WO2011071783A1 - Protéines de liaison à antigène humain qui se lient à bêta-klotho, aux récepteurs de fgf et aux complexes de ceux-ci - Google Patents
Protéines de liaison à antigène humain qui se lient à bêta-klotho, aux récepteurs de fgf et aux complexes de ceux-ci Download PDFInfo
- Publication number
- WO2011071783A1 WO2011071783A1 PCT/US2010/058984 US2010058984W WO2011071783A1 WO 2011071783 A1 WO2011071783 A1 WO 2011071783A1 US 2010058984 W US2010058984 W US 2010058984W WO 2011071783 A1 WO2011071783 A1 WO 2011071783A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antigen binding
- klotho
- fgfrlc
- fgfr3c
- Prior art date
Links
- 102000025171 antigen binding proteins Human genes 0.000 title claims abstract description 470
- 108091000831 antigen binding proteins Proteins 0.000 title claims abstract description 470
- 102100020683 Beta-klotho Human genes 0.000 title claims abstract description 355
- 241000282414 Homo sapiens Species 0.000 title claims abstract description 126
- 101710104526 Beta-klotho Proteins 0.000 title claims description 351
- 108091008794 FGF receptors Proteins 0.000 title description 5
- 102000044168 Fibroblast Growth Factor Receptor Human genes 0.000 title description 4
- 101000917134 Homo sapiens Fibroblast growth factor receptor 4 Proteins 0.000 claims abstract description 298
- 102100023600 Fibroblast growth factor receptor 2 Human genes 0.000 claims abstract description 297
- 101710182389 Fibroblast growth factor receptor 2 Proteins 0.000 claims abstract description 297
- 102100027844 Fibroblast growth factor receptor 4 Human genes 0.000 claims abstract description 296
- -1 FGFR3c Proteins 0.000 claims abstract description 165
- 230000027455 binding Effects 0.000 claims abstract description 123
- 238000000034 method Methods 0.000 claims abstract description 114
- 239000012634 fragment Substances 0.000 claims abstract description 76
- 102000003973 Fibroblast growth factor 21 Human genes 0.000 claims abstract description 64
- 108090000376 Fibroblast growth factor 21 Proteins 0.000 claims abstract description 64
- 230000011664 signaling Effects 0.000 claims abstract description 55
- 239000000203 mixture Substances 0.000 claims abstract description 48
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 34
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 29
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 29
- 230000001404 mediated effect Effects 0.000 claims abstract description 27
- 102000040430 polynucleotide Human genes 0.000 claims abstract description 27
- 108091033319 polynucleotide Proteins 0.000 claims abstract description 27
- 239000002157 polynucleotide Substances 0.000 claims abstract description 27
- 208000008589 Obesity Diseases 0.000 claims abstract description 19
- 235000020824 obesity Nutrition 0.000 claims abstract description 19
- 208000001072 type 2 diabetes mellitus Diseases 0.000 claims abstract description 14
- 206010053219 non-alcoholic steatohepatitis Diseases 0.000 claims abstract description 10
- 208000001145 Metabolic Syndrome Diseases 0.000 claims abstract description 9
- 201000000690 abdominal obesity-metabolic syndrome Diseases 0.000 claims abstract description 9
- 210000004027 cell Anatomy 0.000 claims description 125
- 150000001413 amino acids Chemical group 0.000 claims description 108
- 239000000427 antigen Substances 0.000 claims description 74
- 108091007433 antigens Proteins 0.000 claims description 74
- 102000036639 antigens Human genes 0.000 claims description 74
- 238000006467 substitution reaction Methods 0.000 claims description 56
- 102100035361 Cerebellar degeneration-related protein 2 Human genes 0.000 claims description 47
- 101000737796 Homo sapiens Cerebellar degeneration-related protein 2 Proteins 0.000 claims description 47
- 102100035360 Cerebellar degeneration-related antigen 1 Human genes 0.000 claims description 36
- 101100112922 Candida albicans CDR3 gene Proteins 0.000 claims description 33
- 238000012217 deletion Methods 0.000 claims description 31
- 230000037430 deletion Effects 0.000 claims description 31
- 238000003556 assay Methods 0.000 claims description 29
- 239000008194 pharmaceutical composition Substances 0.000 claims description 27
- 229910052717 sulfur Inorganic materials 0.000 claims description 27
- 229910052727 yttrium Inorganic materials 0.000 claims description 27
- 102000005962 receptors Human genes 0.000 claims description 25
- 108020003175 receptors Proteins 0.000 claims description 25
- 101001139095 Homo sapiens Beta-klotho Proteins 0.000 claims description 20
- 102000051661 human KLB Human genes 0.000 claims description 20
- 229910052757 nitrogen Inorganic materials 0.000 claims description 19
- 239000013604 expression vector Substances 0.000 claims description 18
- 238000011282 treatment Methods 0.000 claims description 18
- 208000032928 Dyslipidaemia Diseases 0.000 claims description 16
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 claims description 16
- 208000017170 Lipid metabolism disease Diseases 0.000 claims description 16
- 239000008103 glucose Substances 0.000 claims description 16
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 claims description 16
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 claims description 15
- 101000737793 Homo sapiens Cerebellar degeneration-related antigen 1 Proteins 0.000 claims description 14
- 238000000338 in vitro Methods 0.000 claims description 13
- 241001529936 Murinae Species 0.000 claims description 11
- 238000007792 addition Methods 0.000 claims description 11
- 230000001270 agonistic effect Effects 0.000 claims description 11
- 230000006229 amino acid addition Effects 0.000 claims description 10
- 108090001061 Insulin Proteins 0.000 claims description 9
- 150000002632 lipids Chemical class 0.000 claims description 9
- 210000002966 serum Anatomy 0.000 claims description 9
- 208000024172 Cardiovascular disease Diseases 0.000 claims description 8
- 102000004877 Insulin Human genes 0.000 claims description 8
- 229910052739 hydrogen Inorganic materials 0.000 claims description 8
- 229940125396 insulin Drugs 0.000 claims description 8
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 claims description 7
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 claims description 7
- 210000001789 adipocyte Anatomy 0.000 claims description 7
- 210000004369 blood Anatomy 0.000 claims description 7
- 239000008280 blood Substances 0.000 claims description 7
- 230000035772 mutation Effects 0.000 claims description 7
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 6
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 6
- 238000010171 animal model Methods 0.000 claims description 6
- 229910052799 carbon Inorganic materials 0.000 claims description 6
- 238000000423 cell based assay Methods 0.000 claims description 4
- 238000003468 luciferase reporter gene assay Methods 0.000 claims description 4
- 239000003937 drug carrier Substances 0.000 claims description 3
- 229910052698 phosphorus Inorganic materials 0.000 claims description 3
- 238000002825 functional assay Methods 0.000 claims description 2
- 108090000765 processed proteins & peptides Proteins 0.000 abstract description 149
- 102000004196 processed proteins & peptides Human genes 0.000 abstract description 129
- 229920001184 polypeptide Polymers 0.000 abstract description 119
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 14
- 235000001014 amino acid Nutrition 0.000 description 131
- 108090000623 proteins and genes Proteins 0.000 description 131
- 125000003275 alpha amino acid group Chemical group 0.000 description 119
- 229940024606 amino acid Drugs 0.000 description 106
- 102000004169 proteins and genes Human genes 0.000 description 99
- 235000018102 proteins Nutrition 0.000 description 93
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 76
- 230000000694 effects Effects 0.000 description 36
- 125000000539 amino acid group Chemical group 0.000 description 32
- 239000013598 vector Substances 0.000 description 28
- 230000014509 gene expression Effects 0.000 description 27
- 241000894007 species Species 0.000 description 27
- 108020004414 DNA Proteins 0.000 description 25
- 108091026890 Coding region Proteins 0.000 description 24
- 108060003951 Immunoglobulin Proteins 0.000 description 24
- 102000018358 immunoglobulin Human genes 0.000 description 24
- 210000004408 hybridoma Anatomy 0.000 description 22
- 238000001727 in vivo Methods 0.000 description 22
- 108091035707 Consensus sequence Proteins 0.000 description 21
- 238000009472 formulation Methods 0.000 description 21
- 239000003981 vehicle Substances 0.000 description 21
- 125000005647 linker group Chemical group 0.000 description 19
- 241001465754 Metazoa Species 0.000 description 18
- 230000004927 fusion Effects 0.000 description 17
- 230000013595 glycosylation Effects 0.000 description 17
- 238000006206 glycosylation reaction Methods 0.000 description 17
- 241000282567 Macaca fascicularis Species 0.000 description 16
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 15
- 241000699666 Mus <mouse, genus> Species 0.000 description 15
- 108010076504 Protein Sorting Signals Proteins 0.000 description 15
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 14
- 102000037865 fusion proteins Human genes 0.000 description 14
- 108020001507 fusion proteins Proteins 0.000 description 14
- 238000002372 labelling Methods 0.000 description 14
- 239000002773 nucleotide Substances 0.000 description 14
- 125000003729 nucleotide group Chemical group 0.000 description 14
- 230000001225 therapeutic effect Effects 0.000 description 14
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 13
- 238000012384 transportation and delivery Methods 0.000 description 13
- 201000010099 disease Diseases 0.000 description 12
- 208000024891 symptom Diseases 0.000 description 12
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 11
- 239000003795 chemical substances by application Substances 0.000 description 11
- 238000003780 insertion Methods 0.000 description 11
- 230000037431 insertion Effects 0.000 description 11
- 210000001519 tissue Anatomy 0.000 description 11
- 108091034117 Oligonucleotide Proteins 0.000 description 10
- 150000001720 carbohydrates Chemical group 0.000 description 10
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 10
- 230000002163 immunogen Effects 0.000 description 10
- 230000004048 modification Effects 0.000 description 10
- 238000012986 modification Methods 0.000 description 10
- 239000000126 substance Substances 0.000 description 10
- 238000012360 testing method Methods 0.000 description 10
- 238000013518 transcription Methods 0.000 description 10
- 230000035897 transcription Effects 0.000 description 10
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 9
- 241000700159 Rattus Species 0.000 description 9
- 239000002253 acid Substances 0.000 description 9
- 230000004071 biological effect Effects 0.000 description 9
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 9
- 239000003623 enhancer Substances 0.000 description 9
- 230000002255 enzymatic effect Effects 0.000 description 9
- 229960002591 hydroxyproline Drugs 0.000 description 9
- 230000003053 immunization Effects 0.000 description 9
- 238000004519 manufacturing process Methods 0.000 description 9
- 239000000463 material Substances 0.000 description 9
- 238000001890 transfection Methods 0.000 description 9
- 108010071690 Prealbumin Proteins 0.000 description 8
- 102000009190 Transthyretin Human genes 0.000 description 8
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 8
- 238000003776 cleavage reaction Methods 0.000 description 8
- 230000000295 complement effect Effects 0.000 description 8
- 230000001900 immune effect Effects 0.000 description 8
- 239000011159 matrix material Substances 0.000 description 8
- 238000006366 phosphorylation reaction Methods 0.000 description 8
- 229920001223 polyethylene glycol Polymers 0.000 description 8
- FSYKKLYZXJSNPZ-UHFFFAOYSA-N sarcosine Chemical compound C[NH2+]CC([O-])=O FSYKKLYZXJSNPZ-UHFFFAOYSA-N 0.000 description 8
- 230000007017 scission Effects 0.000 description 8
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 7
- ODKSFYDXXFIFQN-UHFFFAOYSA-N Arginine Chemical compound OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 7
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 7
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 7
- 241000699660 Mus musculus Species 0.000 description 7
- 241000699670 Mus sp. Species 0.000 description 7
- 230000004988 N-glycosylation Effects 0.000 description 7
- 239000002202 Polyethylene glycol Substances 0.000 description 7
- 235000018417 cysteine Nutrition 0.000 description 7
- 230000007423 decrease Effects 0.000 description 7
- YSMODUONRAFBET-UHFFFAOYSA-N delta-DL-hydroxylysine Natural products NCC(O)CCC(N)C(O)=O YSMODUONRAFBET-UHFFFAOYSA-N 0.000 description 7
- 206010012601 diabetes mellitus Diseases 0.000 description 7
- YSMODUONRAFBET-UHNVWZDZSA-N erythro-5-hydroxy-L-lysine Chemical compound NC[C@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-UHNVWZDZSA-N 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- 210000004185 liver Anatomy 0.000 description 7
- 229920000642 polymer Polymers 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 7
- 239000007790 solid phase Substances 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 230000009261 transgenic effect Effects 0.000 description 7
- 238000011830 transgenic mouse model Methods 0.000 description 7
- 102000004190 Enzymes Human genes 0.000 description 6
- 108090000790 Enzymes Proteins 0.000 description 6
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 6
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 6
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 6
- 206010035226 Plasma cell myeloma Diseases 0.000 description 6
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 6
- 241000700605 Viruses Species 0.000 description 6
- 230000001588 bifunctional effect Effects 0.000 description 6
- 238000004422 calculation algorithm Methods 0.000 description 6
- 238000010367 cloning Methods 0.000 description 6
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 6
- 238000001514 detection method Methods 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- 239000012636 effector Substances 0.000 description 6
- 229940088598 enzyme Drugs 0.000 description 6
- 230000001965 increasing effect Effects 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- 239000007924 injection Substances 0.000 description 6
- 230000003993 interaction Effects 0.000 description 6
- 239000012528 membrane Substances 0.000 description 6
- 201000000050 myeloid neoplasm Diseases 0.000 description 6
- 238000003127 radioimmunoassay Methods 0.000 description 6
- 230000004044 response Effects 0.000 description 6
- UFTFJSFQGQCHQW-UHFFFAOYSA-N triformin Chemical compound O=COCC(OC=O)COC=O UFTFJSFQGQCHQW-UHFFFAOYSA-N 0.000 description 6
- 229940117976 5-hydroxylysine Drugs 0.000 description 5
- 239000004475 Arginine Substances 0.000 description 5
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 5
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 5
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 5
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 5
- 229930006000 Sucrose Natural products 0.000 description 5
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 5
- 239000004473 Threonine Substances 0.000 description 5
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 5
- 230000003321 amplification Effects 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 235000009697 arginine Nutrition 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 229940107161 cholesterol Drugs 0.000 description 5
- 239000000539 dimer Substances 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 238000007446 glucose tolerance test Methods 0.000 description 5
- 230000012010 growth Effects 0.000 description 5
- 238000002513 implantation Methods 0.000 description 5
- 210000004962 mammalian cell Anatomy 0.000 description 5
- 238000003199 nucleic acid amplification method Methods 0.000 description 5
- 239000000546 pharmaceutical excipient Substances 0.000 description 5
- 229920000136 polysorbate Polymers 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 230000010076 replication Effects 0.000 description 5
- 230000007781 signaling event Effects 0.000 description 5
- 125000006850 spacer group Chemical group 0.000 description 5
- 230000009870 specific binding Effects 0.000 description 5
- 239000005720 sucrose Substances 0.000 description 5
- 235000000346 sugar Nutrition 0.000 description 5
- 230000009466 transformation Effects 0.000 description 5
- FTSVTCPUMUXYJS-UHFFFAOYSA-N 1,2,3,4-tetrahydroisoquinoline Chemical compound C1=C=C[C]2CNCCC2=C1 FTSVTCPUMUXYJS-UHFFFAOYSA-N 0.000 description 4
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 description 4
- BRMWTNUJHUMWMS-UHFFFAOYSA-N 3-Methylhistidine Natural products CN1C=NC(CC(N)C(O)=O)=C1 BRMWTNUJHUMWMS-UHFFFAOYSA-N 0.000 description 4
- CMUHFUGDYMFHEI-QMMMGPOBSA-N 4-amino-L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N)C=C1 CMUHFUGDYMFHEI-QMMMGPOBSA-N 0.000 description 4
- 108010088751 Albumins Proteins 0.000 description 4
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 4
- 102100026189 Beta-galactosidase Human genes 0.000 description 4
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 4
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 4
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- SNDPXSYFESPGGJ-UHFFFAOYSA-N L-norVal-OH Natural products CCCC(N)C(O)=O SNDPXSYFESPGGJ-UHFFFAOYSA-N 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- 108060001084 Luciferase Proteins 0.000 description 4
- 239000005089 Luciferase Substances 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 239000004472 Lysine Substances 0.000 description 4
- JDHILDINMRGULE-LURJTMIESA-N N(pros)-methyl-L-histidine Chemical compound CN1C=NC=C1C[C@H](N)C(O)=O JDHILDINMRGULE-LURJTMIESA-N 0.000 description 4
- JJIHLJJYMXLCOY-BYPYZUCNSA-N N-acetyl-L-serine Chemical compound CC(=O)N[C@@H](CO)C(O)=O JJIHLJJYMXLCOY-BYPYZUCNSA-N 0.000 description 4
- PYUSHNKNPOHWEZ-YFKPBYRVSA-N N-formyl-L-methionine Chemical compound CSCC[C@@H](C(O)=O)NC=O PYUSHNKNPOHWEZ-YFKPBYRVSA-N 0.000 description 4
- AKCRVYNORCOYQT-YFKPBYRVSA-N N-methyl-L-valine Chemical compound CN[C@@H](C(C)C)C(O)=O AKCRVYNORCOYQT-YFKPBYRVSA-N 0.000 description 4
- KSPIYJQBLVDRRI-UHFFFAOYSA-N N-methylisoleucine Chemical compound CCC(C)C(NC)C(O)=O KSPIYJQBLVDRRI-UHFFFAOYSA-N 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 102000035195 Peptidases Human genes 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 4
- 108020004511 Recombinant DNA Proteins 0.000 description 4
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 4
- 108010077895 Sarcosine Proteins 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- 230000004913 activation Effects 0.000 description 4
- 230000000890 antigenic effect Effects 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 235000009582 asparagine Nutrition 0.000 description 4
- 229960001230 asparagine Drugs 0.000 description 4
- 210000003719 b-lymphocyte Anatomy 0.000 description 4
- 239000011324 bead Substances 0.000 description 4
- 108010005774 beta-Galactosidase Proteins 0.000 description 4
- 239000011230 binding agent Substances 0.000 description 4
- JCZLABDVDPYLRZ-AWEZNQCLSA-N biphenylalanine Chemical compound C1=CC(C[C@H](N)C(O)=O)=CC=C1C1=CC=CC=C1 JCZLABDVDPYLRZ-AWEZNQCLSA-N 0.000 description 4
- UHBYWPGGCSDKFX-UHFFFAOYSA-N carboxyglutamic acid Chemical compound OC(=O)C(N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-UHFFFAOYSA-N 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 4
- 230000006378 damage Effects 0.000 description 4
- 239000003085 diluting agent Substances 0.000 description 4
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 4
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 4
- 235000004554 glutamine Nutrition 0.000 description 4
- 230000036541 health Effects 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 238000002649 immunization Methods 0.000 description 4
- 230000005847 immunogenicity Effects 0.000 description 4
- 238000002955 isolation Methods 0.000 description 4
- 239000002502 liposome Substances 0.000 description 4
- 230000002503 metabolic effect Effects 0.000 description 4
- 230000003278 mimic effect Effects 0.000 description 4
- 210000000056 organ Anatomy 0.000 description 4
- 238000002823 phage display Methods 0.000 description 4
- BZQFBWGGLXLEPQ-REOHCLBHSA-N phosphoserine Chemical compound OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 229950008882 polysorbate Drugs 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 230000000069 prophylactic effect Effects 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 108091008146 restriction endonucleases Proteins 0.000 description 4
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 4
- 239000000523 sample Substances 0.000 description 4
- 239000000600 sorbitol Substances 0.000 description 4
- 210000004989 spleen cell Anatomy 0.000 description 4
- 238000013268 sustained release Methods 0.000 description 4
- 239000012730 sustained-release form Substances 0.000 description 4
- 239000003826 tablet Substances 0.000 description 4
- UWYZHKAOTLEWKK-UHFFFAOYSA-N tetrahydro-isoquinoline Natural products C1=CC=C2CNCCC2=C1 UWYZHKAOTLEWKK-UHFFFAOYSA-N 0.000 description 4
- 230000005030 transcription termination Effects 0.000 description 4
- 238000010361 transduction Methods 0.000 description 4
- 230000026683 transduction Effects 0.000 description 4
- 102000009027 Albumins Human genes 0.000 description 3
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 3
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 3
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 3
- 229920002307 Dextran Polymers 0.000 description 3
- 241000206602 Eukaryota Species 0.000 description 3
- 108091029865 Exogenous DNA Proteins 0.000 description 3
- XZWYTXMRWQJBGX-VXBMVYAYSA-N FLAG peptide Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=C(O)C=C1 XZWYTXMRWQJBGX-VXBMVYAYSA-N 0.000 description 3
- 108010020195 FLAG peptide Proteins 0.000 description 3
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 3
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 3
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 3
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 3
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 3
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 3
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 229930195725 Mannitol Natural products 0.000 description 3
- 230000004989 O-glycosylation Effects 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 102100029333 Pterin-4-alpha-carbinolamine dehydratase Human genes 0.000 description 3
- 241000283984 Rodentia Species 0.000 description 3
