WO2011071783A1 - Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof - Google Patents

Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof Download PDF

Info

Publication number
WO2011071783A1
WO2011071783A1 PCT/US2010/058984 US2010058984W WO2011071783A1 WO 2011071783 A1 WO2011071783 A1 WO 2011071783A1 US 2010058984 W US2010058984 W US 2010058984W WO 2011071783 A1 WO2011071783 A1 WO 2011071783A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antigen binding
klotho
fgfrlc
fgfr3c
Prior art date
Application number
PCT/US2010/058984
Other languages
English (en)
French (fr)
Inventor
Shaw-Fen Sylvia Hu
Ian Foltz
Chadwick Terence King
Yang Li
Taruna Arora
Original Assignee
Amgen Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=43545013&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2011071783(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to UAA201208326A priority Critical patent/UA109888C2/ru
Priority to AU2010328444A priority patent/AU2010328444B2/en
Priority to SG2012042008A priority patent/SG181568A1/en
Priority to JP2012543173A priority patent/JP5840619B2/ja
Priority to EP16207166.6A priority patent/EP3202787B1/en
Priority to MX2016010041A priority patent/MX360487B/es
Priority to ES10788204.5T priority patent/ES2633810T3/es
Priority to EA201270634A priority patent/EA026129B1/ru
Priority to KR1020187015615A priority patent/KR102121678B1/ko
Priority to CR20180020A priority patent/CR20180020A/es
Priority to KR1020127017717A priority patent/KR101865974B1/ko
Application filed by Amgen Inc. filed Critical Amgen Inc.
Priority to CA2782420A priority patent/CA2782420C/en
Priority to KR1020207015902A priority patent/KR20200067924A/ko
Priority to EP10788204.5A priority patent/EP2510009B1/en
Priority to MX2012006467A priority patent/MX341148B/es
Priority to BR112012013876-6A priority patent/BR112012013876B1/pt
Priority to CN201080063309.5A priority patent/CN102858802B/zh
Priority to MYPI2012002532A priority patent/MY173097A/en
Priority to EP20178046.7A priority patent/EP3760642A1/en
Publication of WO2011071783A1 publication Critical patent/WO2011071783A1/en
Priority to TNP2012000268A priority patent/TN2012000268A1/en
Priority to IL220048A priority patent/IL220048A0/en
Priority to ZA2012/04145A priority patent/ZA201204145B/en
Priority to MA35017A priority patent/MA33854B1/fr
Priority to IL261585A priority patent/IL261585B/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18—Growth factors; Growth regulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
    • A61K47/42—Proteins; Polypeptides; Degradation products thereof; Derivatives thereof, e.g. albumin, gelatin or zein
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00—Preparations for testing in vivo
    • A61K49/06—Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations
    • A61K49/08—Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations characterised by the carrier
    • A61K49/10—Organic compounds
    • A61K49/14—Peptides, e.g. proteins
    • A61K49/16—Antibodies; Immunoglobulins; Fragments thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/04—Anorexiants; Antiobesity agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/06—Antihyperlipidemics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475—Growth factors; Growth regulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/32—Immunoglobulins specific features characterized by aspects of specificity or valency specific for a neo-epitope on a complex, e.g. antibody-antigen or ligand-receptor
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C07K2317/53—Hinge
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/54—F(ab')2
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55—Fab or Fab'
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/626—Diabody or triabody
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75—Agonist effect on antigen
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • the present disclosure relates to nucleic acid molecules encoding antigen binding proteins that bind to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4.
  • the present disclosure also provides antigen binding proteins that bind to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, including antigen binding proteins that induce FGF21-like signaling, as well as pharmaceutical compositions comprising antigen binding proteins that bind to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ - Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, including antigen binding proteins that induce FGF21-like signaling, and methods for treating metabolic disorders using such nucleic acids, polypeptides, or pharmaceutical compositions. Diagnostic methods using the antigen binding proteins are
  • Fibroblast Growth Factor 21 is a secreted polypeptide that belongs to a subfamily of Fibroblast Growth Factors (FGFs) that includes FGF 19, FGF21, and FGF23 (Itoh et al., (2004) Trend Genet. 20:563-69).
  • FGF21 is an atypical FGF in that it is heparin independent and functions as a hormone in the regulation of glucose, lipid, and energy metabolism.
  • FGF21 farnesoid GF21
  • Transgenic mice overexpressing FGF21 exhibit metabolic phenotypes of slow growth rate, low plasma glucose and triglyceride levels, and an absence of age-associated type 2 diabetes, islet hyperplasia, and obesity.
  • Pharmacological administration of recombinant FGF21 protein in rodent and primate models results in normalized levels of plasma glucose, reduced triglyceride and cholesterol levels, and improved glucose tolerance and insulin sensitivity.
  • FGF21 reduces body weight and body fat by increasing energy expenditure, physical activity, and metabolic rate.
  • Experimental research provides support for the pharmacological administration of FGF21 for the treatment of type 2 diabetes, obesity, dyslipidemia, and other metabolic conditions or disorders in humans.
  • FGF21 is a liver derived endocrine hormone that stimulates glucose uptake in adipocytes and lipid homeostasis through the activation of its receptor.
  • the FGF21 receptor also comprises the membrane associated ⁇ -Klotho as an essential cofactor. Activation of the FGF21 receptor leads to multiple effects on a variety of metabolic parameters.
  • FGFs mediate their action via a set of four FGF receptors, FGFR1 - 4, that in turn are expressed in multiple spliced variants, e.g., FGFRlc, FGFR2c, FGFR3c and FGFR4.
  • Each FGF receptor contains an intracellular tyrosine kinase domain that is activated upon ligand binding, leading to downstream signaling pathways involving MAPKs (Erkl/2), RAF1, AKT1 and STATs. (Kharitonenkov et al, (2008) BioDrugs 22:37-44).
  • the present disclosure provides a human (or humanized) antigen binding protein, such as a monoclonal antibody, that induces FGF21-like signaling, e.g., an agonistic antibody that mimics the function of FGF21.
  • a human antigen binding protein such as a monoclonal antibody
  • Such an antibody is a molecule with FGF21-like activity and selectivity but with added therapeutically desirable characteristics typical for an antibody such as protein stability, lack of immunogenicity, ease of production and long half-life in vivo.
  • An isolated antigen binding protein that induces FGF21 -mediated signaling is provided. Also provided is an isolated antigen binding protein that specifically binds to at least one of: (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; and (iii) a complex comprising ⁇ - Klotho and one of FGFRlc, FGFR2c, FGFR3c and FGFR4 wherein the antigen binding protein induces FGF21 -mediated signaling.
  • the provided antigen binding proteins comprise an amino acid sequence selected from the group consisting of: (a) a light chain CDR3 comprising a sequence selected from the group consisting of: (i) a light chain CDR3 sequence that differs by no more than a total of three amino acid additions, substitutions, and/or deletions from a CDR3 sequence selected from the group consisting of the light chain CDR3 sequences of LI -LI 8, SEQ ID NOs: 180-194; (ii) QVWDXiX 2 SDHVV (SEQ ID NO: 276); (iii) QQX3GX 4 X 5 X 6 X 7 T (SEQ ID NO: 283); (iv) LQHNSYPLT (SEQ ID NO: 267); (v) MQSLQTPFT (SEQ ID NO: 268); (vi) QQYNNWPPT (SEQ ID NO: 269); (vii) MQSIQLPRT (SEQ ID NO: 270); (viii) Q
  • the provided antigen binding proteins comprise either: (a) a light chain CDR1 sequence selected from the group consisting of: (i) a light chain CDR1 that differs by no more than three amino acids additions, substitutions, and/or deletions from a CDR1 sequence of L1-L18, SEQ ID NOs: 158-170; (ii) RASQ X 9 Xi 0 XnXi 2 Xi 3 Xi 4 LA (SEQ ID NO: 304); (iii) GGNNIGSXi 5 SVH (SEQ ID NO: 307); (iv) RSSQSLLX 2 9X 3 oNGX 3 iX 32 X 33 LD (SEQ ID NO: 310); (v) RASQSVNSNLA (SEQ ID NO: 295); (vi) RASQDIRYDLG (SEQ ID NO: 296); (vii) RASQGISIWLA (SEQ ID NO: 297); and (viii) KSSQSLL
  • the provided antigen binding proteins comprise either: (a) a light chain variable domain comprising; (i) a light chain CDRl sequence selected from SEQ ID NOs: 158-170; (ii) a light chain CDR2 sequence selected from SEQ ID NOs: 171-179; (iii) a light chain CDR3 sequence selected from SEQ ID NOs: 180- 194; and (b) a heavy chain variable domain comprising: (i) a heavy chain CDRl sequence selected from SEQ ID NOs: 121-131; (ii) a heavy chain CDR2 sequence selected from SEQ ID NOs: 132-144; and (iii) a heavy chain CDR3 sequence selected from SEQ ID NOs: 145-157; or (c) the light chain variable domain of (a) and the heavy chain variable domain of (b), wherein the antigen binding protein specifically binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c
  • the provided antigen binding proteins comprise either: (a) a light chain variable domain sequence selected from the group consisting of: (i) amino acids having a sequence at least 80% identical to a light chain variable domain sequence selected from V L I - V L 18, SEQ ID NOs:48-65; (ii) a sequence of amino acids encoded by a polynucleotide sequence that is at least 80% identical to a polynucleotide sequence encoding the light chain variable domain sequence of V L 1-V L 18, SEQ ID NOs:48-65; (b) a heavy chain variable domain sequence selected from the group consisting of: (i) a sequence of amino acids that is at least 80% identical to a heavy chain variable domain sequence of V H 1-V H 18 of SEQ ID NOs:66-84; (ii) a sequence of amino acids encoded by a polynucleotide sequence that is at least 80% identical to a polynucleotide sequence encoding the heavy chain variable domain sequence of V H 1-
  • the provided antigen binding proteins comprise either: (a) a light chain variable domain sequence selected from the group consisting of: V L 1-V L 18 of SEQ ID NOs:48-65; (b) a heavy chain variable domain sequence selected from the group consisting of: V H 1-V H 18 of SEQ ID NOs:66-84; or (c) the light chain variable domain of (a) and the heavy chain variable domain of (b), wherein the antigen binding protein specifically binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4.
  • the provided antigen binding proteins the light chain variable domain and a heavy chain variable domain are selected from the group of combinations consisting of: V L IV H I , V l 2V H 2, V l 3V H 3, V l 3V h 4, V l 4V h 5, V l 5V h 6, V l 6V h 7, V l 7V h 8, V l 8V h 8, V l 9V h 9, V l 9V H 10, V L I OV H I I , V l 11V h 11, V l 12V h 12, V l 13V h 13, V l 14V h 14, V l 15V h 15, V l 16V h 16, V L 17V H 17, and V L 18V H 18, wherein the antigen binding protein specifically binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klot
  • the provided antigen binding proteins further comprise: (a) the light chain constant sequence of SEQ ID NO: 10; (b) the light chain constant sequence of SEQ ID NO: 11; (c) the heavy chain constant sequence of SEQ ID NO: 9; or (d) the light chain constant sequence of SEQ ID NO: 10 or SEQ ID NO: 11 and the heavy chain constant sequence of SEQ ID NO: 9.
  • the provided antigen binding proteins can take many forms and can be, for example, a human antibody, a humanized antibody, chimeric antibody, a monoclonal antibody, a polyclonal antibody, a recombinant antibody, an antigen-binding antibody fragment, a single chain antibody, a diabody, a triabody, a tetrabody, a Fab fragment, an F(fab') 2 fragment, a domain antibody, an IgD antibody, an IgE antibody, an IgM antibody, an IgGl antibody, an IgG2 antibody, an IgG3 antibody, an IgG4 antibody, or an IgG4 antibody having at least one mutation in the hinge region.
  • the provided antigen binding proteins can when bound to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4: (a) lower blood glucose in an animal model; (b) lower serum lipid levels in an animal model; (c) lower insulin levels in an animal model; or (d) two or more of (a) and (b) and (c).
  • the provided antigen binding proteins comprise: (a) a heavy chain comprising one of SEQ ID NOs:31, 32, 390-401, 404-405; (b) a light chain comprising one of SEQ ID NO: 13, 14, 385-389, 402-403; or (c) a combination comprising a heavy chain of (a) and a light chain of (b).
  • antigen binding proteins that are capable of binding wild type human ⁇ -Klotho (SEQ ID NO:7) but which doesn't bind to a chimeric form of ⁇ -Klotho wherein the chimeric form of ⁇ -Klotho comprises a human ⁇ -Klotho framework wherein murine ⁇ -Klotho sequences replace the wild type human residues at at least one of (a) positions 1-80; (b) positions 303-522; (c) positions 852-1044; and (d) combinations thereof.
  • the present disclosure provides antigen binding proteins that are capable of binding wild type human ⁇ -Klotho (SEQ ID NO:7) at at least one of (a) positions 1- 80; (b) positions 303-522; (c) positions 852-1044; and (d) combinations thereof.
  • the present disclosure provides antigen binding proteins that are capable of competing with an antigen binding protein of claims 8 or 13 for binding to human wild type ⁇ -Klotho residues at at least one of (a) positions 1-80; (b) positions 303-522; (c) positions 852-1044; and (d) combinations thereof.
  • composition comprising one or more antigen binding proteins provided herein, in admixture with a pharmaceutically acceptable carrier thereof.
  • nucleic acid molecules that encode the antigen binding proteins disclosed herein.
  • the isolated nucleic acid molecules are operably-linked to a control sequence.
  • nucleic acids comprise a polynucleotide sequence encoding the light chain variable domain, the heavy chain variable domain, or both, of an antigen binding protein provided herein.
  • the nucleic acids comprise (a) V L 1-V L 18 (SEQ ID NOs:48-65); (b) V H 1-V H 18 (SEQ ID NOs:66-84); or (c) one or more sequences of (a) and one or more sequences of (b).
  • expression vectors and host cells transformed or transfected with the expression vectors that comprise the aforementioned isolated nucleic acid molecules that encode the antigen binding proteins disclosed herein.
  • also provided are methods of preparing antigen binding proteins that specifically or selectively bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4 and comprises the step of preparing the antigen binding protein from a host cell that secretes the antigen binding protein.
  • inventions provide a method of preventing or treating a condition in a subject in need of such treatment comprising administering a therapeutically effective amount of a pharmaceutical composition provided herein to a subject, wherein the condition is treatable by lowering blood glucose, insulin or serum lipid levels.
  • the condition is type 2 diabetes, obesity, dyslipidemia, NASH, cardiovascular disease or metabolic syndrome.
  • Figure 1A-1B is an alignment showing the sequence homology between human FGFRlc (GenBank Accession No PI 1362; SEQ ID NO: 356) and murine FGFRlc (GenBank Accession No NP_034336; SEQ ID NO: 357); various features are highlighted, including the signal peptide, transmembrane sequence, heparin binding region, and a consensus sequence (SEQ ID NO: 358) is provided.
  • Figure 2a-2c is an alignment showing the sequence homology between human ⁇ -Klotho (GenBank Accession No NP 783864; SEQ ID NO: 359) and murine ⁇ -Klotho (GenBank Accession No NP_112457; SEQ ID NO: 360); various features are highlighted, including the transmembrane sequence and two glycosyl hydrolase domains, and a consensus sequence (SEQ ID NO: 361) is provided.
  • FIG. 3 is a flow cytometry profile of cells stained with FGF21-Alexa 647 that were used as an immunogen to generate antigen binding proteins; the figure shows the expression level of an FGF21R (a complex comprising FGFRlc and ⁇ -Klotho) and binding to FGF21.
  • FGF21R a complex comprising FGFRlc and ⁇ -Klotho
  • Figure 4 is a sequence (SEQ ID NO: 362) showing an Fc fusion protein that was used as an immunogen to generate antigen binding proteins; the immunogen comprises the extracellular domain (ECD) of human FGFRlc fused to an IgGl Fc via a Gly 5 linker (SEQ ID NO: 379); the FGFRlc component is in capitals, the linker is italic and underlined and the Fc is in lower case letters.
  • ECD extracellular domain
  • Figure 5 is a sequence (SEQ ID NO: 363) showing an Fc fusion protein that was used as an immunogen to generate antigen binding proteins; the immunogen comprises the extracellular domain (ECD) of human ⁇ -Klotho fused to an IgGl Fc via a Gly 5 linker (SEQ ID NO: 379); the ⁇ -Klotho component is in capitals, the linker is italic and underlined and the Fc is in lower case letters.
  • ECD extracellular domain
  • Figure 6 is a SDS PAGE gel showing the level of purity achieved from preparations of a soluble FGF21 receptor complex comprising FGFRlc ECD-Fc and ⁇ -Klotho ECD-Fc, which was employed as an immunogen to generate antigen binding proteins.
  • Figure 7 is a series of plots generated from an ELK-luciferase reporter assay as described herein performed on recombinant CHO clone 2E10, demonstrating the ability of some of the antigen binding proteins to induce FGF21-like signaling in recombinant CHO cells expressing a FGF21 receptor complex comprising FGFRlc and ⁇ -Klotho.
  • Figure 8 is a series of plots generated from an ER 1/2 phosphorylation assay as described herein, demonstrating the ability of some of the antigen binding proteins to induce FGF21-like signaling in rat L6 cells.
  • the X-axis is the concentrations of the antigen binding proteins and the Y-axis is the percentage of phosphorylated ER 1/2 of total ERK1/2.
  • Figure 9 is a series of plots generated from an ER l/2 phosphorylation assay as described herein, demonstrating that antigen binding protein-mediated FGF21-like signaling in L6 cells is FGFRlc ⁇ -Klotho specific.
  • Figure 10 is a series of plots generated from an ER phosphorylation assay as described herein, demonstrating that some antigen binding proteins are able to induce FGF21-like signaling in human adipocyte cells.
  • Figure 1 la is a series of binding sensorgrams (response units vs time) demonstrating that some of the antigen binding proteins that induce FGF21 -mediated signaling bind to human ⁇ - Klotho at two different but partially overlapping binding sites represented by 24H11 (Group A) and 17D8 (Group B), while antigen binding proteins that do not induce FGF21 -mediated signaling (2G10, 1A2) do not bind to these sites.
  • Figure l ib is a series of binding sensorgrams (response units vs time) demonstrating a third binding site on human ⁇ -Klotho that was identified for Group C antigen binding proteins represented by 39F7.
  • Figure 12 is a series of binding sensorgrams (response units vs time) demonstrating that some of the antigen binding proteins (12E4, 24H11, 17C3, 18B11) that induce FGF21 -mediated signaling interfere with ⁇ -Klotho binding to FGF21, while other antigen binding proteins (21H2, 17D8, 18Gl) do not.
  • Figure 13 is an alignment of the variable regions of some of the antigen binding proteins that were generated; the framework and CDR regions are identified.
  • Figure 13 discloses SEQ ID NOS: 364, 59, 365, 60, 366, 61, 367, 62, 368, 57, 369, 55, 51-52, 56, 56, 53-54, 63-65, 370, 58, 371, 50, 50, 49, 48, 372, 78, 373, 66-69, 79, 374, 76, 81, 375, 70, 73, 73, 71-72, 376, 83, 82, 84, 377, 80, 378, 75 and 74, respectively, in order of appearance.
  • Figure 14 is a diagram graphically depicting the study design for a 68 days study performed in obese cynomolgus monkeys.
  • Figure 15 is a plot depicting the effects of vehicle and 16H7 on AM meal food intake of the obese cynomolgus monkeys studied.
  • Figure 16 is two plots depicting the effects of vehicle and 16H7 on fruit intake and PM food intake of the obese cynomolgus monkeys studied.
  • Figure 17 is a plot depicting the effects of vehicle and 16H7 on body weight of the obese cynomolgus monkeys studied.
  • Figure 18 is a plot showing the effects of vehicle and 16H7 on body mass index (BMI) of the obese cynomolgus monkeys studied.
  • Figure 19 is a plot showing the effects of vehicle on abdominal circumference (AC) of the obese cynomolgus monkeys studied.
  • Figure 20 is a plot showing the effects of vehicle and 16H7 on skin fold thickness (SFT) of the obese cynomolgus monkeys studied.
  • Figure 21 is a plot showing the effects of vehicle and 16H7 on glucose levels during glucose tolerance tests of the obese cynomolgus monkeys studied.
  • Figure 22 is a plot showing the effects of vehicle and 16H7 on plasma insulin levels during glucose tolerance tests of the obese cynomolgus monkeys studied.
  • Figure 23 is a plot showing the effects of vehicle and 16H7 on fasting plasma glucose levels of the obese cynomolgus monkeys studied.
  • Figure 24 is a plot showing the effects of vehicle and 16H7 on fasting plasma insulin levels of the obese cynomolgus monkeys studied.
  • Figure 25 is a plot showing the effects of vehicle and 16H7 on fed plasma glucose levels of the obese cynomolgus monkeys studied.
  • Figure 26 is a plot showing the effects of vehicle and 16H7 on fed plasma insulin levels of the obese cynomolgus monkeys studied.
  • Figure 27 is a plot showing the effects of vehicle and 16H7 on fasting plasma triglyceride levels of the obese cynomolgus monkeys studied.
  • Figure 28 is a plot showing the effects of vehicle and 16H7 on fed plasma triglyceride levels of the obese cynomolgus monkeys studied.
  • Figure 29 is a schematic depicting human-mouse ⁇ -Klotho chimeras that were constructed and used to studying the binding of antigen binding proteins.
  • Figure 30 is a schematic depicting the human-mouse ⁇ -Klotho chimeras that were constructed and also includes qualitative binding data for FGF21, 16H7, 37D3 and 39F7.
  • Figure 31A-C is a series of plots depicting binding data for eight of the 16H7 and 22H5 variants that were constructed, as well as for 22H5 and 16H7.
  • Figures 32A-C is a series of plots depicting the results of ELISA assays that were used to demonstrate that several of the 22H5 and 16H7 variants have binding ability.
  • Figure 33 is a bar graph comparing off-rates for several 22H5 and 17H7 variants that were generated.
  • Figure 34 is two plots that depict binding curves for 39F11 when titrated with FGF21 and for FGF21 when titrated with 39F11; the plots demonstrate an additive effect.
  • Figure 35 is two plots that depict binding curves for 16H7 when titrated with 39F11 and 39F11 when it is titrated with 16H7; the plots demonstrate an additive effect.
  • an "antigen binding protein” is a protein comprising a portion that binds to an antigen or target and, optionally, a scaffold or framework portion that allows the antigen binding portion to adopt a conformation that promotes binding of the antigen binding protein to the antigen.
  • antigen binding proteins examples include a human antibody, a humanized antibody; a chimeric antibody; a recombinant antibody; a single chain antibody; a diabody; a triabody; a tetrabody; a Fab fragment; a F(ab') 2 fragment; an IgD antibody; an IgE antibody; an IgM antibody; an IgGl antibody; an IgG2 antibody; an IgG3 antibody; or an IgG4 antibody, and fragments thereof.
  • the antigen binding protein can comprise, for example, an alternative protein scaffold or artificial scaffold with grafted CDRs or CDR derivatives.
  • Such scaffolds include, but are not limited to, antibody-derived scaffolds comprising mutations introduced to, for example, stabilize the three-dimensional structure of the antigen binding protein as well as wholly synthetic scaffolds comprising, for example, a biocompatible polymer. See, e.g., Korndorfer et al., 2003, Proteins: Structure, Function, and Bioinformatics, 53(1): 121-129 (2003); Roque et al., Biotechnol. Prog. 20:639-654 (2004).
  • PAMs peptide antibody mimetics
  • scaffolds based on antibody mimetics utilizing fibronectin components as a scaffold.
  • An antigen binding protein can have, for example, the structure of a naturally occurring immunoglobulin.
  • An "immunoglobulin” is a tetrameric molecule. In a naturally occurring immunoglobulin, each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy" chain (about 50-70 kDa).
  • the amino- terminal portion of each chain includes a variable region of about 100 to 1 10 or more amino acids primarily responsible for antigen recognition.
  • the carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. Human light chains are classified as kappa and lambda light chains.
  • Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
  • the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2 nd ed. Raven Press, N.Y. (1989)) (incorporated by reference in its entirety for all purposes).
  • the variable regions of each light/heavy chain pair form the antibody binding site such that an intact immunoglobulin has two binding sites.
  • Naturally occurring immunoglobulin chains exhibit the same general structure of relatively conserved framework regions (FR) joined by three hypervariable regions, also called complementarity determining regions or CDRs. From N-terminus to C-terminus, both light and heavy chains comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain can be done in accordance with the definitions of Kabat et al. in Sequences of Proteins of Immunological Interest, 5 th Ed., US Dept. of Health and Human Services, PHS, NIH, NIH Publication no. 91-3242, 1991.
  • the CDRs can also be redefined according an alternative nomenclature scheme, such as that of Chothia (see Chothia & Lesk, 1987, J. Mol. Biol. 196:901-917; Chothia et al, 1989, Nature 342:878-883 or Honegger & Pluckthun, 2001, J . Mol. Biol. 309:657-670).
  • an antigen binding protein is said to “specifically bind” or “selectively bind” its target antigen when the dissociation constant (K D ) is ⁇ 10 "8 M.
  • the antibody specifically binds antigen with "high affinity” when the K D is ⁇ 5x 10 ⁇ 9 M, and with “very high affinity” when the K D is ⁇ 5x 10 "10 M.
  • the antibodies will bind to FGFRlc, ⁇ -Klotho, both FGFRlc and ⁇ -Klotho or a complex comprising FGFRlc and ⁇ -Klotho, including human FGFRlc, human ⁇ -Klotho or both human FGFRlc and human ⁇ -Klotho, with a K D of between about 10 "7 M and 10 "12 M, and in yet another embodiment the antibodies will bind with a K D ⁇ 5x 10 ⁇ 9 .
  • an “antibody” refers to an intact immunoglobulin or to an antigen binding portion thereof that competes with the intact antibody for specific binding, unless otherwise specified.
  • Antigen binding portions can be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of intact antibodies.
  • Antigen binding portions include, inter alia, Fab, Fab', F(ab') 2 , Fv, domain antibodies (dAbs), fragments including complementarity determining regions (CDRs), single-chain antibodies (scFv), chimeric antibodies, diabodies, triabodies, tetrabodies, and polypeptides that contain at least a portion of an immunoglobulin that is sufficient to confer specific antigen binding to the polypeptide.
  • a Fab fragment is a monovalent fragment having the V L , V H , C L and C H I domains;
  • F(ab') 2 fragment is a bivalent fragment having two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment has the V H and C H I domains; an Fv fragment has the V L and V H domains of a single arm of an antibody; and a dAb fragment has a V H domain, a V L domain, or an antigen-binding fragment of a V H or V L domain (US Pat. Nos. 6,846,634, 6,696,245, US App. Pub. Nos. 05/0202512, 04/0202995, 04/0038291, 04/0009507, 03/0039958, Ward et al, Nature 341 :544-546 (1989)).
  • a single-chain antibody is an antibody in which a V L and a V H region are joined via a linker (e.g., a synthetic sequence of amino acid residues) to form a continuous protein chain wherein the linker is long enough to allow the protein chain to fold back on itself and form a monovalent antigen binding site (see, e.g., Bird et al, Science 242:423-26 (1988) and Huston et al, 1988, Proc. Natl. Acad. Sci. USA 85:5879-83 (1988)).
  • a linker e.g., a synthetic sequence of amino acid residues
  • Diabodies are bivalent antibodies comprising two polypeptide chains, wherein each polypeptide chain comprises V H and V L domains joined by a linker that is too short to allow for pairing between two domains on the same chain, thus allowing each domain to pair with a complementary domain on another polypeptide chain (see, e.g., HoUiger et al, 1993, Proc. Natl. Acad. Sci. USA 90:6444-48 (1993), and Poljak et al, Structure 2: 1121-23 (1994)). If the two polypeptide chains of a diabody are identical, then a diabody resulting from their pairing will have two identical antigen binding sites.
