-03-09 JP JP2016045452A patent/JP2016117759A/ja not_active Withdrawn
• 2018
  • 2018-08-30 US US16/118,381 patent/US10960052B2/en active Active
• 2021
  • 2021-02-19 US US17/180,370 patent/US11382957B2/en active Active
• 2022
  • 2022-06-03 US US17/831,836 patent/US20220313786A1/en not_active Abandoned
• 2023
  • 2023-04-04 US US18/130,441 patent/US20230302092A1/en not_active Abandoned
• 2024
  • 2024-04-23 US US18/643,038 patent/US20240277817A1/en active Pending

Patent Citations (27)

Non-Patent Citations (4)

Also Published As

Similar Documents

Legal Events