- 108010022394 Threonine synthase Proteins 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- 230000000996 additive effect Effects 0.000 description 3
- 238000001261 affinity purification Methods 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 3
- 239000002585 base Substances 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 239000001506 calcium phosphate Substances 0.000 description 3
- 229910000389 calcium phosphate Inorganic materials 0.000 description 3
- 235000011010 calcium phosphates Nutrition 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 210000000349 chromosome Anatomy 0.000 description 3
- 238000004590 computer program Methods 0.000 description 3
- 102000004419 dihydrofolate reductase Human genes 0.000 description 3
- 239000000975 dye Substances 0.000 description 3
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 235000014304 histidine Nutrition 0.000 description 3
- 238000009396 hybridization Methods 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 238000003018 immunoassay Methods 0.000 description 3
- 230000006698 induction Effects 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 235000018977 lysine Nutrition 0.000 description 3
- 239000000594 mannitol Substances 0.000 description 3
- 235000010355 mannitol Nutrition 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 229910052751 metal Inorganic materials 0.000 description 3
- 239000002184 metal Substances 0.000 description 3
- 231100000252 nontoxic Toxicity 0.000 description 3
- 230000003000 nontoxic effect Effects 0.000 description 3
- 230000003287 optical effect Effects 0.000 description 3
- 238000007911 parenteral administration Methods 0.000 description 3
- 230000007170 pathology Effects 0.000 description 3
- 239000000816 peptidomimetic Substances 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 238000003566 phosphorylation assay Methods 0.000 description 3
- 229920002401 polyacrylamide Polymers 0.000 description 3
- 238000003752 polymerase chain reaction Methods 0.000 description 3
- 210000004896 polypeptide structure Anatomy 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 235000019833 protease Nutrition 0.000 description 3
- 230000002285 radioactive effect Effects 0.000 description 3
- 238000003259 recombinant expression Methods 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 229940124597 therapeutic agent Drugs 0.000 description 3
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 241000701161 unidentified adenovirus Species 0.000 description 3
- 241001515965 unidentified phage Species 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical group O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- GMKMEZVLHJARHF-UHFFFAOYSA-N (2R,6R)-form-2.6-Diaminoheptanedioic acid Natural products OC(=O)C(N)CCCC(N)C(O)=O GMKMEZVLHJARHF-UHFFFAOYSA-N 0.000 description 2
- YOWXRBVUSFLFJO-ZETCQYMHSA-N (2S)-7-amino-2-(methylamino)heptanoic acid Chemical compound CN[C@@H](CCCCCN)C(=O)O YOWXRBVUSFLFJO-ZETCQYMHSA-N 0.000 description 2
- NMDDZEVVQDPECF-LURJTMIESA-N (2s)-2,7-diaminoheptanoic acid Chemical compound NCCCCC[C@H](N)C(O)=O NMDDZEVVQDPECF-LURJTMIESA-N 0.000 description 2
- PIVJVCRQCUYKNZ-HNNXBMFYSA-N (2s)-2-(benzylazaniumyl)-3-phenylpropanoate Chemical compound C([C@@H](C(=O)O)NCC=1C=CC=CC=1)C1=CC=CC=C1 PIVJVCRQCUYKNZ-HNNXBMFYSA-N 0.000 description 2
- BVAUMRCGVHUWOZ-ZETCQYMHSA-N (2s)-2-(cyclohexylazaniumyl)propanoate Chemical compound OC(=O)[C@H](C)NC1CCCCC1 BVAUMRCGVHUWOZ-ZETCQYMHSA-N 0.000 description 2
- DQLHSFUMICQIMB-VIFPVBQESA-N (2s)-2-amino-3-(4-methylphenyl)propanoic acid Chemical compound CC1=CC=C(C[C@H](N)C(O)=O)C=C1 DQLHSFUMICQIMB-VIFPVBQESA-N 0.000 description 2
- FYMNTAQFDTZISY-QMMMGPOBSA-N (2s)-2-amino-3-[4-(diaminomethylideneamino)phenyl]propanoic acid Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N=C(N)N)C=C1 FYMNTAQFDTZISY-QMMMGPOBSA-N 0.000 description 2
- WAMWSIDTKSNDCU-ZETCQYMHSA-N (2s)-2-azaniumyl-2-cyclohexylacetate Chemical compound OC(=O)[C@@H](N)C1CCCCC1 WAMWSIDTKSNDCU-ZETCQYMHSA-N 0.000 description 2
- OPOTYPXOKUZEKY-QMMMGPOBSA-N (2s)-2-nitramido-3-phenylpropanoic acid Chemical compound [O-][N+](=O)N[C@H](C(=O)O)CC1=CC=CC=C1 OPOTYPXOKUZEKY-QMMMGPOBSA-N 0.000 description 2
- VYEWZWBILJHHCU-OMQUDAQFSA-N (e)-n-[(2s,3r,4r,5r,6r)-2-[(2r,3r,4s,5s,6s)-3-acetamido-5-amino-4-hydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-[2-[(2r,3s,4r,5r)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]-2-hydroxyethyl]-4,5-dihydroxyoxan-3-yl]-5-methylhex-2-enamide Chemical compound N1([C@@H]2O[C@@H]([C@H]([C@H]2O)O)C(O)C[C@@H]2[C@H](O)[C@H](O)[C@H]([C@@H](O2)O[C@@H]2[C@@H]([C@@H](O)[C@H](N)[C@@H](CO)O2)NC(C)=O)NC(=O)/C=C/CC(C)C)C=CC(=O)NC1=O VYEWZWBILJHHCU-OMQUDAQFSA-N 0.000 description 2
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical group COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 2
- RIJNIVWHYSNSLQ-UHFFFAOYSA-N 2-(2,3-dihydro-1h-inden-2-ylazaniumyl)acetate Chemical compound C1=CC=C2CC(NCC(=O)O)CC2=C1 RIJNIVWHYSNSLQ-UHFFFAOYSA-N 0.000 description 2
- LRHRHAWNXCGABU-UHFFFAOYSA-N 2-(cyclopentylazaniumyl)acetate Chemical compound OC(=O)CNC1CCCC1 LRHRHAWNXCGABU-UHFFFAOYSA-N 0.000 description 2
- RDFMDVXONNIGBC-UHFFFAOYSA-N 2-aminoheptanoic acid Chemical compound CCCCCC(N)C(O)=O RDFMDVXONNIGBC-UHFFFAOYSA-N 0.000 description 2
- JUQLUIFNNFIIKC-UHFFFAOYSA-N 2-aminopimelic acid Chemical compound OC(=O)C(N)CCCCC(O)=O JUQLUIFNNFIIKC-UHFFFAOYSA-N 0.000 description 2
- WRMNZCZEMHIOCP-UHFFFAOYSA-N 2-phenylethanol Chemical compound OCCC1=CC=CC=C1 WRMNZCZEMHIOCP-UHFFFAOYSA-N 0.000 description 2
- PECYZEOJVXMISF-UHFFFAOYSA-N 3-aminoalanine Chemical compound [NH3+]CC(N)C([O-])=O PECYZEOJVXMISF-UHFFFAOYSA-N 0.000 description 2
- YXDGRBPZVQPESQ-QMMMGPOBSA-N 4-[(2s)-2-amino-2-carboxyethyl]benzoic acid Chemical compound OC(=O)[C@@H](N)CC1=CC=C(C(O)=O)C=C1 YXDGRBPZVQPESQ-QMMMGPOBSA-N 0.000 description 2
- RCPSZERYYLEKBV-UHFFFAOYSA-N 4-aminooxyphthalic acid Chemical compound NOC1=CC=C(C(O)=O)C(=C1)C(O)=O RCPSZERYYLEKBV-UHFFFAOYSA-N 0.000 description 2
- PZNQZSRPDOEBMS-QMMMGPOBSA-N 4-iodo-L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(I)C=C1 PZNQZSRPDOEBMS-QMMMGPOBSA-N 0.000 description 2
- IKYJCHYORFJFRR-UHFFFAOYSA-N Alexa Fluor 350 Chemical compound O=C1OC=2C=C(N)C(S(O)(=O)=O)=CC=2C(C)=C1CC(=O)ON1C(=O)CCC1=O IKYJCHYORFJFRR-UHFFFAOYSA-N 0.000 description 2
- WEJVZSAYICGDCK-UHFFFAOYSA-N Alexa Fluor 430 Chemical compound CC[NH+](CC)CC.CC1(C)C=C(CS([O-])(=O)=O)C2=CC=3C(C(F)(F)F)=CC(=O)OC=3C=C2N1CCCCCC(=O)ON1C(=O)CCC1=O WEJVZSAYICGDCK-UHFFFAOYSA-N 0.000 description 2
- ZAINTDRBUHCDPZ-UHFFFAOYSA-M Alexa Fluor 546 Chemical compound [H+].[Na+].CC1CC(C)(C)NC(C(=C2OC3=C(C4=NC(C)(C)CC(C)C4=CC3=3)S([O-])(=O)=O)S([O-])(=O)=O)=C1C=C2C=3C(C(=C(Cl)C=1Cl)C(O)=O)=C(Cl)C=1SCC(=O)NCCCCCC(=O)ON1C(=O)CCC1=O ZAINTDRBUHCDPZ-UHFFFAOYSA-M 0.000 description 2
- 241001156002 Anthonomus pomorum Species 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- ZEOWTGPWHLSLOG-UHFFFAOYSA-N Cc1ccc(cc1-c1ccc2c(n[nH]c2c1)-c1cnn(c1)C1CC1)C(=O)Nc1cccc(c1)C(F)(F)F Chemical compound Cc1ccc(cc1-c1ccc2c(n[nH]c2c1)-c1cnn(c1)C1CC1)C(=O)Nc1cccc(c1)C(F)(F)F ZEOWTGPWHLSLOG-UHFFFAOYSA-N 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 241000557626 Corvus corax Species 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- 150000008574 D-amino acids Chemical class 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- 102000053602 DNA Human genes 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- 108091006020 Fc-tagged proteins Proteins 0.000 description 2
- 102100023593 Fibroblast growth factor receptor 1 Human genes 0.000 description 2
- 101710182386 Fibroblast growth factor receptor 1 Proteins 0.000 description 2
- 241000724791 Filamentous phage Species 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 206010056740 Genital discharge Diseases 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- IKAIKUBBJHFNBZ-LURJTMIESA-N Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CN IKAIKUBBJHFNBZ-LURJTMIESA-N 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 2
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- 101000846529 Homo sapiens Fibroblast growth factor 21 Proteins 0.000 description 2
- 101000935587 Homo sapiens Flavin reductase (NADPH) Proteins 0.000 description 2
- YZJSUQQZGCHHNQ-UHFFFAOYSA-N Homoglutamine Chemical compound OC(=O)C(N)CCCC(N)=O YZJSUQQZGCHHNQ-UHFFFAOYSA-N 0.000 description 2
- 108091006905 Human Serum Albumin Proteins 0.000 description 2
- 102000008100 Human Serum Albumin Human genes 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- LCWXJXMHJVIJFK-UHFFFAOYSA-N Hydroxylysine Natural products NCC(O)CC(N)CC(O)=O LCWXJXMHJVIJFK-UHFFFAOYSA-N 0.000 description 2
- 235000003332 Ilex aquifolium Nutrition 0.000 description 2
- 241000209027 Ilex aquifolium Species 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- 102000019223 Interleukin-1 receptor Human genes 0.000 description 2
- 108050006617 Interleukin-1 receptor Proteins 0.000 description 2
- 102000000704 Interleukin-7 Human genes 0.000 description 2
- 108010002586 Interleukin-7 Proteins 0.000 description 2
- OYIFNHCXNCRBQI-BYPYZUCNSA-N L-2-aminoadipic acid Chemical compound OC(=O)[C@@H](N)CCCC(O)=O OYIFNHCXNCRBQI-BYPYZUCNSA-N 0.000 description 2
- SNDPXSYFESPGGJ-BYPYZUCNSA-N L-2-aminopentanoic acid Chemical compound CCC[C@H](N)C(O)=O SNDPXSYFESPGGJ-BYPYZUCNSA-N 0.000 description 2
- QUOGESRFPZDMMT-UHFFFAOYSA-N L-Homoarginine Natural products OC(=O)C(N)CCCCNC(N)=N QUOGESRFPZDMMT-UHFFFAOYSA-N 0.000 description 2
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- AGPKZVBTJJNPAG-UHNVWZDZSA-N L-allo-Isoleucine Chemical compound CC[C@@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-UHNVWZDZSA-N 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- RHGKLRLOHDJJDR-BYPYZUCNSA-N L-citrulline Chemical compound NC(=O)NCCC[C@H]([NH3+])C([O-])=O RHGKLRLOHDJJDR-BYPYZUCNSA-N 0.000 description 2
- QUOGESRFPZDMMT-YFKPBYRVSA-N L-homoarginine Chemical compound OC(=O)[C@@H](N)CCCCNC(N)=N QUOGESRFPZDMMT-YFKPBYRVSA-N 0.000 description 2
- XIGSAGMEBXLVJJ-YFKPBYRVSA-N L-homocitrulline Chemical compound NC(=O)NCCCC[C@H]([NH3+])C([O-])=O XIGSAGMEBXLVJJ-YFKPBYRVSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 102000043136 MAP kinase family Human genes 0.000 description 2
- 108091054455 MAP kinase family Proteins 0.000 description 2
- 101100205847 Mus musculus Srst gene Proteins 0.000 description 2
- NTNWOCRCBQPEKQ-YFKPBYRVSA-N N(omega)-methyl-L-arginine Chemical compound CN=C(N)NCCC[C@H](N)C(O)=O NTNWOCRCBQPEKQ-YFKPBYRVSA-N 0.000 description 2
- OVRNDRQMDRJTHS-CBQIKETKSA-N N-Acetyl-D-Galactosamine Chemical compound CC(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@H](O)[C@@H]1O OVRNDRQMDRJTHS-CBQIKETKSA-N 0.000 description 2
- MBLBDJOUHNCFQT-UHFFFAOYSA-N N-acetyl-D-galactosamine Natural products CC(=O)NC(C=O)C(O)C(O)C(O)CO MBLBDJOUHNCFQT-UHFFFAOYSA-N 0.000 description 2
- YPIGGYHFMKJNKV-UHFFFAOYSA-N N-ethylglycine Chemical compound CC[NH2+]CC([O-])=O YPIGGYHFMKJNKV-UHFFFAOYSA-N 0.000 description 2
- 108010065338 N-ethylglycine Proteins 0.000 description 2
- RHGKLRLOHDJJDR-UHFFFAOYSA-N Ndelta-carbamoyl-DL-ornithine Natural products OC(=O)C(N)CCCNC(N)=O RHGKLRLOHDJJDR-UHFFFAOYSA-N 0.000 description 2
- 241000121237 Nitrospirae Species 0.000 description 2
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 2
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 108010067372 Pancreatic elastase Proteins 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 108010007127 Pulmonary Surfactant-Associated Protein D Proteins 0.000 description 2
- 102100027845 Pulmonary surfactant-associated protein D Human genes 0.000 description 2
- 241000242739 Renilla Species 0.000 description 2
- YASAKCUCGLMORW-UHFFFAOYSA-N Rosiglitazone Chemical compound C=1C=CC=NC=1N(C)CCOC(C=C1)=CC=C1CC1SC(=O)NC1=O YASAKCUCGLMORW-UHFFFAOYSA-N 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- 102000007562 Serum Albumin Human genes 0.000 description 2
- 108010071390 Serum Albumin Proteins 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- 239000004098 Tetracycline Substances 0.000 description 2
- 108020004440 Thymidine kinase Proteins 0.000 description 2
- 101000980463 Treponema pallidum (strain Nichols) Chaperonin GroEL Proteins 0.000 description 2
- YJQCOFNZVFGCAF-UHFFFAOYSA-N Tunicamycin II Natural products O1C(CC(O)C2C(C(O)C(O2)N2C(NC(=O)C=C2)=O)O)C(O)C(O)C(NC(=O)C=CCCCCCCCCC(C)C)C1OC1OC(CO)C(O)C(O)C1NC(C)=O YJQCOFNZVFGCAF-UHFFFAOYSA-N 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 208000027418 Wounds and injury Diseases 0.000 description 2
- SNEIUMQYRCDYCH-UHFFFAOYSA-N acetylarginine Chemical compound CC(=O)NC(C(O)=O)CCCN=C(N)N SNEIUMQYRCDYCH-UHFFFAOYSA-N 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 230000002411 adverse Effects 0.000 description 2
- 239000000556 agonist Substances 0.000 description 2
- 238000012867 alanine scanning Methods 0.000 description 2
- 208000026935 allergic disease Diseases 0.000 description 2
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 2
- QWCKQJZIFLGMSD-UHFFFAOYSA-N alpha-aminobutyric acid Chemical compound CCC(N)C(O)=O QWCKQJZIFLGMSD-UHFFFAOYSA-N 0.000 description 2
- 229940124277 aminobutyric acid Drugs 0.000 description 2
- 229960000723 ampicillin Drugs 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 229940009098 aspartate Drugs 0.000 description 2
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 2
- 229940000635 beta-alanine Drugs 0.000 description 2
- 150000001576 beta-amino acids Chemical class 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- 230000008512 biological response Effects 0.000 description 2
- 125000004057 biotinyl group Chemical group [H]N1C(=O)N([H])[C@]2([H])[C@@]([H])(SC([H])([H])[C@]12[H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C(*)=O 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- RYYVLZVUVIJVGH-UHFFFAOYSA-N caffeine Chemical compound CN1C(=O)N(C)C(=O)C2=C1N=CN2C RYYVLZVUVIJVGH-UHFFFAOYSA-N 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 229960002173 citrulline Drugs 0.000 description 2
- 235000013477 citrulline Nutrition 0.000 description 2
- 238000004440 column chromatography Methods 0.000 description 2
- 238000002648 combination therapy Methods 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000013270 controlled release Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 229920001577 copolymer Polymers 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000007812 deficiency Effects 0.000 description 2
- 230000007850 degeneration Effects 0.000 description 2
- 230000022811 deglycosylation Effects 0.000 description 2
- VEVRNHHLCPGNDU-MUGJNUQGSA-O desmosine Chemical compound OC(=O)[C@@H](N)CCCC[N+]1=CC(CC[C@H](N)C(O)=O)=C(CCC[C@H](N)C(O)=O)C(CC[C@H](N)C(O)=O)=C1 VEVRNHHLCPGNDU-MUGJNUQGSA-O 0.000 description 2
- 238000002405 diagnostic procedure Methods 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 230000002526 effect on cardiovascular system Effects 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- 238000005538 encapsulation Methods 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 230000001747 exhibiting effect Effects 0.000 description 2
- 239000007850 fluorescent dye Substances 0.000 description 2
- 235000012631 food intake Nutrition 0.000 description 2
- 230000037406 food intake Effects 0.000 description 2
- UHBYWPGGCSDKFX-VKHMYHEASA-N gamma-carboxy-L-glutamic acid Chemical compound OC(=O)[C@@H](N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-VKHMYHEASA-N 0.000 description 2
- 210000001035 gastrointestinal tract Anatomy 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 229930195712 glutamate Natural products 0.000 description 2
- 229940049906 glutamate Drugs 0.000 description 2
- 230000002641 glycemic effect Effects 0.000 description 2
- 229930182470 glycoside Natural products 0.000 description 2
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 2
- 108010015792 glycyllysine Proteins 0.000 description 2
- 239000005090 green fluorescent protein Substances 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 229960002897 heparin Drugs 0.000 description 2
- 229920000669 heparin Polymers 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 102000056713 human FGF21 Human genes 0.000 description 2
- 102000055699 human FGFR4 Human genes 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- QJHBJHUKURJDLG-UHFFFAOYSA-N hydroxy-L-lysine Natural products NCCCCC(NO)C(O)=O QJHBJHUKURJDLG-UHFFFAOYSA-N 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 125000001841 imino group Chemical group [H]N=* 0.000 description 2
- 229940127121 immunoconjugate Drugs 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 238000012606 in vitro cell culture Methods 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 208000014674 injury Diseases 0.000 description 2
- 229940100994 interleukin-7 Drugs 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- RGXCTRIQQODGIZ-UHFFFAOYSA-O isodesmosine Chemical compound OC(=O)C(N)CCCC[N+]1=CC(CCC(N)C(O)=O)=CC(CCC(N)C(O)=O)=C1CCCC(N)C(O)=O RGXCTRIQQODGIZ-UHFFFAOYSA-O 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000318 kanamycin Drugs 0.000 description 2
- 229930027917 kanamycin Natural products 0.000 description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 2
- 229930182823 kanamycin A Natural products 0.000 description 2
- 229910052747 lanthanoid Inorganic materials 0.000 description 2
- 150000002602 lanthanoids Chemical class 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- GMKMEZVLHJARHF-SYDPRGILSA-N meso-2,6-diaminopimelic acid Chemical compound [O-]C(=O)[C@@H]([NH3+])CCC[C@@H]([NH3+])C([O-])=O GMKMEZVLHJARHF-SYDPRGILSA-N 0.000 description 2
- 208000030159 metabolic disease Diseases 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 2
- 238000000520 microinjection Methods 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 239000003068 molecular probe Substances 0.000 description 2
- SCIFESDRCALIIM-UHFFFAOYSA-N n-methylphenylalanine Chemical compound CNC(C(O)=O)CC1=CC=CC=C1 SCIFESDRCALIIM-UHFFFAOYSA-N 0.000 description 2
- OFYAYGJCPXRNBL-LBPRGKRZSA-N naphthalen-2-yl-3-alanine Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CC=CC2=C1 OFYAYGJCPXRNBL-LBPRGKRZSA-N 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- 238000001668 nucleic acid synthesis Methods 0.000 description 2
- 235000015097 nutrients Nutrition 0.000 description 2
- CQYBNXGHMBNGCG-RNJXMRFFSA-N octahydroindole-2-carboxylic acid Chemical compound C1CCC[C@H]2N[C@H](C(=O)O)C[C@@H]21 CQYBNXGHMBNGCG-RNJXMRFFSA-N 0.000 description 2
- 229960003104 ornithine Drugs 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- HYAFETHFCAUJAY-UHFFFAOYSA-N pioglitazone Chemical compound N1=CC(CC)=CC=C1CCOC(C=C1)=CC=C1CC1C(=O)NC(=O)S1 HYAFETHFCAUJAY-UHFFFAOYSA-N 0.000 description 2
- 229920000747 poly(lactic acid) Polymers 0.000 description 2
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 238000000159 protein binding assay Methods 0.000 description 2
- 230000002685 pulmonary effect Effects 0.000 description 2
- BBEAQIROQSPTKN-UHFFFAOYSA-N pyrene Chemical compound C1=CC=C2C=CC3=CC=CC4=CC=C1C2=C43 BBEAQIROQSPTKN-UHFFFAOYSA-N 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- YGSDEFSMJLZEOE-UHFFFAOYSA-N salicylic acid Chemical compound OC(=O)C1=CC=CC=C1O YGSDEFSMJLZEOE-UHFFFAOYSA-N 0.000 description 2
- 229940043230 sarcosine Drugs 0.000 description 2
- 238000007423 screening assay Methods 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- UQDJGEHQDNVPGU-UHFFFAOYSA-N serine phosphoethanolamine Chemical compound [NH3+]CCOP([O-])(=O)OCC([NH3+])C([O-])=O UQDJGEHQDNVPGU-UHFFFAOYSA-N 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 150000003384 small molecules Chemical class 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M sodium chloride Inorganic materials [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- GEHJYWRUCIMESM-UHFFFAOYSA-L sodium sulfite Chemical compound [Na+].[Na+].[O-]S([O-])=O GEHJYWRUCIMESM-UHFFFAOYSA-L 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 230000001954 sterilising effect Effects 0.000 description 2
- 238000004659 sterilization and disinfection Methods 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 229960002180 tetracycline Drugs 0.000 description 2
- 229930101283 tetracycline Natural products 0.000 description 2
- 235000019364 tetracycline Nutrition 0.000 description 2
- 150000003522 tetracyclines Chemical class 0.000 description 2
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 2
- YSMODUONRAFBET-WHFBIAKZSA-N threo-5-hydroxy-L-lysine Chemical compound NC[C@@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-WHFBIAKZSA-N 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 108700012359 toxins Proteins 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 230000001131 transforming effect Effects 0.000 description 2
- 239000013638 trimer Substances 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- MEYZYGMYMLNUHJ-UHFFFAOYSA-N tunicamycin Natural products CC(C)CCCCCCCCCC=CC(=O)NC1C(O)C(O)C(CC(O)C2OC(C(O)C2O)N3C=CC(=O)NC3=O)OC1OC4OC(CO)C(O)C(O)C4NC(=O)C MEYZYGMYMLNUHJ-UHFFFAOYSA-N 0.000 description 2
- 241001430294 unidentified retrovirus Species 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- JPZXHKDZASGCLU-LBPRGKRZSA-N β-(2-naphthyl)-alanine Chemical compound C1=CC=CC2=CC(C[C@H](N)C(O)=O)=CC=C21 JPZXHKDZASGCLU-LBPRGKRZSA-N 0.000 description 2
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- JNYAEWCLZODPBN-JGWLITMVSA-N (2r,3r,4s)-2-[(1r)-1,2-dihydroxyethyl]oxolane-3,4-diol Chemical class OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O JNYAEWCLZODPBN-JGWLITMVSA-N 0.000 description 1
- XSYUPRQVAHJETO-WPMUBMLPSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-amino-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-imidaz Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(O)=O)C1=CN=CN1 XSYUPRQVAHJETO-WPMUBMLPSA-N 0.000 description 1
- XMQUEQJCYRFIQS-YFKPBYRVSA-N (2s)-2-amino-5-ethoxy-5-oxopentanoic acid Chemical compound CCOC(=O)CC[C@H](N)C(O)=O XMQUEQJCYRFIQS-YFKPBYRVSA-N 0.000 description 1
- KYBXNPIASYUWLN-WUCPZUCCSA-N (2s)-5-hydroxypyrrolidine-2-carboxylic acid Chemical compound OC1CC[C@@H](C(O)=O)N1 KYBXNPIASYUWLN-WUCPZUCCSA-N 0.000 description 1
- GQPYTJVDPQTBQC-KLQYNRQASA-N (3r)-3-amino-1-[3-(trifluoromethyl)-6,8-dihydro-5h-[1,2,4]triazolo[4,3-a]pyrazin-7-yl]-4-(2,4,5-trifluorophenyl)butan-1-one;phosphoric acid;hydrate Chemical compound O.OP(O)(O)=O.C([C@H](CC(=O)N1CC=2N(C(=NN=2)C(F)(F)F)CC1)N)C1=CC(F)=C(F)C=C1F GQPYTJVDPQTBQC-KLQYNRQASA-N 0.000 description 1
- RMQHBNLAFHDMEN-UHFFFAOYSA-N (4,4,4-trifluoro-2-oxobutyl) dihydrogen phosphate Chemical compound OP(O)(=O)OCC(=O)CC(F)(F)F RMQHBNLAFHDMEN-UHFFFAOYSA-N 0.000 description 1
- WHBMMWSBFZVSSR-GSVOUGTGSA-N (R)-3-hydroxybutyric acid Chemical compound C[C@@H](O)CC(O)=O WHBMMWSBFZVSSR-GSVOUGTGSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- VGIRNWJSIRVFRT-UHFFFAOYSA-N 2',7'-difluorofluorescein Chemical compound OC(=O)C1=CC=CC=C1C1=C2C=C(F)C(=O)C=C2OC2=CC(O)=C(F)C=C21 VGIRNWJSIRVFRT-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- 125000000979 2-amino-2-oxoethyl group Chemical group [H]C([*])([H])C(=O)N([H])[H] 0.000 description 1