  • Polypeptide chains having different sequences can be used to make a diabody with two different antigen binding sites.
  • tribodies and tetrabodies are antibodies comprising three and four polypeptide chains, respectively, and forming three and four antigen binding sites, respectively, which can be the same or different.
  • Complementarity determining regions (CDRs) and framework regions (FR) of a given antibody can be identified using the system described by Kabat et al. in Sequences of Proteins of Immunological Interest, 5th Ed., US Dept. of Health and Human Services, PHS, NIH, NIH Publication no. 91-3242, 1991 As desired, the CDRs can also be redefined according an alternative nomenclature scheme, such as that of Chothia (see Chothia & Lesk, 1987, J. Mol. Biol. 196:901-917; Chothia et al, 1989, Nature 342:878-883 or Honegger & Pluckthun, 2001, J. Mol. Biol. 309:657-670.
  • One or more CDRs can be incorporated into a molecule either covalently or noncovalently to make it an antigen binding protein.
  • An antigen binding protein can incorporate the CDR(s) as part of a larger polypeptide chain, can covalently link the CDR(s) to another polypeptide chain, or can incorporate the CDR(s) noncovalently.
  • the CDRs permit the antigen binding protein to specifically bind to a particular antigen of interest.
  • An antigen binding protein can have one or more binding sites. If there is more than one binding site, the binding sites can be identical to one another or can be different. For example, a naturally occurring human immunoglobulin typically has two identical binding sites, while a "bispecific” or “bifunctional” antibody has two different binding sites.
  • human antibody includes all antibodies that have one or more variable and constant regions derived from human immunoglobulin sequences. In one embodiment, all of the variable and constant domains are derived from human immunoglobulin sequences (a fully human antibody).
  • antibodies can be prepared in a variety of ways, examples of which are described below, including through the immunization with an antigen of interest of a mouse that is genetically modified to express antibodies derived from human heavy and/or light chain- encoding genes, such as a mouse derived from a Xenomouse®, UltiMabTM, or Velocimmune® system. Phage-based approaches can also be employed.
  • a humanized antibody has a sequence that differs from the sequence of an antibody derived from a non-human species by one or more amino acid substitutions, deletions, and/or additions, such that the humanized antibody is less likely to induce an immune response, and/or induces a less severe immune response, as compared to the non-human species antibody, when it is administered to a human subject.
  • certain amino acids in the framework and constant domains of the heavy and/or light chains of the non-human species antibody are mutated to produce the humanized antibody.
  • the constant domain(s) from a human antibody are fused to the variable domain(s) of a non-human species.
  • one or more amino acid residues in one or more CDR sequences of a non-human antibody are changed to reduce the likely immunogenicity of the non-human antibody when it is administered to a human subject, wherein the changed amino acid residues either are not critical for immunospecific binding of the antibody to its antigen, or the changes to the amino acid sequence that are made are conservative changes, such that the binding of the humanized antibody to the antigen is not significantly worse than the binding of the non-human antibody to the antigen. Examples of how to make humanized antibodies can be found in U.S. Pat. Nos. 6,054,297, 5,886,152 and 5,877,293.
  • chimeric antibody refers to an antibody that contains one or more regions from one antibody and one or more regions from one or more other antibodies.
  • one or more of the CDRs are derived from a human antibody that binds (i) ⁇ - Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4.
  • all of the CDRs are derived from a human antibody that binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4.
  • the CDRs from more than one human antibody that binds are mixed and matched in a chimeric antibody.
  • a chimeric antibody can comprise a CDRl from the light chain of a first human antibody that binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, a CDR2 and a CDR3 from the light chain of a second human antibody that binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, and the CDRs from the heavy chain from a third antibody that binds (i) ⁇ - Klotho; (ii) FGFRl
  • the framework regions can be derived from one of the same antibodies that bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, from one or more different antibodies, such as a human antibody, or from a humanized antibody.
  • a portion of the heavy and/or light chain is identical with, homologous to, or derived from an antibody from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is/are identical with, homologous to, or derived from an antibody or antibodies from another species or belonging to another antibody class or subclass.
  • fragments of such antibodies that exhibit the desired biological activity (e.g., the ability to specifically bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4).
  • desired biological activity e.g., the ability to specifically bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4).
  • light chain includes a full-length light chain and fragments thereof having sufficient variable region sequence to confer binding specificity.
  • a full-length light chain includes a variable region domain, VL, and a constant region domain, CL.
  • the variable region domain of the light chain is at the amino-terminus of the polypeptide.
  • Light chains include kappa (“ ⁇ ”) chains and lambda (“ ⁇ ”) chains.
  • heavy chain includes a full-length heavy chain and fragments thereof having sufficient variable region sequence to confer binding specificity.
  • a full-length heavy chain includes a variable region domain, V H , and three constant region domains, C H 1 , C H 2, and C H 3.
  • the V H domain is at the amino-terminus of the polypeptide
  • the C H domains are at the carboxyl-terminus, with the C H 3 being closest to the carboxy-terminus of the polypeptide.
  • Heavy chains can be of any isotype, including IgG (including IgGl, IgG2, IgG3 and IgG4 subtypes), IgA (including IgAl and IgA2 subtypes), IgM and IgE.
  • an antigen binding protein e.g., an antibody or immunoglobulin chain (heavy or light chain)
  • an antigen binding protein comprising a portion (regardless of how that portion is obtained or synthesized) of an antibody that lacks at least some of the amino acids present in a full-length chain but which is capable of specifically binding to an antigen.
  • Such fragments are biologically active in that they bind specifically to the target antigen and can compete with other antigen binding proteins, including intact antibodies, for specific binding to a given epitope.
  • such a fragment will retain at least one CDR present in the full-length light or heavy chain, and in some embodiments will comprise a single heavy chain and/or light chain or portion thereof.
  • These biologically active fragments can be produced by recombinant DNA techniques, or can be produced by enzymatic or chemical cleavage of antigen binding proteins, including intact antibodies.
  • Immunologically functional immunoglobulin fragments include, but are not limited to, Fab, Fab', F(ab') 2 , Fv, domain antibodies and single-chain antibodies, and can be derived from any mammalian source, including but not limited to human, mouse, rat, camelid or rabbit.
  • a functional portion of the antigen binding proteins disclosed herein could be covalently bound to a second protein or to a small molecule to create a therapeutic agent directed to a particular target in the body, possessing bifunctional therapeutic properties, or having a prolonged serum half-life.
  • An "Fc" region contains two heavy chain fragments comprising the C R 2 and C R 3 domains of an antibody.
  • the two heavy chain fragments are held together by two or more disulfide bonds and by hydrophobic interactions of the C H 3 domains.
  • Fab' fragment contains one light chain and a portion of one heavy chain that contains the V H domain and the C R I domain and also the region between the C R I and C R 2 domains, such that an interchain disulfide bond can be formed between the two heavy chains of two Fab' fragments to form an F(ab') 2 molecule.
  • F(ab') 2 fragment contains two light chains and two heavy chains containing a portion of the constant region between the C R I and C R 2 domains, such that an interchain disulfide bond is formed between the two heavy chains.
  • a F(ab') 2 fragment thus is composed of two Fab' fragments that are held together by a disulfide bond between the two heavy chains.
  • the "Fv region” comprises the variable regions from both the heavy and light chains, but lacks the constant regions.
  • a “domain antibody” is an immunologically functional immunoglobulin fragment containing only the variable region of a heavy chain or the variable region of a light chain.
  • two or more V H regions are covalently joined with a peptide linker to create a bivalent domain antibody.
  • the two V H regions of a bivalent domain antibody can target the same or different antigens.
  • a “hemibody” is an immunologically functional immunoglobulin construct comprising a complete heavy chain, a complete light chain and a second heavy chain Fc region paired with the Fc region of the complete heavy chain.
  • a linker can, but need not, be employed to join the heavy chain Fc region and the second heavy chain Fc region.
  • a hemibody is a monovalent form of an antigen binding protein disclosed herein.
  • pairs of charged residues can be employed to associate one Fc region with the second Fc region.
  • the second heavy chain Fc region can comprise, for example, SEQ ID NO:441 and can be joined to the light chain via a linker (e.g., SEQ ID NO:440)
  • An exemplary hemibody heavy chain comprises the sequence SEQ ID NO:453.
  • a “bivalent antigen binding protein” or “bivalent antibody” comprises two antigen binding sites. In some instances, the two binding sites have the same antigen specificities. Bivalent antigen binding proteins and bivalent antibodies can be bispecific, as described herein.
  • a multispecific antigen binding protein or “multispecific antibody” is one that targets more than one antigen or epitope.
  • a "bispecific,” “dual-specific” or “bifunctional” antigen binding protein or antibody is a hybrid antigen binding protein or antibody, respectively, having two different antigen binding sites.
  • Bispecific antigen binding proteins and antibodies are a species of multispecific antigen binding protein or multispecific antibody and can be produced by a variety of methods including, but not limited to, fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai and Lachmann, 1990, Clin. Exp. Immunol. 79:315-321; Kostelny et ah, 1992, J. Immunol. 148:1547- 1553.
  • FGF21-like signaling and “induces FGF21-like signaling,” when applied to an antigen binding protein of the present disclosure, means that the antigen binding protein mimics, or modulates, an in vivo biological effect induced by the binding of (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4 and induces a biological response that otherwise would result from FGF21 binding to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho
  • an antibody or fragment is deemed to induce a biological response when the response is equal to or greater than 5%, and preferably equal to or greater than 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%), 85%o, 90%) or 95%, of the activity of a wild type FGF21 standard comprising the mature form of SEQ ID NO:2 (i.e., the mature form of the human FGF21 sequence) and has the following properties: exhibiting an efficacy level of equal to or more than 5% of an FGF21 standard, with an EC50 of equal to or less than ⁇ , e.g., 90 nM, 80 nM, 70nM, 60nM, 50nM, 40nM, 30nM, 20nM or 10 nM in (1) the recombinant FGF21 receptor mediated lucifera
  • the "potency" of an antigen binding protein is defined as exhibiting an EC50 of equal to or less than ⁇ , e.g., 90nM, 80nM, 70nM, 60nM, 50nM, 40nM, 30nM, 20nM, 10 nM and preferably less than ⁇ of the antigen binding protein in the following assays: (1) the recombinant FGF21 receptor mediated luciferase-reporter cell assay of Example 5; (2) the ERK-phosphorylation in the recombinant FGF21 receptor mediated cell assay of Example 5; and (3) ERK-phosphorylation in human adipocytes as described in Example 7.
  • FGF21 -mediated signaling nor is this property desirable in all circumstances. Nevertheless, antigen binding proteins that do not induce FGF21 -mediated signaling form aspects of the present disclosure and may be useful as diagnostic reagents or other applications.
  • FGF21R means a multimeric receptor complex that FGF21 is known or suspected to form in vivo.
  • FGF21R comprises (i) an FGFR, e.g., FGFRlc, FGFR2c, FGFR3c or FGFR4, and (ii) ⁇ -Klotho.
  • polynucleotide or “nucleic acid” includes both single-stranded and double- stranded nucleotide polymers.
  • the nucleotides comprising the polynucleotide can be ribonucleotides or deoxyribonucleotides or a modified form of either type of nucleotide.
  • Said modifications include base modifications such as bromouridine and inosine derivatives, ribose modifications such as 2', 3'-dideoxyribose, and internucleotide linkage modifications such as phosphorothioate, phosphorodithioate, phosphoroselenoate, phosphorodiselenoate, phosphoroanilothioate, phoshoraniladate and phosphoroamidate.
  • oligonucleotide means a polynucleotide comprising 200 or fewer nucleotides. In some embodiments, oligonucleotides are 10 to 60 bases in length. In other embodiments, oligonucleotides are 12, 13, 14, 15, 16, 17, 18, 19, or 20 to 40 nucleotides in length. Oligonucleotides can be single stranded or double stranded, e.g. , for use in the construction of a mutant gene. Oligonucleotides can be sense or antisense oligonucleotides.
  • An oligonucleotide can include a label, including a radiolabel, a fluorescent label, a hapten or an antigenic label, for detection assays. Oligonucleotides can be used, for example, as PCR primers, cloning primers or hybridization probes.
  • isolated nucleic acid molecule means a DNA or RNA of genomic, mRNA, cDNA, or synthetic origin or some combination thereof which is not associated with all or a portion of a polynucleotide in which the isolated polynucleotide is found in nature, or is linked to a polynucleotide to which it is not linked in nature.
  • a nucleic acid molecule comprising a particular nucleotide sequence does not encompass intact chromosomes.
  • Isolated nucleic acid molecules "comprising" specified nucleic acid sequences can include, in addition to the specified sequences, coding sequences for up to ten or even up to twenty other proteins or portions thereof, or can include operably linked regulatory sequences that control expression of the coding region of the recited nucleic acid sequences, and/or can include vector sequences.
  • the left-hand end of any single-stranded polynucleotide sequence discussed herein is the 5' end; the left-hand direction of double-stranded polynucleotide sequences is referred to as the 5' direction.
  • the direction of 5' to 3' addition of nascent RNA transcripts is referred to as the transcription direction; sequence regions on the DNA strand having the same sequence as the RNA transcript that are 5' to the 5' end of the RNA transcript are referred to as "upstream sequences;" sequence regions on the DNA strand having the same sequence as the RNA transcript that are 3' to the 3' end of the RNA transcript are referred to as "downstream sequences.”
  • control sequence refers to a polynucleotide sequence that can affect the expression and processing of coding sequences to which it is ligated. The nature of such control sequences can depend upon the host organism.
  • control sequences for prokaryotes can include a promoter, a ribosomal binding site, and a transcription termination sequence.
  • control sequences for eukaryotes can include promoters comprising one or a plurality of recognition sites for transcription factors, transcription enhancer sequences, and transcription termination sequence.
  • Control sequences can include leader sequences and/or fusion partner sequences.
  • vector means any molecule or entity (e.g., nucleic acid, plasmid, bacteriophage or virus) used to transfer protein coding information into a host cell.
  • expression vector refers to a vector that is suitable for transformation of a host cell and contains nucleic acid sequences that direct and/or control (in conjunction with the host cell) expression of one or more heterologous coding regions operatively linked thereto.
  • An expression construct can include, but is not limited to, sequences that affect or control transcription, translation, and, if introns are present, affect RNA splicing of a coding region operably linked thereto.
  • operably linked means that the components to which the term is applied are in a relationship that allows them to carry out their inherent functions under suitable conditions.
  • a control sequence in a vector that is "operably linked" to a protein coding sequence is ligated thereto so that expression of the protein coding sequence is achieved under conditions compatible with the transcriptional activity of the control sequences.
  • the term "host cell” means a cell that has been transformed, or is capable of being transformed, with a nucleic acid sequence and thereby expresses a gene of interest.
  • the term includes the progeny of the parent cell, whether or not the progeny is identical in morphology or in genetic make-up to the original parent cell, so long as the gene of interest is present.
  • transduction means the transfer of genes from one bacterium to another, usually by bacteriophage. "Transduction” also refers to the acquisition and transfer of eukaryotic cellular sequences by replication-defective retroviruses.
  • transfection means the uptake of foreign or exogenous DNA by a cell, and a cell has been "transfected” when the exogenous DNA has been introduced inside the cell membrane. A number of transfection techniques are well known in the art and are disclosed herein.
  • transformation refers to a change in a cell's genetic characteristics, and a cell has been transformed when it has been modified to contain new DNA or RNA.
  • a cell is transformed where it is genetically modified from its native state by introducing new genetic material via transfection, transduction, or other techniques.
  • the transforming DNA can recombine with that of the cell by physically integrating into a chromosome of the cell, or can be maintained transiently as an episomal element without being replicated, or can replicate independently as a plasmid.
  • a cell is considered to have been "stably transformed” when the transforming DNA is replicated with the division of the cell.
  • polypeptide or "protein” are used interchangeably herein to refer to a polymer of amino acid residues.
  • the terms also apply to amino acid polymers in which one or more amino acid residues is an analog or mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers.
  • the terms can also encompass amino acid polymers that have been modified, e.g., by the addition of carbohydrate residues to form glycoproteins, or phosphorylated.
  • Polypeptides and proteins can be produced by a naturally-occurring and non-recombinant cell, or polypeptides and proteins can be produced by a genetically-engineered or recombinant cell.
  • Polypeptides and proteins can comprise molecules having the amino acid sequence of a native protein, or molecules having deletions from, additions to, and/or substitutions of one or more amino acids of the native sequence.
  • the terms "polypeptide” and "protein” encompass antigen binding proteins that specifically or selectively bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ - Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, or sequences that have deletions from, additions to, and/or substitutions of one or more amino acids of an antigen binding protein that specifically or selectively binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFR
  • polypeptide fragment refers to a polypeptide that has an amino-terminal deletion, a carboxyl-terminal deletion, and/or an internal deletion as compared with the full-length protein. Such fragments can also contain modified amino acids as compared with the full-length protein. In certain embodiments, fragments are about five to 500 amino acids long. For example, fragments can be at least 5, 6, 8, 10, 14, 20, 50, 70, 100, 110, 150, 200, 250, 300, 350, 400, or 450 amino acids long.
  • Useful polypeptide fragments include immunologically functional fragments of antibodies, including binding domains.
  • an antigen binding protein that binds to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, useful fragments include but are not limited to a CDR region, a variable domain of a heavy or light chain, a portion of an antibody chain or just its variable region including two CDRs, and the like.
  • isolated protein means that a subject protein (1) is free of at least some other proteins with which it would normally be found, (2) is essentially free of other proteins from the same source, e.g., from the same species, (3) is expressed by a cell from a different species, (4) has been separated from at least about 50 percent of polynucleotides, lipids, carbohydrates, or other materials with which it is associated in nature, (5) is operably associated (by covalent or noncovalent interaction) with a polypeptide with which it is not associated in nature, or (6) does not occur in nature.
  • an "isolated protein" constitutes at least about 5%, at least about 10%, at least about 25%, or at least about 50%> of a given sample.
  • Genomic DNA, cDNA, mRNA or other RNA, of synthetic origin, or any combination thereof can encode such an isolated protein.
  • the isolated protein is substantially free from proteins or polypeptides or other contaminants that are found in its natural environment that would interfere with its therapeutic, diagnostic, prophylactic, research or other use.
  • a "variant" of a polypeptide comprises an amino acid sequence wherein one or more amino acid residues are inserted into, deleted from and/or substituted into the amino acid sequence relative to another polypeptide sequence.
  • Variants include fusion proteins.
  • a “derivative" of a polypeptide is a polypeptide ⁇ e.g., an antigen binding protein, or an antibody) that has been chemically modified in some manner distinct from insertion, deletion, or substitution variants, e.g., by conjugation to another chemical moiety.
  • Antigen binding region means a protein, or a portion of a protein, that specifically binds a specified antigen, e.g., FGFRlc, ⁇ -Klotho or both FGFRlc and ⁇ -Klotho.
  • a specified antigen e.g., FGFRlc, ⁇ -Klotho or both FGFRlc and ⁇ -Klotho.
  • An antigen binding region typically includes one or more “complementary binding regions” (“CDRs").
  • CDRs complementary binding regions
  • Certain antigen binding regions also include one or more "framework” regions.
  • a “CDR” is an amino acid sequence that contributes to antigen binding specificity and affinity. "Framework” regions can aid in maintaining the proper conformation of the CDRs to promote binding between the antigen binding region and an antigen.
  • recombinant antigen binding proteins that bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, are provided.
  • a "recombinant protein” is a protein made using recombinant techniques, i.e., through the expression of a recombinant nucleic acid as described herein. Methods and techniques for the production of recombinant proteins are well known in the art.
  • antigen binding proteins ⁇ e.g., neutralizing antigen binding proteins, neutralizing antibodies, agonistic antigen binding proteins, agonistic antibodies and binding proteins that bind to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4) that compete for the same epitope or binding site on a target means competition between antigen binding proteins as determined by an assay in which the antigen binding protein ⁇ e.g., antibody or immunologically functional fragment thereof) under study prevents or inhibits the specific binding of a reference molecule ⁇ e.g., a reference ligand, or reference antigen binding protein, such as a reference antibody) to a common antigen ⁇ e.g., FGFRlc, FGFR2c,
  • ⁇ assays Numerous types of competitive binding assays can be used to determine if a test molecule competes with a reference molecule for binding.
  • assays include solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay (see, e.g., Stahli et ah, (1983) Methods in Enzymology 9:242-253); solid phase direct biotin-avidin EIA (see, e.g., Kirkland et ah, (1986) J. Immunol.
  • RIA solid phase direct or indirect radioimmunoassay
  • EIA enzyme immunoassay
  • sandwich competition assay see, e.g., Stahli et ah, (1983) Methods in Enzymology 9:242-253
  • solid phase direct biotin-avidin EIA see, e.g., Kirkland et ah, (1986) J.
  • solid phase direct labeled assay solid phase direct labeled sandwich assay (see, e.g., Harlow and Lane, (1988) Antibodies, A Laboratory Manual, Cold Spring Harbor Press); solid phase direct label RIA using 1-125 label (see, e.g., Morel et ah, (1988) Molec. Immunol. 25 :7- 15); solid phase direct biotin-avidin EIA (see, e.g., Cheung, et ah, (1990) Virology 176:546-552); and direct labeled RIA (Moldenhauer et ah, (1990) Scand. J. Immunol. 32:77-82).
  • such an assay involves the use of a purified antigen bound to a solid surface or cells bearing either of an unlabelled test antigen binding protein or a labeled reference antigen binding protein.
  • Competitive inhibition is measured by determining the amount of label bound to the solid surface or cells in the presence of the test antigen binding protein.
  • the test antigen binding protein is present in excess.
  • Antigen binding proteins identified by competition assay include antigen binding proteins binding to the same epitope as the reference antigen binding proteins and antigen binding proteins binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antigen binding protein for steric hindrance to occur. Additional details regarding methods for determining competitive binding are provided in the examples herein.
  • a competing antigen binding protein when present in excess, it will inhibit specific binding of a reference antigen binding protein to a common antigen by at least 40%, 45%, 50%, 55%, 60%, 65%, 70% or 75%. In some instance, binding is inhibited by at least 80%, 85%, 90%, 95%, or 97% or more.
  • antigen refers to a molecule or a portion of a molecule capable of being bound by a selective binding agent, such as an antigen binding protein (including, e.g., an antibody or immunological functional fragment thereof), and may also be capable of being used in an animal to produce antibodies capable of binding to that antigen.
  • a selective binding agent such as an antigen binding protein (including, e.g., an antibody or immunological functional fragment thereof)
  • an antigen can possess one or more epitopes that are capable of interacting with different antigen binding proteins, e.g., antibodies.
  • epitope means the amino acids of a target molecule that are contacted by an antigen binding protein (for example, an antibody) when the antigen binding protein is bound to the target molecule.
  • an antigen binding protein for example, an antibody
  • the term includes any subset of the complete list of amino acids of the target molecule that are contacted when an antigen binding protein, such as an antibody, is bound to the target molecule.
  • An epitope can be contiguous or non-contiguous (e.g., (i) in a single- chain polypeptide, amino acid residues that are not contiguous to one another in the polypeptide sequence but that within in context of the target molecule are bound by the antigen binding protein, or (ii) in a multimeric receptor comprising two or more individual components, e.g., (i) FGFRlc, FGFR2c, FGFR3c or FGFR4, and (ii) ⁇ -Klotho, amino acid residues that are present on one or more of the individual components, but which are still bound by the antigen binding protein).
  • epitopes can be mimetic in that they comprise a three dimensional structure that is similar to an antigenic epitope used to generate the antigen binding protein, yet comprise none or only some of the amino acid residues found in that epitope used to generate the antigen binding protein.
  • epitopes reside on proteins, but in some instances can reside on other kinds of molecules, such as nucleic acids.
  • Epitope determinants can include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and can have specific three dimensional structural characteristics, and/or specific charge characteristics.
  • antigen binding proteins specific for a particular target molecule will preferentially recognize an epitope on the target molecule in a complex mixture of proteins and/or macromolecules.
  • identity refers to a relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules, as determined by aligning and comparing the sequences. "Percent identity” means the percent of identical residues between the amino acids or nucleotides in the compared molecules and is calculated based on the size of the smallest of the molecules being compared. For these calculations, gaps in alignments (if any) must be addressed by a particular mathematical model or computer program (i.e., an "algorithm”). Methods that can be used to calculate the identity of the aligned nucleic acids or polypeptides include those described in Computational Molecular Biology, (Lesk, A.
  • the sequences being compared are aligned in a way that gives the largest match between the sequences.
  • the computer program used to determine percent identity is the GCG program package, which includes GAP (Devereux et al, (1984) Nucl. Acid Res. 12:387; Genetics Computer Group, University of Wisconsin, Madison, WI).
  • GAP is used to align the two polypeptides or polynucleotides for which the percent sequence identity is to be determined.
  • the sequences are aligned for optimal matching of their respective amino acid or nucleotide (the "matched span", as determined by the algorithm).
  • a gap opening penalty (which is calculated as 3x the average diagonal, wherein the "average diagonal” is the average of the diagonal of the comparison matrix being used; the “diagonal” is the score or number assigned to each perfect amino acid match by the particular comparison matrix) and a gap extension penalty (which is usually 1/10 times the gap opening penalty), as well as a comparison matrix such as PAM 250 or BLOSUM 62 are used in conjunction with the algorithm.
  • a standard comparison matrix ⁇ see, Dayhoff et al, (1978) Atlas of Protein Sequence and Structure 5:345-352 for the PAM 250 comparison matrix; Henikoff et al, (1992) Proc. Natl. Acad. Sci. U.S.A. 89: 10915-10919 for the BLOSUM 62 comparison matrix) is also used by the algorithm.
  • Certain alignment schemes for aligning two amino acid sequences can result in matching of only a short region of the two sequences, and this small aligned region can have very high sequence identity even though there is no significant relationship between the two full-length sequences. Accordingly, the selected alignment method ⁇ e.g., the GAP program) can be adjusted if so desired to result in an alignment that spans at least 50 contiguous amino acids of the target polypeptide.
  • substantially pure means that the described species of molecule is the predominant species present, that is, on a molar basis it is more abundant than any other individual species in the same mixture.
  • a substantially pure molecule is a composition wherein the object species comprises at least 50% (on a molar basis) of all macromolecular species present.
  • a substantially pure composition will comprise at least 80%, 85%, 90%, 95%, or 99% of all macromolecular species present in the composition.
  • the object species is purified to essential homogeneity wherein contaminating species cannot be detected in the composition by conventional detection methods and thus the composition consists of a single detectable macromolecular species.
  • treat and “treating” refer to any indicia of success in the treatment or amelioration of an injury, pathology or condition, including any objective or subjective parameter such as abatement; remission; diminishing of symptoms or making the injury, pathology or condition more tolerable to the patient; slowing in the rate of degeneration or decline; making the final point of degeneration less debilitating; improving a patient's physical or mental well-being.
  • the treatment or amelioration of symptoms can be based on objective or subjective parameters; including the results of a physical examination, neuropsychiatric exams, and/or a psychiatric evaluation.
  • certain methods presented herein can be employed to treat Type 2 diabetes, obesity and/or dyslipidemia, either prophylactically or as an acute treatment, to decrease plasma glucose levels, to decrease circulating triglyceride levels, to decrease circulating cholesterol levels and/or ameliorate a symptom associated with type 2 diabetes, obesity and dyslipidemia.
  • an “effective amount” is generally an amount sufficient to reduce the severity and/or frequency of symptoms, eliminate the symptoms and/or underlying cause, prevent the occurrence of symptoms and/or their underlying cause, and/or improve or remediate the damage that results from or is associated with diabetes, obesity and dyslipidemia.
  • the effective amount is a therapeutically effective amount or a prophylactically effective amount.
  • a “therapeutically effective amount” is an amount sufficient to remedy a disease state (e.g., diabetes, obesity or dyslipidemia) or symptoms, particularly a state or symptoms associated with the disease state, or otherwise prevent, hinder, retard or reverse the progression of the disease state or any other undesirable symptom associated with the disease in any way whatsoever.
  • a “prophylactically effective amount” is an amount of a pharmaceutical composition that, when administered to a subject, will have the intended prophylactic effect, e.g., preventing or delaying the onset (or reoccurrence) of diabetes, obesity or dyslipidemia, or reducing the likelihood of the onset (or reoccurrence) of diabetes, obesity or dyslipidemia or associated symptoms.
  • the full therapeutic or prophylactic effect does not necessarily occur by administration of one dose, and can occur only after administration of a series of doses.
  • a therapeutically or prophylactically effective amount can be administered in one or more administrations.
  • amino acid takes its normal meaning in the art. The twenty naturally-occurring amino acids and their abbreviations follow conventional usage. See, Immunology-A Synthesis, 2 nd Edition, (E. S. Golub and D. R. Green, eds.), Sinauer Associates: Sunderland, Mass. (1991), incorporated herein by reference for any purpose.
  • Stereoisomers e.g., D-amino acids of the twenty conventional amino acids, unnatural or non-naturally occurring amino acids such as ⁇ -, ⁇ - disubstituted amino acids, N-alkyl amino acids, and other unconventional amino acids can also be suitable components for polypeptides and are included in the phrase "amino acid.”
  • non-naturally amino acids include: 4-hydroxyproline, ⁇ - carboxyglutamate, ⁇ - ⁇ , ⁇ , ⁇ -trimethyllysine, ⁇ - ⁇ -acetyllysine, O-phosphoserine, N-acetylserine, N-formylmethionine, 3-methylhistidine, 5 -hydroxy lysine, ⁇ - ⁇ -methylarginine, and other similar amino acids and imino acids (e.g., 4-hydroxyproline).
  • the left-hand direction is the amino terminal direction and the right-hand direction is the carboxyl-terminal direction, in accordance with standard usage and convention.
  • a non-limiting lists of examples of non-naturally occurring amino acids that can be inserted into an antigen binding protein sequence or substituted for a wild-type residue in an antigen binding sequence include ⁇ -amino acids, homoamino acids, cyclic amino acids and amino acids with derivatized side chains.
  • Examples include (in the L-form or D-form; abbreviated as in parentheses): citrulline (Cit), homocitrulline (hCit), Na-methylcitrulline (NMeCit), Na-methylhomocitrulline (Na-MeHoCit), ornithine (Orn), Na-Methylornithine (Na-MeOrn or NMeOrn), sarcosine (Sar), homolysine (hLys or hK), homoarginine (hArg or hR), homoglutamine (hQ), Na-methylarginine (NMeR), Na-methylleucine (Na-MeL or NMeL), N-methylhomolysine (NMeHoK), Na- methylglutamine (NMeQ), norleucine (Nle), norvaline (Nva), 1,2,3, 4-tetrahydroisoquino line (Tic), Octahydroindole-2-carboxylic acid
  • Antigen-binding proteins that bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, are provided herein.
  • a unique property of the antigen binding proteins disclosed herein is the agonistic nature of these proteins, specifically the ability to mimic the in vivo effect of FGF21 and to induce FGF21-like signaling.
  • the antigen binding proteins disclosed herein induce FGF21-like signaling in several in vitro cell- based assay, including the ELK-luciferase reporter assay of Example 5 under the following conditions: (1) the binding to and activity of the FGF21 receptor is ⁇ -Klotho dependent; (2) the activity is selective to FGFRlc ⁇ Klotho complex; (3) the binding to the FGFRlc ⁇ Klotho triggers FGF21-like signaling pathways; and (4) the potency (EC50) is comparable to a wild- type FGF21 standard comprising the mature form of SEQ ID NO:2, as measured in the following cell-based assays: (1) the recombinant FGF21 receptor mediated luciferase-reporter cell assay of Example 5; (2) the ERK-phosphorylation in the recombinant FGF21 receptor mediated cell assay of Example 5; and (3) ERK-phosphorylation in human adipocytes as described in more details in Example 7.
  • the disclosed antigen binding proteins therefore, are expected to exhibit activities in vivo that are consistent with the natural biological function of FGF21. This property makes the disclosed antigen binding proteins viable therapeutics for the treatment of metabolic diseases such as type 2 diabetes, obesity, dyslipidemia, NASH, cardiovascular disease, metabolic syndrome and broadly any disease or condition in which it is desirable to mimic or augment the in vivo effects of FGF21.
  • metabolic diseases such as type 2 diabetes, obesity, dyslipidemia, NASH, cardiovascular disease, metabolic syndrome and broadly any disease or condition in which it is desirable to mimic or augment the in vivo effects of FGF21.
  • the antigen binding proteins provided can comprise polypeptides into which one or more complementary determining regions (CDRs) can be embedded and/or joined.
  • CDRs complementary determining regions
  • the CDRs can be embedded into a "framework" region, which orients the CDR(s) such that the proper antigen binding properties of the CDR(s) is achieved.
  • such antigen binding proteins that are provided can facilitate or enhance the interaction between FGFRlc and ⁇ -Klotho, and can substantially induce FGF21- like signaling.
  • antigen binding proteins described herein are antibodies or are derived from antibodies.
  • the polypeptide structure of the antigen binding proteins is based on antibodies, including, but not limited to, monoclonal antibodies, bispecific antibodies, minibodies, domain antibodies, synthetic antibodies (sometimes referred to herein as "antibody mimetics"), chimeric antibodies, humanized antibodies, human antibodies, antibody fusions (sometimes referred to herein as "antibody conjugates”), hemibodies and fragments thereof.
  • the antigen binding proteins provided herein have been demonstrated to bind to (i) ⁇ - Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, and particularly to (i) human ⁇ -Klotho; (ii) human FGFRlc, human FGFR2c, human FGFR3c or human FGFR4; or (iii) a complex comprising human ⁇ -Klotho and one of human FGFRlc, human FGFR2c, human FGFR3c, and human FGFR4.
  • antigen binding proteins As described and shown in the Examples presented herein, based the Western blot results, commercially-available anti ⁇ -Klotho or anti-FGFRlc antibodies bind to denatured ⁇ -Klotho or FGFRlc whereas the antigen binding protein (agonistic antibodies) do not. Conversely, the provided antigen binding proteins recognize the native structure of the FGFRlc and ⁇ -Klotho on the cell surface whereas the commercial antibodies do not, based on the FACS results provided. See Example 9. The antigen binding proteins that are provided therefore mimic the natural in vivo biological activity of FGF21. As a consequence, the antigen binding proteins provided herein are capable of activating FGF21-like signaling activity.
  • the disclosed antigen binding proteins can have one or more of the following activities in vivo: induction of FGF21-like signal transduction pathways, lowering blood glucose levels, lowering circulating lipid levels, improving metabolic parameters and other physiological effects induced in vivo by the formation of the ternary complex of FGFRlc, ⁇ -Klotho and FGF21, for example in conditions such as type 2 diabetes, obesity, dyslipidemia, NASH, cardiovascular disease, and metabolic syndrome.
  • the antigen binding proteins that specifically bind to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4 that are disclosed herein have a variety of utilities.
  • antigen binding proteins are useful in specific binding assays, in the affinity purification of (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, including the human forms of these disclosed proteins, and in screening assays to identify other agonists of FGF21-like signaling activity.
  • the antigen binding proteins that specifically bind can be used in a variety of treatment applications, as explained herein.
  • certain antigen binding proteins are useful for treating conditions associated with FGF21-like signaling processes in a patient, such as reducing, alleviating, or treating type 2 diabetes, obesity, dyslipidemia, NASH, cardiovascular disease, and metabolic syndrome.
  • antigen binding proteins include, for example, diagnosis of diseases or conditions associated with ⁇ -Klotho, FGFRlc, FGFR2c, FGFR3c, FGFR4 or FGF21, and screening assays to determine the presence or absence of these molecules.
  • Some of the antigen binding proteins described herein can be useful in treating conditions, symptoms and/or the pathology associated with decreased FGF21-like signaling activity.
  • Exemplary conditions include, but are not limited to, diabetes, obesity, NASH and dyslipidemia.
  • FGF21 FGF21
  • the antigen binding proteins disclosed herein induce FGF21 -mediated signaling, as defined herein.
  • the mature form of FGF21 is the active form of the molecule.
  • the nucleotide sequence encoding full length FGF21 is provided; the nucleotides encoding the signal sequence are underlined.
  • the antigen binding proteins disclosed herein bind to FGFRlc, in particular human FGFRlc, when associated with ⁇ -Klotho.
  • the nucleotide sequence encoding human FGFRlc (GenBank Accession Number NM 023110) is provided:
  • the antigen binding proteins described herein bind the extracellular portion of FGFRlc.
  • An example of an extracellular region of FGFRlc is:
  • FGFRlc proteins can also include fragments.
  • the terms are used interchangeably to mean a receptor, in particular and unless otherwise specified, a human receptor, that upon association with ⁇ -Klotho and FGF21 induces FGF21-like signaling activity.
  • FGFRlc also includes post-translational modifications of the FGFRlc amino acid sequence, for example, possible N-linked glycosylation sites.
  • the antigen binding proteins can bind to or be generated from proteins glycosylated at one or more of the positions. ⁇ - lotho
  • the antigen binding proteins disclosed herein bind to ⁇ -Klotho, in particular human ⁇ - Klotho.
  • the nucleotide sequence encoding human ⁇ -Klotho (GenBank Accession Number NM_175737) is provided:
  • the antigen binding proteins described herein bind the extracellular portion of ⁇ -Klotho.
  • ample of an extracellular region of ⁇ -Klotho is: MKPGC AAGSPGNE WIFF STDEITTRYRNTM SNGGLQRS VIL S ALILLRAVTGF S G DGRAIWSK PNFTPVNESQLFLYDTFPK FFWGIGTGALQVEGSWKKDGKGPSI WDHFIHTHLK VSSTNGSSDSYIFLEKDLSALDFIGVSFYQFSISWPRLFPDGIVTV ANAKGLQYYSTLLDALVLRNIEPIVTLYHWDLPLALQEKYGGWK DTIIDIFNDY ATYCFQMFGDRVKYWITIHNPYLVAWHGYGTGMHAPGEKGNLAAVYTVGHNL IKAHSKVWHNYNTHFRPHQKGWLSITLGSHWIEPNRSENTMDIFKCQQSMVSVL GWFANPIHGDGDYPEGMRK LFSVLPIFSEA
  • the murine form of ⁇ -Klotho, and fragments and subsequences thereof, can be of use in studying and/or constructing the molecules provided herein.
  • the nucleotide sequence encoding murine ⁇ -Klotho (GenBank Accession Number NM 031180) is provided:
  • ⁇ -Klotho proteins can also include fragments.
  • the terms are used interchangeably to mean a co-receptor, in particular and unless otherwise specified, a human co-receptor, that upon association with FGFRlc and FGF21 induces FGF21- like signaling activity.
  • ⁇ -Klotho also includes post-translational modifications of the ⁇ -Klotho amino acid sequence, for example, possible N-linked glycosylation sites.
  • the antigen binding proteins can bind to or be generated from proteins glycosylated at one or more of the positions.
  • Antigen Binding Proteins that Specifically Bind One or More of ⁇ -Klotho, FGFRlc, FGFR2c, FGFR3C, FGFR4c
  • a variety of selective binding agents useful for modulating FGF21-like signaling are provided. These agents include, for instance, antigen binding proteins that contain an antigen binding domain (e.g. , single chain antibodies, domain antibodies, hemibodies, immunoadhesions, and polypeptides with an antigen binding region) and specifically bind to FGFRlc, ⁇ -Klotho or both FGFRlc and ⁇ -Klotho, in particular human FGFRlc and human ⁇ -Klotho.
  • an antigen binding domain e.g. , single chain antibodies, domain antibodies, hemibodies, immunoadhesions, and polypeptides with an antigen binding region
  • agents for example, are useful in mimicking the signaling effect generated in vivo by the association of FGFRlc with ⁇ -Klotho and with FGF21, and can thus be used to enhance or modulate one or more activities associated with FGF21-like signaling.
  • the antigen binding proteins that are provided typically comprise one or more CDRs as described herein (e.g., 1, 2, 3, 4, 5 or 6 CDRs).
  • the antigen binding proteins are naturally expressed by clones, while in other embodiments, the antigen binding protein can comprise (a) a polypeptide framework structure and (b) one or more CDRs that are inserted into and/or joined to the polypeptide framework structure.
  • a CDR forms a component of a heavy or light chains expressed by the clones described herein; in other embodiments a CDR can be inserted into a framework in which the CDR is not naturally expressed.
  • a polypeptide framework structure can take a variety of different forms.
  • a polypeptide framework structure can be, or comprise, the framework of a naturally occurring antibody, or fragment or variant thereof, or it can be completely synthetic in nature. Examples of various antigen binding protein structures are further described below.
  • the polypeptide framework structure of an antigen binding protein is an antibody or is derived from an antibody, including, but not limited to, monoclonal antibodies, bispecific antibodies, minibodies, domain antibodies, synthetic antibodies (sometimes referred to herein as "antibody mimetics"), chimeric antibodies, humanized antibodies, antibody fusions (sometimes referred to as "antibody conjugates"), and portions or fragments of each, respectively.
  • the antigen binding protein is an immunological fragment of an antibody (e.g., a Fab, a Fab', a F(ab') 2 , or a scFv).
  • antigen binding proteins specifically bind to (i) ⁇ - Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, including the human forms of these proteins .
  • an antigen binding protein specifically binds to both human FGFRlc comprising the amino acid sequence of SEQ ID NO:5, and human ⁇ -Klotho comprising the amino acid sequence of SEQ ID NO: 8, and in another embodiment an antigen binding protein specifically binds to both human FGFRlc comprising the amino acid sequence of SEQ ID NO:5 and human ⁇ -Klotho having the amino acid sequence of SEQ ID NO: 8 and induces FGF21-like signaling.
  • an antigen binding protein can, but need not, induce FGF21-like signaling.
  • antigen binding proteins that specifically bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, including the human forms of these proteins that are provided herein have a structure typically associated with naturally occurring antibodies.
  • the structural units of these antibodies typically comprise one or more tetramers, each composed of two identical couplets of polypeptide chains, though some species of mammals also produce antibodies having only a single heavy chain.
  • each pair or couplet includes one full-length "light” chain (in certain embodiments, about 25 kDa) and one full-length “heavy” chain (in certain embodiments, about 50-70 kDa).
  • Each individual immunoglobulin chain is composed of several "immunoglobulin domains," each consisting of roughly 90 to 110 amino acids and expressing a characteristic folding pattern. These domains are the basic units of which antibody polypeptides are composed.
  • the amino-terminal portion of each chain typically includes a variable domain that is responsible for antigen recognition.
  • the carboxy-terminal portion is more conserved evolutionarily than the other end of the chain and is referred to as the "constant region" or "C region”.
  • Human light chains generally are classified as kappa (" ⁇ ") and lambda (“ ⁇ ") light chains, and each of these contains one variable domain and one constant domain.
  • Heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon chains, and these define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
  • IgG has several subtypes, including, but not limited to, IgGl, IgG2, IgG3, and IgG4.
  • IgM subtypes include IgM, and IgM2.
  • IgA subtypes include IgAl and IgA2.
  • the IgA and IgD isotypes contain four heavy chains and four light chains; the IgG and IgE isotypes contain two heavy chains and two light chains; and the IgM isotype contains five heavy chains and five light chains.
  • the heavy chain C region typically comprises one or more domains that can be responsible for effector function. The number of heavy chain constant region domains will depend on the isotype. IgG heavy chains, for example, each contain three C region domains known as C H I , C H 2 and C H 3.
  • the antibodies that are provided can have any of these isotypes and subtypes.
  • an antigen binding protein that specifically binds one or more of (i) ⁇ - Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4 is an antibody of the IgGl, IgG2, or IgG4 subtype.
  • variable and constant regions are joined by a "J" region of about twelve or more amino acids, with the heavy chain also including a "D” region of about ten more amino acids.
  • the variable regions of each light/heavy chain pair typically form the antigen binding site.
  • IgG2 heavy constant domain of an exemplary monoclonal antibody that specifically binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4 has the amino acid sequence: ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGV
  • a kappa light constant domain of an exemplary monoclonal antibody that binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ - Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4 has the amino acid sequence:
  • a lambda light constant domain of an exemplary monoclonal antibody that binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4 has the amino acid sequence:
  • VAPTECS SEQ ID NO: 1
  • Variable regions of immunoglobulin chains generally exhibit the same overall structure, comprising relatively conserved framework regions (FR) joined by three hypervariable regions, more often called “complementarity determining regions” or CDRs.
  • the CDRs from the two chains of each heavy chain/light chain pair mentioned above typically are aligned by the framework regions to form a structure that binds specifically with a specific epitope on the target protein (e.g., (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4).
  • a specific epitope on the target protein e.g., (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a
  • FRl From N-terminal to C-terminal, naturally-occurring light and heavy chain variable regions both typically conform with the following order of these elements: FRl, CDRl, FR2, CDR2, FR3, CDR3 and FR4.
  • a numbering system has been devised for assigning numbers to amino acids that occupy positions in each of these domains. This numbering system is defined in Kabat Sequences of Proteins of Immunological Interest (1987 and 1991, NIH, Bethesda, MD).
  • the CDRs can also be redefined according an alternative nomenclature scheme, such as that of Chothia (see Chothia & Lesk, 1987, J. Mol. Biol. 196:901-917; Chothia et al, 1989, Nature 342:878-883 or Honegger & Pluckthun, 2001, J. Mol. Biol. 309:657-670.
  • the various heavy chain and light chain variable regions of antigen binding proteins provided herein are depicted in Table 2. Each of these variable regions can be attached to the above heavy and light chain constant regions to form a complete antibody heavy and light chain, respectively. Further, each of the so-generated heavy and light chain sequences can be combined to form a complete antibody structure. It should be understood that the heavy chain and light chain variable regions provided herein can also be attached to other constant domains having different sequences than the exemplary sequences listed above.
  • Tables 1A and IB Specific examples of some of the full length light and heavy chains of the antibodies that are provided and their corresponding amino acid sequences are summarized in Tables 1A and IB.
  • Table 1A shows exemplary light chain sequences
  • Table IB shows exemplary heavy chain sequences.
  • each of the exemplary heavy chains (HI, H2, H3 etc.) listed in Table IB and 6 A, infra can be combined with any of the exemplary light chains shown in Table 1 A and 6A, infra, to form an antibody.
  • Examples of such combinations include HI combined with any of LI through L18; H2 combined with any of LI through L18; H3 combined with any of LI through LI 8, and so on.
  • the antibodies include at least one heavy chain and one light chain from those listed in Tables 1A and IB and 6A, infra; particular examples pairings of light chains and heavy chains include LI with HI, L2 with H2, L3 with H3, L4 with H4, L5 with H5, L6 with H6, L7 with H7, L8 with H8, L9 with H9, L10 with H10, LI 1 with HI 1, L12 with H12, L13 with H13, L14 with H14, L15 with H15, L16 with H16, L17 with H17, and L18 with H18.
  • a heavy chain from a first clone can be paired with a light chain from a second clone ⁇ e.g., a heavy chain from 46D11 paired with a light chain from 16H7 or a heavy chain from 16H7 paired with a light chain from 46D11).
  • a heavy chain from 46D11 paired with a light chain from 16H7 or a heavy chain from 16H7 paired with a light chain from 46D11
  • such pairings can include VL with 90% or greater homology can be paired with the heavy chain of the naturally occurring clone.
  • the antibodies comprise two different heavy chains and two different light chains listed in Tables 1A and IB and 6A, infra. In other instances, the antibodies contain two identical light chains and two identical heavy chains.
  • an antibody or immunologically functional fragment can include two HI heavy chains and two LI light chains, or two H2 heavy chains and two L2 light chains, or two H3 heavy chains and two L3 light chains and other similar combinations of pairs of light chains and pairs of heavy chains as listed in Tables 1A and IB and 6 A, infra.
  • a hemibody is a monovalent antigen binding protein comprising (i) an intact light chain, and (ii) a heavy chain fused to an Fc region ⁇ e.g., an IgG2 Fc region of SEQ ID NO:441), optionally via a linker,
  • the linker can be a (G 4 S) X linker where "x" is a non-zero integer ⁇ e.g., (G 4 S) 8 ; SEQ ID NO:440).
  • Hemibodies can be constructed using the provided heavy and light chain components. Specific examples of hemibodies are disclosed in Example 14.
  • antigen binding proteins that are provided are variants of antibodies formed by combination of the heavy and light chains shown in Tables 1A and IB and 6 A, infra and comprise light and/or heavy chains that each have at least 70%, 75%, 80%>, 85%, 90%, 95%, 96%), 97%), 98%) or 99% identity to the amino acid sequences of these chains.
  • such antibodies include at least one heavy chain and one light chain, whereas in other instances the variant forms contain two identical light chains and two identical heavy chains.
  • antigen binding proteins that contain an antibody heavy chain variable region selected from the group consisting of V H 1, V H 2, V H 3, V H 4, V H 5, V H 6, V H 7, V H 8, V H 9, V H I O, V h 11, V h 12, V h 13, V h 14, V h 15, V h 16, V h 17 and V H 18 as shown in Table 2B and/or an antibody light chain variable region selected from the group consisting of V L I , V L 2, V L 3, V L 4, V L 5, V L 6, V L 7, V L 8, V L 9, V L 10, V L 11, V L 12, V L 13, V L 14, V L 15, V L 16, V L 17 and V L 18 as shown in Table 2A, and immunologically functional fragments, derivatives, muteins and variants of these light chain and heavy chain variable regions.
  • VNWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTI SKDTSKSQVVLTMTNMDPVDTATYYCARVRIAGD YYYYYGMD VWGQGTTVTVSS