- QKCKCXFWENOGER-UHFFFAOYSA-N 2-phenyloxazol-5(4H)-one Chemical compound O1C(=O)CN=C1C1=CC=CC=C1 QKCKCXFWENOGER-UHFFFAOYSA-N 0.000 description 1
- SWLAMJPTOQZTAE-UHFFFAOYSA-N 4-[2-[(5-chloro-2-methoxybenzoyl)amino]ethyl]benzoic acid Chemical compound COC1=CC=C(Cl)C=C1C(=O)NCCC1=CC=C(C(O)=O)C=C1 SWLAMJPTOQZTAE-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- SJQRQOKXQKVJGJ-UHFFFAOYSA-N 5-(2-aminoethylamino)naphthalene-1-sulfonic acid Chemical compound C1=CC=C2C(NCCN)=CC=CC2=C1S(O)(=O)=O SJQRQOKXQKVJGJ-UHFFFAOYSA-N 0.000 description 1
- AGFIRQJZCNVMCW-UAKXSSHOSA-N 5-bromouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(Br)=C1 AGFIRQJZCNVMCW-UAKXSSHOSA-N 0.000 description 1
- ZMERMCRYYFRELX-UHFFFAOYSA-N 5-{[2-(iodoacetamido)ethyl]amino}naphthalene-1-sulfonic acid Chemical compound C1=CC=C2C(S(=O)(=O)O)=CC=CC2=C1NCCNC(=O)CI ZMERMCRYYFRELX-UHFFFAOYSA-N 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 241000243290 Aequorea Species 0.000 description 1
- 239000012103 Alexa Fluor 488 Substances 0.000 description 1
- 239000012109 Alexa Fluor 568 Substances 0.000 description 1
- 239000012110 Alexa Fluor 594 Substances 0.000 description 1
- 239000012112 Alexa Fluor 633 Substances 0.000 description 1
- 239000012114 Alexa Fluor 647 Substances 0.000 description 1
- 239000012115 Alexa Fluor 660 Substances 0.000 description 1
- 239000012116 Alexa Fluor 680 Substances 0.000 description 1
- 239000012099 Alexa Fluor family Substances 0.000 description 1
- 102100022524 Alpha-1-antichymotrypsin Human genes 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 108010032595 Antibody Binding Sites Proteins 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 238000012935 Averaging Methods 0.000 description 1
- 241000713842 Avian sarcoma virus Species 0.000 description 1
- 210000002237 B-cell of pancreatic islet Anatomy 0.000 description 1
- 239000005711 Benzoic acid Substances 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- 229940123208 Biguanide Drugs 0.000 description 1
- XNCOSPRUTUOJCJ-UHFFFAOYSA-N Biguanide Chemical compound NC(N)=NC(N)=N XNCOSPRUTUOJCJ-UHFFFAOYSA-N 0.000 description 1
- BTBUEUYNUDRHOZ-UHFFFAOYSA-N Borate Chemical compound [O-]B([O-])[O-] BTBUEUYNUDRHOZ-UHFFFAOYSA-N 0.000 description 1
- 241000701822 Bovine papillomavirus Species 0.000 description 1
- 102100028672 C-type lectin domain family 4 member D Human genes 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- GHXZTYHSJHQHIJ-UHFFFAOYSA-N Chlorhexidine Chemical compound C=1C=C(Cl)C=CC=1NC(N)=NC(N)=NCCCCCCN=C(N)N=C(N)NC1=CC=C(Cl)C=C1 GHXZTYHSJHQHIJ-UHFFFAOYSA-N 0.000 description 1
- 108091062157 Cis-regulatory element Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- LEVWYRKDKASIDU-QWWZWVQMSA-N D-cystine Chemical compound OC(=O)[C@H](N)CSSC[C@@H](N)C(O)=O LEVWYRKDKASIDU-QWWZWVQMSA-N 0.000 description 1
- KDXKERNSBIXSRK-RXMQYKEDSA-N D-lysine Chemical compound NCCCC[C@@H](N)C(O)=O KDXKERNSBIXSRK-RXMQYKEDSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 1
- 108700020911 DNA-Binding Proteins Proteins 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 108090000204 Dipeptidase 1 Proteins 0.000 description 1
- 101100012887 Drosophila melanogaster btl gene Proteins 0.000 description 1
- 101100012878 Drosophila melanogaster htl gene Proteins 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 206010014476 Elevated cholesterol Diseases 0.000 description 1
- 206010014486 Elevated triglycerides Diseases 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 239000001116 FEMA 4028 Substances 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 102100024802 Fibroblast growth factor 23 Human genes 0.000 description 1
- 102100037362 Fibronectin Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 241000700662 Fowlpox virus Species 0.000 description 1
- JRZJKWGQFNTSRN-UHFFFAOYSA-N Geldanamycin Natural products C1C(C)CC(OC)C(O)C(C)C=C(C)C(OC(N)=O)C(OC)CCC=C(C)C(=O)NC2=CC(=O)C(OC)=C1C2=O JRZJKWGQFNTSRN-UHFFFAOYSA-N 0.000 description 1
- FAEKWTJYAYMJKF-QHCPKHFHSA-N GlucoNorm Chemical compound C1=C(C(O)=O)C(OCC)=CC(CC(=O)N[C@@H](CC(C)C)C=2C(=CC=CC=2)N2CCCCC2)=C1 FAEKWTJYAYMJKF-QHCPKHFHSA-N 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 1
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 1
- 108091005904 Hemoglobin subunit beta Proteins 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 101000678026 Homo sapiens Alpha-1-antichymotrypsin Proteins 0.000 description 1
- 101000766905 Homo sapiens C-type lectin domain family 4 member D Proteins 0.000 description 1
- 101000967216 Homo sapiens Eosinophil cationic protein Proteins 0.000 description 1
- 101001051973 Homo sapiens Fibroblast growth factor 23 Proteins 0.000 description 1
- 101000779418 Homo sapiens RAC-alpha serine/threonine-protein kinase Proteins 0.000 description 1
- 101000712530 Homo sapiens RAF proto-oncogene serine/threonine-protein kinase Proteins 0.000 description 1
- 101000617830 Homo sapiens Sterol O-acyltransferase 1 Proteins 0.000 description 1
- 241000701109 Human adenovirus 2 Species 0.000 description 1
- 102000004157 Hydrolases Human genes 0.000 description 1
- 108090000604 Hydrolases Proteins 0.000 description 1
- 208000035150 Hypercholesterolemia Diseases 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- XQFRJNBWHJMXHO-RRKCRQDMSA-N IDUR Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 XQFRJNBWHJMXHO-RRKCRQDMSA-N 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical class O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 206010022489 Insulin Resistance Diseases 0.000 description 1
- 102000010789 Interleukin-2 Receptors Human genes 0.000 description 1
- 108010038453 Interleukin-2 Receptors Proteins 0.000 description 1
- 108010038486 Interleukin-4 Receptors Proteins 0.000 description 1
- 102100039078 Interleukin-4 receptor subunit alpha Human genes 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- LPHGQDQBBGAPDZ-UHFFFAOYSA-N Isocaffeine Natural products CN1C(=O)N(C)C(=O)C2=C1N(C)C=N2 LPHGQDQBBGAPDZ-UHFFFAOYSA-N 0.000 description 1
- 102000015834 Klotho Human genes 0.000 description 1
- 108050004036 Klotho Proteins 0.000 description 1
- 235000019766 L-Lysine Nutrition 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 102000019149 MAP kinase activity proteins Human genes 0.000 description 1
- 108040008097 MAP kinase activity proteins Proteins 0.000 description 1
- 241000282560 Macaca mulatta Species 0.000 description 1
- 240000002769 Morchella esculenta Species 0.000 description 1
- 235000002779 Morchella esculenta Nutrition 0.000 description 1
- 241000713333 Mouse mammary tumor virus Species 0.000 description 1
- 102000007474 Multiprotein Complexes Human genes 0.000 description 1
- 108010085220 Multiprotein Complexes Proteins 0.000 description 1
- 101710107068 Myelin basic protein Proteins 0.000 description 1
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 1
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 1
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 102000000536 PPAR gamma Human genes 0.000 description 1
- 108010016731 PPAR gamma Proteins 0.000 description 1
- 241000282577 Pan troglodytes Species 0.000 description 1
- 102000016387 Pancreatic elastase Human genes 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 241001505332 Polyomavirus sp. Species 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 241001343656 Ptilosarcus Species 0.000 description 1
- 102100033810 RAC-alpha serine/threonine-protein kinase Human genes 0.000 description 1
- 102100033479 RAF proto-oncogene serine/threonine-protein kinase Human genes 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- UIIMBOGNXHQVGW-DEQYMQKBSA-M Sodium bicarbonate-14C Chemical compound [Na+].O[14C]([O-])=O UIIMBOGNXHQVGW-DEQYMQKBSA-M 0.000 description 1
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 1
- 101800001707 Spacer peptide Proteins 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 102100021993 Sterol O-acyltransferase 1 Human genes 0.000 description 1
- PJANXHGTPQOBST-VAWYXSNFSA-N Stilbene Natural products C=1C=CC=CC=1/C=C/C1=CC=CC=C1 PJANXHGTPQOBST-VAWYXSNFSA-N 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 101000697584 Streptomyces lavendulae Streptothricin acetyltransferase Proteins 0.000 description 1
- 229940100389 Sulfonylurea Drugs 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- IXKSXJFAGXLQOQ-XISFHERQSA-N WHWLQLKPGQPMY Chemical compound C([C@@H](C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)C1=CNC=N1 IXKSXJFAGXLQOQ-XISFHERQSA-N 0.000 description 1
- 238000012452 Xenomouse strains Methods 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 239000008351 acetate buffer Substances 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 210000000577 adipose tissue Anatomy 0.000 description 1
- 210000000593 adipose tissue white Anatomy 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 229910001508 alkali metal halide Inorganic materials 0.000 description 1
- 150000008045 alkali metal halides Chemical class 0.000 description 1
- 108010050122 alpha 1-Antitrypsin Proteins 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 102000013529 alpha-Fetoproteins Human genes 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 125000003368 amide group Chemical group 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 239000013011 aqueous formulation Substances 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- 235000010233 benzoic acid Nutrition 0.000 description 1
- 229960004365 benzoic acid Drugs 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- WHGYBXFWUBPSRW-FOUAGVGXSA-N beta-cyclodextrin Chemical compound OC[C@H]([C@H]([C@@H]([C@H]1O)O)O[C@H]2O[C@@H]([C@@H](O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O3)[C@H](O)[C@H]2O)CO)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H]3O[C@@H]1CO WHGYBXFWUBPSRW-FOUAGVGXSA-N 0.000 description 1
- 235000011175 beta-cyclodextrine Nutrition 0.000 description 1
- 102000006635 beta-lactamase Human genes 0.000 description 1
- 229960004853 betadex Drugs 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 229920000249 biocompatible polymer Polymers 0.000 description 1
- 239000012620 biological material Substances 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 229920001222 biopolymer Polymers 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 108091005948 blue fluorescent proteins Proteins 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 239000004067 bulking agent Substances 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- 229960001948 caffeine Drugs 0.000 description 1
- VJEONQKOZGKCAK-UHFFFAOYSA-N caffeine Natural products CN1C(=O)N(C)C(=O)C2=C1C=CN2C VJEONQKOZGKCAK-UHFFFAOYSA-N 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 1
- 229930195731 calicheamicin Natural products 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 230000000973 chemotherapeutic effect Effects 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 229960003260 chlorhexidine Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 150000001860 citric acid derivatives Chemical class 0.000 description 1
- 238000000975 co-precipitation Methods 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 230000009137 competitive binding Effects 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 239000008139 complexing agent Substances 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 229960003067 cystine Drugs 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 239000002254 cytotoxic agent Substances 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000002354 daily effect Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- PGUYAANYCROBRT-UHFFFAOYSA-N dihydroxy-selanyl-selanylidene-lambda5-phosphane Chemical compound OP(O)([SeH])=[Se] PGUYAANYCROBRT-UHFFFAOYSA-N 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 230000003467 diminishing effect Effects 0.000 description 1
- NAGJZTKCGNOGPW-UHFFFAOYSA-K dioxido-sulfanylidene-sulfido-$l^{5}-phosphane Chemical compound [O-]P([O-])([S-])=S NAGJZTKCGNOGPW-UHFFFAOYSA-K 0.000 description 1
- 229940090124 dipeptidyl peptidase 4 (dpp-4) inhibitors for blood glucose lowering Drugs 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 230000007783 downstream signaling Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 230000002124 endocrine Effects 0.000 description 1
- 230000037149 energy metabolism Effects 0.000 description 1
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- YQGOJNYOYNNSMM-UHFFFAOYSA-N eosin Chemical compound [Na+].OC(=O)C1=CC=CC=C1C1=C2C=C(Br)C(=O)C(Br)=C2OC2=C(Br)C(O)=C(Br)C=C21 YQGOJNYOYNNSMM-UHFFFAOYSA-N 0.000 description 1
- IINNWAYUJNWZRM-UHFFFAOYSA-L erythrosin B Chemical compound [Na+].[Na+].[O-]C(=O)C1=CC=CC=C1C1=C2C=C(I)C(=O)C(I)=C2OC2=C(I)C([O-])=C(I)C=C21 IINNWAYUJNWZRM-UHFFFAOYSA-L 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 102000052178 fibroblast growth factor receptor activity proteins Human genes 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- GVEPBJHOBDJJJI-UHFFFAOYSA-N fluoranthrene Natural products C1=CC(C2=CC=CC=C22)=C3C2=CC=CC3=C1 GVEPBJHOBDJJJI-UHFFFAOYSA-N 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 235000020983 fruit intake Nutrition 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- QTQAWLPCGQOSGP-GBTDJJJQSA-N geldanamycin Chemical compound N1C(=O)\C(C)=C/C=C\[C@@H](OC)[C@H](OC(N)=O)\C(C)=C/[C@@H](C)[C@@H](O)[C@H](OC)C[C@@H](C)CC2=C(OC)C(=O)C=C1C2=O QTQAWLPCGQOSGP-GBTDJJJQSA-N 0.000 description 1
- 229960004580 glibenclamide Drugs 0.000 description 1
- 229960001381 glipizide Drugs 0.000 description 1
- ZJJXGWJIGJFDTL-UHFFFAOYSA-N glipizide Chemical compound C1=NC(C)=CN=C1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)NC2CCCCC2)C=C1 ZJJXGWJIGJFDTL-UHFFFAOYSA-N 0.000 description 1
- 102000018146 globin Human genes 0.000 description 1
- 108060003196 globin Proteins 0.000 description 1
- 230000014101 glucose homeostasis Effects 0.000 description 1
- 230000004190 glucose uptake Effects 0.000 description 1
- 229960002989 glutamic acid Drugs 0.000 description 1
- ZNNLBTZKUZBEKO-UHFFFAOYSA-N glyburide Chemical compound COC1=CC=C(Cl)C=C1C(=O)NCCC1=CC=C(S(=O)(=O)NC(=O)NC2CCCCC2)C=C1 ZNNLBTZKUZBEKO-UHFFFAOYSA-N 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 150000002338 glycosides Chemical class 0.000 description 1
- 125000003147 glycosyl group Chemical group 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 230000001456 gonadotroph Effects 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 229920001519 homopolymer Polymers 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 229960002163 hydrogen peroxide Drugs 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 238000002169 hydrotherapy Methods 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 125000002349 hydroxyamino group Chemical group [H]ON([H])[*] 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 210000003016 hypothalamus Anatomy 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000000185 intracerebroventricular administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 239000000644 isotonic solution Substances 0.000 description 1
- 230000000155 isotopic effect Effects 0.000 description 1
- 229940090473 januvia Drugs 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 150000002614 leucines Chemical class 0.000 description 1
- 230000004322 lipid homeostasis Effects 0.000 description 1
- 230000037356 lipid metabolism Effects 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- DLBFLQKQABVKGT-UHFFFAOYSA-L lucifer yellow dye Chemical compound [Li+].[Li+].[O-]S(=O)(=O)C1=CC(C(N(C(=O)NN)C2=O)=O)=C3C2=CC(S([O-])(=O)=O)=CC3=C1N DLBFLQKQABVKGT-UHFFFAOYSA-L 0.000 description 1
- 238000003670 luciferase enzyme activity assay Methods 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 239000006249 magnetic particle Substances 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 238000013178 mathematical model Methods 0.000 description 1
- 235000012054 meals Nutrition 0.000 description 1
- 229950004994 meglitinide Drugs 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 230000003340 mental effect Effects 0.000 description 1
- 230000037323 metabolic rate Effects 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 102000035118 modified proteins Human genes 0.000 description 1
- 108091005573 modified proteins Proteins 0.000 description 1
- 238000000302 molecular modelling Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 210000000066 myeloid cell Anatomy 0.000 description 1
- 108010065781 myosin light chain 2 Proteins 0.000 description 1
- 229950006780 n-acetylglucosamine Drugs 0.000 description 1
- 229960000698 nateglinide Drugs 0.000 description 1
- OELFLUMRDSZNSF-BRWVUGGUSA-N nateglinide Chemical compound C1C[C@@H](C(C)C)CC[C@@H]1C(=O)N[C@@H](C(O)=O)CC1=CC=CC=C1 OELFLUMRDSZNSF-BRWVUGGUSA-N 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 210000004248 oligodendroglia Anatomy 0.000 description 1
- 238000006384 oligomerization reaction Methods 0.000 description 1
- 230000006548 oncogenic transformation Effects 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 239000005022 packaging material Substances 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N papa-hydroxy-benzoic acid Natural products OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 235000021317 phosphate Nutrition 0.000 description 1
- PTMHPRAIXMAOOB-UHFFFAOYSA-N phosphoramidic acid Chemical compound NP(O)(O)=O PTMHPRAIXMAOOB-UHFFFAOYSA-N 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- LFGREXWGYUGZLY-UHFFFAOYSA-N phosphoryl Chemical group [P]=O LFGREXWGYUGZLY-UHFFFAOYSA-N 0.000 description 1
- 230000037081 physical activity Effects 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 229960005095 pioglitazone Drugs 0.000 description 1
- 230000027086 plasmid maintenance Effects 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920000191 poly(N-vinyl pyrrolidone) Polymers 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920001583 poly(oxyethylated polyols) Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229940068977 polysorbate 20 Drugs 0.000 description 1
- 229940068965 polysorbates Drugs 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 235000019422 polyvinyl alcohol Nutrition 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 238000011809 primate model Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 238000001498 protein fragment complementation assay Methods 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 150000003254 radicals Chemical class 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000029964 regulation of glucose metabolic process Effects 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 239000003488 releasing hormone Substances 0.000 description 1
- 229960002354 repaglinide Drugs 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 238000011808 rodent model Methods 0.000 description 1
- 229960004586 rosiglitazone Drugs 0.000 description 1
- 229960004889 salicylic acid Drugs 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 239000006152 selective media Substances 0.000 description 1
- JRPHGDYSKGJTKZ-UHFFFAOYSA-K selenophosphate Chemical compound [O-]P([O-])([O-])=[Se] JRPHGDYSKGJTKZ-UHFFFAOYSA-K 0.000 description 1
- 210000002027 skeletal muscle Anatomy 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 235000015424 sodium Nutrition 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 239000007974 sodium acetate buffer Substances 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229940079827 sodium hydrogen sulfite Drugs 0.000 description 1
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 1
- 229940001482 sodium sulfite Drugs 0.000 description 1
- 235000010265 sodium sulphite Nutrition 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 238000011146 sterile filtration Methods 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- PJANXHGTPQOBST-UHFFFAOYSA-N stilbene Chemical compound C=1C=CC=CC=1C=CC1=CC=CC=C1 PJANXHGTPQOBST-UHFFFAOYSA-N 0.000 description 1
- 235000021286 stilbenes Nutrition 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 150000005846 sugar alcohols Chemical class 0.000 description 1
- 125000000472 sulfonyl group Chemical group *S(*)(=O)=O 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 230000002381 testicular Effects 0.000 description 1
- WGTODYJZXSJIAG-UHFFFAOYSA-N tetramethylrhodamine chloride Chemical compound [Cl-].C=12C=CC(N(C)C)=CC2=[O+]C2=CC(N(C)C)=CC=C2C=1C1=CC=CC=C1C(O)=O WGTODYJZXSJIAG-UHFFFAOYSA-N 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-K thiophosphate Chemical compound [O-]P([O-])([O-])=S RYYWUUFWQRZTIU-UHFFFAOYSA-K 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 239000012443 tonicity enhancing agent Substances 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 230000014723 transformation of host cell by virus Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- ODLHGICHYURWBS-LKONHMLTSA-N trappsol cyclo Chemical compound CC(O)COC[C@H]([C@H]([C@@H]([C@H]1O)O)O[C@H]2O[C@@H]([C@@H](O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O3)[C@H](O)[C@H]2O)COCC(O)C)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H]3O[C@@H]1COCC(C)O ODLHGICHYURWBS-LKONHMLTSA-N 0.000 description 1
- ITMCEJHCFYSIIV-UHFFFAOYSA-N triflic acid Chemical compound OS(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-N 0.000 description 1
- 238000005829 trimerization reaction Methods 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 229960000281 trometamol Drugs 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 230000036642 wellbeing Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 108091005957 yellow fluorescent proteins Proteins 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
- A61K47/42—Proteins; Polypeptides; Degradation products thereof; Derivatives thereof, e.g. albumin, gelatin or zein
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/06—Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations
- A61K49/08—Nuclear magnetic resonance [NMR] contrast preparations; Magnetic resonance imaging [MRI] contrast preparations characterised by the carrier
- A61K49/10—Organic compounds
- A61K49/14—Peptides, e.g. proteins
- A61K49/16—Antibodies; Immunoglobulins; Fragments thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/32—Immunoglobulins specific features characterized by aspects of specificity or valency specific for a neo-epitope on a complex, e.g. antibody-antigen or ligand-receptor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/54—F(ab')2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/626—Diabody or triabody
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- the present disclosure relates to nucleic acid molecules encoding antigen binding proteins that bind to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4.