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Diabetes (AREA)
  • Zoology (AREA)
  • Epidemiology (AREA)
  • Toxicology (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Cell Biology (AREA)
  • Endocrinology (AREA)
  • Emergency Medicine (AREA)
  • Biotechnology (AREA)
  • Inorganic Chemistry (AREA)
  • Mycology (AREA)
  • Radiology & Medical Imaging (AREA)
  • Microbiology (AREA)
  • Cardiology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Child & Adolescent Psychology (AREA)
  • Pain & Pain Management (AREA)
PCT/US2010/058984 2009-12-07 2010-12-03 Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof WO2011071783A1 (en)

Priority Applications (24)

Application Number Priority Date Filing Date Title
UAA201208326A UA109888C2 (uk) 2009-12-07 2010-03-12 ІЗОЛЬОВАНЕ АНТИТІЛО АБО ЙОГО ФРАГМЕНТ, ЩО ЗВ'ЯЗУЄТЬСЯ З β-КЛОТО, РЕЦЕПТОРАМИ FGF І ЇХНІМИ КОМПЛЕКСАМИ
EP20178046.7A EP3760642A1 (en) 2009-12-07 2010-12-03 Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof
EP10788204.5A EP2510009B1 (en) 2009-12-07 2010-12-03 Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof
KR1020207015902A KR20200067924A (ko) 2009-12-07 2010-12-03 β-KLOTHO, FGF 수용체 및 이들의 복합체에 결합하는 인간 항원 결합 단백질
EP16207166.6A EP3202787B1 (en) 2009-12-07 2010-12-03 Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof
SG2012042008A SG181568A1 (en) 2009-12-07 2010-12-03 Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof
ES10788204.5T ES2633810T3 (es) 2009-12-07 2010-12-03 Proteínas de unión a antígeno humanas que se unen a beta-Klotho, receptores de FGF y complejos de los mismos
EA201270634A EA026129B1 (ru) 2009-12-07 2010-12-03 АНТИГЕНСВЯЗЫВАЮЩИЕ БЕЛКИ ЧЕЛОВЕКА, КОТОРЫЕ СВЯЗЫВАЮТСЯ С β-КЛОТО, РЕЦЕПТОРАМИ FGF И ИХ КОМПЛЕКСАМИ
MX2012006467A MX341148B (es) 2009-12-07 2010-12-03 PROTEINAS DE ENLACE A ANTIGENOS HUMANAS QUE ENLAZAN ß-KLOTHO, RECEPTORES FGF Y COMPLEJOS DE LOS MISMOS.
CR20180020A CR20180020A (es) 2009-12-07 2010-12-03 PROTEÍNAS DE ENLACE A ANTIGENOS HUMANAS QUE ENLAZAN BETA-KLOTHO, RECEPTORES FGF Y COMPLEJOS DE LOS MISMOS. (Divisional 2012-0366)
KR1020127017717A KR101865974B1 (ko) 2009-12-07 2010-12-03 β-ＫＬＯＴＨＯ, ＦＧＦ 수용체 및 이들의 복합체에 결합하는 인간 항원 결합 단백질
AU2010328444A AU2010328444B2 (en) 2009-12-07 2010-12-03 Human antigen binding proteins that bind beta-Klotho, FGF receptors and complexes thereof
CA2782420A CA2782420C (en) 2009-12-07 2010-12-03 Human antigen binding proteins that bind .beta.-klotho, fgf receptors and complexes thereof
JP2012543173A JP5840619B2 (ja) 2009-12-07 2010-12-03 β‐クロトー、ＦＧＦ受容体、およびその複合体と結合するヒト抗原結合タンパク質
MX2016010041A MX360487B (es) 2009-12-07 2010-12-03 PROTEÍNAS DE ENLACE A ANTÍGENOS HUMANAS QUE ENLAZAN ß-KLOTHO, RECEPTORES FGF Y COMPLEJOS DE LOS MISMOS.
KR1020187015615A KR102121678B1 (ko) 2009-12-07 2010-12-03 β-KLOTHO, FGF 수용체 및 이들의 복합체에 결합하는 인간 항원 결합 단백질
BR112012013876-6A BR112012013876B1 (pt) 2009-12-07 2010-12-03 Anticorpo isolado ou um fragmento do mesmo e composição farmacêutica que compreende o mesmo
CN201080063309.5A CN102858802B (zh) 2009-12-07 2010-12-03 结合β‑KLOTHO、FGF受体及其复合物的人抗原结合蛋白
MYPI2012002532A MY173097A (en) 2009-12-07 2010-12-03 Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof
TNP2012000268A TN2012000268A1 (en) 2009-12-07 2012-05-28 Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof
IL220048A IL220048A0 (en) 2009-12-07 2012-05-29 Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof
ZA2012/04145A ZA201204145B (en) 2009-12-07 2012-06-06 Human antigen binding proteins that bind beta-klotho,fgf receptors and complexes thereof
MA35017A MA33854B1 (fr) 2009-12-07 2012-06-28 Protéines de liaison à antigène humain qui se lient à bêta-klotho, aux récepteurs de fgf et aux complexes de ceux-ci
IL261585A IL261585B (en) 2009-12-07 2018-09-04 Human antigen-binding proteins that bind beta-klotho, fgf receptors and their complexes

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US26732109P 2009-12-07 2009-12-07
US61/267,321 2009-12-07
US38184610P 2010-09-10 2010-09-10
US61/381,846 2010-09-10

Publications (1)

Publication Number Publication Date
WO2011071783A1 true WO2011071783A1 (en) 2011-06-16

Family

ID=43545013

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2010/058984 WO2011071783A1 (en) 2009-12-07 2010-12-03 Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof

Country Status (36)

Country Link
US (4) US9284378B2 (zh)
EP (4) EP3202787B1 (zh)
JP (4) JP5840619B2 (zh)
KR (3) KR101865974B1 (zh)
CN (2) CN108586602A (zh)
AR (1) AR079274A1 (zh)
AU (1) AU2010328444B2 (zh)
BR (1) BR112012013876B1 (zh)
CA (2) CA2981687C (zh)
CL (1) CL2012001504A1 (zh)
CR (2) CR20180020A (zh)
CY (1) CY1119000T1 (zh)
DK (1) DK2711375T3 (zh)
EA (2) EA033405B1 (zh)
ES (2) ES2631135T3 (zh)
HR (1) HRP20170882T1 (zh)
HU (1) HUE034727T2 (zh)
IL (2) IL220048A0 (zh)
LT (1) LT2711375T (zh)
MA (1) MA33854B1 (zh)
ME (1) ME02807B (zh)
MX (2) MX360487B (zh)
MY (2) MY173097A (zh)
NZ (2) NZ717847A (zh)
PE (1) PE20121686A1 (zh)
PL (1) PL2711375T3 (zh)
PT (1) PT2711375T (zh)
RS (1) RS56016B1 (zh)
SG (2) SG181568A1 (zh)
SI (1) SI2711375T1 (zh)
TN (1) TN2012000268A1 (zh)
TW (3) TWI693234B (zh)
UA (1) UA109888C2 (zh)
UY (2) UY33089A (zh)
WO (1) WO2011071783A1 (zh)
ZA (1) ZA201204145B (zh)

Cited By (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013033452A2 (en) 2011-08-31 2013-03-07 Amgen Inc. Method of treating or ameliorating type 1 diabetes using fgf21
WO2012170438A3 (en) * 2011-06-06 2013-04-11 Amgen Inc. HUMAN ANTIGEN BINDING PROTEINS THAT BIND TO A COMPLEX COMPRISING β-KLOTHO AND AN FGF RECEPTOR
WO2015100366A1 (en) * 2013-12-23 2015-07-02 Genentech, Inc. Antibodies and methods of use
US9085626B2 (en) 2011-05-16 2015-07-21 Genentech, Inc. FGFR1 agonists and methods of use
US9089525B1 (en) 2011-07-01 2015-07-28 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject
US9273107B2 (en) 2012-12-27 2016-03-01 Ngm Biopharmaceuticals, Inc. Uses and methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US9284378B2 (en) 2009-12-07 2016-03-15 Shaw-Fen Sylvia Hu Human antigen binding proteins that bind β-Klotho, FGF receptors and complexes thereof
US9290557B2 (en) 2012-11-28 2016-03-22 Ngm Biopharmaceuticals, Inc. Compositions comprising variants and fusions of FGF19 polypeptides
WO2017079768A1 (en) 2015-11-08 2017-05-11 Genentech, Inc. Methods of screening for multispecific antibodies
WO2018032785A1 (zh) 2016-08-19 2018-02-22 安源医药科技（上海）有限公司 人成纤维细胞生长因子21融合蛋白及其制备方法与用途
US9925242B2 (en) 2012-12-27 2018-03-27 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of nonalcoholic steatohepatitis
US9963494B2 (en) 2012-11-28 2018-05-08 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject
EP3331914A1 (en) * 2015-08-03 2018-06-13 Novartis AG Methods of treating fgf21-associated disorders
WO2018146594A1 (en) * 2017-02-08 2018-08-16 Novartis Ag Fgf21 mimetic antibodies and uses thereof
US10093735B2 (en) 2014-01-24 2018-10-09 Ngm Biopharmaceuticals, Inc. Beta-klotho binding proteins
US10369199B2 (en) 2013-10-28 2019-08-06 Ngm Biopharmaceuticals, Inc. Methods of using variants of FGF19 polypeptides for the treatment of cancer
US10398758B2 (en) 2014-05-28 2019-09-03 Ngm Biopharmaceuticals, Inc. Compositions comprising variants of FGF19 polypeptides and uses thereof for the treatment of hyperglycemic conditions
EP3538555A1 (en) * 2016-11-14 2019-09-18 Amgen Inc. Bispecific or biparatopic antigen binding proteins and uses thereof
US10434144B2 (en) 2014-11-07 2019-10-08 Ngm Biopharmaceuticals, Inc. Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders
US10456449B2 (en) 2014-06-16 2019-10-29 Ngm Biopharmaceuticals, Inc. Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US10519240B2 (en) 2014-03-25 2019-12-31 Regeneron Pharmaceuticals, Inc. Anti-FGFR1c antibody-FGF21 fusion proteins
US10517929B2 (en) 2014-10-23 2019-12-31 Ngm Biopharmaceuticals, Inc. Pharmaceutical compositions comprising FGF19 variants
EP3434690A4 (en) * 2016-03-23 2020-04-01 Seoul National University R&DB Foundation ANTIBODY BINDING TO HULL GLYCOPROTEIN OF HEAVY-FEVER-WITH-THROMBOZYTOPENIA-SYNDROME-VIRUS AND THE USE THEREOF
US10744185B2 (en) 2015-11-09 2020-08-18 Ngm Biopharmaceuticals, Inc. Methods of using variants of FGF19 polypeptides for the treatment of pruritus
US10800843B2 (en) 2015-07-29 2020-10-13 Ngm Biopharmaceuticals, Inc. Beta klotho-binding proteins
US11072640B2 (en) 2008-06-04 2021-07-27 Amgen Inc. Methods of treating non-alcoholic steatohepatitis using FGF21 mutants
US11123438B2 (en) 2016-08-19 2021-09-21 Ampsource Biopharma Shanghai Inc. Linker peptide for constructing fusion protein
WO2022003169A1 (en) 2020-07-02 2022-01-06 Sanofi Fgfr1/klb targeting agonistic antigen-binding proteins and conjugates thereof with glp-1r agonistic peptides
US11370841B2 (en) 2016-08-26 2022-06-28 Ngm Biopharmaceuticals, Inc. Methods of treating fibroblast growth factor 19-mediated cancers and tumors
US11471513B2 (en) 2016-08-19 2022-10-18 Ampsource Biopharma Shanghai Inc. Highly glycosylated human blood-clotting factor VIII fusion protein, and manufacturing method and application of same
US11963999B2 (en) 2014-03-11 2024-04-23 Novartis Ag Methods of treating HIV-HAART induced partial lipodystrophy with FGF21 protein variant FC fusion proteins
US11981718B2 (en) 2020-05-27 2024-05-14 Ampsource Biopharma Shanghai Inc. Dual-function protein for lipid and blood glucose regulation

Families Citing this family (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7981420B2 (en) 2000-12-22 2011-07-19 Max-Planck-Gesellschaft Zur Foederung Der Wissenschaften E.V. Therapeutic use of antibodies directed against repulsive guidance molecule (RGM)
JPWO2002077546A1 (ja) * 2001-03-14 2004-07-15 積水化学工業株式会社 ヒートポンプ及びヒートポンプシステム
US8906864B2 (en) 2005-09-30 2014-12-09 AbbVie Deutschland GmbH & Co. KG Binding domains of proteins of the repulsive guidance molecule (RGM) protein family and functional fragments thereof, and their use
US8962803B2 (en) 2008-02-29 2015-02-24 AbbVie Deutschland GmbH & Co. KG Antibodies against the RGM A protein and uses thereof
ES2562832T3 (es) * 2009-12-08 2016-03-08 Abbvie Deutschland Gmbh & Co Kg Anticuerpos monoclonales contra la proteína RGM para su uso en el tratamiento de la degeneración de la capa de fibra nerviosa de la retina
JP2014513981A (ja) * 2011-05-10 2014-06-19 アムジエン・インコーポレーテツド ＦＧＦＲ１とβ−ＫＬＯＴＨＯの相互作用を特異的に調節する化合物の同定方法
JP6635655B2 (ja) * 2011-12-08 2020-01-29 アムジエン・インコーポレーテツド ヒトｌｃａｔ抗原結合タンパク質および治療法におけるそれらの使用
CN107880124B (zh) 2012-01-27 2021-08-13 艾伯维德国有限责任两合公司 用于诊断和治疗与神经突变性相关的疾病的组合物和方法
ES2774160T3 (es) 2012-02-13 2020-07-17 Seattle Childrens Hospital D/B/A Seattle Childrens Res Institute Receptores de antígenos quiméricos biespecíficos y usos terapéuticos de los mismos
UY35148A (es) 2012-11-21 2014-05-30 Amgen Inc Immunoglobulinas heterodiméricas
BR112015022191A8 (pt) 2013-03-15 2018-01-23 Celgene Avilomics Res Inc compostos heteroarila e usos dos mesmos
US9321786B2 (en) * 2013-03-15 2016-04-26 Celgene Avilomics Research, Inc. Heteroaryl compounds and uses thereof
MY181020A (en) 2013-03-15 2020-12-16 Sanofi Sa Heteroaryl compounds and uses thereof
WO2014144817A2 (en) 2013-03-15 2014-09-18 Amgen Inc. Inhibitory polypeptides specific to wnt inhibitors
AU2014318017B2 (en) 2013-09-05 2020-02-06 Amgen Inc. Fc-containing molecules exhibiting predictable, consistent, and reproducible glycoform profiles
KR20160097294A (ko) 2013-12-09 2016-08-17 뉴욕 유니버시티 항-포도상구균 제제의 식세포 전달을 위한 조성물 및 방법
AU2015259053B2 (en) 2014-05-16 2020-12-24 Amgen Inc. Assay for detecting Th1 and Th2 cell populations
MX2018003536A (es) 2015-09-24 2018-08-01 Genentech Inc Metodos para el tratamiento de la epilepsia.
CL2015003047A1 (es) * 2015-10-15 2016-06-17 Univ Chile Método ex vivo para detectar precozmente injuria renal aguda en pacientes críticos, que comprende la mediciom en una muestra de tres proteinas como biomarcadores, factor de crecimiento fibroblástico 23, klotho y eritropoyetina
CN107177002B (zh) * 2016-03-09 2021-02-09 郑州鸿运华宁生物医药有限公司 一种能与人β-Klotho受体特异性结合的抗体及其用途
JP2020513813A (ja) 2017-03-14 2020-05-21 アムジエン・インコーポレーテツド 細胞培養において産生される抗体の総非フコシル化グリコフォームの調節
CA3102086A1 (en) * 2017-06-06 2018-12-13 Relinia, Inc. Single-chain tnf receptor 2 agonist fusion proteins
WO2019010314A1 (en) * 2017-07-06 2019-01-10 Yale University COMPOSITIONS AND METHODS FOR TREATING OR PREVENTING ENDOCRINE FGF-RELATED DISEASES
KR101917854B1 (ko) * 2017-08-24 2018-11-12 한국콜마주식회사 세포 수용체 결합능이 있는 펩티드를 포함하는 마이크로 캡슐 및 이를 포함하는 화장료 조성물
JP2021519068A (ja) 2018-03-26 2021-08-10 アムジェン インコーポレイテッド 細胞培養において産生される抗体の総非フコシル化グリコフォーム
EP3801766A1 (en) * 2018-05-31 2021-04-14 Novartis AG Hepatitis b antibodies
CN112239507A (zh) * 2019-07-17 2021-01-19 鸿运华宁（杭州）生物医药有限公司 ETA抗体与TGF-β Trap的融合蛋白质，以及其药物组合物和应用
US20220349898A1 (en) 2019-09-26 2022-11-03 Amgen Inc. Methods of producing antibody compositions
US20230273126A1 (en) 2020-06-04 2023-08-31 Amgen Inc. Assessment of cleaning procedures of a biotherapeutic manufacturing process
MX2023004364A (es) 2020-10-15 2023-05-03 Amgen Inc Glucanos no emparejados relativos en metodos de produccion de anticuerpos.
US20240002477A1 (en) * 2020-12-04 2024-01-04 The University Of Chicago Polypeptides for detection and treatment of coronavirus infection
WO2022235628A1 (en) 2021-05-04 2022-11-10 Regeneron Pharmaceuticals, Inc. Multispecific fgf21 receptor agonists and their uses
AU2022289365A1 (en) 2021-06-07 2023-12-14 Amgen Inc. Using fucosidase to control afucosylation level of glycosylated proteins
CN117813323A (zh) * 2021-09-23 2024-04-02 江苏恒瑞医药股份有限公司 抗klb抗体及用途
AU2022361382A1 (en) 2021-10-05 2024-03-28 Amgen Inc. Fc-gamma receptor ii binding and glycan content
CN118451109A (zh) * 2021-12-30 2024-08-06 上海津曼特生物科技有限公司 抗βKlotho抗体及其应用
WO2023215725A1 (en) 2022-05-02 2023-11-09 Fred Hutchinson Cancer Center Compositions and methods for cellular immunotherapy

Citations (74)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
EP0036676A1 (en) 1978-03-24 1981-09-30 The Regents Of The University Of California Method of making uniformly sized liposomes and liposomes so made
EP0058481A1 (en) 1981-02-16 1982-08-25 Zeneca Limited Continuous release pharmaceutical compositions
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
EP0088046A2 (de) 1982-02-17 1983-09-07 Ciba-Geigy Ag Lipide in wässriger Phase
EP0133988A2 (de) 1983-08-02 1985-03-13 Hoechst Aktiengesellschaft Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung
EP0143949A1 (en) 1983-11-01 1985-06-12 TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION Pharmaceutical composition containing urokinase
WO1987005330A1 (en) 1986-03-07 1987-09-11 Michel Louis Eugene Bergh Method for enhancing glycoprotein stability
US4740461A (en) 1983-12-27 1988-04-26 Genetics Institute, Inc. Vectors and methods for transformation of eucaryotic cells
US4751180A (en) 1985-03-28 1988-06-14 Chiron Corporation Expression using fused genes providing for protein product
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4912040A (en) 1986-11-14 1990-03-27 Genetics Institute, Inc. Eucaryotic expression system
WO1990004036A1 (en) 1988-10-12 1990-04-19 Medical Research Council Production of antibodies from transgenic animals
EP0367566A1 (en) 1988-10-31 1990-05-09 Immunex Corporation Interleukin-4 receptors
US4935233A (en) 1985-12-02 1990-06-19 G. D. Searle And Company Covalently linked polypeptide cell modulators
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US4959455A (en) 1986-07-14 1990-09-25 Genetics Institute, Inc. Primate hematopoietic growth factors IL-3 and pharmaceutical compositions
US4965195A (en) 1987-10-26 1990-10-23 Immunex Corp. Interleukin-7
US4968607A (en) 1987-11-25 1990-11-06 Immunex Corporation Interleukin-1 receptors
US5011912A (en) 1986-12-19 1991-04-30 Immunex Corporation Hybridoma and monoclonal antibody for use in an immunoaffinity purification system
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
EP0460846A1 (en) 1990-06-05 1991-12-11 Immunex Corporation Type II interleukin-1 receptors
WO1992003918A1 (en) 1990-08-29 1992-03-19 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
WO1992015673A1 (en) 1991-03-11 1992-09-17 The University Of Georgia Research Foundation, Inc. Cloning and expression of renilla luciferase
WO1992022646A1 (en) 1991-06-14 1992-12-23 Dnx Corp. Production of human hemoglobin in transgenic pigs
WO1993001227A1 (en) 1991-07-08 1993-01-21 University Of Massachusetts At Amherst Thermotropic liquid crystal segmented block copolymer
WO1993010151A1 (en) 1991-11-22 1993-05-27 Immunex Corporation Receptor for oncostatin m and leukemia inhibitory factor
WO1994002602A1 (en) 1992-07-24 1994-02-03 Cell Genesys, Inc. Generation of xenogeneic antibodies
US5292658A (en) 1989-12-29 1994-03-08 University Of Georgia Research Foundation, Inc. Boyd Graduate Studies Research Center Cloning and expressions of Renilla luciferase
WO1994010308A1 (en) 1992-10-23 1994-05-11 Immunex Corporation Methods of preparing soluble, oligomeric proteins
WO1995007463A1 (en) 1993-09-10 1995-03-16 The Trustees Of Columbia University In The City Of New York Uses of green fluorescent protein
US5457035A (en) 1993-07-23 1995-10-10 Immunex Corporation Cytokine which is a ligand for OX40
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5683888A (en) 1989-07-22 1997-11-04 University Of Wales College Of Medicine Modified bioluminescent proteins and their use
WO1998014605A1 (en) 1996-10-04 1998-04-09 Loma Linda University Renilla luciferase and green fluorescent protein fusion genes
US5741668A (en) 1994-02-04 1998-04-21 Rutgers, The State University Of New Jersey Expression of a gene for a modified green-fluorescent protein
WO1998024893A2 (en) 1996-12-03 1998-06-11 Abgenix, Inc. TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM
WO1998026277A2 (en) 1996-12-12 1998-06-18 Prolume, Ltd. Apparatus and method for detecting and identifying infectious agents
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5777079A (en) 1994-11-10 1998-07-07 The Regents Of The University Of California Modified green fluorescent proteins
US5789650A (en) 1990-08-29 1998-08-04 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5804387A (en) 1996-02-01 1998-09-08 The Board Of Trustees Of The Leland Stanford Junior University FACS-optimized mutants of the green fluorescent protein (GFP)
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5874299A (en) 1990-08-29 1999-02-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5874304A (en) 1996-01-18 1999-02-23 University Of Florida Research Foundation, Inc. Humanized green fluorescent protein genes and methods
US5877293A (en) 1990-07-05 1999-03-02 Celltech Therapeutics Limited CDR grafted anti-CEA antibodies and their production
US5876995A (en) 1996-02-06 1999-03-02 Bryan; Bruce Bioluminescent novelty items
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1999010494A2 (en) 1997-08-25 1999-03-04 Genentech, Inc. Agonist antibodies to the thrombopoietin receptor, and their therapeutic uses
US5886152A (en) 1991-12-06 1999-03-23 Sumitomo Pharmaceuticals Company, Limited Humanized B-B10
US5925558A (en) 1996-07-16 1999-07-20 The Regents Of The University Of California Assays for protein kinases using fluorescent protein substrates
WO1999049019A2 (en) 1998-03-27 1999-09-30 Prolume, Ltd. Luciferases, fluorescent proteins, nucleic acids encoding the luciferases and fluorescent proteins and the use thereof in diagnostics
WO2000009560A2 (en) 1998-08-17 2000-02-24 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
US6054297A (en) 1991-06-14 2000-04-25 Genentech, Inc. Humanized antibodies and methods for making them
US6162963A (en) 1990-01-12 2000-12-19 Abgenix, Inc. Generation of Xenogenetic antibodies
WO2000076310A1 (en) 1999-06-10 2000-12-21 Abgenix, Inc. Transgenic animals for producing specific isotypes of human antibodies via non-cognate switch regions
US6255458B1 (en) 1990-08-29 2001-07-03 Genpharm International High affinity human antibodies and human antibodies against digoxin
US6270964B1 (en) 1997-01-31 2001-08-07 Odyssey Pharmaceuticals Inc. Protein fragment complementation assays for the detection of biological or drug interactions
US6300129B1 (en) 1990-08-29 2001-10-09 Genpharm International Transgenic non-human animals for producing heterologous antibodies
US20030039958A1 (en) 1999-12-03 2003-02-27 Domantis Limited Direct screening method
US20040009507A1 (en) 2000-10-13 2004-01-15 Domantis, Ltd. Concatenated nucleic acid sequence
US6696245B2 (en) 1997-10-20 2004-02-24 Domantis Limited Methods for selecting functional polypeptides
US6713610B1 (en) 1990-01-12 2004-03-30 Raju Kucherlapati Human antibodies derived from immunized xenomice
US20040202995A1 (en) 2003-04-09 2004-10-14 Domantis Nucleic acids, proteins, and screening methods
WO2005037235A2 (en) * 2003-10-16 2005-04-28 Imclone Systems Incorporated Fibroblast growth factor receptor-1 inhibitors and methods of treatment thereof
US20070293430A1 (en) * 2004-12-14 2007-12-20 Frye Christopher C Muteins of Fibroblast Growth Factor 21
US20070299007A1 (en) * 2004-09-02 2007-12-27 Eli Lilly And Company Muteins OF Fibroblast Growth Factor 21
US9300829B2 (en) 2014-04-04 2016-03-29 Canon Kabushiki Kaisha Image reading apparatus and correction method thereof
US9401875B2 (en) 2012-06-01 2016-07-26 Nippon Telegraph And Telephone Corporation Packet transfer processing method and packet transfer processing device