- the present disclosure also provides antigen binding proteins that bind to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, including antigen binding proteins that induce FGF21-like signaling, as well as pharmaceutical compositions comprising antigen binding proteins that bind to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ - Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, including antigen binding proteins that induce FGF21-like signaling, and methods for treating metabolic disorders using such nucleic acids, polypeptides, or pharmaceutical compositions. Diagnostic methods using the antigen binding proteins are
- Fibroblast Growth Factor 21 is a secreted polypeptide that belongs to a subfamily of Fibroblast Growth Factors (FGFs) that includes FGF 19, FGF21, and FGF23 (Itoh et al., (2004) Trend Genet. 20:563-69).
- FGF21 is an atypical FGF in that it is heparin independent and functions as a hormone in the regulation of glucose, lipid, and energy metabolism.
- FGF21 farnesoid GF21
- Transgenic mice overexpressing FGF21 exhibit metabolic phenotypes of slow growth rate, low plasma glucose and triglyceride levels, and an absence of age-associated type 2 diabetes, islet hyperplasia, and obesity.
- Pharmacological administration of recombinant FGF21 protein in rodent and primate models results in normalized levels of plasma glucose, reduced triglyceride and cholesterol levels, and improved glucose tolerance and insulin sensitivity.
- FGF21 reduces body weight and body fat by increasing energy expenditure, physical activity, and metabolic rate.
- Experimental research provides support for the pharmacological administration of FGF21 for the treatment of type 2 diabetes, obesity, dyslipidemia, and other metabolic conditions or disorders in humans.
- FGF21 is a liver derived endocrine hormone that stimulates glucose uptake in adipocytes and lipid homeostasis through the activation of its receptor.
- the FGF21 receptor also comprises the membrane associated ⁇ -Klotho as an essential cofactor. Activation of the FGF21 receptor leads to multiple effects on a variety of metabolic parameters.
- FGFs mediate their action via a set of four FGF receptors, FGFR1 - 4, that in turn are expressed in multiple spliced variants, e.g., FGFRlc, FGFR2c, FGFR3c and FGFR4.
- Each FGF receptor contains an intracellular tyrosine kinase domain that is activated upon ligand binding, leading to downstream signaling pathways involving MAPKs (Erkl/2), RAF1, AKT1 and STATs. (Kharitonenkov et al, (2008) BioDrugs 22:37-44).
- the present disclosure provides a human (or humanized) antigen binding protein, such as a monoclonal antibody, that induces FGF21-like signaling, e.g., an agonistic antibody that mimics the function of FGF21.
- a human antigen binding protein such as a monoclonal antibody
- Such an antibody is a molecule with FGF21-like activity and selectivity but with added therapeutically desirable characteristics typical for an antibody such as protein stability, lack of immunogenicity, ease of production and long half-life in vivo.
- An isolated antigen binding protein that induces FGF21 -mediated signaling is provided. Also provided is an isolated antigen binding protein that specifically binds to at least one of: (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; and (iii) a complex comprising ⁇ - Klotho and one of FGFRlc, FGFR2c, FGFR3c and FGFR4 wherein the antigen binding protein induces FGF21 -mediated signaling.
- the provided antigen binding proteins comprise an amino acid sequence selected from the group consisting of: (a) a light chain CDR3 comprising a sequence selected from the group consisting of: (i) a light chain CDR3 sequence that differs by no more than a total of three amino acid additions, substitutions, and/or deletions from a CDR3 sequence selected from the group consisting of the light chain CDR3 sequences of LI -LI 8, SEQ ID NOs: 180-194; (ii) QVWDXiX 2 SDHVV (SEQ ID NO: 276); (iii) QQX3GX 4 X 5 X 6 X 7 T (SEQ ID NO: 283); (iv) LQHNSYPLT (SEQ ID NO: 267); (v) MQSLQTPFT (SEQ ID NO: 268); (vi) QQYNNWPPT (SEQ ID NO: 269); (vii) MQSIQLPRT (SEQ ID NO: 270); (viii) Q
- the provided antigen binding proteins comprise either: (a) a light chain CDR1 sequence selected from the group consisting of: (i) a light chain CDR1 that differs by no more than three amino acids additions, substitutions, and/or deletions from a CDR1 sequence of L1-L18, SEQ ID NOs: 158-170; (ii) RASQ X 9 Xi 0 XnXi 2 Xi 3 Xi 4 LA (SEQ ID NO: 304); (iii) GGNNIGSXi 5 SVH (SEQ ID NO: 307); (iv) RSSQSLLX 2 9X 3 oNGX 3 iX 32 X 33 LD (SEQ ID NO: 310); (v) RASQSVNSNLA (SEQ ID NO: 295); (vi) RASQDIRYDLG (SEQ ID NO: 296); (vii) RASQGISIWLA (SEQ ID NO: 297); and (viii) KSSQSLL
- the provided antigen binding proteins comprise either: (a) a light chain variable domain comprising; (i) a light chain CDRl sequence selected from SEQ ID NOs: 158-170; (ii) a light chain CDR2 sequence selected from SEQ ID NOs: 171-179; (iii) a light chain CDR3 sequence selected from SEQ ID NOs: 180- 194; and (b) a heavy chain variable domain comprising: (i) a heavy chain CDRl sequence selected from SEQ ID NOs: 121-131; (ii) a heavy chain CDR2 sequence selected from SEQ ID NOs: 132-144; and (iii) a heavy chain CDR3 sequence selected from SEQ ID NOs: 145-157; or (c) the light chain variable domain of (a) and the heavy chain variable domain of (b), wherein the antigen binding protein specifically binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c
- the provided antigen binding proteins comprise either: (a) a light chain variable domain sequence selected from the group consisting of: (i) amino acids having a sequence at least 80% identical to a light chain variable domain sequence selected from V L I - V L 18, SEQ ID NOs:48-65; (ii) a sequence of amino acids encoded by a polynucleotide sequence that is at least 80% identical to a polynucleotide sequence encoding the light chain variable domain sequence of V L 1-V L 18, SEQ ID NOs:48-65; (b) a heavy chain variable domain sequence selected from the group consisting of: (i) a sequence of amino acids that is at least 80% identical to a heavy chain variable domain sequence of V H 1-V H 18 of SEQ ID NOs:66-84; (ii) a sequence of amino acids encoded by a polynucleotide sequence that is at least 80% identical to a polynucleotide sequence encoding the heavy chain variable domain sequence of V H 1-
- the provided antigen binding proteins comprise either: (a) a light chain variable domain sequence selected from the group consisting of: V L 1-V L 18 of SEQ ID NOs:48-65; (b) a heavy chain variable domain sequence selected from the group consisting of: V H 1-V H 18 of SEQ ID NOs:66-84; or (c) the light chain variable domain of (a) and the heavy chain variable domain of (b), wherein the antigen binding protein specifically binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4.
- the provided antigen binding proteins the light chain variable domain and a heavy chain variable domain are selected from the group of combinations consisting of: V L IV H I , V l 2V H 2, V l 3V H 3, V l 3V h 4, V l 4V h 5, V l 5V h 6, V l 6V h 7, V l 7V h 8, V l 8V h 8, V l 9V h 9, V l 9V H 10, V L I OV H I I , V l 11V h 11, V l 12V h 12, V l 13V h 13, V l 14V h 14, V l 15V h 15, V l 16V h 16, V L 17V H 17, and V L 18V H 18, wherein the antigen binding protein specifically binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klot
- the provided antigen binding proteins further comprise: (a) the light chain constant sequence of SEQ ID NO: 10; (b) the light chain constant sequence of SEQ ID NO: 11; (c) the heavy chain constant sequence of SEQ ID NO: 9; or (d) the light chain constant sequence of SEQ ID NO: 10 or SEQ ID NO: 11 and the heavy chain constant sequence of SEQ ID NO: 9.
- the provided antigen binding proteins can take many forms and can be, for example, a human antibody, a humanized antibody, chimeric antibody, a monoclonal antibody, a polyclonal antibody, a recombinant antibody, an antigen-binding antibody fragment, a single chain antibody, a diabody, a triabody, a tetrabody, a Fab fragment, an F(fab') 2 fragment, a domain antibody, an IgD antibody, an IgE antibody, an IgM antibody, an IgGl antibody, an IgG2 antibody, an IgG3 antibody, an IgG4 antibody, or an IgG4 antibody having at least one mutation in the hinge region.
- the provided antigen binding proteins can when bound to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4: (a) lower blood glucose in an animal model; (b) lower serum lipid levels in an animal model; (c) lower insulin levels in an animal model; or (d) two or more of (a) and (b) and (c).
- the provided antigen binding proteins comprise: (a) a heavy chain comprising one of SEQ ID NOs:31, 32, 390-401, 404-405; (b) a light chain comprising one of SEQ ID NO: 13, 14, 385-389, 402-403; or (c) a combination comprising a heavy chain of (a) and a light chain of (b).
- antigen binding proteins that are capable of binding wild type human ⁇ -Klotho (SEQ ID NO:7) but which doesn't bind to a chimeric form of ⁇ -Klotho wherein the chimeric form of ⁇ -Klotho comprises a human ⁇ -Klotho framework wherein murine ⁇ -Klotho sequences replace the wild type human residues at at least one of (a) positions 1-80; (b) positions 303-522; (c) positions 852-1044; and (d) combinations thereof.
- the present disclosure provides antigen binding proteins that are capable of binding wild type human ⁇ -Klotho (SEQ ID NO:7) at at least one of (a) positions 1- 80; (b) positions 303-522; (c) positions 852-1044; and (d) combinations thereof.
- the present disclosure provides antigen binding proteins that are capable of competing with an antigen binding protein of claims 8 or 13 for binding to human wild type ⁇ -Klotho residues at at least one of (a) positions 1-80; (b) positions 303-522; (c) positions 852-1044; and (d) combinations thereof.
- composition comprising one or more antigen binding proteins provided herein, in admixture with a pharmaceutically acceptable carrier thereof.
- nucleic acid molecules that encode the antigen binding proteins disclosed herein.
- the isolated nucleic acid molecules are operably-linked to a control sequence.
- nucleic acids comprise a polynucleotide sequence encoding the light chain variable domain, the heavy chain variable domain, or both, of an antigen binding protein provided herein.
- the nucleic acids comprise (a) V L 1-V L 18 (SEQ ID NOs:48-65); (b) V H 1-V H 18 (SEQ ID NOs:66-84); or (c) one or more sequences of (a) and one or more sequences of (b).
- expression vectors and host cells transformed or transfected with the expression vectors that comprise the aforementioned isolated nucleic acid molecules that encode the antigen binding proteins disclosed herein.
- also provided are methods of preparing antigen binding proteins that specifically or selectively bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4 and comprises the step of preparing the antigen binding protein from a host cell that secretes the antigen binding protein.
- inventions provide a method of preventing or treating a condition in a subject in need of such treatment comprising administering a therapeutically effective amount of a pharmaceutical composition provided herein to a subject, wherein the condition is treatable by lowering blood glucose, insulin or serum lipid levels.
- the condition is type 2 diabetes, obesity, dyslipidemia, NASH, cardiovascular disease or metabolic syndrome.
- Figure 1A-1B is an alignment showing the sequence homology between human FGFRlc (GenBank Accession No PI 1362; SEQ ID NO: 356) and murine FGFRlc (GenBank Accession No NP_034336; SEQ ID NO: 357); various features are highlighted, including the signal peptide, transmembrane sequence, heparin binding region, and a consensus sequence (SEQ ID NO: 358) is provided.
- Figure 2a-2c is an alignment showing the sequence homology between human ⁇ -Klotho (GenBank Accession No NP 783864; SEQ ID NO: 359) and murine ⁇ -Klotho (GenBank Accession No NP_112457; SEQ ID NO: 360); various features are highlighted, including the transmembrane sequence and two glycosyl hydrolase domains, and a consensus sequence (SEQ ID NO: 361) is provided.
- FIG. 3 is a flow cytometry profile of cells stained with FGF21-Alexa 647 that were used as an immunogen to generate antigen binding proteins; the figure shows the expression level of an FGF21R (a complex comprising FGFRlc and ⁇ -Klotho) and binding to FGF21.
- FGF21R a complex comprising FGFRlc and ⁇ -Klotho
- Figure 4 is a sequence (SEQ ID NO: 362) showing an Fc fusion protein that was used as an immunogen to generate antigen binding proteins; the immunogen comprises the extracellular domain (ECD) of human FGFRlc fused to an IgGl Fc via a Gly 5 linker (SEQ ID NO: 379); the FGFRlc component is in capitals, the linker is italic and underlined and the Fc is in lower case letters.
- ECD extracellular domain
- Figure 5 is a sequence (SEQ ID NO: 363) showing an Fc fusion protein that was used as an immunogen to generate antigen binding proteins; the immunogen comprises the extracellular domain (ECD) of human ⁇ -Klotho fused to an IgGl Fc via a Gly 5 linker (SEQ ID NO: 379); the ⁇ -Klotho component is in capitals, the linker is italic and underlined and the Fc is in lower case letters.
- ECD extracellular domain
- Figure 6 is a SDS PAGE gel showing the level of purity achieved from preparations of a soluble FGF21 receptor complex comprising FGFRlc ECD-Fc and ⁇ -Klotho ECD-Fc, which was employed as an immunogen to generate antigen binding proteins.
- Figure 7 is a series of plots generated from an ELK-luciferase reporter assay as described herein performed on recombinant CHO clone 2E10, demonstrating the ability of some of the antigen binding proteins to induce FGF21-like signaling in recombinant CHO cells expressing a FGF21 receptor complex comprising FGFRlc and ⁇ -Klotho.
- Figure 8 is a series of plots generated from an ER 1/2 phosphorylation assay as described herein, demonstrating the ability of some of the antigen binding proteins to induce FGF21-like signaling in rat L6 cells.
- the X-axis is the concentrations of the antigen binding proteins and the Y-axis is the percentage of phosphorylated ER 1/2 of total ERK1/2.
- Figure 9 is a series of plots generated from an ER l/2 phosphorylation assay as described herein, demonstrating that antigen binding protein-mediated FGF21-like signaling in L6 cells is FGFRlc ⁇ -Klotho specific.
- Figure 10 is a series of plots generated from an ER phosphorylation assay as described herein, demonstrating that some antigen binding proteins are able to induce FGF21-like signaling in human adipocyte cells.
- Figure 1 la is a series of binding sensorgrams (response units vs time) demonstrating that some of the antigen binding proteins that induce FGF21 -mediated signaling bind to human ⁇ - Klotho at two different but partially overlapping binding sites represented by 24H11 (Group A) and 17D8 (Group B), while antigen binding proteins that do not induce FGF21 -mediated signaling (2G10, 1A2) do not bind to these sites.
- Figure l ib is a series of binding sensorgrams (response units vs time) demonstrating a third binding site on human ⁇ -Klotho that was identified for Group C antigen binding proteins represented by 39F7.
- Figure 12 is a series of binding sensorgrams (response units vs time) demonstrating that some of the antigen binding proteins (12E4, 24H11, 17C3, 18B11) that induce FGF21 -mediated signaling interfere with ⁇ -Klotho binding to FGF21, while other antigen binding proteins (21H2, 17D8, 18Gl) do not.
- Figure 13 is an alignment of the variable regions of some of the antigen binding proteins that were generated; the framework and CDR regions are identified.
- Figure 13 discloses SEQ ID NOS: 364, 59, 365, 60, 366, 61, 367, 62, 368, 57, 369, 55, 51-52, 56, 56, 53-54, 63-65, 370, 58, 371, 50, 50, 49, 48, 372, 78, 373, 66-69, 79, 374, 76, 81, 375, 70, 73, 73, 71-72, 376, 83, 82, 84, 377, 80, 378, 75 and 74, respectively, in order of appearance.
- Figure 14 is a diagram graphically depicting the study design for a 68 days study performed in obese cynomolgus monkeys.
- Figure 15 is a plot depicting the effects of vehicle and 16H7 on AM meal food intake of the obese cynomolgus monkeys studied.
- Figure 16 is two plots depicting the effects of vehicle and 16H7 on fruit intake and PM food intake of the obese cynomolgus monkeys studied.
- Figure 17 is a plot depicting the effects of vehicle and 16H7 on body weight of the obese cynomolgus monkeys studied.
- Figure 18 is a plot showing the effects of vehicle and 16H7 on body mass index (BMI) of the obese cynomolgus monkeys studied.
- Figure 19 is a plot showing the effects of vehicle on abdominal circumference (AC) of the obese cynomolgus monkeys studied.
- Figure 20 is a plot showing the effects of vehicle and 16H7 on skin fold thickness (SFT) of the obese cynomolgus monkeys studied.
- Figure 21 is a plot showing the effects of vehicle and 16H7 on glucose levels during glucose tolerance tests of the obese cynomolgus monkeys studied.
- Figure 22 is a plot showing the effects of vehicle and 16H7 on plasma insulin levels during glucose tolerance tests of the obese cynomolgus monkeys studied.
- Figure 23 is a plot showing the effects of vehicle and 16H7 on fasting plasma glucose levels of the obese cynomolgus monkeys studied.
- Figure 24 is a plot showing the effects of vehicle and 16H7 on fasting plasma insulin levels of the obese cynomolgus monkeys studied.
- Figure 25 is a plot showing the effects of vehicle and 16H7 on fed plasma glucose levels of the obese cynomolgus monkeys studied.
- Figure 26 is a plot showing the effects of vehicle and 16H7 on fed plasma insulin levels of the obese cynomolgus monkeys studied.
- Figure 27 is a plot showing the effects of vehicle and 16H7 on fasting plasma triglyceride levels of the obese cynomolgus monkeys studied.
- Figure 28 is a plot showing the effects of vehicle and 16H7 on fed plasma triglyceride levels of the obese cynomolgus monkeys studied.
- Figure 29 is a schematic depicting human-mouse ⁇ -Klotho chimeras that were constructed and used to studying the binding of antigen binding proteins.
- Figure 30 is a schematic depicting the human-mouse ⁇ -Klotho chimeras that were constructed and also includes qualitative binding data for FGF21, 16H7, 37D3 and 39F7.
- Figure 31A-C is a series of plots depicting binding data for eight of the 16H7 and 22H5 variants that were constructed, as well as for 22H5 and 16H7.
- Figures 32A-C is a series of plots depicting the results of ELISA assays that were used to demonstrate that several of the 22H5 and 16H7 variants have binding ability.
- Figure 33 is a bar graph comparing off-rates for several 22H5 and 17H7 variants that were generated.
- Figure 34 is two plots that depict binding curves for 39F11 when titrated with FGF21 and for FGF21 when titrated with 39F11; the plots demonstrate an additive effect.
- Figure 35 is two plots that depict binding curves for 16H7 when titrated with 39F11 and 39F11 when it is titrated with 16H7; the plots demonstrate an additive effect.
- an "antigen binding protein” is a protein comprising a portion that binds to an antigen or target and, optionally, a scaffold or framework portion that allows the antigen binding portion to adopt a conformation that promotes binding of the antigen binding protein to the antigen.
- antigen binding proteins examples include a human antibody, a humanized antibody; a chimeric antibody; a recombinant antibody; a single chain antibody; a diabody; a triabody; a tetrabody; a Fab fragment; a F(ab') 2 fragment; an IgD antibody; an IgE antibody; an IgM antibody; an IgGl antibody; an IgG2 antibody; an IgG3 antibody; or an IgG4 antibody, and fragments thereof.
- the antigen binding protein can comprise, for example, an alternative protein scaffold or artificial scaffold with grafted CDRs or CDR derivatives.
- Such scaffolds include, but are not limited to, antibody-derived scaffolds comprising mutations introduced to, for example, stabilize the three-dimensional structure of the antigen binding protein as well as wholly synthetic scaffolds comprising, for example, a biocompatible polymer. See, e.g., Korndorfer et al., 2003, Proteins: Structure, Function, and Bioinformatics, 53(1): 121-129 (2003); Roque et al., Biotechnol. Prog. 20:639-654 (2004).
- PAMs peptide antibody mimetics
- scaffolds based on antibody mimetics utilizing fibronectin components as a scaffold.
- An antigen binding protein can have, for example, the structure of a naturally occurring immunoglobulin.
- An "immunoglobulin” is a tetrameric molecule. In a naturally occurring immunoglobulin, each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy" chain (about 50-70 kDa).
- the amino- terminal portion of each chain includes a variable region of about 100 to 1 10 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. Human light chains are classified as kappa and lambda light chains.
- Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
- the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2 nd ed. Raven Press, N.Y. (1989)) (incorporated by reference in its entirety for all purposes).
- the variable regions of each light/heavy chain pair form the antibody binding site such that an intact immunoglobulin has two binding sites.