Family Cites Families (131)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
JPS6023084B2 (ja) * 1979-07-11 1985-06-05 味の素株式会社 代用血液
US4376110A (en) * 1980-08-04 1983-03-08 Hybritech, Incorporated Immunometric assays using monoclonal antibodies
US4640835A (en) * 1981-10-30 1987-02-03 Nippon Chemiphar Company, Ltd. Plasminogen activator derivatives
US4496689A (en) * 1983-12-27 1985-01-29 Miles Laboratories, Inc. Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer
DE3572982D1 (en) 1984-03-06 1989-10-19 Takeda Chemical Industries Ltd Chemically modified lymphokine and production thereof
US4945050A (en) * 1984-11-13 1990-07-31 Cornell Research Foundation, Inc. Method for transporting substances into living cells and tissues and apparatus therefor
DE3675588D1 (de) * 1985-06-19 1990-12-20 Ajinomoto Kk Haemoglobin, das an ein poly(alkenylenoxid) gebunden ist.
CA1310924C (en) * 1986-04-24 1992-12-01 Francis P. Mccormick Infective drug delivery system
US4791192A (en) 1986-06-26 1988-12-13 Takeda Chemical Industries, Ltd. Chemically modified protein with polyethyleneglycol
US4970154A (en) * 1987-10-09 1990-11-13 Baylor College Of Medicine Method for inserting foreign genes into cells using pulsed radiofrequency
DE3889853D1 (de) 1987-11-05 1994-07-07 Hybritech Inc Polysaccharidmodifizierte Immunglobuline mit reduziertem immunogenem Potential oder verbesserter Pharmakokinetik.
US5158881A (en) 1987-11-17 1992-10-27 Brown University Research Foundation Method and system for encapsulating cells in a tubular extrudate in separate cell compartments
US5106627A (en) * 1987-11-17 1992-04-21 Brown University Research Foundation Neurological therapy devices
US4892538A (en) * 1987-11-17 1990-01-09 Brown University Research Foundation In vivo delivery of neurotransmitters by implanted, encapsulated cells
US5011472A (en) * 1988-09-06 1991-04-30 Brown University Research Foundation Implantable delivery system for biological factors
CA2006596C (en) 1988-12-22 2000-09-05 Rika Ishikawa Chemically-modified g-csf
US5288855A (en) * 1989-01-23 1994-02-22 Farmitalia Carlo Erba Extracellular form of the human fibroblast growth factor receptor
CA2063431C (en) 1989-07-06 2002-10-29 Lewis T. Williams Receptors for fibroblast growth factors
US5676954A (en) * 1989-11-03 1997-10-14 Vanderbilt University Method of in vivo delivery of functioning foreign genes
US5272071A (en) 1989-12-22 1993-12-21 Applied Research Systems Ars Holding N.V. Method for the modification of the expression characteristics of an endogenous gene of a given cell line
DE69034135T3 (de) 1989-12-22 2012-08-23 Laboratoires Serono S.A. DNS-Konstrukten zur Aktivierung und Veränderung der Expression von endogenen Genen
WO1991010470A1 (en) 1990-01-08 1991-07-25 Brown University Research Foundation Devices and methods for enhanced delivery of active factors
US5672510A (en) * 1990-01-19 1997-09-30 Genetic Therapy, Inc. Retroviral vectors
WO1992000999A1 (en) * 1990-07-06 1992-01-23 Rhone-Poulenc Rorer International (Holdings) Inc. Fibroblast growth factor receptors
US5217889A (en) * 1990-10-19 1993-06-08 Roninson Igor B Methods and applications for efficient genetic suppressor elements
US5252714A (en) * 1990-11-28 1993-10-12 The University Of Alabama In Huntsville Preparation and use of polyethylene glycol propionaldehyde
US5229501A (en) * 1991-01-11 1993-07-20 Chiron Corporation Expression and use of human fibroblast growth factor receptor
US6565841B1 (en) 1991-03-15 2003-05-20 Amgen, Inc. Pulmonary administration of granulocyte colony stimulating factor
IL100219A0 (en) 1991-12-02 1992-09-06 Yeda Res & Dev Variable region within fibroblast growth factor receptors that confers ligand specificity
WO1993015722A1 (en) 1992-02-07 1993-08-19 Syntex (Usa) Inc. Controlled delivery of pharmaceuticals from preformed porous microparticles
US5234784A (en) * 1992-04-01 1993-08-10 Eastman Kodak Company Method of making a projection viewable transparency comprising an electrostatographic toner image
US5364791A (en) * 1992-05-14 1994-11-15 Elisabetta Vegeto Progesterone receptor having C. terminal hormone binding domain truncations
US5489743A (en) * 1993-01-19 1996-02-06 Amgen Inc. Transgenic animal models for thrombocytopenia
US5581476A (en) * 1993-01-28 1996-12-03 Amgen Inc. Computer-based methods and articles of manufacture for preparing G-CSF analogs
JPH08509870A (ja) 1993-05-26 1996-10-22 オンタリオ キャンサー インスティテュート 特定のｃｄ４５イソ型タンパク質の発現を遮断するトランスジェニック哺乳動物
US6664107B1 (en) * 1993-05-26 2003-12-16 Ontario Cancer Institute, University Health Network CD45 disrupted nucleic acid
US5654168A (en) * 1994-07-01 1997-08-05 Basf Aktiengesellschaft Tetracycline-inducible transcriptional activator and tetracycline-regulated transcription units
US5589362A (en) 1993-06-14 1996-12-31 Basf Aktiengesellschaft Tetracycline regulated transcriptional modulators with altered DNA binding specificities
EP0705334A1 (en) * 1993-06-14 1996-04-10 Basf Aktiengesellschaft Tight control of gene expression in eucaryotic cells by tetracycline-responsive promoters
DE69430824T2 (de) 1993-08-12 2003-01-23 Neurotech S.A., Evry Biokompatible immunoisolatorische Kapseln, die genetisch veränderte Zellen enthalten
US5658785A (en) 1994-06-06 1997-08-19 Children's Hospital, Inc. Adeno-associated virus materials and methods
US5484720A (en) * 1994-09-08 1996-01-16 Genentech, Inc. Methods for calcium phosphate transfection
US5824784A (en) 1994-10-12 1998-10-20 Amgen Inc. N-terminally chemically modified protein compositions and methods
US6096871A (en) 1995-04-14 2000-08-01 Genentech, Inc. Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life
MX9709156A (es) 1995-05-26 1998-03-31 Zeneca Ltd Un interruptor de gen que comprende un receptor ecdisona.
KR19990022651A (ko) 1995-06-07 1999-03-25 데이비드 엘. 버스테인 생물학적 사건에 대한 라파마이신 기재 조절방법
EP0832269A1 (en) 1995-06-07 1998-04-01 Baylor College Of Medicine Nucleic acid transporters for delivery of nucleic acids into a cell
AU731826B2 (en) 1996-02-28 2001-04-05 Ariad Pharmaceuticals, Inc. Synthetic Multimerizing Agents
AU728657B2 (en) 1996-03-18 2001-01-18 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
US5679559A (en) * 1996-07-03 1997-10-21 University Of Utah Research Foundation Cationic polymer and lipoprotein-containing system for gene delivery
US6214795B1 (en) * 1996-11-12 2001-04-10 Praecis Pharmaceuticals, Inc. Peptide compounds useful for modulating FGF receptor activity
ATE355371T1 (de) * 1996-12-26 2006-03-15 Kyowa Hakko Kogyo Kk Protein having an activity of suppressing aging
US6133426A (en) * 1997-02-21 2000-10-17 Genentech, Inc. Humanized anti-IL-8 monoclonal antibodies
IL136055A0 (en) 1997-11-25 2001-05-20 Genentech Inc Fibroblast growth factor -19
US6150098A (en) * 1998-02-20 2000-11-21 Amgen Inc. Methods for identifying novel secreted mammalian polypeptides
US6101683A (en) * 1998-04-02 2000-08-15 Avery Dennison Corporation Loop fastener, fastener clip including same and loop fastener dispensing tool
US6548634B1 (en) 1998-09-30 2003-04-15 Chiron Corporation Synthetic peptides having FGF receptor affinity
US6660843B1 (en) 1998-10-23 2003-12-09 Amgen Inc. Modified peptides as therapeutic agents
WO2000027885A1 (fr) 1998-11-05 2000-05-18 Kyowa Hakko Kogyo Co., Ltd. Nouveau popypeptide chimerique
US6656728B1 (en) 1999-02-08 2003-12-02 Chiron Corporation Fibroblast growth factor receptor-immunoglobulin fusion
JP2002539176A (ja) 1999-03-15 2002-11-19 カイロン コーポレイション 眼の疾患を処置または予防するための組換え遺伝子送達ベクターの使用
GB9916482D0 (en) 1999-07-15 1999-09-15 British Aerospace Terrain navigation apparatus for a legged animal traversing terrain
CA2311201A1 (en) * 1999-08-05 2001-02-05 Genset S.A. Ests and encoded human proteins
US7408047B1 (en) * 1999-09-07 2008-08-05 Amgen Inc. Fibroblast growth factor-like polypeptides
US7459540B1 (en) * 1999-09-07 2008-12-02 Amgen Inc. Fibroblast growth factor-like polypeptides
AU7368100A (en) 1999-09-10 2001-04-10 Curagen Corporation Fibroblast growth factor polypeptide and nucleic acids encoding same
WO2001032678A1 (en) * 1999-11-05 2001-05-10 Smithkline Beecham Corporation sbgFGF-19a
US6716626B1 (en) * 1999-11-18 2004-04-06 Chiron Corporation Human FGF-21 nucleic acids
DE60043197D1 (zh) 1999-11-18 2009-12-03 Univ Kyoto
WO2001038357A2 (en) 1999-11-22 2001-05-31 Millennium Pharmaceuticals, Inc. Jaffa, a novel fibroblast growth factor family member and uses therefor
US7108984B2 (en) * 2000-01-12 2006-09-19 Mount Sinai School Of Medicine Methods of identifying modulators of the FGF receptor
US20020081663A1 (en) 2000-01-05 2002-06-27 Conklin Darrell C. Novel FGF homolog ZFGF11
WO2001049849A1 (en) 2000-01-05 2001-07-12 Zymogenetics, Inc. Novel fgf homolog zfgf11
AU5056501A (en) 2000-03-31 2001-10-08 Nobuyuki Itoh Fibroblast growth factor-like molecules and uses thereof
IL139380A0 (en) 2000-10-31 2001-11-25 Prochon Biotech Ltd Active variants of fibroblast growth factor
US20060223114A1 (en) 2001-04-26 2006-10-05 Avidia Research Institute Protein scaffolds and uses thereof
US20030157561A1 (en) 2001-11-19 2003-08-21 Kolkman Joost A. Combinatorial libraries of monomer domains
US20040018499A1 (en) * 2001-06-06 2004-01-29 Lal Preeti G Extracellular messengers
WO2002102972A2 (en) * 2001-06-20 2002-12-27 Prochon Biotech Ltd. Antibodies that block receptor protein tyrosine kinase activation, methods of screening for and uses thereof
JP4444652B2 (ja) * 2001-07-11 2010-03-31 マキシゲン・ホールディングズ・リミテッド Ｇ−ｃｓｆ結合体
AU2002322394A1 (en) 2001-07-30 2003-02-17 Eli Lilly And Company Method for treating diabetes and obesity
US20050187150A1 (en) * 2001-10-31 2005-08-25 New York University Structure-based design and synthesis of FGF inhibitors and FGF modulator compounds
JP2005519891A (ja) 2002-01-15 2005-07-07 イーライ・リリー・アンド・カンパニー 危篤状態の患者における罹病率および死亡率を低下させる方法
EP1332761A1 (en) * 2002-01-31 2003-08-06 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Agonists of fibroblast growth factor receptors (FGFR)
DK1469878T3 (da) * 2002-01-31 2011-07-18 Max Planck Gesellschaft FGFR agonister
CN1162704C (zh) * 2002-06-17 2004-08-18 北京大学 一种检测人血液中Klotho蛋白的方法
WO2004022095A1 (en) 2002-09-04 2004-03-18 Abtech Anti-idiotypic antibodies as vegf or fgf agonists for bone therapy
WO2004023973A2 (en) 2002-09-12 2004-03-25 Incyte Corporation Molecules for diagnostics and therapeutics
US20060263774A1 (en) * 2002-11-01 2006-11-23 Genentech, Inc. Compositions and methods for the treatment of immune related diseases
AU2003287918A1 (en) * 2002-12-20 2004-07-14 Enkam Pharmaceuticals A/S Method of modulation of interaction between receptor and ligand
TWI300430B (en) * 2003-01-10 2008-09-01 Ritek Corp Optical recording medium dye and optical recording medium using thereof
WO2004083381A2 (en) 2003-03-13 2004-09-30 Indiana University Advanced Research & Technology Institute Fibroblast growth factor receptor-1 polynucleotides, polypeptides, and mutants
JP2006240990A (ja) 2003-05-15 2006-09-14 Kirin Brewery Co Ltd ｋｌｏｔｈｏタンパク質および抗ｋｌｏｔｈｏタンパク質抗体ならびにそれらの用途
CA2526169A1 (en) 2003-06-12 2004-12-23 Eli Lilly And Company Fusion proteins
PT1641823E (pt) * 2003-06-12 2011-11-08 Lilly Co Eli Proteínas de fusão de análogos de glp-1
BRPI0416683A (pt) * 2003-12-10 2007-01-30 Lilly Co Eli muteìna de fator de crescimento de fibroblasto de humano 21 (fgf-21), ou um seu peptìdeo biologicamente ativo, polinucleotìdeo, vetor de expressão, célula hospedeira, processo para produzir um polipeptìdeo, composição farmacêutica, método para tratar um paciente, e, uso da muteìna fgf-21
US20070248605A1 (en) 2003-12-19 2007-10-25 Five Prime Therapetutics, Inc. Fibroblast Growth Factor Receptors 1,2,3, and 4 as Targets for Therapeutic Intervention
US20090111742A1 (en) 2004-01-26 2009-04-30 Alexei Kharitonenkov Use of fgf-21 and thiazolidinedione for treating type 2 diabetes
CA2557782A1 (en) 2004-03-17 2005-10-06 Eli Lilly And Company Glycol linked fgf-21 compounds
ATE444306T1 (de) * 2004-05-13 2009-10-15 Lilly Co Eli Fgf-21-fusionsproteine
JP4809352B2 (ja) * 2004-09-02 2011-11-09 イーライ リリー アンド カンパニー 線維芽細胞成長因子２１の突然変異タンパク質
US20080176790A1 (en) 2004-10-29 2008-07-24 Defrees Shawn Remodeling and Glycopegylation of Fibroblast Growth Factor (Fgf)
WO2006078463A2 (en) 2005-01-21 2006-07-27 Eli Lilly And Company Method for treating cardiovascular disease
JP2006246823A (ja) 2005-03-11 2006-09-21 Kyoto Univ 造血因子としてのＦｇｆ２１の使用
WO2006130527A2 (en) 2005-05-31 2006-12-07 Novartis Ag Mutations and polymorphisms of fibroblast growth factor receptor 1
EP1910542B1 (en) * 2005-07-22 2009-12-02 Five Prime Therapeutics, Inc. Compositions and methods of treating disease with fgfr fusion proteins
CA2619577A1 (en) * 2005-08-15 2007-02-22 Genentech, Inc. Gene disruptions, compositions and methods relating thereto
WO2007055789A2 (en) 2005-10-31 2007-05-18 Neose Technologies, Inc. Expression of soluble therapeutic proteins
KR20080108487A (ko) 2006-02-28 2008-12-15 트르스티스 오브 보스톤 유니버시티 대사 조절인자 및 그의 용도
CA2655504A1 (en) * 2006-06-15 2007-12-21 Fibron Ltd. Antibodies blocking fibroblast growth factor receptor activation and methods of use thereof
US20080242607A1 (en) * 2006-07-21 2008-10-02 Neose Technologies, Inc. Glycosylation of peptides via o-linked glycosylation sequences
US20100075375A1 (en) * 2006-10-03 2010-03-25 Novo Nordisk A/S Methods for the purification of polypeptide conjugates
JP2010523084A (ja) 2007-03-30 2010-07-15 アンブルックス，インコーポレイテッド 修飾ｆｇｆ−２１ポリペプチド
ES2665996T3 (es) * 2007-04-02 2018-04-30 Genentech, Inc. Anticuerpo agonista de klotho-beta para utilizar en el tratamiento de diabetes mellitus o resistencia a la insulina
JP5187837B2 (ja) * 2007-04-06 2013-04-24 独立行政法人産業技術総合研究所 補助因子による受容体の活性化方法並びにリガンド活性の利用方法
US7537903B2 (en) * 2007-04-23 2009-05-26 Board Of Regents, The University Of Texas System FGF21 upregulates expression of GLUT-1 in a βklotho-dependent manner
EA200901550A1 (ru) 2007-05-22 2010-10-29 Новартис Аг Способы лечения, диагностирования и выявления ассоциированных с fgf21 нарушений
EP2165715B1 (en) 2007-05-29 2013-12-18 Sapporo Medical University Therapeutic agent for cancer, and method for treatment of cancer
WO2008151258A2 (en) 2007-06-04 2008-12-11 Neose Technologies, Inc. O-linked glycosylation using n-acetylglucosaminyl transferases
EP3260129A1 (en) 2007-08-03 2017-12-27 Eli Lilly and Company An fgf-21 compound and a glp-1 compound for use in the treatment of obesity
SG187477A1 (en) 2007-09-26 2013-02-28 U3 Pharma Gmbh Heparin-binding epidermal growth factor-like growth factor antigen binding proteins
TW200936156A (en) * 2008-01-28 2009-09-01 Novartis Ag Methods and compositions using Klotho-FGF fusion polypeptides
JOP20190083A1 (ar) 2008-06-04 2017-06-16 Amgen Inc بولي ببتيدات اندماجية طافرة لـfgf21 واستخداماتها
WO2010006214A1 (en) 2008-07-09 2010-01-14 Ambrx, Inc. Fgf-21 neutralizing antibodies and their uses
JP5787757B2 (ja) * 2008-08-04 2015-09-30 ファイブ プライム セラピューティックス インコーポレイテッド Ｆｇｆｒ細胞外ドメイン酸性領域突然変異タンパク質
AU2009294414A1 (en) 2008-09-19 2010-03-25 Medimmune Llc Antibodies directed to CD105 and uses thereof
EP2356270B1 (en) 2008-11-07 2016-08-24 Fabrus Llc Combinatorial antibody libraries and uses thereof
UY32607A (es) 2009-05-05 2010-12-31 Amgen Inc Mutantes de fgf21 y usos del mismo
EP2506861A1 (en) * 2009-12-02 2012-10-10 Amgen Inc. Binding proteins that bind to human fgfr1c, human b-klotho and both human fgfr1c and human b-klotho
UA109888C2 (uk) 2009-12-07 2015-10-26 ІЗОЛЬОВАНЕ АНТИТІЛО АБО ЙОГО ФРАГМЕНТ, ЩО ЗВ'ЯЗУЄТЬСЯ З β-КЛОТО, РЕЦЕПТОРАМИ FGF І ЇХНІМИ КОМПЛЕКСАМИ

Patent Citations (89)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
EP0036676A1 (en) 1978-03-24 1981-09-30 The Regents Of The University Of California Method of making uniformly sized liposomes and liposomes so made
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
EP0058481A1 (en) 1981-02-16 1982-08-25 Zeneca Limited Continuous release pharmaceutical compositions
EP0088046A2 (de) 1982-02-17 1983-09-07 Ciba-Geigy Ag Lipide in wässriger Phase
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0133988A2 (de) 1983-08-02 1985-03-13 Hoechst Aktiengesellschaft Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung
EP0143949A1 (en) 1983-11-01 1985-06-12 TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION Pharmaceutical composition containing urokinase
US4740461A (en) 1983-12-27 1988-04-26 Genetics Institute, Inc. Vectors and methods for transformation of eucaryotic cells
US4751180A (en) 1985-03-28 1988-06-14 Chiron Corporation Expression using fused genes providing for protein product
US4935233A (en) 1985-12-02 1990-06-19 G. D. Searle And Company Covalently linked polypeptide cell modulators
WO1987005330A1 (en) 1986-03-07 1987-09-11 Michel Louis Eugene Bergh Method for enhancing glycoprotein stability
US4959455A (en) 1986-07-14 1990-09-25 Genetics Institute, Inc. Primate hematopoietic growth factors IL-3 and pharmaceutical compositions
US4912040A (en) 1986-11-14 1990-03-27 Genetics Institute, Inc. Eucaryotic expression system
US5011912A (en) 1986-12-19 1991-04-30 Immunex Corporation Hybridoma and monoclonal antibody for use in an immunoaffinity purification system
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US4965195A (en) 1987-10-26 1990-10-23 Immunex Corp. Interleukin-7
US4968607A (en) 1987-11-25 1990-11-06 Immunex Corporation Interleukin-1 receptors
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
WO1990004036A1 (en) 1988-10-12 1990-04-19 Medical Research Council Production of antibodies from transgenic animals
EP0367566A1 (en) 1988-10-31 1990-05-09 Immunex Corporation Interleukin-4 receptors
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US6180370B1 (en) 1988-12-28 2001-01-30 Protein Design Labs, Inc. Humanized immunoglobulins and methods of making the same
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5693761A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Polynucleotides encoding improved humanized immunoglobulins
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
US5683888A (en) 1989-07-22 1997-11-04 University Of Wales College Of Medicine Modified bioluminescent proteins and their use
US5418155A (en) 1989-12-29 1995-05-23 University Of Georgia Research Foundation, Inc. Isolated Renilla luciferase and method of use thereof
US5292658A (en) 1989-12-29 1994-03-08 University Of Georgia Research Foundation, Inc. Boyd Graduate Studies Research Center Cloning and expressions of Renilla luciferase
US6713610B1 (en) 1990-01-12 2004-03-30 Raju Kucherlapati Human antibodies derived from immunized xenomice
US6162963A (en) 1990-01-12 2000-12-19 Abgenix, Inc. Generation of Xenogenetic antibodies
US6673986B1 (en) 1990-01-12 2004-01-06 Abgenix, Inc. Generation of xenogeneic antibodies
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
EP0460846A1 (en) 1990-06-05 1991-12-11 Immunex Corporation Type II interleukin-1 receptors
US5877293A (en) 1990-07-05 1999-03-02 Celltech Therapeutics Limited CDR grafted anti-CEA antibodies and their production
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
EP0546073A1 (en) 1990-08-29 1993-06-16 Genpharm Int NON-HUMAN TRANSGENETES CAPABLE OF PRODUCING HETEROLOGICAL ANTIBODIES.
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5874299A (en) 1990-08-29 1999-02-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1992003918A1 (en) 1990-08-29 1992-03-19 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5789650A (en) 1990-08-29 1998-08-04 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
EP0546073B1 (en) 1990-08-29 1997-09-10 GenPharm International, Inc. production and use of transgenic non-human animals capable of producing heterologous antibodies
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US6255458B1 (en) 1990-08-29 2001-07-03 Genpharm International High affinity human antibodies and human antibodies against digoxin
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US6300129B1 (en) 1990-08-29 2001-10-09 Genpharm International Transgenic non-human animals for producing heterologous antibodies
WO1992015673A1 (en) 1991-03-11 1992-09-17 The University Of Georgia Research Foundation, Inc. Cloning and expression of renilla luciferase
WO1992022646A1 (en) 1991-06-14 1992-12-23 Dnx Corp. Production of human hemoglobin in transgenic pigs
US6054297A (en) 1991-06-14 2000-04-25 Genentech, Inc. Humanized antibodies and methods for making them
WO1993001227A1 (en) 1991-07-08 1993-01-21 University Of Massachusetts At Amherst Thermotropic liquid crystal segmented block copolymer
US5262522A (en) 1991-11-22 1993-11-16 Immunex Corporation Receptor for oncostatin M and leukemia inhibitory factor
US5426048A (en) 1991-11-22 1995-06-20 Immunex Corporation DNA encoding a fusion receptor for oncostatin M and leukemia inhibitory factor
WO1993010151A1 (en) 1991-11-22 1993-05-27 Immunex Corporation Receptor for oncostatin m and leukemia inhibitory factor
US5886152A (en) 1991-12-06 1999-03-23 Sumitomo Pharmaceuticals Company, Limited Humanized B-B10
WO1994002602A1 (en) 1992-07-24 1994-02-03 Cell Genesys, Inc. Generation of xenogeneic antibodies
WO1994010308A1 (en) 1992-10-23 1994-05-11 Immunex Corporation Methods of preparing soluble, oligomeric proteins
US5457035A (en) 1993-07-23 1995-10-10 Immunex Corporation Cytokine which is a ligand for OX40
WO1995007463A1 (en) 1993-09-10 1995-03-16 The Trustees Of Columbia University In The City Of New York Uses of green fluorescent protein
US5741668A (en) 1994-02-04 1998-04-21 Rutgers, The State University Of New Jersey Expression of a gene for a modified green-fluorescent protein
US5777079A (en) 1994-11-10 1998-07-07 The Regents Of The University Of California Modified green fluorescent proteins
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5874304A (en) 1996-01-18 1999-02-23 University Of Florida Research Foundation, Inc. Humanized green fluorescent protein genes and methods
US5804387A (en) 1996-02-01 1998-09-08 The Board Of Trustees Of The Leland Stanford Junior University FACS-optimized mutants of the green fluorescent protein (GFP)
US5876995A (en) 1996-02-06 1999-03-02 Bryan; Bruce Bioluminescent novelty items
US5925558A (en) 1996-07-16 1999-07-20 The Regents Of The University Of California Assays for protein kinases using fluorescent protein substrates
WO1998014605A1 (en) 1996-10-04 1998-04-09 Loma Linda University Renilla luciferase and green fluorescent protein fusion genes
WO1998024893A2 (en) 1996-12-03 1998-06-11 Abgenix, Inc. TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM
WO1998026277A2 (en) 1996-12-12 1998-06-18 Prolume, Ltd. Apparatus and method for detecting and identifying infectious agents
US6270964B1 (en) 1997-01-31 2001-08-07 Odyssey Pharmaceuticals Inc. Protein fragment complementation assays for the detection of biological or drug interactions
WO1999010494A2 (en) 1997-08-25 1999-03-04 Genentech, Inc. Agonist antibodies to the thrombopoietin receptor, and their therapeutic uses
US6846634B1 (en) 1997-10-20 2005-01-25 Domantis Limited Method to screen phage display libraries with different ligands
US20050202512A1 (en) 1997-10-20 2005-09-15 Domantis Limited Method to screen phage display libraries with different ligands
US6696245B2 (en) 1997-10-20 2004-02-24 Domantis Limited Methods for selecting functional polypeptides
US20040038291A2 (en) 1997-10-20 2004-02-26 Domantis Limited Method to screen phage display libraries with different ligands
WO1999049019A2 (en) 1998-03-27 1999-09-30 Prolume, Ltd. Luciferases, fluorescent proteins, nucleic acids encoding the luciferases and fluorescent proteins and the use thereof in diagnostics
WO2000009560A2 (en) 1998-08-17 2000-02-24 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
WO2000076310A1 (en) 1999-06-10 2000-12-21 Abgenix, Inc. Transgenic animals for producing specific isotypes of human antibodies via non-cognate switch regions
US20030039958A1 (en) 1999-12-03 2003-02-27 Domantis Limited Direct screening method
US20040009507A1 (en) 2000-10-13 2004-01-15 Domantis, Ltd. Concatenated nucleic acid sequence
US20040202995A1 (en) 2003-04-09 2004-10-14 Domantis Nucleic acids, proteins, and screening methods
WO2005037235A2 (en) * 2003-10-16 2005-04-28 Imclone Systems Incorporated Fibroblast growth factor receptor-1 inhibitors and methods of treatment thereof
US20070299007A1 (en) * 2004-09-02 2007-12-27 Eli Lilly And Company Muteins OF Fibroblast Growth Factor 21
US20070293430A1 (en) * 2004-12-14 2007-12-20 Frye Christopher C Muteins of Fibroblast Growth Factor 21
US9401875B2 (en) 2012-06-01 2016-07-26 Nippon Telegraph And Telephone Corporation Packet transfer processing method and packet transfer processing device
US9300829B2 (en) 2014-04-04 2016-03-29 Canon Kabushiki Kaisha Image reading apparatus and correction method thereof

Non-Patent Citations (169)

* Cited by examiner, † Cited by third party
Title
"Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS
"Biocomputing Informatics and Genome Projects", 1993, NEW YORK: ACADEMIC PRESS
"Computational Molecular Biology", 1988, NEW YORK: OXFORD UNIVERSITY PRESS
"Computer Analysis of Sequence Data, Part I", 1994, NEW JERSEY: HUMANA PRESS
"Current Protocols In Immunology", 1993, JOHN WILEY & SONS
"Fundamental Immunology", 1989, RAVEN PRESS
"Immunology-A Synthesis", 1991, SINAUER ASSOCIATES
"Introduction to Protein Structure", 1991, NEW YORK: GARLAND PUBLISHING
"Kabat Sequences of Proteins of Immunological Interest", 1987, NIH
"Methods Enzymol.", vol. 185, 1990, NEW YORK: ACADEMIC PRESS
"Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses", 1980, PLENUM PRESS
"Proteins, Structures and Molecular Principles", 1984, W. H. NEW YORK: FREEMAN AND COMPANY
"Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING COMPANY
"Sequence Analysis Primer", 1991, NEW YORK: M. STOCKTON PRESS
ADAMES ET AL., NATURE, vol. 318, 1985, pages 533 - 538
ALEXANDER ET AL., MOL. CELL. BIOL., vol. 7, 1987, pages 1436 - 1444
ANONYMOUS: "Monoclonal Anti-human/mouse Klotho beta Antibody", 6 February 2007 (2007-02-06), pages 1 - 1, XP002624719, Retrieved from the Internet <URL:http://www.rndsystems.com/pdf/MAB3738.pdf> [retrieved on 20110221] *
APLIN; WRISTON, CRC CRIT. REV. BIOCHEM., 1981, pages 259 - 306
ASHKENAZI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 10535
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1992, GREENE PUBLISHING ASSOCIATES
BAUM ET AL., EMBO J., vol. 13, 1994, pages 3992 - 4001
BEENKEN ANDREW ET AL: "The FGF family: biology, pathophysiology and therapy.", NATURE REVIEWS. DRUG DISCOVERY MAR 2009 LNKD- PUBMED:19247306, vol. 8, no. 3, March 2009 (2009-03-01), pages 235 - 253, XP002624720, ISSN: 1474-1784 *
BENOIST; CHAMBON, NATURE, vol. 290, 1981, pages 304 - 310
BIANCHI; MCGREW, BIOTECH. BIOTECHNOL. BIOENG., vol. 84, 2003, pages 439 - 44
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 26
BIRD, SCIENCE, vol. 242, 1988, pages 423
BLOOM ET AL., PROTEIN SCIENCE, vol. 6, 1997, pages 407
BOWIE ET AL., SCIENCE, vol. 253, 1991, pages 164 - 170
BRENNER ET AL., CURR. OP. STRUCT. BIOL., vol. 7, 1997, pages 369 - 376
BRUGGERMANN ET AL., YEAR IN IMMUNOL., vol. 7, 1993, pages 33
BYRN ET AL., NATURE, vol. 344, 1990, pages 677
CARILLO ET AL., SIAMJ. APPLIED MATH., vol. 48, 1988, pages 1073
CHALFIE ET AL., SCIENCE, vol. 263, 1994, pages 802 - 805
CHEN ET AL., INTERNATIONAL IMMUNOLOGY, vol. 5, 1993, pages 647 - 656
CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546 - 552
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 - 883
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883
CHOTHIA; LESK, J. MOL. BIOL, vol. 196, 1987, pages 901 - 917
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOU ET AL., ADV. ENZYMOL. RELAT. AREAS MOL. BIOL., vol. 47, 1978, pages 45 - 148
CHOU ET AL., ANN. REV. BIOCHEM., vol. 47, 1979, pages 251 - 276
CHOU ET AL., BIOCHEM., vol. 13, 1974, pages 222 - 245
CHOU ET AL., BIOCHEMISTRY, vol. 113, 1974, pages 211 - 222
CHOU ET AL., BIOPHYS. J., vol. 26, 1979, pages 367 - 384
CHU ET AL., GENE, vol. 13, 1981, pages 197
COSMAN ET AL., NATURE, vol. 312, 1984, pages 768
DAVIS ET AL.: "Basic Methods in Molecular Biology", 1986, ELSEVIER
DAYHOFF ET AL., ATLAS OF PROTEIN SEQUENCE AND STRUCTURE, vol. 5, 1978, pages 345 - 352
DE GRAAF ET AL., METHODS MOL BIOL, vol. 178, 2002, pages 379 - 387
DEBOER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 80, 1983, pages 21 - 25
DEVEREUX ET AL., NUCL. ACID RES., vol. 12, 1984, pages 387
DUSKIN ET AL., J. BIOL. CHEM., vol. 257, 1982, pages 3105
EDGE ET AL., ANAL. BIOCHEM., vol. 118, 1981, pages 131
EPPSTEIN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 82, 1985, pages 3688 - 3692
EVANS ET AL., J. MED. CHEM., vol. 30, 1987, pages 1229
FANSLOW ET AL., SEMIN. IMMUNOL., vol. 6, 1994, pages 267 - 278
FAUCHERE, ADV. DRUG RES., vol. 15, 1986, pages 29
FISHWILD ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851
GENETICS COMPUTER GROUP
GRAHAM ET AL., VIROLOGY, vol. 52, 1973, pages 456
GRIBSKOV ET AL., METH. ENZYM., vol. 183, 1990, pages 146 - 159
GRIBSKOV ET AL., PROC. NAT. ACAD. SCI., vol. 84, 1987, pages 4355 - 4358
GROSSCHEDL ET AL., CELL, vol. 38, 1984, pages 647 - 658
HAKIMUDDIN ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 259, 1987, pages 52
HAMMER ET AL., SCIENCE, vol. 253, 1987, pages 53 - 58
HANAHAN, NATURE, vol. 315, 1985, pages 115 - 122
HARDING; LONBERG, ANN. N.Y ACAD. SCI., vol. 764, 1995, pages 536 - 546
HARDING; LONBERG, ANN. N.YACAD. SCI., vol. 764, 1995, pages 536 - 546
HARLOW; LANE: "Antibodies, A Laboratory Manual", 1988, COLD SPRING HARBOR PRESS
HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR
HARLOW; LANE: "Antibodies: A Laboratory Manual", 1990, COLD SPRING HARBOR LABORATORY PRESS
HEIM ET AL., CURR. BIOL., vol. 6, 1996, pages 178 - 182
HENIKOFF ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 89, 1992, pages 10915 - 10919
HOLLENBAUGH ET AL.: "Construction of Immunoglobulin Fusion Proteins", CURRENT PROTOCOLS IN IMMUNOLOGY, vol. 4, 1992, pages 10.19.1 - 10.19.11
HOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 48
HOLM ET AL., NUCL. ACID. RES., vol. 27, 1999, pages 244 - 247
HONEGGER; PLUCKTHUN, J. MOL. BIOL., vol. 309, 2001, pages 657 - 670
HOOGENBOOM ET AL., J. MOL. BIOL., vol. 227, 1991, pages 381
HOPP ET AL., BIO/TECHNOLOGY, vol. 2, 1988, pages 1204
HOPPE ET AL., FEBS LETTERS, vol. 344, 1994, pages 191
HUSTON ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 5879
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 83
ICHIKI ET AL., J. IMMUNOL., vol. 150, 1993, pages 5408 - 5417
INVEST. OPHTHALMOL VIS SCI, vol. 43, 2002, pages 3292 - 3298
ITOH ET AL., TREND GENET., vol. 20, 2004, pages 563 - 69
JAKOBOVITS ET AL., NATURE, vol. 362, 1993, pages 255 - 258
JAKOBOVITS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2551 - 2555
JALKANEN ET AL., J. CELL BIOL., vol. 105, 1987, pages 3087 - 3096
JALKANEN ET AL., J. CELL. BIOL., vol. 101, 1985, pages 976 - 985
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
JONES, CURR. OPIN. STRUCT. BIOL., vol. 7, 1997, pages 377 - 387
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PHS, NIH, NIH PUBLICATION
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE N.I.H.
KEARNEY ET AL., J. IMMUNOL., vol. 123, 1979, pages 1548 - 1550
KELSEY ET AL., GENES AND DEVEL., vol. 1, 1987, pages 161 - 171
KHARITONENKOV ALEXEI ET AL: "THE METABOLIC STATE OF DIABETIC MONKEYS IS REGULATED BY FIBROBLAST GROWTH FACTOR-21", ENDOCRINOLOGY SOCIETY, BALTIMORE, MD, US, vol. 148, no. 2, 1 February 2007 (2007-02-01), pages 774 - 781, XP009078947, ISSN: 0013-7227, DOI: DOI:10.1210/EN.2006-1168 *
KHARITONENKOV ET AL., BIODRUGS, vol. 22, 2008, pages 37 - 44
KHARITONENKOV ET AL., J. CELL PHYSIOL., vol. 215, 2008, pages 1 - 7
KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614 - 3619
KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495
KOLLIAS ET AL., CELL, vol. 46, 1986, pages 89 - 94
KORNDORFER ET AL., PROTEINS: STRUCTURE, FUNCTION, AND BIOINFORMATICS, vol. 53, no. 1, 2003, pages 121 - 129
KORTT ET AL., BIOMOL. ENG., vol. 18, 2001, pages 95 - 108
KORTT ET AL., PROT. ENG., vol. 10, 1997, pages 423
KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553
KRIANGKUM ET AL., BIOMOL. ENG., vol. 18, 2001, pages 31 - 40
KRUMLAUF ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 1639 - 1648
KURO-O ET AL: "Endocrine FGFs and Klothos: emerging concepts", TRENDS IN ENDOCRINOLOGY AND METABOLISM, ELSEVIER SCIENCE PUBLISHING, NEW YORK, NY, US, vol. 19, no. 7, 1 September 2008 (2008-09-01), pages 239 - 245, XP023980904, ISSN: 1043-2760, [retrieved on 20080807], DOI: DOI:10.1016/J.TEM.2008.06.002 *
KUROSU ET AL., J. BIOL. CHEM., vol. 282, 2007, pages 26687 - 26695
KYTE ET AL., J. MOL. BIOL., vol. 157, 1982, pages 105 - 131
LANDSCHULZ ET AL., SCIENCE, vol. 240, 1988, pages 1759
LANGER ET AL., J. BIOMED. MATER. RES., vol. 15, 1981, pages 167 - 277
LANGER, CHEM. TECH., vol. 12, 1982, pages 98 - 105
LANTTO ET AL., METHODS MOL. BIOL., vol. 178, 2002, pages 303 - 316
LEDER ET AL., CELL, vol. 45, 1986, pages 485 - 495
LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859
LONBERG: "Handbook of Exp. Pharmacology", vol. 113, 1994, pages: 49 - 101
LONBERG; HUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93
MACDONALD, HEPATOLOGY, vol. 2, 1987, pages 425 - 515
MARKS ET AL., BIOTECHNOLOGY, vol. 10, 1992, pages 779
MARKS ET AL., J. MOL. BIOL, vol. 222, 1991, pages 581
MASON ET AL., SCIENCE, vol. 234, 1986, pages 1372 - 1378
MENDEZ ET AL., NATURE GENETICS, vol. 15, 1997, pages 146 - 156
MOGRAM ET AL., NATURE, vol. 315, 1985, pages 338 - 340
MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77 - 82
MOREL ET AL., MOLEC. IMMUNOL., vol. 25, 1988, pages 7 - 15
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1985, pages 6851 - 6855
MOULT, CURR. OP. IN BIOTECH., vol. 7, 1996, pages 422 - 427
NANEVICZ ET AL., J. BIOL. CHEM., vol. 270, no. 37, 1995, pages 21619 - 21625
NEEDLEMAN ET AL., J. MOL. BIOL, vol. 48, 1970, pages 443 - 453
NOLAN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 2603 - 2607
OGAWA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 104, 2007, pages 7432 - 7437
ORNITZ ET AL., COLD SPRING HARBOR SYMP. QUANT. BIOL., vol. 50, 1986, pages 399 - 409
PINKERT ET AL., GENES AND DEVEL., vol. 1, 1987, pages 268 - 276
POLJAK ET AL., STRUCTURE, vol. 2, 1994, pages 1121 - 23
PRINSTER ET AL., NATURE, vol. 296, 1982, pages 39 - 42
PROC. NATL. ACAD. SCIENCES USA, vol. 103, 2006, pages 3896 - 3901
READHEAD ET AL., CELL, vol. 48, 1987, pages 703 - 712
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 27
RIZO; GIERASCH, ANN. REV. BIOCHEM., vol. 61, 1992, pages 387
ROQUE ET AL., BIOTECHNOL. PROG., vol. 20, 2004, pages 639 - 654
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 2001
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS
SANI, NATURE, vol. 314, 1985, pages 283 - 286
SIDMAN ET AL., BIOPOLYMERS, vol. 2, 1983, pages 547 - 556
SIPPL ET AL., STRUCTURE, vol. 4, 1996, pages 15 - 19
SONGSIVILAI; LACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321
STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 2, 1983, pages 242 - 253
STAUBER, BIOTECHNIQUES, vol. 24, 1998, pages 462 - 471
SUZUKI MASASHI ET AL: "betaKlotho is required for fibroblast growth factor (FGF) 21 signaling through FGF receptor (FGFR) 1c and FGFR3c.", MOLECULAR ENDOCRINOLOGY (BALTIMORE, MD.) APR 2008 LNKD- PUBMED:18187602, vol. 22, no. 4, April 2008 (2008-04-01), pages 1006 - 1014, XP002624718, ISSN: 0888-8809 *
SWIFT ET AL., CELL, vol. 38, 1984, pages 639 - 646
TAYLOR ET AL., INTERNATIONAL IMMUNOLOGY, vol. 6, 1994, pages 579 - 591
TAYLOR ET AL., NUCLEIC ACIDS RESEARCH, vol. 20, 1992, pages 6287 - 6295
THORNSEN ET AL., PROC. NATL. ACAD. U.S.A., vol. 81, 1984, pages 659 - 663
THORNTON ET AL., NATURE, vol. 354, 1991, pages 105
THOTAKURA ET AL., METH. ENZYMOL., vol. 138, 1987, pages 350
TIJSSEN: "Practice and Theory of Enzyme Immunoassays", vol. 15, 1993, ELSEVIER
TUAILLON ET AL., J. IMMUNOL., vol. 152, 1994, pages 2912 - 2920
VEBER; FREIDINGER, TINS, 1985, pages 392
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536
VILLA-KAMAROFF ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 75, 1978, pages 3727 - 3731
VON HEINJE, G.: "Sequence Analysis in Molecular Biology", 1987, NEW YORK: ACADEMIC PRESS
WAGNER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 78, 1981, pages 1444 - 1445
WARD ET AL., NATURE, vol. 334, 1989, pages 544
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546
XU JING ET AL: "Fibroblast Growth Factor 21 Reverses Hepatic Steatosis, Increases Energy Expenditure, and Improves Insulin Sensitivity in Diet-Induced Obese Mice", DIABETES, AMERICAN DIABETES ASSOCIATION, US, vol. 58, no. 1, 1 January 2009 (2009-01-01), pages 250 - 259, XP009144078, ISSN: 0012-1797 *
YAMAMOTO ET AL., CELL, vol. 22, 1980, pages 787 - 797
ZOLA: "Monoclonal Antibodies: A Manual of Techniques", 1987, CRC PRESS, INC., pages: 147 - 158
ZUPNICK ET AL., J. BIOL. CHEM., vol. 281, no. 29, 2006, pages 20464 - 20473