- Naturally occurring immunoglobulin chains exhibit the same general structure of relatively conserved framework regions (FR) joined by three hypervariable regions, also called complementarity determining regions or CDRs. From N-terminus to C-terminus, both light and heavy chains comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain can be done in accordance with the definitions of Kabat et al. in Sequences of Proteins of Immunological Interest, 5 th Ed., US Dept. of Health and Human Services, PHS, NIH, NIH Publication no. 91-3242, 1991.
- the CDRs can also be redefined according an alternative nomenclature scheme, such as that of Chothia (see Chothia & Lesk, 1987, J. Mol. Biol. 196:901-917; Chothia et al, 1989, Nature 342:878-883 or Honegger & Pluckthun, 2001, J . Mol. Biol. 309:657-670).
- an antigen binding protein is said to “specifically bind” or “selectively bind” its target antigen when the dissociation constant (K D ) is ⁇ 10 "8 M.
- the antibody specifically binds antigen with "high affinity” when the K D is ⁇ 5x 10 ⁇ 9 M, and with “very high affinity” when the K D is ⁇ 5x 10 "10 M.
- the antibodies will bind to FGFRlc, ⁇ -Klotho, both FGFRlc and ⁇ -Klotho or a complex comprising FGFRlc and ⁇ -Klotho, including human FGFRlc, human ⁇ -Klotho or both human FGFRlc and human ⁇ -Klotho, with a K D of between about 10 "7 M and 10 "12 M, and in yet another embodiment the antibodies will bind with a K D ⁇ 5x 10 ⁇ 9 .
- an “antibody” refers to an intact immunoglobulin or to an antigen binding portion thereof that competes with the intact antibody for specific binding, unless otherwise specified.
- Antigen binding portions can be produced by recombinant DNA techniques or by enzymatic or chemical cleavage of intact antibodies.
- Antigen binding portions include, inter alia, Fab, Fab', F(ab') 2 , Fv, domain antibodies (dAbs), fragments including complementarity determining regions (CDRs), single-chain antibodies (scFv), chimeric antibodies, diabodies, triabodies, tetrabodies, and polypeptides that contain at least a portion of an immunoglobulin that is sufficient to confer specific antigen binding to the polypeptide.
- a Fab fragment is a monovalent fragment having the V L , V H , C L and C H I domains;
- F(ab') 2 fragment is a bivalent fragment having two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment has the V H and C H I domains; an Fv fragment has the V L and V H domains of a single arm of an antibody; and a dAb fragment has a V H domain, a V L domain, or an antigen-binding fragment of a V H or V L domain (US Pat. Nos. 6,846,634, 6,696,245, US App. Pub. Nos. 05/0202512, 04/0202995, 04/0038291, 04/0009507, 03/0039958, Ward et al, Nature 341 :544-546 (1989)).
- a single-chain antibody is an antibody in which a V L and a V H region are joined via a linker (e.g., a synthetic sequence of amino acid residues) to form a continuous protein chain wherein the linker is long enough to allow the protein chain to fold back on itself and form a monovalent antigen binding site (see, e.g., Bird et al, Science 242:423-26 (1988) and Huston et al, 1988, Proc. Natl. Acad. Sci. USA 85:5879-83 (1988)).
- a linker e.g., a synthetic sequence of amino acid residues
- Diabodies are bivalent antibodies comprising two polypeptide chains, wherein each polypeptide chain comprises V H and V L domains joined by a linker that is too short to allow for pairing between two domains on the same chain, thus allowing each domain to pair with a complementary domain on another polypeptide chain (see, e.g., HoUiger et al, 1993, Proc. Natl. Acad. Sci. USA 90:6444-48 (1993), and Poljak et al, Structure 2: 1121-23 (1994)). If the two polypeptide chains of a diabody are identical, then a diabody resulting from their pairing will have two identical antigen binding sites.
- Polypeptide chains having different sequences can be used to make a diabody with two different antigen binding sites.
- tribodies and tetrabodies are antibodies comprising three and four polypeptide chains, respectively, and forming three and four antigen binding sites, respectively, which can be the same or different.
- Complementarity determining regions (CDRs) and framework regions (FR) of a given antibody can be identified using the system described by Kabat et al. in Sequences of Proteins of Immunological Interest, 5th Ed., US Dept. of Health and Human Services, PHS, NIH, NIH Publication no. 91-3242, 1991 As desired, the CDRs can also be redefined according an alternative nomenclature scheme, such as that of Chothia (see Chothia & Lesk, 1987, J. Mol. Biol. 196:901-917; Chothia et al, 1989, Nature 342:878-883 or Honegger & Pluckthun, 2001, J. Mol. Biol. 309:657-670.
- One or more CDRs can be incorporated into a molecule either covalently or noncovalently to make it an antigen binding protein.
- An antigen binding protein can incorporate the CDR(s) as part of a larger polypeptide chain, can covalently link the CDR(s) to another polypeptide chain, or can incorporate the CDR(s) noncovalently.
- the CDRs permit the antigen binding protein to specifically bind to a particular antigen of interest.
- An antigen binding protein can have one or more binding sites. If there is more than one binding site, the binding sites can be identical to one another or can be different. For example, a naturally occurring human immunoglobulin typically has two identical binding sites, while a "bispecific” or “bifunctional” antibody has two different binding sites.
- human antibody includes all antibodies that have one or more variable and constant regions derived from human immunoglobulin sequences. In one embodiment, all of the variable and constant domains are derived from human immunoglobulin sequences (a fully human antibody).
- antibodies can be prepared in a variety of ways, examples of which are described below, including through the immunization with an antigen of interest of a mouse that is genetically modified to express antibodies derived from human heavy and/or light chain- encoding genes, such as a mouse derived from a Xenomouse®, UltiMabTM, or Velocimmune® system. Phage-based approaches can also be employed.
- a humanized antibody has a sequence that differs from the sequence of an antibody derived from a non-human species by one or more amino acid substitutions, deletions, and/or additions, such that the humanized antibody is less likely to induce an immune response, and/or induces a less severe immune response, as compared to the non-human species antibody, when it is administered to a human subject.
- certain amino acids in the framework and constant domains of the heavy and/or light chains of the non-human species antibody are mutated to produce the humanized antibody.
- the constant domain(s) from a human antibody are fused to the variable domain(s) of a non-human species.
- one or more amino acid residues in one or more CDR sequences of a non-human antibody are changed to reduce the likely immunogenicity of the non-human antibody when it is administered to a human subject, wherein the changed amino acid residues either are not critical for immunospecific binding of the antibody to its antigen, or the changes to the amino acid sequence that are made are conservative changes, such that the binding of the humanized antibody to the antigen is not significantly worse than the binding of the non-human antibody to the antigen. Examples of how to make humanized antibodies can be found in U.S. Pat. Nos. 6,054,297, 5,886,152 and 5,877,293.
- chimeric antibody refers to an antibody that contains one or more regions from one antibody and one or more regions from one or more other antibodies.
- one or more of the CDRs are derived from a human antibody that binds (i) ⁇ - Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4.
- all of the CDRs are derived from a human antibody that binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4.
- the CDRs from more than one human antibody that binds are mixed and matched in a chimeric antibody.
- a chimeric antibody can comprise a CDRl from the light chain of a first human antibody that binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, a CDR2 and a CDR3 from the light chain of a second human antibody that binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, and the CDRs from the heavy chain from a third antibody that binds (i) ⁇ - Klotho; (ii) FGFRl
- the framework regions can be derived from one of the same antibodies that bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, from one or more different antibodies, such as a human antibody, or from a humanized antibody.
- a portion of the heavy and/or light chain is identical with, homologous to, or derived from an antibody from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is/are identical with, homologous to, or derived from an antibody or antibodies from another species or belonging to another antibody class or subclass.
- fragments of such antibodies that exhibit the desired biological activity (e.g., the ability to specifically bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4).
- desired biological activity e.g., the ability to specifically bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4).
- light chain includes a full-length light chain and fragments thereof having sufficient variable region sequence to confer binding specificity.
- a full-length light chain includes a variable region domain, VL, and a constant region domain, CL.
- the variable region domain of the light chain is at the amino-terminus of the polypeptide.
- Light chains include kappa (“ ⁇ ”) chains and lambda (“ ⁇ ”) chains.
- heavy chain includes a full-length heavy chain and fragments thereof having sufficient variable region sequence to confer binding specificity.
- a full-length heavy chain includes a variable region domain, V H , and three constant region domains, C H 1 , C H 2, and C H 3.
- the V H domain is at the amino-terminus of the polypeptide
- the C H domains are at the carboxyl-terminus, with the C H 3 being closest to the carboxy-terminus of the polypeptide.
- Heavy chains can be of any isotype, including IgG (including IgGl, IgG2, IgG3 and IgG4 subtypes), IgA (including IgAl and IgA2 subtypes), IgM and IgE.
- an antigen binding protein e.g., an antibody or immunoglobulin chain (heavy or light chain)
- an antigen binding protein comprising a portion (regardless of how that portion is obtained or synthesized) of an antibody that lacks at least some of the amino acids present in a full-length chain but which is capable of specifically binding to an antigen.
- Such fragments are biologically active in that they bind specifically to the target antigen and can compete with other antigen binding proteins, including intact antibodies, for specific binding to a given epitope.
- such a fragment will retain at least one CDR present in the full-length light or heavy chain, and in some embodiments will comprise a single heavy chain and/or light chain or portion thereof.
- These biologically active fragments can be produced by recombinant DNA techniques, or can be produced by enzymatic or chemical cleavage of antigen binding proteins, including intact antibodies.
- Immunologically functional immunoglobulin fragments include, but are not limited to, Fab, Fab', F(ab') 2 , Fv, domain antibodies and single-chain antibodies, and can be derived from any mammalian source, including but not limited to human, mouse, rat, camelid or rabbit.
- a functional portion of the antigen binding proteins disclosed herein could be covalently bound to a second protein or to a small molecule to create a therapeutic agent directed to a particular target in the body, possessing bifunctional therapeutic properties, or having a prolonged serum half-life.
- An "Fc" region contains two heavy chain fragments comprising the C R 2 and C R 3 domains of an antibody.
- the two heavy chain fragments are held together by two or more disulfide bonds and by hydrophobic interactions of the C H 3 domains.
- Fab' fragment contains one light chain and a portion of one heavy chain that contains the V H domain and the C R I domain and also the region between the C R I and C R 2 domains, such that an interchain disulfide bond can be formed between the two heavy chains of two Fab' fragments to form an F(ab') 2 molecule.
- F(ab') 2 fragment contains two light chains and two heavy chains containing a portion of the constant region between the C R I and C R 2 domains, such that an interchain disulfide bond is formed between the two heavy chains.
- a F(ab') 2 fragment thus is composed of two Fab' fragments that are held together by a disulfide bond between the two heavy chains.
- the "Fv region” comprises the variable regions from both the heavy and light chains, but lacks the constant regions.
- a “domain antibody” is an immunologically functional immunoglobulin fragment containing only the variable region of a heavy chain or the variable region of a light chain.
- two or more V H regions are covalently joined with a peptide linker to create a bivalent domain antibody.
- the two V H regions of a bivalent domain antibody can target the same or different antigens.
- a “hemibody” is an immunologically functional immunoglobulin construct comprising a complete heavy chain, a complete light chain and a second heavy chain Fc region paired with the Fc region of the complete heavy chain.
- a linker can, but need not, be employed to join the heavy chain Fc region and the second heavy chain Fc region.
- a hemibody is a monovalent form of an antigen binding protein disclosed herein.
- pairs of charged residues can be employed to associate one Fc region with the second Fc region.
- the second heavy chain Fc region can comprise, for example, SEQ ID NO:441 and can be joined to the light chain via a linker (e.g., SEQ ID NO:440)
- An exemplary hemibody heavy chain comprises the sequence SEQ ID NO:453.
- a “bivalent antigen binding protein” or “bivalent antibody” comprises two antigen binding sites. In some instances, the two binding sites have the same antigen specificities. Bivalent antigen binding proteins and bivalent antibodies can be bispecific, as described herein.
- a multispecific antigen binding protein or “multispecific antibody” is one that targets more than one antigen or epitope.
- a "bispecific,” “dual-specific” or “bifunctional” antigen binding protein or antibody is a hybrid antigen binding protein or antibody, respectively, having two different antigen binding sites.
- Bispecific antigen binding proteins and antibodies are a species of multispecific antigen binding protein or multispecific antibody and can be produced by a variety of methods including, but not limited to, fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai and Lachmann, 1990, Clin. Exp. Immunol. 79:315-321; Kostelny et ah, 1992, J. Immunol. 148:1547- 1553.
- FGF21-like signaling and “induces FGF21-like signaling,” when applied to an antigen binding protein of the present disclosure, means that the antigen binding protein mimics, or modulates, an in vivo biological effect induced by the binding of (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4 and induces a biological response that otherwise would result from FGF21 binding to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho
- an antibody or fragment is deemed to induce a biological response when the response is equal to or greater than 5%, and preferably equal to or greater than 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%), 85%o, 90%) or 95%, of the activity of a wild type FGF21 standard comprising the mature form of SEQ ID NO:2 (i.e., the mature form of the human FGF21 sequence) and has the following properties: exhibiting an efficacy level of equal to or more than 5% of an FGF21 standard, with an EC50 of equal to or less than ⁇ , e.g., 90 nM, 80 nM, 70nM, 60nM, 50nM, 40nM, 30nM, 20nM or 10 nM in (1) the recombinant FGF21 receptor mediated lucifera
- the "potency" of an antigen binding protein is defined as exhibiting an EC50 of equal to or less than ⁇ , e.g., 90nM, 80nM, 70nM, 60nM, 50nM, 40nM, 30nM, 20nM, 10 nM and preferably less than ⁇ of the antigen binding protein in the following assays: (1) the recombinant FGF21 receptor mediated luciferase-reporter cell assay of Example 5; (2) the ERK-phosphorylation in the recombinant FGF21 receptor mediated cell assay of Example 5; and (3) ERK-phosphorylation in human adipocytes as described in Example 7.
- FGF21 -mediated signaling nor is this property desirable in all circumstances. Nevertheless, antigen binding proteins that do not induce FGF21 -mediated signaling form aspects of the present disclosure and may be useful as diagnostic reagents or other applications.
- FGF21R means a multimeric receptor complex that FGF21 is known or suspected to form in vivo.
- FGF21R comprises (i) an FGFR, e.g., FGFRlc, FGFR2c, FGFR3c or FGFR4, and (ii) ⁇ -Klotho.
- polynucleotide or “nucleic acid” includes both single-stranded and double- stranded nucleotide polymers.
- the nucleotides comprising the polynucleotide can be ribonucleotides or deoxyribonucleotides or a modified form of either type of nucleotide.
- Said modifications include base modifications such as bromouridine and inosine derivatives, ribose modifications such as 2', 3'-dideoxyribose, and internucleotide linkage modifications such as phosphorothioate, phosphorodithioate, phosphoroselenoate, phosphorodiselenoate, phosphoroanilothioate, phoshoraniladate and phosphoroamidate.
- oligonucleotide means a polynucleotide comprising 200 or fewer nucleotides. In some embodiments, oligonucleotides are 10 to 60 bases in length. In other embodiments, oligonucleotides are 12, 13, 14, 15, 16, 17, 18, 19, or 20 to 40 nucleotides in length. Oligonucleotides can be single stranded or double stranded, e.g. , for use in the construction of a mutant gene. Oligonucleotides can be sense or antisense oligonucleotides.
- An oligonucleotide can include a label, including a radiolabel, a fluorescent label, a hapten or an antigenic label, for detection assays. Oligonucleotides can be used, for example, as PCR primers, cloning primers or hybridization probes.
- isolated nucleic acid molecule means a DNA or RNA of genomic, mRNA, cDNA, or synthetic origin or some combination thereof which is not associated with all or a portion of a polynucleotide in which the isolated polynucleotide is found in nature, or is linked to a polynucleotide to which it is not linked in nature.
- a nucleic acid molecule comprising a particular nucleotide sequence does not encompass intact chromosomes.
- Isolated nucleic acid molecules "comprising" specified nucleic acid sequences can include, in addition to the specified sequences, coding sequences for up to ten or even up to twenty other proteins or portions thereof, or can include operably linked regulatory sequences that control expression of the coding region of the recited nucleic acid sequences, and/or can include vector sequences.
- the left-hand end of any single-stranded polynucleotide sequence discussed herein is the 5' end; the left-hand direction of double-stranded polynucleotide sequences is referred to as the 5' direction.
- the direction of 5' to 3' addition of nascent RNA transcripts is referred to as the transcription direction; sequence regions on the DNA strand having the same sequence as the RNA transcript that are 5' to the 5' end of the RNA transcript are referred to as "upstream sequences;" sequence regions on the DNA strand having the same sequence as the RNA transcript that are 3' to the 3' end of the RNA transcript are referred to as "downstream sequences.”
- control sequence refers to a polynucleotide sequence that can affect the expression and processing of coding sequences to which it is ligated. The nature of such control sequences can depend upon the host organism.
- control sequences for prokaryotes can include a promoter, a ribosomal binding site, and a transcription termination sequence.
- control sequences for eukaryotes can include promoters comprising one or a plurality of recognition sites for transcription factors, transcription enhancer sequences, and transcription termination sequence.
- Control sequences can include leader sequences and/or fusion partner sequences.
- vector means any molecule or entity (e.g., nucleic acid, plasmid, bacteriophage or virus) used to transfer protein coding information into a host cell.
- expression vector refers to a vector that is suitable for transformation of a host cell and contains nucleic acid sequences that direct and/or control (in conjunction with the host cell) expression of one or more heterologous coding regions operatively linked thereto.
- An expression construct can include, but is not limited to, sequences that affect or control transcription, translation, and, if introns are present, affect RNA splicing of a coding region operably linked thereto.
- operably linked means that the components to which the term is applied are in a relationship that allows them to carry out their inherent functions under suitable conditions.
- a control sequence in a vector that is "operably linked" to a protein coding sequence is ligated thereto so that expression of the protein coding sequence is achieved under conditions compatible with the transcriptional activity of the control sequences.
- the term "host cell” means a cell that has been transformed, or is capable of being transformed, with a nucleic acid sequence and thereby expresses a gene of interest.
- the term includes the progeny of the parent cell, whether or not the progeny is identical in morphology or in genetic make-up to the original parent cell, so long as the gene of interest is present.
- transduction means the transfer of genes from one bacterium to another, usually by bacteriophage. "Transduction” also refers to the acquisition and transfer of eukaryotic cellular sequences by replication-defective retroviruses.
- transfection means the uptake of foreign or exogenous DNA by a cell, and a cell has been "transfected” when the exogenous DNA has been introduced inside the cell membrane. A number of transfection techniques are well known in the art and are disclosed herein.
- transformation refers to a change in a cell's genetic characteristics, and a cell has been transformed when it has been modified to contain new DNA or RNA.
- a cell is transformed where it is genetically modified from its native state by introducing new genetic material via transfection, transduction, or other techniques.
- the transforming DNA can recombine with that of the cell by physically integrating into a chromosome of the cell, or can be maintained transiently as an episomal element without being replicated, or can replicate independently as a plasmid.
- a cell is considered to have been "stably transformed” when the transforming DNA is replicated with the division of the cell.
- polypeptide or "protein” are used interchangeably herein to refer to a polymer of amino acid residues.
- the terms also apply to amino acid polymers in which one or more amino acid residues is an analog or mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers.
- the terms can also encompass amino acid polymers that have been modified, e.g., by the addition of carbohydrate residues to form glycoproteins, or phosphorylated.
- Polypeptides and proteins can be produced by a naturally-occurring and non-recombinant cell, or polypeptides and proteins can be produced by a genetically-engineered or recombinant cell.
- Polypeptides and proteins can comprise molecules having the amino acid sequence of a native protein, or molecules having deletions from, additions to, and/or substitutions of one or more amino acids of the native sequence.
- the terms "polypeptide” and "protein” encompass antigen binding proteins that specifically or selectively bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ - Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, or sequences that have deletions from, additions to, and/or substitutions of one or more amino acids of an antigen binding protein that specifically or selectively binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFR
- polypeptide fragment refers to a polypeptide that has an amino-terminal deletion, a carboxyl-terminal deletion, and/or an internal deletion as compared with the full-length protein. Such fragments can also contain modified amino acids as compared with the full-length protein. In certain embodiments, fragments are about five to 500 amino acids long. For example, fragments can be at least 5, 6, 8, 10, 14, 20, 50, 70, 100, 110, 150, 200, 250, 300, 350, 400, or 450 amino acids long.
- Useful polypeptide fragments include immunologically functional fragments of antibodies, including binding domains.
- an antigen binding protein that binds to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, useful fragments include but are not limited to a CDR region, a variable domain of a heavy or light chain, a portion of an antibody chain or just its variable region including two CDRs, and the like.
- isolated protein means that a subject protein (1) is free of at least some other proteins with which it would normally be found, (2) is essentially free of other proteins from the same source, e.g., from the same species, (3) is expressed by a cell from a different species, (4) has been separated from at least about 50 percent of polynucleotides, lipids, carbohydrates, or other materials with which it is associated in nature, (5) is operably associated (by covalent or noncovalent interaction) with a polypeptide with which it is not associated in nature, or (6) does not occur in nature.
- an "isolated protein" constitutes at least about 5%, at least about 10%, at least about 25%, or at least about 50%> of a given sample.
- Genomic DNA, cDNA, mRNA or other RNA, of synthetic origin, or any combination thereof can encode such an isolated protein.
- the isolated protein is substantially free from proteins or polypeptides or other contaminants that are found in its natural environment that would interfere with its therapeutic, diagnostic, prophylactic, research or other use.
- a "variant" of a polypeptide comprises an amino acid sequence wherein one or more amino acid residues are inserted into, deleted from and/or substituted into the amino acid sequence relative to another polypeptide sequence.
- Variants include fusion proteins.
- a “derivative" of a polypeptide is a polypeptide ⁇ e.g., an antigen binding protein, or an antibody) that has been chemically modified in some manner distinct from insertion, deletion, or substitution variants, e.g., by conjugation to another chemical moiety.
- Antigen binding region means a protein, or a portion of a protein, that specifically binds a specified antigen, e.g., FGFRlc, ⁇ -Klotho or both FGFRlc and ⁇ -Klotho.
- a specified antigen e.g., FGFRlc, ⁇ -Klotho or both FGFRlc and ⁇ -Klotho.
- An antigen binding region typically includes one or more “complementary binding regions” (“CDRs").
- CDRs complementary binding regions
- Certain antigen binding regions also include one or more "framework” regions.
- a “CDR” is an amino acid sequence that contributes to antigen binding specificity and affinity. "Framework” regions can aid in maintaining the proper conformation of the CDRs to promote binding between the antigen binding region and an antigen.
- recombinant antigen binding proteins that bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, are provided.
- a "recombinant protein” is a protein made using recombinant techniques, i.e., through the expression of a recombinant nucleic acid as described herein. Methods and techniques for the production of recombinant proteins are well known in the art.
- antigen binding proteins ⁇ e.g., neutralizing antigen binding proteins, neutralizing antibodies, agonistic antigen binding proteins, agonistic antibodies and binding proteins that bind to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4) that compete for the same epitope or binding site on a target means competition between antigen binding proteins as determined by an assay in which the antigen binding protein ⁇ e.g., antibody or immunologically functional fragment thereof) under study prevents or inhibits the specific binding of a reference molecule ⁇ e.g., a reference ligand, or reference antigen binding protein, such as a reference antibody) to a common antigen ⁇ e.g., FGFRlc, FGFR2c,
- ⁇ assays Numerous types of competitive binding assays can be used to determine if a test molecule competes with a reference molecule for binding.
- assays include solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay (see, e.g., Stahli et ah, (1983) Methods in Enzymology 9:242-253); solid phase direct biotin-avidin EIA (see, e.g., Kirkland et ah, (1986) J. Immunol.
- RIA solid phase direct or indirect radioimmunoassay
- EIA enzyme immunoassay
- sandwich competition assay see, e.g., Stahli et ah, (1983) Methods in Enzymology 9:242-253
- solid phase direct biotin-avidin EIA see, e.g., Kirkland et ah, (1986) J.
- solid phase direct labeled assay solid phase direct labeled sandwich assay (see, e.g., Harlow and Lane, (1988) Antibodies, A Laboratory Manual, Cold Spring Harbor Press); solid phase direct label RIA using 1-125 label (see, e.g., Morel et ah, (1988) Molec. Immunol. 25 :7- 15); solid phase direct biotin-avidin EIA (see, e.g., Cheung, et ah, (1990) Virology 176:546-552); and direct labeled RIA (Moldenhauer et ah, (1990) Scand. J. Immunol. 32:77-82).
- such an assay involves the use of a purified antigen bound to a solid surface or cells bearing either of an unlabelled test antigen binding protein or a labeled reference antigen binding protein.
- Competitive inhibition is measured by determining the amount of label bound to the solid surface or cells in the presence of the test antigen binding protein.
- the test antigen binding protein is present in excess.
- Antigen binding proteins identified by competition assay include antigen binding proteins binding to the same epitope as the reference antigen binding proteins and antigen binding proteins binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antigen binding protein for steric hindrance to occur. Additional details regarding methods for determining competitive binding are provided in the examples herein.
- a competing antigen binding protein when present in excess, it will inhibit specific binding of a reference antigen binding protein to a common antigen by at least 40%, 45%, 50%, 55%, 60%, 65%, 70% or 75%. In some instance, binding is inhibited by at least 80%, 85%, 90%, 95%, or 97% or more.
- antigen refers to a molecule or a portion of a molecule capable of being bound by a selective binding agent, such as an antigen binding protein (including, e.g., an antibody or immunological functional fragment thereof), and may also be capable of being used in an animal to produce antibodies capable of binding to that antigen.
- a selective binding agent such as an antigen binding protein (including, e.g., an antibody or immunological functional fragment thereof)
- an antigen can possess one or more epitopes that are capable of interacting with different antigen binding proteins, e.g., antibodies.
- epitope means the amino acids of a target molecule that are contacted by an antigen binding protein (for example, an antibody) when the antigen binding protein is bound to the target molecule.
- an antigen binding protein for example, an antibody
- the term includes any subset of the complete list of amino acids of the target molecule that are contacted when an antigen binding protein, such as an antibody, is bound to the target molecule.
- An epitope can be contiguous or non-contiguous (e.g., (i) in a single- chain polypeptide, amino acid residues that are not contiguous to one another in the polypeptide sequence but that within in context of the target molecule are bound by the antigen binding protein, or (ii) in a multimeric receptor comprising two or more individual components, e.g., (i) FGFRlc, FGFR2c, FGFR3c or FGFR4, and (ii) ⁇ -Klotho, amino acid residues that are present on one or more of the individual components, but which are still bound by the antigen binding protein).
- epitopes can be mimetic in that they comprise a three dimensional structure that is similar to an antigenic epitope used to generate the antigen binding protein, yet comprise none or only some of the amino acid residues found in that epitope used to generate the antigen binding protein.
- epitopes reside on proteins, but in some instances can reside on other kinds of molecules, such as nucleic acids.
- Epitope determinants can include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and can have specific three dimensional structural characteristics, and/or specific charge characteristics.
- antigen binding proteins specific for a particular target molecule will preferentially recognize an epitope on the target molecule in a complex mixture of proteins and/or macromolecules.
- identity refers to a relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules, as determined by aligning and comparing the sequences. "Percent identity” means the percent of identical residues between the amino acids or nucleotides in the compared molecules and is calculated based on the size of the smallest of the molecules being compared. For these calculations, gaps in alignments (if any) must be addressed by a particular mathematical model or computer program (i.e., an "algorithm”). Methods that can be used to calculate the identity of the aligned nucleic acids or polypeptides include those described in Computational Molecular Biology, (Lesk, A.
- the sequences being compared are aligned in a way that gives the largest match between the sequences.
- the computer program used to determine percent identity is the GCG program package, which includes GAP (Devereux et al, (1984) Nucl. Acid Res. 12:387; Genetics Computer Group, University of Wisconsin, Madison, WI).
- GAP is used to align the two polypeptides or polynucleotides for which the percent sequence identity is to be determined.
- the sequences are aligned for optimal matching of their respective amino acid or nucleotide (the "matched span", as determined by the algorithm).
- a gap opening penalty (which is calculated as 3x the average diagonal, wherein the "average diagonal” is the average of the diagonal of the comparison matrix being used; the “diagonal” is the score or number assigned to each perfect amino acid match by the particular comparison matrix) and a gap extension penalty (which is usually 1/10 times the gap opening penalty), as well as a comparison matrix such as PAM 250 or BLOSUM 62 are used in conjunction with the algorithm.
- a standard comparison matrix ⁇ see, Dayhoff et al, (1978) Atlas of Protein Sequence and Structure 5:345-352 for the PAM 250 comparison matrix; Henikoff et al, (1992) Proc. Natl. Acad. Sci. U.S.A. 89: 10915-10919 for the BLOSUM 62 comparison matrix) is also used by the algorithm.
- Certain alignment schemes for aligning two amino acid sequences can result in matching of only a short region of the two sequences, and this small aligned region can have very high sequence identity even though there is no significant relationship between the two full-length sequences. Accordingly, the selected alignment method ⁇ e.g., the GAP program) can be adjusted if so desired to result in an alignment that spans at least 50 contiguous amino acids of the target polypeptide.
- substantially pure means that the described species of molecule is the predominant species present, that is, on a molar basis it is more abundant than any other individual species in the same mixture.
- a substantially pure molecule is a composition wherein the object species comprises at least 50% (on a molar basis) of all macromolecular species present.
- a substantially pure composition will comprise at least 80%, 85%, 90%, 95%, or 99% of all macromolecular species present in the composition.
- the object species is purified to essential homogeneity wherein contaminating species cannot be detected in the composition by conventional detection methods and thus the composition consists of a single detectable macromolecular species.
- treat and “treating” refer to any indicia of success in the treatment or amelioration of an injury, pathology or condition, including any objective or subjective parameter such as abatement; remission; diminishing of symptoms or making the injury, pathology or condition more tolerable to the patient; slowing in the rate of degeneration or decline; making the final point of degeneration less debilitating; improving a patient's physical or mental well-being.
- the treatment or amelioration of symptoms can be based on objective or subjective parameters; including the results of a physical examination, neuropsychiatric exams, and/or a psychiatric evaluation.
- certain methods presented herein can be employed to treat Type 2 diabetes, obesity and/or dyslipidemia, either prophylactically or as an acute treatment, to decrease plasma glucose levels, to decrease circulating triglyceride levels, to decrease circulating cholesterol levels and/or ameliorate a symptom associated with type 2 diabetes, obesity and dyslipidemia.
- an “effective amount” is generally an amount sufficient to reduce the severity and/or frequency of symptoms, eliminate the symptoms and/or underlying cause, prevent the occurrence of symptoms and/or their underlying cause, and/or improve or remediate the damage that results from or is associated with diabetes, obesity and dyslipidemia.
- the effective amount is a therapeutically effective amount or a prophylactically effective amount.
- a “therapeutically effective amount” is an amount sufficient to remedy a disease state (e.g., diabetes, obesity or dyslipidemia) or symptoms, particularly a state or symptoms associated with the disease state, or otherwise prevent, hinder, retard or reverse the progression of the disease state or any other undesirable symptom associated with the disease in any way whatsoever.
- a “prophylactically effective amount” is an amount of a pharmaceutical composition that, when administered to a subject, will have the intended prophylactic effect, e.g., preventing or delaying the onset (or reoccurrence) of diabetes, obesity or dyslipidemia, or reducing the likelihood of the onset (or reoccurrence) of diabetes, obesity or dyslipidemia or associated symptoms.
- the full therapeutic or prophylactic effect does not necessarily occur by administration of one dose, and can occur only after administration of a series of doses.
- a therapeutically or prophylactically effective amount can be administered in one or more administrations.
- amino acid takes its normal meaning in the art. The twenty naturally-occurring amino acids and their abbreviations follow conventional usage. See, Immunology-A Synthesis, 2 nd Edition, (E. S. Golub and D. R. Green, eds.), Sinauer Associates: Sunderland, Mass. (1991), incorporated herein by reference for any purpose.
- Stereoisomers e.g., D-amino acids of the twenty conventional amino acids, unnatural or non-naturally occurring amino acids such as ⁇ -, ⁇ - disubstituted amino acids, N-alkyl amino acids, and other unconventional amino acids can also be suitable components for polypeptides and are included in the phrase "amino acid.”
- non-naturally amino acids include: 4-hydroxyproline, ⁇ - carboxyglutamate, ⁇ - ⁇ , ⁇ , ⁇ -trimethyllysine, ⁇ - ⁇ -acetyllysine, O-phosphoserine, N-acetylserine, N-formylmethionine, 3-methylhistidine, 5 -hydroxy lysine, ⁇ - ⁇ -methylarginine, and other similar amino acids and imino acids (e.g., 4-hydroxyproline).
- the left-hand direction is the amino terminal direction and the right-hand direction is the carboxyl-terminal direction, in accordance with standard usage and convention.
- a non-limiting lists of examples of non-naturally occurring amino acids that can be inserted into an antigen binding protein sequence or substituted for a wild-type residue in an antigen binding sequence include ⁇ -amino acids, homoamino acids, cyclic amino acids and amino acids with derivatized side chains.
- Examples include (in the L-form or D-form; abbreviated as in parentheses): citrulline (Cit), homocitrulline (hCit), Na-methylcitrulline (NMeCit), Na-methylhomocitrulline (Na-MeHoCit), ornithine (Orn), Na-Methylornithine (Na-MeOrn or NMeOrn), sarcosine (Sar), homolysine (hLys or hK), homoarginine (hArg or hR), homoglutamine (hQ), Na-methylarginine (NMeR), Na-methylleucine (Na-MeL or NMeL), N-methylhomolysine (NMeHoK), Na- methylglutamine (NMeQ), norleucine (Nle), norvaline (Nva), 1,2,3, 4-tetrahydroisoquino line (Tic), Octahydroindole-2-carboxylic acid
- Antigen-binding proteins that bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, are provided herein.
- a unique property of the antigen binding proteins disclosed herein is the agonistic nature of these proteins, specifically the ability to mimic the in vivo effect of FGF21 and to induce FGF21-like signaling.
- the antigen binding proteins disclosed herein induce FGF21-like signaling in several in vitro cell- based assay, including the ELK-luciferase reporter assay of Example 5 under the following conditions: (1) the binding to and activity of the FGF21 receptor is ⁇ -Klotho dependent; (2) the activity is selective to FGFRlc ⁇ Klotho complex; (3) the binding to the FGFRlc ⁇ Klotho triggers FGF21-like signaling pathways; and (4) the potency (EC50) is comparable to a wild- type FGF21 standard comprising the mature form of SEQ ID NO:2, as measured in the following cell-based assays: (1) the recombinant FGF21 receptor mediated luciferase-reporter cell assay of Example 5; (2) the ERK-phosphorylation in the recombinant FGF21 receptor mediated cell assay of Example 5; and (3) ERK-phosphorylation in human adipocytes as described in more details in Example 7.
- the disclosed antigen binding proteins therefore, are expected to exhibit activities in vivo that are consistent with the natural biological function of FGF21. This property makes the disclosed antigen binding proteins viable therapeutics for the treatment of metabolic diseases such as type 2 diabetes, obesity, dyslipidemia, NASH, cardiovascular disease, metabolic syndrome and broadly any disease or condition in which it is desirable to mimic or augment the in vivo effects of FGF21.
- metabolic diseases such as type 2 diabetes, obesity, dyslipidemia, NASH, cardiovascular disease, metabolic syndrome and broadly any disease or condition in which it is desirable to mimic or augment the in vivo effects of FGF21.
- the antigen binding proteins provided can comprise polypeptides into which one or more complementary determining regions (CDRs) can be embedded and/or joined.
- CDRs complementary determining regions
- the CDRs can be embedded into a "framework" region, which orients the CDR(s) such that the proper antigen binding properties of the CDR(s) is achieved.
- such antigen binding proteins that are provided can facilitate or enhance the interaction between FGFRlc and ⁇ -Klotho, and can substantially induce FGF21- like signaling.
- antigen binding proteins described herein are antibodies or are derived from antibodies.
- the polypeptide structure of the antigen binding proteins is based on antibodies, including, but not limited to, monoclonal antibodies, bispecific antibodies, minibodies, domain antibodies, synthetic antibodies (sometimes referred to herein as "antibody mimetics"), chimeric antibodies, humanized antibodies, human antibodies, antibody fusions (sometimes referred to herein as "antibody conjugates”), hemibodies and fragments thereof.
- the antigen binding proteins provided herein have been demonstrated to bind to (i) ⁇ - Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, and particularly to (i) human ⁇ -Klotho; (ii) human FGFRlc, human FGFR2c, human FGFR3c or human FGFR4; or (iii) a complex comprising human ⁇ -Klotho and one of human FGFRlc, human FGFR2c, human FGFR3c, and human FGFR4.
- antigen binding proteins As described and shown in the Examples presented herein, based the Western blot results, commercially-available anti ⁇ -Klotho or anti-FGFRlc antibodies bind to denatured ⁇ -Klotho or FGFRlc whereas the antigen binding protein (agonistic antibodies) do not. Conversely, the provided antigen binding proteins recognize the native structure of the FGFRlc and ⁇ -Klotho on the cell surface whereas the commercial antibodies do not, based on the FACS results provided. See Example 9. The antigen binding proteins that are provided therefore mimic the natural in vivo biological activity of FGF21. As a consequence, the antigen binding proteins provided herein are capable of activating FGF21-like signaling activity.
- the disclosed antigen binding proteins can have one or more of the following activities in vivo: induction of FGF21-like signal transduction pathways, lowering blood glucose levels, lowering circulating lipid levels, improving metabolic parameters and other physiological effects induced in vivo by the formation of the ternary complex of FGFRlc, ⁇ -Klotho and FGF21, for example in conditions such as type 2 diabetes, obesity, dyslipidemia, NASH, cardiovascular disease, and metabolic syndrome.
- the antigen binding proteins that specifically bind to (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4 that are disclosed herein have a variety of utilities.
- antigen binding proteins are useful in specific binding assays, in the affinity purification of (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, including the human forms of these disclosed proteins, and in screening assays to identify other agonists of FGF21-like signaling activity.
- the antigen binding proteins that specifically bind can be used in a variety of treatment applications, as explained herein.
- certain antigen binding proteins are useful for treating conditions associated with FGF21-like signaling processes in a patient, such as reducing, alleviating, or treating type 2 diabetes, obesity, dyslipidemia, NASH, cardiovascular disease, and metabolic syndrome.
- antigen binding proteins include, for example, diagnosis of diseases or conditions associated with ⁇ -Klotho, FGFRlc, FGFR2c, FGFR3c, FGFR4 or FGF21, and screening assays to determine the presence or absence of these molecules.
- Some of the antigen binding proteins described herein can be useful in treating conditions, symptoms and/or the pathology associated with decreased FGF21-like signaling activity.
- Exemplary conditions include, but are not limited to, diabetes, obesity, NASH and dyslipidemia.
- FGF21 FGF21
- the antigen binding proteins disclosed herein induce FGF21 -mediated signaling, as defined herein.
- the mature form of FGF21 is the active form of the molecule.
- the nucleotide sequence encoding full length FGF21 is provided; the nucleotides encoding the signal sequence are underlined.
- the antigen binding proteins disclosed herein bind to FGFRlc, in particular human FGFRlc, when associated with ⁇ -Klotho.
- the nucleotide sequence encoding human FGFRlc (GenBank Accession Number NM 023110) is provided:
- the antigen binding proteins described herein bind the extracellular portion of FGFRlc.
- An example of an extracellular region of FGFRlc is:
- FGFRlc proteins can also include fragments.
- the terms are used interchangeably to mean a receptor, in particular and unless otherwise specified, a human receptor, that upon association with ⁇ -Klotho and FGF21 induces FGF21-like signaling activity.
- FGFRlc also includes post-translational modifications of the FGFRlc amino acid sequence, for example, possible N-linked glycosylation sites.
- the antigen binding proteins can bind to or be generated from proteins glycosylated at one or more of the positions. ⁇ - lotho
- the antigen binding proteins disclosed herein bind to ⁇ -Klotho, in particular human ⁇ - Klotho.
- the nucleotide sequence encoding human ⁇ -Klotho (GenBank Accession Number NM_175737) is provided:
- the antigen binding proteins described herein bind the extracellular portion of ⁇ -Klotho.
- ample of an extracellular region of ⁇ -Klotho is: MKPGC AAGSPGNE WIFF STDEITTRYRNTM SNGGLQRS VIL S ALILLRAVTGF S G DGRAIWSK PNFTPVNESQLFLYDTFPK FFWGIGTGALQVEGSWKKDGKGPSI WDHFIHTHLK VSSTNGSSDSYIFLEKDLSALDFIGVSFYQFSISWPRLFPDGIVTV ANAKGLQYYSTLLDALVLRNIEPIVTLYHWDLPLALQEKYGGWK DTIIDIFNDY ATYCFQMFGDRVKYWITIHNPYLVAWHGYGTGMHAPGEKGNLAAVYTVGHNL IKAHSKVWHNYNTHFRPHQKGWLSITLGSHWIEPNRSENTMDIFKCQQSMVSVL GWFANPIHGDGDYPEGMRK LFSVLPIFSEA
- the murine form of ⁇ -Klotho, and fragments and subsequences thereof, can be of use in studying and/or constructing the molecules provided herein.
- the nucleotide sequence encoding murine ⁇ -Klotho (GenBank Accession Number NM 031180) is provided:
- ⁇ -Klotho proteins can also include fragments.
- the terms are used interchangeably to mean a co-receptor, in particular and unless otherwise specified, a human co-receptor, that upon association with FGFRlc and FGF21 induces FGF21- like signaling activity.
- ⁇ -Klotho also includes post-translational modifications of the ⁇ -Klotho amino acid sequence, for example, possible N-linked glycosylation sites.
- the antigen binding proteins can bind to or be generated from proteins glycosylated at one or more of the positions.
- Antigen Binding Proteins that Specifically Bind One or More of ⁇ -Klotho, FGFRlc, FGFR2c, FGFR3C, FGFR4c
- a variety of selective binding agents useful for modulating FGF21-like signaling are provided. These agents include, for instance, antigen binding proteins that contain an antigen binding domain (e.g. , single chain antibodies, domain antibodies, hemibodies, immunoadhesions, and polypeptides with an antigen binding region) and specifically bind to FGFRlc, ⁇ -Klotho or both FGFRlc and ⁇ -Klotho, in particular human FGFRlc and human ⁇ -Klotho.
- an antigen binding domain e.g. , single chain antibodies, domain antibodies, hemibodies, immunoadhesions, and polypeptides with an antigen binding region
- agents for example, are useful in mimicking the signaling effect generated in vivo by the association of FGFRlc with ⁇ -Klotho and with FGF21, and can thus be used to enhance or modulate one or more activities associated with FGF21-like signaling.
- the antigen binding proteins that are provided typically comprise one or more CDRs as described herein (e.g., 1, 2, 3, 4, 5 or 6 CDRs).
- the antigen binding proteins are naturally expressed by clones, while in other embodiments, the antigen binding protein can comprise (a) a polypeptide framework structure and (b) one or more CDRs that are inserted into and/or joined to the polypeptide framework structure.
- a CDR forms a component of a heavy or light chains expressed by the clones described herein; in other embodiments a CDR can be inserted into a framework in which the CDR is not naturally expressed.
- a polypeptide framework structure can take a variety of different forms.
- a polypeptide framework structure can be, or comprise, the framework of a naturally occurring antibody, or fragment or variant thereof, or it can be completely synthetic in nature. Examples of various antigen binding protein structures are further described below.
- the polypeptide framework structure of an antigen binding protein is an antibody or is derived from an antibody, including, but not limited to, monoclonal antibodies, bispecific antibodies, minibodies, domain antibodies, synthetic antibodies (sometimes referred to herein as "antibody mimetics"), chimeric antibodies, humanized antibodies, antibody fusions (sometimes referred to as "antibody conjugates"), and portions or fragments of each, respectively.
- the antigen binding protein is an immunological fragment of an antibody (e.g., a Fab, a Fab', a F(ab') 2 , or a scFv).
- antigen binding proteins specifically bind to (i) ⁇ - Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, including the human forms of these proteins .
- an antigen binding protein specifically binds to both human FGFRlc comprising the amino acid sequence of SEQ ID NO:5, and human ⁇ -Klotho comprising the amino acid sequence of SEQ ID NO: 8, and in another embodiment an antigen binding protein specifically binds to both human FGFRlc comprising the amino acid sequence of SEQ ID NO:5 and human ⁇ -Klotho having the amino acid sequence of SEQ ID NO: 8 and induces FGF21-like signaling.
- an antigen binding protein can, but need not, induce FGF21-like signaling.
- antigen binding proteins that specifically bind (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4, including the human forms of these proteins that are provided herein have a structure typically associated with naturally occurring antibodies.
- the structural units of these antibodies typically comprise one or more tetramers, each composed of two identical couplets of polypeptide chains, though some species of mammals also produce antibodies having only a single heavy chain.
- each pair or couplet includes one full-length "light” chain (in certain embodiments, about 25 kDa) and one full-length “heavy” chain (in certain embodiments, about 50-70 kDa).
- Each individual immunoglobulin chain is composed of several "immunoglobulin domains," each consisting of roughly 90 to 110 amino acids and expressing a characteristic folding pattern. These domains are the basic units of which antibody polypeptides are composed.
- the amino-terminal portion of each chain typically includes a variable domain that is responsible for antigen recognition.