Cited By (86)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11840558B2 (en) 2008-06-04 2023-12-12 Amgen Inc. Methods of treating non-alcoholic steatohepatitis using FGF21 mutants
US11072640B2 (en) 2008-06-04 2021-07-27 Amgen Inc. Methods of treating non-alcoholic steatohepatitis using FGF21 mutants
US12116413B2 (en) 2009-12-07 2024-10-15 Amgen Inc. Human antigen binding proteins that bind β-klotho, FGF receptors and complexes thereof
US9284378B2 (en) 2009-12-07 2016-03-15 Shaw-Fen Sylvia Hu Human antigen binding proteins that bind β-Klotho, FGF receptors and complexes thereof
US10570205B2 (en) 2009-12-07 2020-02-25 Amgen, Inc. Human antigen binding proteins that bind β-Klotho, FGF receptors and complexes thereof
US9493577B2 (en) 2009-12-07 2016-11-15 Amgen Inc. Human antigen binding proteins that bind β-klotho, FGF receptors and complexes thereof
US9085626B2 (en) 2011-05-16 2015-07-21 Genentech, Inc. FGFR1 agonists and methods of use
US9845359B2 (en) 2011-05-16 2017-12-19 Genentech, Inc. FGFR1 agonists and methods of use
WO2012170438A3 (en) * 2011-06-06 2013-04-11 Amgen Inc. HUMAN ANTIGEN BINDING PROTEINS THAT BIND TO A COMPLEX COMPRISING β-KLOTHO AND AN FGF RECEPTOR
EP3447074A3 (en) * 2011-06-06 2019-08-28 Amgen, Inc Human antigen binding proteins that bind to a complex comprising beta-klotho and an fgf receptor
US11248052B2 (en) 2011-06-06 2022-02-15 Amgen Inc. Antigen binding proteins that bind to a complex comprising β-Klotho and an FGF receptor
US9574002B2 (en) 2011-06-06 2017-02-21 Amgen Inc. Human antigen binding proteins that bind to a complex comprising β-Klotho and an FGF receptor
US9089525B1 (en) 2011-07-01 2015-07-28 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject
US9670260B2 (en) 2011-07-01 2017-06-06 Ngm Biopharmaceuticals, Inc. Compositions comprising fusion variants of FGF19 polypeptides
US9751924B2 (en) 2011-07-01 2017-09-05 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising fusion variants of FGF19 polypeptides for reducing glucose levels in a subject
US9580483B2 (en) 2011-07-01 2017-02-28 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of diabetes
US10413590B2 (en) 2011-07-01 2019-09-17 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants of FGF19 polypeptides for reducing body mass in a subject
US11065302B2 (en) 2011-07-01 2021-07-20 Ngm Biopharmaceuticals, Inc. Compositions comprising fusion variants of FGF19 polypeptides
WO2013033452A2 (en) 2011-08-31 2013-03-07 Amgen Inc. Method of treating or ameliorating type 1 diabetes using fgf21
US9963494B2 (en) 2012-11-28 2018-05-08 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject
US11066454B2 (en) 2012-11-28 2021-07-20 Ngm Biopharmaceuticals, Inc. Compositions comprising variants and fusions of FGF19 polypeptides
US9290557B2 (en) 2012-11-28 2016-03-22 Ngm Biopharmaceuticals, Inc. Compositions comprising variants and fusions of FGF19 polypeptides
US10758590B2 (en) 2012-11-28 2020-09-01 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF 19 polypeptides for treating diabetes
US9974833B2 (en) 2012-12-27 2018-05-22 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having pregnancy intrahepatic cholestasis
US9925242B2 (en) 2012-12-27 2018-03-27 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of nonalcoholic steatohepatitis
US9273107B2 (en) 2012-12-27 2016-03-01 Ngm Biopharmaceuticals, Inc. Uses and methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US9878008B2 (en) 2012-12-27 2018-01-30 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having bile acid diarrhea or bile acid malabsorption
US9895416B2 (en) 2012-12-27 2018-02-20 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having cholestasis
US9889178B2 (en) 2012-12-27 2018-02-13 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having nonalcoholic steatohepatitis
US11103554B2 (en) 2012-12-27 2021-08-31 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants of FGF19 polypeptides for reducing bile acid synthesis in a subject having cirrhosis
US9889177B2 (en) 2012-12-27 2018-02-13 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having primary sclerosing cholangitis
US11564972B2 (en) 2012-12-27 2023-01-31 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants of FGF19 polypeptides for treating primary biliary cirrhosis in a subject
US9878009B2 (en) 2012-12-27 2018-01-30 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having error of bile acid synthesis
US10369199B2 (en) 2013-10-28 2019-08-06 Ngm Biopharmaceuticals, Inc. Methods of using variants of FGF19 polypeptides for the treatment of cancer
EP4219555A1 (en) 2013-12-23 2023-08-02 F. Hoffmann-La Roche AG Antibodies and methods of use
AU2019204128B2 (en) * 2013-12-23 2021-05-13 Genentech, Inc. Antibodies and methods of use
WO2015100366A1 (en) * 2013-12-23 2015-07-02 Genentech, Inc. Antibodies and methods of use
US10882921B2 (en) 2013-12-23 2021-01-05 Genentech, Inc. Host cell comprising nucleic acids encoding bispecific antibodies binding to beta-klotho and fibroblast growth factor receptor 1 and antibody production
US10246518B2 (en) 2013-12-23 2019-04-02 Genentech, Inc. Nucleic acids encoding bispecific antibodies binding to beta-Klotho and fibroblast growth factor receptor 1
US9873748B2 (en) 2013-12-23 2018-01-23 Genentech, Inc. Bispecific antibodies binding to beta-klotho and fibroblast growth factor receptor 1
IL277633A (en) * 2013-12-23 2020-11-30 Genentech Inc Antibodies and methods of use
EA036107B1 (ru) * 2013-12-23 2020-09-29 Дженентек Инк. Антитела и способы их применения
US9884919B2 (en) 2013-12-23 2018-02-06 Genentech, Inc. Methods of treatment with bispecific antibodies binding to beta-klotho and fibroblast growth factor receptor 1
KR20160102030A (ko) * 2013-12-23 2016-08-26 제넨테크, 인크. 항체 및 사용 방법
AU2014369872B2 (en) * 2013-12-23 2019-03-14 Genentech, Inc. Antibodies and methods of use
KR102329693B1 (ko) 2013-12-23 2021-11-23 제넨테크, 인크. 항체 및 사용 방법
US10093735B2 (en) 2014-01-24 2018-10-09 Ngm Biopharmaceuticals, Inc. Beta-klotho binding proteins
US10744191B2 (en) 2014-01-24 2020-08-18 Ngm Biopharmaceuticals, Inc. Beta klotho-binding proteins and methods of use thereof
RU2701434C2 (ru) * 2014-01-24 2019-09-26 Нгм Биофармасьютикалс, Инк. Связывающие белки и способы их применения
US11596676B2 (en) 2014-01-24 2023-03-07 Ngm Biopharmaceuticals, Inc. Methods of treating nonalcoholic steatohepatitis comprising administering an anti-human beta klotho antibody or binding fragment thereof
US11963999B2 (en) 2014-03-11 2024-04-23 Novartis Ag Methods of treating HIV-HAART induced partial lipodystrophy with FGF21 protein variant FC fusion proteins
US10519240B2 (en) 2014-03-25 2019-12-31 Regeneron Pharmaceuticals, Inc. Anti-FGFR1c antibody-FGF21 fusion proteins
US10398758B2 (en) 2014-05-28 2019-09-03 Ngm Biopharmaceuticals, Inc. Compositions comprising variants of FGF19 polypeptides and uses thereof for the treatment of hyperglycemic conditions
US11241481B2 (en) 2014-06-16 2022-02-08 Ngm Biopharmaceuticals, Inc. Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US10456449B2 (en) 2014-06-16 2019-10-29 Ngm Biopharmaceuticals, Inc. Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US10517929B2 (en) 2014-10-23 2019-12-31 Ngm Biopharmaceuticals, Inc. Pharmaceutical compositions comprising FGF19 variants
US10434144B2 (en) 2014-11-07 2019-10-08 Ngm Biopharmaceuticals, Inc. Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders
US11141460B2 (en) 2014-11-07 2021-10-12 Ngm Biopharmaceuticals, Inc. Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders
US10800843B2 (en) 2015-07-29 2020-10-13 Ngm Biopharmaceuticals, Inc. Beta klotho-binding proteins
US11667708B2 (en) 2015-07-29 2023-06-06 Ngm Biopharmaceuticals, Inc. Anti-human beta klotho antibody or binding fragment thereof and methods of their use
EP3331914A1 (en) * 2015-08-03 2018-06-13 Novartis AG Methods of treating fgf21-associated disorders
US11802152B2 (en) 2015-08-03 2023-10-31 Novartis Ag Methods of treating FGF21-associated disorders
US11236159B2 (en) 2015-08-03 2022-02-01 Novartis Ag Methods of treating FGF21-associated disorders
WO2017079768A1 (en) 2015-11-08 2017-05-11 Genentech, Inc. Methods of screening for multispecific antibodies
US10744185B2 (en) 2015-11-09 2020-08-18 Ngm Biopharmaceuticals, Inc. Methods of using variants of FGF19 polypeptides for the treatment of pruritus
US10947299B2 (en) 2016-03-23 2021-03-16 Seoul National University R&Db Foundation Antibody that binds to envelope glycoprotein of severe fever with thrombocytopenia syndrome virus and use for same
EP3434690A4 (en) * 2016-03-23 2020-04-01 Seoul National University R&DB Foundation ANTIBODY BINDING TO HULL GLYCOPROTEIN OF HEAVY-FEVER-WITH-THROMBOZYTOPENIA-SYNDROME-VIRUS AND THE USE THEREOF
US11472863B2 (en) 2016-08-19 2022-10-18 Ampsource Biopharma Shanghai Inc. Human coagulation factor IX (FIX) fusion protein, preparation method therefor, and use thereof
US11123438B2 (en) 2016-08-19 2021-09-21 Ampsource Biopharma Shanghai Inc. Linker peptide for constructing fusion protein
WO2018032785A1 (zh) 2016-08-19 2018-02-22 安源医药科技（上海）有限公司 人成纤维细胞生长因子21融合蛋白及其制备方法与用途
US11471513B2 (en) 2016-08-19 2022-10-18 Ampsource Biopharma Shanghai Inc. Highly glycosylated human blood-clotting factor VIII fusion protein, and manufacturing method and application of same
US11833212B2 (en) 2016-08-19 2023-12-05 Ampsource Biopharma Shanghai Inc. Linker peptide for constructing fusion protein
US11370841B2 (en) 2016-08-26 2022-06-28 Ngm Biopharmaceuticals, Inc. Methods of treating fibroblast growth factor 19-mediated cancers and tumors
EP3538555A1 (en) * 2016-11-14 2019-09-18 Amgen Inc. Bispecific or biparatopic antigen binding proteins and uses thereof
CN110520443A (zh) * 2017-02-08 2019-11-29 诺华股份有限公司 Fgf21模拟抗体及其用途
US11692046B2 (en) 2017-02-08 2023-07-04 Novartis Ag FGF21 mimetic antibodies and uses thereof
CN110520443B (zh) * 2017-02-08 2023-07-25 诺华股份有限公司 Fgf21模拟抗体及其用途
WO2018146594A1 (en) * 2017-02-08 2018-08-16 Novartis Ag Fgf21 mimetic antibodies and uses thereof
KR102572663B1 (ko) 2017-02-08 2023-09-01 노파르티스 아게 Fgf21 모방 항체 및 이의 용도
KR20190115471A (ko) * 2017-02-08 2019-10-11 노파르티스 아게 Fgf21 모방 항체 및 이의 용도
US10899844B2 (en) 2017-02-08 2021-01-26 Novartis Ag FGF21 mimetic antibodies and uses thereof
AU2018218557B2 (en) * 2017-02-08 2021-05-27 Novartis Ag FGF21 mimetic antibodies and uses thereof
AU2018218557B9 (en) * 2017-02-08 2021-06-24 Novartis Ag FGF21 mimetic antibodies and uses thereof
US11981718B2 (en) 2020-05-27 2024-05-14 Ampsource Biopharma Shanghai Inc. Dual-function protein for lipid and blood glucose regulation
WO2022003169A1 (en) 2020-07-02 2022-01-06 Sanofi Fgfr1/klb targeting agonistic antigen-binding proteins and conjugates thereof with glp-1r agonistic peptides
US12054551B2 (en) 2020-07-02 2024-08-06 Sanofi FGFR1/KLB targeting agonistic antigen-binding proteins and conjugates thereof with GLP-1R agonistic peptides

Also Published As

Publication number Publication date
TW201130973A (en) 2011-09-16
KR102121678B1 (ko) 2020-06-10
EP2510009B1 (en) 2017-04-26
CA2981687C (en) 2023-01-31
ME02807B (me) 2018-01-20
NZ700473A (en) 2016-05-27
US20170015750A1 (en) 2017-01-19
AU2010328444B2 (en) 2014-11-13
TWI600761B (zh) 2017-10-01
AU2010328444A1 (en) 2012-06-21
KR101865974B1 (ko) 2018-06-11
KR20200067924A (ko) 2020-06-12
SI2711375T1 (sl) 2017-07-31
MY173097A (en) 2019-12-26
US20160145351A1 (en) 2016-05-26
HRP20170882T1 (hr) 2017-08-25
PL2711375T3 (pl) 2017-09-29
UY39124A (es) 2021-04-30
AR079274A1 (es) 2012-01-04
SG181568A1 (en) 2012-07-30
EP2711375A1 (en) 2014-03-26
US9493577B2 (en) 2016-11-15
ES2633810T3 (es) 2017-09-25
CN102858802B (zh) 2018-02-02
CR20120366A (es) 2012-09-25
EA201691176A1 (ru) 2016-10-31
EA033405B1 (ru) 2019-10-31
CA2782420C (en) 2017-11-14
PT2711375T (pt) 2017-06-22
MX360487B (es) 2018-10-24
JP2020054376A (ja) 2020-04-09
CA2782420A1 (en) 2011-06-16
JP5840619B2 (ja) 2016-01-06
EA201270634A1 (ru) 2013-02-28
ZA201204145B (en) 2014-02-26
MA33854B1 (fr) 2012-12-03
CN108586602A (zh) 2018-09-28
JP2016105704A (ja) 2016-06-16
CA2981687A1 (en) 2011-06-16
TN2012000268A1 (en) 2013-12-12
EP3202787B1 (en) 2020-06-10
KR20120098871A (ko) 2012-09-05
EP3202787A1 (en) 2017-08-09
US9284378B2 (en) 2016-03-15
NZ717847A (en) 2018-12-21
JP6931590B2 (ja) 2021-09-08
BR112012013876B1 (pt) 2020-02-11
PE20121686A1 (es) 2012-12-16
UA109888C2 (uk) 2015-10-26
SG10201708609PA (en) 2017-11-29
MX341148B (es) 2016-08-09
CL2012001504A1 (es) 2012-12-07
TW201805308A (zh) 2018-02-16
TWI693234B (zh) 2020-05-11
MX2012006467A (es) 2012-09-12
EA026129B1 (ru) 2017-03-31
JP6240138B2 (ja) 2017-11-29
IL261585B (en) 2021-08-31
RS56016B1 (sr) 2017-09-29
US12116413B2 (en) 2024-10-15
EP2711375B1 (en) 2017-03-15
DK2711375T3 (en) 2017-05-22
JP2013512689A (ja) 2013-04-18
JP2018050628A (ja) 2018-04-05
CR20180020A (es) 2018-07-20
IL261585A (en) 2018-10-31
US10570205B2 (en) 2020-02-25
CY1119000T1 (el) 2018-01-10
BR112012013876A2 (pt) 2017-01-10
CN102858802A (zh) 2013-01-02
JP7065822B2 (ja) 2022-05-12
IL220048A0 (en) 2012-07-31
EP2510009A1 (en) 2012-10-17
US20110135657A1 (en) 2011-06-09
EP3760642A1 (en) 2021-01-06
ES2631135T3 (es) 2017-08-28
HUE034727T2 (en) 2018-02-28
LT2711375T (lt) 2017-06-26
KR20180063373A (ko) 2018-06-11
UY33089A (es) 2011-06-30
MY191950A (en) 2022-07-20
TW202033554A (zh) 2020-09-16
US20200216546A1 (en) 2020-07-09

Similar Documents

Publication Publication Date Title
US12116413B2 (en) Human antigen binding proteins that bind β-klotho, FGF receptors and complexes thereof
US11248052B2 (en) Antigen binding proteins that bind to a complex comprising β-Klotho and an FGF receptor
US9517264B2 (en) Human FGF receptor and β-Klotho binding proteins
AU2017200115B2 (en) Human antigen binding proteins that bind beta-Klotho, FGF receptors and complexes thereof

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201080063309.5

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10788204

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 220048

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2782420

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 12012501101

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 2010328444

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: /P/2012/00011

Country of ref document: BW

Ref document number: 2012543173

Country of ref document: JP

Ref document number: 000781-2012

Country of ref document: PE

Ref document number: MX/A/2012/006467

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2012001504

Country of ref document: CL

Ref document number: 1201002601

Country of ref document: TH

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 12097413

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: 201270634

Country of ref document: EA

ENP Entry into the national phase

Ref document number: 2010328444

Country of ref document: AU

Date of ref document: 20101203

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 5965/DELNP/2012

Country of ref document: IN

REEP Request for entry into the european phase

Ref document number: 2010788204

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2010788204

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20127017717

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: A201208326

Country of ref document: UA

Ref document number: CR2012-000366

Country of ref document: CR

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112012013876

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: IDP00201604339

Country of ref document: ID

ENP Entry into the national phase

Ref document number: 112012013876

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20120608

WWE Wipo information: entry into national phase

Ref document number: CR2018-000020

Country of ref document: CR