- the carboxy-terminal portion is more conserved evolutionarily than the other end of the chain and is referred to as the "constant region" or "C region”.
- Human light chains generally are classified as kappa (" ⁇ ") and lambda (“ ⁇ ") light chains, and each of these contains one variable domain and one constant domain.
- Heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon chains, and these define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
- IgG has several subtypes, including, but not limited to, IgGl, IgG2, IgG3, and IgG4.
- IgM subtypes include IgM, and IgM2.
- IgA subtypes include IgAl and IgA2.
- the IgA and IgD isotypes contain four heavy chains and four light chains; the IgG and IgE isotypes contain two heavy chains and two light chains; and the IgM isotype contains five heavy chains and five light chains.
- the heavy chain C region typically comprises one or more domains that can be responsible for effector function. The number of heavy chain constant region domains will depend on the isotype. IgG heavy chains, for example, each contain three C region domains known as C H I , C H 2 and C H 3.
- the antibodies that are provided can have any of these isotypes and subtypes.
- an antigen binding protein that specifically binds one or more of (i) ⁇ - Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4 is an antibody of the IgGl, IgG2, or IgG4 subtype.
- variable and constant regions are joined by a "J" region of about twelve or more amino acids, with the heavy chain also including a "D” region of about ten more amino acids.
- the variable regions of each light/heavy chain pair typically form the antigen binding site.
- IgG2 heavy constant domain of an exemplary monoclonal antibody that specifically binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4 has the amino acid sequence: ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGV
- a kappa light constant domain of an exemplary monoclonal antibody that binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ - Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4 has the amino acid sequence:
- a lambda light constant domain of an exemplary monoclonal antibody that binds (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4 has the amino acid sequence:
- VAPTECS SEQ ID NO: 1
- Variable regions of immunoglobulin chains generally exhibit the same overall structure, comprising relatively conserved framework regions (FR) joined by three hypervariable regions, more often called “complementarity determining regions” or CDRs.
- the CDRs from the two chains of each heavy chain/light chain pair mentioned above typically are aligned by the framework regions to form a structure that binds specifically with a specific epitope on the target protein (e.g., (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising ⁇ -Klotho and one of FGFRlc, FGFR2c, FGFR3c, and FGFR4).
- a specific epitope on the target protein e.g., (i) ⁇ -Klotho; (ii) FGFRlc, FGFR2c, FGFR3c or FGFR4; or (iii) a
- FRl From N-terminal to C-terminal, naturally-occurring light and heavy chain variable regions both typically conform with the following order of these elements: FRl, CDRl, FR2, CDR2, FR3, CDR3 and FR4.
- a numbering system has been devised for assigning numbers to amino acids that occupy positions in each of these domains. This numbering system is defined in Kabat Sequences of Proteins of Immunological Interest (1987 and 1991, NIH, Bethesda, MD).
- the CDRs can also be redefined according an alternative nomenclature scheme, such as that of Chothia (see Chothia & Lesk, 1987, J. Mol. Biol. 196:901-917; Chothia et al, 1989, Nature 342:878-883 or Honegger & Pluckthun, 2001, J. Mol. Biol. 309:657-670.
- the various heavy chain and light chain variable regions of antigen binding proteins provided herein are depicted in Table 2. Each of these variable regions can be attached to the above heavy and light chain constant regions to form a complete antibody heavy and light chain, respectively. Further, each of the so-generated heavy and light chain sequences can be combined to form a complete antibody structure. It should be understood that the heavy chain and light chain variable regions provided herein can also be attached to other constant domains having different sequences than the exemplary sequences listed above.
- Tables 1A and IB Specific examples of some of the full length light and heavy chains of the antibodies that are provided and their corresponding amino acid sequences are summarized in Tables 1A and IB.
- Table 1A shows exemplary light chain sequences
- Table IB shows exemplary heavy chain sequences.
- each of the exemplary heavy chains (HI, H2, H3 etc.) listed in Table IB and 6 A, infra can be combined with any of the exemplary light chains shown in Table 1 A and 6A, infra, to form an antibody.
- Examples of such combinations include HI combined with any of LI through L18; H2 combined with any of LI through L18; H3 combined with any of LI through LI 8, and so on.
- the antibodies include at least one heavy chain and one light chain from those listed in Tables 1A and IB and 6A, infra; particular examples pairings of light chains and heavy chains include LI with HI, L2 with H2, L3 with H3, L4 with H4, L5 with H5, L6 with H6, L7 with H7, L8 with H8, L9 with H9, L10 with H10, LI 1 with HI 1, L12 with H12, L13 with H13, L14 with H14, L15 with H15, L16 with H16, L17 with H17, and L18 with H18.
- a heavy chain from a first clone can be paired with a light chain from a second clone ⁇ e.g., a heavy chain from 46D11 paired with a light chain from 16H7 or a heavy chain from 16H7 paired with a light chain from 46D11).
- a heavy chain from 46D11 paired with a light chain from 16H7 or a heavy chain from 16H7 paired with a light chain from 46D11
- such pairings can include VL with 90% or greater homology can be paired with the heavy chain of the naturally occurring clone.
- the antibodies comprise two different heavy chains and two different light chains listed in Tables 1A and IB and 6A, infra. In other instances, the antibodies contain two identical light chains and two identical heavy chains.
- an antibody or immunologically functional fragment can include two HI heavy chains and two LI light chains, or two H2 heavy chains and two L2 light chains, or two H3 heavy chains and two L3 light chains and other similar combinations of pairs of light chains and pairs of heavy chains as listed in Tables 1A and IB and 6 A, infra.
- a hemibody is a monovalent antigen binding protein comprising (i) an intact light chain, and (ii) a heavy chain fused to an Fc region ⁇ e.g., an IgG2 Fc region of SEQ ID NO:441), optionally via a linker,
- the linker can be a (G 4 S) X linker where "x" is a non-zero integer ⁇ e.g., (G 4 S) 8 ; SEQ ID NO:440).
- Hemibodies can be constructed using the provided heavy and light chain components. Specific examples of hemibodies are disclosed in Example 14.
- antigen binding proteins that are provided are variants of antibodies formed by combination of the heavy and light chains shown in Tables 1A and IB and 6 A, infra and comprise light and/or heavy chains that each have at least 70%, 75%, 80%>, 85%, 90%, 95%, 96%), 97%), 98%) or 99% identity to the amino acid sequences of these chains.
- such antibodies include at least one heavy chain and one light chain, whereas in other instances the variant forms contain two identical light chains and two identical heavy chains.
- antigen binding proteins that contain an antibody heavy chain variable region selected from the group consisting of V H 1, V H 2, V H 3, V H 4, V H 5, V H 6, V H 7, V H 8, V H 9, V H I O, V h 11, V h 12, V h 13, V h 14, V h 15, V h 16, V h 17 and V H 18 as shown in Table 2B and/or an antibody light chain variable region selected from the group consisting of V L I , V L 2, V L 3, V L 4, V L 5, V L 6, V L 7, V L 8, V L 9, V L 10, V L 11, V L 12, V L 13, V L 14, V L 15, V L 16, V L 17 and V L 18 as shown in Table 2A, and immunologically functional fragments, derivatives, muteins and variants of these light chain and heavy chain variable regions.
- VNWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTI SKDTSKSQVVLTMTNMDPVDTATYYCARVRIAGD YYYYYGMD VWGQGTTVTVSS
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Gastroenterology & Hepatology (AREA)
- Diabetes (AREA)
- Zoology (AREA)
- Epidemiology (AREA)
- Toxicology (AREA)
- Hematology (AREA)
- Obesity (AREA)
- Cell Biology (AREA)
- Emergency Medicine (AREA)
- Endocrinology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Radiology & Medical Imaging (AREA)
- Inorganic Chemistry (AREA)
- Mycology (AREA)
- Cardiology (AREA)
- Pain & Pain Management (AREA)
- Child & Adolescent Psychology (AREA)
- Heart & Thoracic Surgery (AREA)
Abstract
Priority Applications (24)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
UAA201208326A UA109888C2 (uk) | 2009-12-07 | 2010-03-12 | ІЗОЛЬОВАНЕ АНТИТІЛО АБО ЙОГО ФРАГМЕНТ, ЩО ЗВ'ЯЗУЄТЬСЯ З β-КЛОТО, РЕЦЕПТОРАМИ FGF І ЇХНІМИ КОМПЛЕКСАМИ |
EA201270634A EA026129B1 (ru) | 2009-12-07 | 2010-12-03 | АНТИГЕНСВЯЗЫВАЮЩИЕ БЕЛКИ ЧЕЛОВЕКА, КОТОРЫЕ СВЯЗЫВАЮТСЯ С β-КЛОТО, РЕЦЕПТОРАМИ FGF И ИХ КОМПЛЕКСАМИ |
JP2012543173A JP5840619B2 (ja) | 2009-12-07 | 2010-12-03 | β‐クロトー、FGF受容体、およびその複合体と結合するヒト抗原結合タンパク質 |
AU2010328444A AU2010328444B2 (en) | 2009-12-07 | 2010-12-03 | Human antigen binding proteins that bind beta-Klotho, FGF receptors and complexes thereof |
MX2016010041A MX360487B (es) | 2009-12-07 | 2010-12-03 | PROTEÍNAS DE ENLACE A ANTÍGENOS HUMANAS QUE ENLAZAN ß-KLOTHO, RECEPTORES FGF Y COMPLEJOS DE LOS MISMOS. |
KR1020207015902A KR20200067924A (ko) | 2009-12-07 | 2010-12-03 | β-KLOTHO, FGF 수용체 및 이들의 복합체에 결합하는 인간 항원 결합 단백질 |
CA2782420A CA2782420C (fr) | 2009-12-07 | 2010-12-03 | Proteines de liaison a antigene humain qui se lient a beta-klotho, aux recepteurs de fgf et aux complexes de ceux-ci |
MYPI2012002532A MY173097A (en) | 2009-12-07 | 2010-12-03 | Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof |
BR112012013876-6A BR112012013876B1 (pt) | 2009-12-07 | 2010-12-03 | Anticorpo isolado ou um fragmento do mesmo e composição farmacêutica que compreende o mesmo |
CN201080063309.5A CN102858802B (zh) | 2009-12-07 | 2010-12-03 | 结合β‑KLOTHO、FGF受体及其复合物的人抗原结合蛋白 |
KR1020127017717A KR101865974B1 (ko) | 2009-12-07 | 2010-12-03 | β-KLOTHO, FGF 수용체 및 이들의 복합체에 결합하는 인간 항원 결합 단백질 |
KR1020187015615A KR102121678B1 (ko) | 2009-12-07 | 2010-12-03 | β-KLOTHO, FGF 수용체 및 이들의 복합체에 결합하는 인간 항원 결합 단백질 |
EP10788204.5A EP2510009B1 (fr) | 2009-12-07 | 2010-12-03 | Protéines de liaison à antigène humain qui se lient à bêta-klotho, aux récepteurs de fgf et aux complexes de ceux-ci |
CR20180020A CR20180020A (es) | 2009-12-07 | 2010-12-03 | PROTEÍNAS DE ENLACE A ANTIGENOS HUMANAS QUE ENLAZAN BETA-KLOTHO, RECEPTORES FGF Y COMPLEJOS DE LOS MISMOS. (Divisional 2012-0366) |
EP16207166.6A EP3202787B1 (fr) | 2009-12-07 | 2010-12-03 | Protéines de liaison à antigène humain qui se lient à bêta-klotho, aux récepteurs de fgf et aux complexes de ceux-ci |
SG2012042008A SG181568A1 (en) | 2009-12-07 | 2010-12-03 | Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof |
MX2012006467A MX341148B (es) | 2009-12-07 | 2010-12-03 | PROTEINAS DE ENLACE A ANTIGENOS HUMANAS QUE ENLAZAN ß-KLOTHO, RECEPTORES FGF Y COMPLEJOS DE LOS MISMOS. |
ES10788204.5T ES2633810T3 (es) | 2009-12-07 | 2010-12-03 | Proteínas de unión a antígeno humanas que se unen a beta-Klotho, receptores de FGF y complejos de los mismos |
EP20178046.7A EP3760642A1 (fr) | 2009-12-07 | 2010-12-03 | Protéines de liaison à antigène humain qui se lient à bêta-klotho, aux récepteurs de fgf et aux complexes de ceux-ci |
TNP2012000268A TN2012000268A1 (en) | 2009-12-07 | 2012-05-28 | Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof |
IL220048A IL220048A0 (en) | 2009-12-07 | 2012-05-29 | Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof |
ZA2012/04145A ZA201204145B (en) | 2009-12-07 | 2012-06-06 | Human antigen binding proteins that bind beta-klotho,fgf receptors and complexes thereof |
MA35017A MA33854B1 (fr) | 2009-12-07 | 2012-06-28 | Protéines de liaison à antigène humain qui se lient à bêta-klotho, aux récepteurs de fgf et aux complexes de ceux-ci |
IL261585A IL261585B (en) | 2009-12-07 | 2018-09-04 | Human antigen-binding proteins that bind beta-klotho, fgf receptors and their complexes |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US26732109P | 2009-12-07 | 2009-12-07 | |
US61/267,321 | 2009-12-07 | ||
US38184610P | 2010-09-10 | 2010-09-10 | |
US61/381,846 | 2010-09-10 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2011071783A1 true WO2011071783A1 (fr) | 2011-06-16 |
Family
ID=43545013
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2010/058984 WO2011071783A1 (fr) | 2009-12-07 | 2010-12-03 | Protéines de liaison à antigène humain qui se lient à bêta-klotho, aux récepteurs de fgf et aux complexes de ceux-ci |
Country Status (36)
Country | Link |
---|---|
US (4) | US9284378B2 (fr) |
EP (4) | EP2510009B1 (fr) |
JP (4) | JP5840619B2 (fr) |
KR (3) | KR20200067924A (fr) |
CN (2) | CN108586602A (fr) |
AR (1) | AR079274A1 (fr) |
AU (1) | AU2010328444B2 (fr) |
BR (1) | BR112012013876B1 (fr) |
CA (2) | CA2782420C (fr) |
CL (1) | CL2012001504A1 (fr) |
CR (2) | CR20180020A (fr) |
CY (1) | CY1119000T1 (fr) |
DK (1) | DK2711375T3 (fr) |
EA (2) | EA026129B1 (fr) |
ES (2) | ES2633810T3 (fr) |
HR (1) | HRP20170882T1 (fr) |
HU (1) | HUE034727T2 (fr) |
IL (2) | IL220048A0 (fr) |
LT (1) | LT2711375T (fr) |
MA (1) | MA33854B1 (fr) |
ME (1) | ME02807B (fr) |
MX (2) | MX341148B (fr) |
MY (2) | MY191950A (fr) |
NZ (2) | NZ717847A (fr) |
PE (1) | PE20121686A1 (fr) |
PL (1) | PL2711375T3 (fr) |
PT (1) | PT2711375T (fr) |
RS (1) | RS56016B1 (fr) |
SG (2) | SG181568A1 (fr) |
SI (1) | SI2711375T1 (fr) |
TN (1) | TN2012000268A1 (fr) |
TW (3) | TWI693234B (fr) |
UA (1) | UA109888C2 (fr) |
UY (2) | UY33089A (fr) |
WO (1) | WO2011071783A1 (fr) |
ZA (1) | ZA201204145B (fr) |
Cited By (31)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2013033452A2 (fr) | 2011-08-31 | 2013-03-07 | Amgen Inc. | Procédé de traitement ou d'amélioration du diabète type i employant fgf21 |
WO2012170438A3 (fr) * | 2011-06-06 | 2013-04-11 | Amgen Inc. | Protéines de liaison à un antigène humain qui se lient à un complexe comprenant bêta-klotho et un récepteur de fgf |
WO2015100366A1 (fr) * | 2013-12-23 | 2015-07-02 | Genentech, Inc. | Anticorps et leurs procédés d'utilisation |
US9085626B2 (en) | 2011-05-16 | 2015-07-21 | Genentech, Inc. | FGFR1 agonists and methods of use |
US9089525B1 (en) | 2011-07-01 | 2015-07-28 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject |
US9273107B2 (en) | 2012-12-27 | 2016-03-01 | Ngm Biopharmaceuticals, Inc. | Uses and methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
US9284378B2 (en) | 2009-12-07 | 2016-03-15 | Shaw-Fen Sylvia Hu | Human antigen binding proteins that bind β-Klotho, FGF receptors and complexes thereof |
US9290557B2 (en) | 2012-11-28 | 2016-03-22 | Ngm Biopharmaceuticals, Inc. | Compositions comprising variants and fusions of FGF19 polypeptides |
WO2017079768A1 (fr) | 2015-11-08 | 2017-05-11 | Genentech, Inc. | Procédés de criblage d'anticorps multispécifiques |
WO2018032785A1 (fr) | 2016-08-19 | 2018-02-22 | 安源医药科技(上海)有限公司 | Protéine de fusion du facteur 21 de croissance des fibroblastes humains (hfgf21), son procédé de préparation et son utilisation |
US9925242B2 (en) | 2012-12-27 | 2018-03-27 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of nonalcoholic steatohepatitis |
US9963494B2 (en) | 2012-11-28 | 2018-05-08 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject |
WO2018146594A1 (fr) * | 2017-02-08 | 2018-08-16 | Novartis Ag | Anticorps mimétiques du fgf21 et leurs utilisations |
US10093735B2 (en) | 2014-01-24 | 2018-10-09 | Ngm Biopharmaceuticals, Inc. | Beta-klotho binding proteins |
US10369199B2 (en) | 2013-10-28 | 2019-08-06 | Ngm Biopharmaceuticals, Inc. | Methods of using variants of FGF19 polypeptides for the treatment of cancer |
US10398758B2 (en) | 2014-05-28 | 2019-09-03 | Ngm Biopharmaceuticals, Inc. | Compositions comprising variants of FGF19 polypeptides and uses thereof for the treatment of hyperglycemic conditions |
US10434144B2 (en) | 2014-11-07 | 2019-10-08 | Ngm Biopharmaceuticals, Inc. | Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders |
US10456449B2 (en) | 2014-06-16 | 2019-10-29 | Ngm Biopharmaceuticals, Inc. | Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
US10517929B2 (en) | 2014-10-23 | 2019-12-31 | Ngm Biopharmaceuticals, Inc. | Pharmaceutical compositions comprising FGF19 variants |
US10519240B2 (en) | 2014-03-25 | 2019-12-31 | Regeneron Pharmaceuticals, Inc. | Anti-FGFR1c antibody-FGF21 fusion proteins |
EP3434690A4 (fr) * | 2016-03-23 | 2020-04-01 | Seoul National University R&DB Foundation | Anticorps qui se lie à la protéine d'enveloppe du virus du syndrome de fièvre sévère avec thrombocytopénie, et son utilisation |
US10744185B2 (en) | 2015-11-09 | 2020-08-18 | Ngm Biopharmaceuticals, Inc. | Methods of using variants of FGF19 polypeptides for the treatment of pruritus |
US10800843B2 (en) | 2015-07-29 | 2020-10-13 | Ngm Biopharmaceuticals, Inc. | Beta klotho-binding proteins |
US11072640B2 (en) | 2008-06-04 | 2021-07-27 | Amgen Inc. | Methods of treating non-alcoholic steatohepatitis using FGF21 mutants |
US11123438B2 (en) | 2016-08-19 | 2021-09-21 | Ampsource Biopharma Shanghai Inc. | Linker peptide for constructing fusion protein |
WO2022003169A1 (fr) | 2020-07-02 | 2022-01-06 | Sanofi | Protéines agonistes de liaison à l'antigène ciblant fgfr1/klb et leurs conjugués avec des peptides agonistes de glp-1 r |
US11236159B2 (en) | 2015-08-03 | 2022-02-01 | Novartis Ag | Methods of treating FGF21-associated disorders |
US11370841B2 (en) | 2016-08-26 | 2022-06-28 | Ngm Biopharmaceuticals, Inc. | Methods of treating fibroblast growth factor 19-mediated cancers and tumors |
US11471513B2 (en) | 2016-08-19 | 2022-10-18 | Ampsource Biopharma Shanghai Inc. | Highly glycosylated human blood-clotting factor VIII fusion protein, and manufacturing method and application of same |
US11963999B2 (en) | 2014-03-11 | 2024-04-23 | Novartis Ag | Methods of treating HIV-HAART induced partial lipodystrophy with FGF21 protein variant FC fusion proteins |
US11981718B2 (en) | 2020-05-27 | 2024-05-14 | Ampsource Biopharma Shanghai Inc. | Dual-function protein for lipid and blood glucose regulation |
Families Citing this family (37)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU2002231736A1 (en) | 2000-12-22 | 2002-07-08 | Max-Planck-Gesellschaft Zur Forderung Der Wissenschaften E.V. | Use of repulsive guidance molecule (rgm) and its modulators |
JPWO2002077546A1 (ja) * | 2001-03-14 | 2004-07-15 | 積水化学工業株式会社 | ヒートポンプ及びヒートポンプシステム |
EP1928905B1 (fr) | 2005-09-30 | 2015-04-15 | AbbVie Deutschland GmbH & Co KG | Domaines de liaison de proteines de la famille proteinique des molecules de guidage repulsif (rgm), fragments fonctionnels de ces domaines et leur utilisation |
US8962803B2 (en) | 2008-02-29 | 2015-02-24 | AbbVie Deutschland GmbH & Co. KG | Antibodies against the RGM A protein and uses thereof |
MX2012006560A (es) * | 2009-12-08 | 2012-10-05 | Abbott Gmbh & Co Kg | Anticuerpos monoclonales contra la proteina rgm a para utilizarse en el tratamiento de degeneracion de capa de fibra de nervio retinal. |
WO2012154263A1 (fr) * | 2011-05-10 | 2012-11-15 | Amgen Inc. | Procédé d'identification de composés qui modulent spécifiquement l'interaction de fgfr1 et de bêta-klotho |
CA2858572C (fr) * | 2011-12-08 | 2023-01-17 | Amgen Inc. | Proteines liant un antigene lcat humain et leur utilisation en therapie |
IL297229A (en) | 2012-01-27 | 2022-12-01 | Abbvie Inc | The composition and method for the diagnosis and treatment of diseases related to the degeneration of nerve cells |
EP2814846B1 (fr) * | 2012-02-13 | 2020-01-08 | Seattle Children's Hospital d/b/a Seattle Children's Research Institute | Récepteurs d'antigène chimères bispécifiques et utilisations thérapeutiques de ceux-ci |
UY35148A (es) | 2012-11-21 | 2014-05-30 | Amgen Inc | Immunoglobulinas heterodiméricas |
WO2014144817A2 (fr) | 2013-03-15 | 2014-09-18 | Amgen Inc. | Polypeptides inhibiteurs spécifiques à des inhibiteurs wnt |
JP6576325B2 (ja) | 2013-03-15 | 2019-09-18 | セルジーン シーエーアール エルエルシー | ヘテロアリール化合物およびそれらの使用 |
US9321786B2 (en) | 2013-03-15 | 2016-04-26 | Celgene Avilomics Research, Inc. | Heteroaryl compounds and uses thereof |
NZ711376A (en) | 2013-03-15 | 2020-01-31 | Sanofi Sa | Heteroaryl compounds and uses thereof |
US11427627B2 (en) | 2013-09-05 | 2022-08-30 | Amgen Inc. | Fc-containing molecules exhibiting predictable, consistent, and reproducible glycoform profiles |
US9644023B2 (en) | 2013-12-09 | 2017-05-09 | New York University | Compositions and methods for phagocyte delivery of anti-staphylococcal agents |
MX2016014761A (es) | 2014-05-16 | 2017-05-25 | Amgen Inc | Ensayo para detectar poblaciones celulares linfocitos t colaboradores 1 (th1) y linfocitos t colaboradores (th2). |
CN108026175A (zh) | 2015-09-24 | 2018-05-11 | 豪夫迈·罗氏有限公司 | 用于治疗癫痫的方法 |
CL2015003047A1 (es) * | 2015-10-15 | 2016-06-17 | Univ Chile | Método ex vivo para detectar precozmente injuria renal aguda en pacientes críticos, que comprende la mediciom en una muestra de tres proteinas como biomarcadores, factor de crecimiento fibroblástico 23, klotho y eritropoyetina |
CN107177002B (zh) * | 2016-03-09 | 2021-02-09 | 郑州鸿运华宁生物医药有限公司 | 一种能与人β-Klotho受体特异性结合的抗体及其用途 |
MA47775A (fr) | 2017-03-14 | 2020-01-22 | Amgen Inc | Contrôle des glycoformes afucosylées totales d'anticorps produits en culture cellulaire |
AU2018281337B2 (en) * | 2017-06-06 | 2022-08-25 | Relinia, Inc. | Single-chain TNF receptor 2 agonist fusion proteins |
EP3649157A4 (fr) * | 2017-07-06 | 2021-07-28 | Yale University | Compositions et méthodes de traitement ou de prévention de maladies liées au fgf endocrinien |
KR101917854B1 (ko) * | 2017-08-24 | 2018-11-12 | 한국콜마주식회사 | 세포 수용체 결합능이 있는 펩티드를 포함하는 마이크로 캡슐 및 이를 포함하는 화장료 조성물 |
MA52186A (fr) | 2018-03-26 | 2021-02-17 | Amgen Inc | Glycoformes afucosylées totales d'anticorps produits en culture cellulaire |
EP3801766A1 (fr) * | 2018-05-31 | 2021-04-14 | Novartis AG | Anticorps contre l'hépatite b |
CN112239507A (zh) * | 2019-07-17 | 2021-01-19 | 鸿运华宁(杭州)生物医药有限公司 | ETA抗体与TGF-β Trap的融合蛋白质,以及其药物组合物和应用 |
US20220349898A1 (en) | 2019-09-26 | 2022-11-03 | Amgen Inc. | Methods of producing antibody compositions |
EP4162257A1 (fr) | 2020-06-04 | 2023-04-12 | Amgen Inc. | Évaluation de procédures de nettoyage d'un procédé de fabrication biothérapeutique |
KR20230087539A (ko) | 2020-10-15 | 2023-06-16 | 암젠 인크 | 항체 생산 방법에서의 상대적인 비결합 글리칸 |
WO2022120375A1 (fr) * | 2020-12-04 | 2022-06-09 | The University Of Chicago | Polypeptides de détection et de traitement d'infection à coronavirus |
JP2024517844A (ja) | 2021-05-04 | 2024-04-23 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | 多重特異性fgf21受容体アゴニスト及びそれらの使用 |
CA3222409A1 (fr) | 2021-06-07 | 2022-12-15 | Amgen Inc. | Utilisation de fucosidase pour controler le taux d'afucosylation de proteines glycosylees |
CN117813323A (zh) * | 2021-09-23 | 2024-04-02 | 江苏恒瑞医药股份有限公司 | 抗klb抗体及用途 |
WO2023059607A1 (fr) | 2021-10-05 | 2023-04-13 | Amgen Inc. | Liaison de récepteur fc-gamma et teneur en glycane |
WO2023125745A1 (fr) * | 2021-12-30 | 2023-07-06 | 上海津曼特生物科技有限公司 | ANTICORPS ANTI-βKLOTHO ET SON UTILISATION |
WO2023215725A1 (fr) | 2022-05-02 | 2023-11-09 | Fred Hutchinson Cancer Center | Compositions et méthodes pour l'immunothérapie cellulaire |
Citations (74)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
EP0036676A1 (fr) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Procédé de préparation de liposomes de taille identique et les liposomes ainsi obtenus |
EP0058481A1 (fr) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Compositions pharmaceutiques pour la libération continue de la substance active |
US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
EP0088046A2 (fr) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipides en phase aqueuse |
EP0133988A2 (fr) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Préparations pharmaceutiques contenant des peptides régulateurs à libération retardée et procédé pour leur préparation |
EP0143949A1 (fr) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Composition pharmaceutique contenant de l'urokinase |
WO1987005330A1 (fr) | 1986-03-07 | 1987-09-11 | Michel Louis Eugene Bergh | Procede pour ameliorer la stabilite des glycoproteines |
US4740461A (en) | 1983-12-27 | 1988-04-26 | Genetics Institute, Inc. | Vectors and methods for transformation of eucaryotic cells |
US4751180A (en) | 1985-03-28 | 1988-06-14 | Chiron Corporation | Expression using fused genes providing for protein product |
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
US4912040A (en) | 1986-11-14 | 1990-03-27 | Genetics Institute, Inc. | Eucaryotic expression system |
WO1990004036A1 (fr) | 1988-10-12 | 1990-04-19 | Medical Research Council | Production d'anticorps a partir d'animaux transgeniques |
EP0367566A1 (fr) | 1988-10-31 | 1990-05-09 | Immunex Corporation | Récepteurs d'interleukine-4 |
US4935233A (en) | 1985-12-02 | 1990-06-19 | G. D. Searle And Company | Covalently linked polypeptide cell modulators |
US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
US4959455A (en) | 1986-07-14 | 1990-09-25 | Genetics Institute, Inc. | Primate hematopoietic growth factors IL-3 and pharmaceutical compositions |
US4965195A (en) | 1987-10-26 | 1990-10-23 | Immunex Corp. | Interleukin-7 |
US4968607A (en) | 1987-11-25 | 1990-11-06 | Immunex Corporation | Interleukin-1 receptors |
US5011912A (en) | 1986-12-19 | 1991-04-30 | Immunex Corporation | Hybridoma and monoclonal antibody for use in an immunoaffinity purification system |
WO1991010741A1 (fr) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation d'anticorps xenogeniques |
EP0460846A1 (fr) | 1990-06-05 | 1991-12-11 | Immunex Corporation | Récepteurs de type II de l'interleukine 1 |
WO1992003918A1 (fr) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Animaux non humains transgeniques capables de produire des anticorps heterologues |
WO1992015673A1 (fr) | 1991-03-11 | 1992-09-17 | The University Of Georgia Research Foundation, Inc. | Clonage et expression de renilla luciferase |
WO1992022646A1 (fr) | 1991-06-14 | 1992-12-23 | Dnx Corp. | Procede d'utilisation de porcs transgeniques dans la production d'hemoglobine humaine |
WO1993001227A1 (fr) | 1991-07-08 | 1993-01-21 | University Of Massachusetts At Amherst | Copolymere en masse segmentee a cristaux liquides thermotropiques |
WO1993010151A1 (fr) | 1991-11-22 | 1993-05-27 | Immunex Corporation | Recepteur de l'oncostatine m et facteur d'inhibition de la leucemie |
WO1994002602A1 (fr) | 1992-07-24 | 1994-02-03 | Cell Genesys, Inc. | Production d'anticorps xenogeniques |
US5292658A (en) | 1989-12-29 | 1994-03-08 | University Of Georgia Research Foundation, Inc. Boyd Graduate Studies Research Center | Cloning and expressions of Renilla luciferase |
WO1994010308A1 (fr) | 1992-10-23 | 1994-05-11 | Immunex Corporation | Procede de preparation de proteines oligomeres solubles |
WO1995007463A1 (fr) | 1993-09-10 | 1995-03-16 | The Trustees Of Columbia University In The City Of New York | Methodes d'utilisation de proteines fluorescentes vertes |
US5457035A (en) | 1993-07-23 | 1995-10-10 | Immunex Corporation | Cytokine which is a ligand for OX40 |
US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
WO1996033735A1 (fr) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Anticorps humains derives d'une xenosouris immunisee |
US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
US5683888A (en) | 1989-07-22 | 1997-11-04 | University Of Wales College Of Medicine | Modified bioluminescent proteins and their use |
WO1998014605A1 (fr) | 1996-10-04 | 1998-04-09 | Loma Linda University | Luciferase renilla et genes de fusion de proteines fluorescentes vertes |
US5741668A (en) | 1994-02-04 | 1998-04-21 | Rutgers, The State University Of New Jersey | Expression of a gene for a modified green-fluorescent protein |
WO1998024893A2 (fr) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | MAMMIFERES TRANSGENIQUES POSSEDANT DES LOCI DE GENES D'IMMUNOGLOBULINE D'ORIGINE HUMAINE, DOTES DE REGIONS VH ET Vλ, ET ANTICORPS PRODUITS A PARTIR DE TELS MAMMIFERES |
WO1998026277A2 (fr) | 1996-12-12 | 1998-06-18 | Prolume, Ltd. | Appareil permettant de detecter et d'identifier des agents infectieux et procede correspondant |
US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5777079A (en) | 1994-11-10 | 1998-07-07 | The Regents Of The University Of California | Modified green fluorescent proteins |
US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5804387A (en) | 1996-02-01 | 1998-09-08 | The Board Of Trustees Of The Leland Stanford Junior University | FACS-optimized mutants of the green fluorescent protein (GFP) |
US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5874304A (en) | 1996-01-18 | 1999-02-23 | University Of Florida Research Foundation, Inc. | Humanized green fluorescent protein genes and methods |
US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
US5876995A (en) | 1996-02-06 | 1999-03-02 | Bryan; Bruce | Bioluminescent novelty items |
US5877293A (en) | 1990-07-05 | 1999-03-02 | Celltech Therapeutics Limited | CDR grafted anti-CEA antibodies and their production |
WO1999010494A2 (fr) | 1997-08-25 | 1999-03-04 | Genentech, Inc. | Anticorps agonistes envers le recepteur de thrombopoietine, et utilisation therapeutique de ces anticorps |
US5886152A (en) | 1991-12-06 | 1999-03-23 | Sumitomo Pharmaceuticals Company, Limited | Humanized B-B10 |
US5925558A (en) | 1996-07-16 | 1999-07-20 | The Regents Of The University Of California | Assays for protein kinases using fluorescent protein substrates |
WO1999049019A2 (fr) | 1998-03-27 | 1999-09-30 | Prolume, Ltd. | Luciferases, proteines fluorescentes, acides nucleiques codant pour les luciferases et les proteines fluorescentes, et leur utilisation dans des diagnostics, des criblages a haut rendement et des articles nouveaux |
WO2000009560A2 (fr) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Production de molecules modifiees avec demi-vie serique prolongee |
US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
US6162963A (en) | 1990-01-12 | 2000-12-19 | Abgenix, Inc. | Generation of Xenogenetic antibodies |
WO2000076310A1 (fr) | 1999-06-10 | 2000-12-21 | Abgenix, Inc. | Animaux transgeniques servant a produire des isotypes specifiques d'anticorps humains via des regions de transition non parentes |
US6255458B1 (en) | 1990-08-29 | 2001-07-03 | Genpharm International | High affinity human antibodies and human antibodies against digoxin |
US6270964B1 (en) | 1997-01-31 | 2001-08-07 | Odyssey Pharmaceuticals Inc. | Protein fragment complementation assays for the detection of biological or drug interactions |
US6300129B1 (en) | 1990-08-29 | 2001-10-09 | Genpharm International | Transgenic non-human animals for producing heterologous antibodies |
US20030039958A1 (en) | 1999-12-03 | 2003-02-27 | Domantis Limited | Direct screening method |
US20040009507A1 (en) | 2000-10-13 | 2004-01-15 | Domantis, Ltd. | Concatenated nucleic acid sequence |
US6696245B2 (en) | 1997-10-20 | 2004-02-24 | Domantis Limited | Methods for selecting functional polypeptides |
US6713610B1 (en) | 1990-01-12 | 2004-03-30 | Raju Kucherlapati | Human antibodies derived from immunized xenomice |
US20040202995A1 (en) | 2003-04-09 | 2004-10-14 | Domantis | Nucleic acids, proteins, and screening methods |
WO2005037235A2 (fr) * | 2003-10-16 | 2005-04-28 | Imclone Systems Incorporated | Inhibiteurs du recepteur 1 du facteur de croissance du fibroblaste et methodes therapeutiques associees |
US20070293430A1 (en) * | 2004-12-14 | 2007-12-20 | Frye Christopher C | Muteins of Fibroblast Growth Factor 21 |
US20070299007A1 (en) * | 2004-09-02 | 2007-12-27 | Eli Lilly And Company | Muteins OF Fibroblast Growth Factor 21 |
US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
US9401875B2 (en) | 2012-06-01 | 2016-07-26 | Nippon Telegraph And Telephone Corporation | Packet transfer processing method and packet transfer processing device |
Family Cites Families (131)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
JPS6023084B2 (ja) * | 1979-07-11 | 1985-06-05 | 味の素株式会社 | 代用血液 |
US4376110A (en) * | 1980-08-04 | 1983-03-08 | Hybritech, Incorporated | Immunometric assays using monoclonal antibodies |
US4640835A (en) * | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
US4496689A (en) * | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
EP0154316B1 (fr) | 1984-03-06 | 1989-09-13 | Takeda Chemical Industries, Ltd. | Lymphokine chimiquement modifiée et son procédé de préparation |
US4945050A (en) * | 1984-11-13 | 1990-07-31 | Cornell Research Foundation, Inc. | Method for transporting substances into living cells and tissues and apparatus therefor |
EP0206448B1 (fr) * | 1985-06-19 | 1990-11-14 | Ajinomoto Co., Inc. | Hémoglobine liée à un poly(oxyde d'alkylène) |
CA1310924C (fr) * | 1986-04-24 | 1992-12-01 | Francis P. Mccormick | Systeme d'administration d'un medicament a l'aide de particules infectieuses |
US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
US4970154A (en) * | 1987-10-09 | 1990-11-13 | Baylor College Of Medicine | Method for inserting foreign genes into cells using pulsed radiofrequency |
DE3889853D1 (de) | 1987-11-05 | 1994-07-07 | Hybritech Inc | Polysaccharidmodifizierte Immunglobuline mit reduziertem immunogenem Potential oder verbesserter Pharmakokinetik. |
US4892538A (en) * | 1987-11-17 | 1990-01-09 | Brown University Research Foundation | In vivo delivery of neurotransmitters by implanted, encapsulated cells |
US5106627A (en) * | 1987-11-17 | 1992-04-21 | Brown University Research Foundation | Neurological therapy devices |
US5158881A (en) | 1987-11-17 | 1992-10-27 | Brown University Research Foundation | Method and system for encapsulating cells in a tubular extrudate in separate cell compartments |
US5011472A (en) * | 1988-09-06 | 1991-04-30 | Brown University Research Foundation | Implantable delivery system for biological factors |
CA2006596C (fr) | 1988-12-22 | 2000-09-05 | Rika Ishikawa | G-csf modifie chimiquement |
US5288855A (en) * | 1989-01-23 | 1994-02-22 | Farmitalia Carlo Erba | Extracellular form of the human fibroblast growth factor receptor |
ES2133271T3 (es) * | 1989-07-06 | 1999-09-16 | Univ California | Receptores para factores de crecimiento de fibroblastos. |
US5676954A (en) * | 1989-11-03 | 1997-10-14 | Vanderbilt University | Method of in vivo delivery of functioning foreign genes |
US5272071A (en) | 1989-12-22 | 1993-12-21 | Applied Research Systems Ars Holding N.V. | Method for the modification of the expression characteristics of an endogenous gene of a given cell line |
DE779362T1 (de) | 1989-12-22 | 2001-04-05 | Applied Research Systems | DNS-Konstrukten zur Aktivierung und Veränderung der Expression von endogenen Genen |
WO1991010470A1 (fr) | 1990-01-08 | 1991-07-25 | Brown University Research Foundation | Dispositifs et procedes d'apport ameliore de facteurs actifs |
US5672510A (en) * | 1990-01-19 | 1997-09-30 | Genetic Therapy, Inc. | Retroviral vectors |
JP3615220B2 (ja) * | 1990-07-06 | 2005-02-02 | アヴェンティス ファーマシューティカルズ インコーポレイテッド | 繊維芽細胞生育因子受容体 |
US5217889A (en) * | 1990-10-19 | 1993-06-08 | Roninson Igor B | Methods and applications for efficient genetic suppressor elements |
US5252714A (en) * | 1990-11-28 | 1993-10-12 | The University Of Alabama In Huntsville | Preparation and use of polyethylene glycol propionaldehyde |
US5229501A (en) * | 1991-01-11 | 1993-07-20 | Chiron Corporation | Expression and use of human fibroblast growth factor receptor |
US6565841B1 (en) | 1991-03-15 | 2003-05-20 | Amgen, Inc. | Pulmonary administration of granulocyte colony stimulating factor |
IL100219A0 (en) | 1991-12-02 | 1992-09-06 | Yeda Res & Dev | Variable region within fibroblast growth factor receptors that confers ligand specificity |
WO1993015722A1 (fr) | 1992-02-07 | 1993-08-19 | Syntex (Usa) Inc. | Liberation controlee de produits pharmaceutiques a partir de microparticules poreuses preformees |
US5234784A (en) * | 1992-04-01 | 1993-08-10 | Eastman Kodak Company | Method of making a projection viewable transparency comprising an electrostatographic toner image |
US5364791A (en) * | 1992-05-14 | 1994-11-15 | Elisabetta Vegeto | Progesterone receptor having C. terminal hormone binding domain truncations |
US5489743A (en) * | 1993-01-19 | 1996-02-06 | Amgen Inc. | Transgenic animal models for thrombocytopenia |
US5581476A (en) * | 1993-01-28 | 1996-12-03 | Amgen Inc. | Computer-based methods and articles of manufacture for preparing G-CSF analogs |
JPH08509870A (ja) | 1993-05-26 | 1996-10-22 | オンタリオ キャンサー インスティテュート | 特定のcd45イソ型タンパク質の発現を遮断するトランスジェニック哺乳動物 |
US6664107B1 (en) * | 1993-05-26 | 2003-12-16 | Ontario Cancer Institute, University Health Network | CD45 disrupted nucleic acid |
US5654168A (en) * | 1994-07-01 | 1997-08-05 | Basf Aktiengesellschaft | Tetracycline-inducible transcriptional activator and tetracycline-regulated transcription units |
US5589362A (en) | 1993-06-14 | 1996-12-31 | Basf Aktiengesellschaft | Tetracycline regulated transcriptional modulators with altered DNA binding specificities |
CA2165162C (fr) * | 1993-06-14 | 2000-05-23 | Hermann Bujard | Regulation etroite de l'expression de genes dans les cellules d'eucaryotes, grace a des promoteurs sensibles a la tetracycline |
DE69430824T2 (de) | 1993-08-12 | 2003-01-23 | Neurotech Sa | Biokompatible immunoisolatorische Kapseln, die genetisch veränderte Zellen enthalten |
US5658785A (en) | 1994-06-06 | 1997-08-19 | Children's Hospital, Inc. | Adeno-associated virus materials and methods |
US5484720A (en) * | 1994-09-08 | 1996-01-16 | Genentech, Inc. | Methods for calcium phosphate transfection |
US5824784A (en) | 1994-10-12 | 1998-10-20 | Amgen Inc. | N-terminally chemically modified protein compositions and methods |
US6096871A (en) | 1995-04-14 | 2000-08-01 | Genentech, Inc. | Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life |
CZ372297A3 (cs) | 1995-05-26 | 1998-03-18 | Zeneca Limited | Přepínání genové exprese využívající receptoru pro ekdyson |
KR19990022651A (ko) | 1995-06-07 | 1999-03-25 | 데이비드 엘. 버스테인 | 생물학적 사건에 대한 라파마이신 기재 조절방법 |
WO1996040958A1 (fr) | 1995-06-07 | 1996-12-19 | Baylor College Of Medicine | Transporteurs d'acide nucleique servant a introduire des acides nucleiques dans une cellule |
DE69739853D1 (de) | 1996-02-28 | 2010-06-02 | Ariad Pharma Inc | Synthetische rapamycinderivate als multimerisierende wirkstoffe für chimere proteine mit von immunophilin abgeleiteten domänen |
CA2249195A1 (fr) | 1996-03-18 | 1997-09-25 | Board Of Regents, The University Of Texas System | Domaines analogues a l'immunoglobuline a demi-vies prolongees |
US5679559A (en) * | 1996-07-03 | 1997-10-21 | University Of Utah Research Foundation | Cationic polymer and lipoprotein-containing system for gene delivery |
US6214795B1 (en) * | 1996-11-12 | 2001-04-10 | Praecis Pharmaceuticals, Inc. | Peptide compounds useful for modulating FGF receptor activity |
JP4112627B2 (ja) * | 1996-12-26 | 2008-07-02 | 社団法人芝蘭会 | 新規ポリペプチド、新規dnaおよび新規抗体 |
US6133426A (en) * | 1997-02-21 | 2000-10-17 | Genentech, Inc. | Humanized anti-IL-8 monoclonal antibodies |
DK1032668T3 (da) | 1997-11-25 | 2008-09-29 | Genentech Inc | Fibroblast vækstfaktor 19 |
US6150098A (en) * | 1998-02-20 | 2000-11-21 | Amgen Inc. | Methods for identifying novel secreted mammalian polypeptides |
US6101683A (en) * | 1998-04-02 | 2000-08-15 | Avery Dennison Corporation | Loop fastener, fastener clip including same and loop fastener dispensing tool |
US6548634B1 (en) * | 1998-09-30 | 2003-04-15 | Chiron Corporation | Synthetic peptides having FGF receptor affinity |
US6660843B1 (en) | 1998-10-23 | 2003-12-09 | Amgen Inc. | Modified peptides as therapeutic agents |
WO2000027885A1 (fr) | 1998-11-05 | 2000-05-18 | Kyowa Hakko Kogyo Co., Ltd. | Nouveau popypeptide chimerique |
US6656728B1 (en) | 1999-02-08 | 2003-12-02 | Chiron Corporation | Fibroblast growth factor receptor-immunoglobulin fusion |
AU3755900A (en) | 1999-03-15 | 2000-10-04 | Chiron Corporation | Use of recombinant gene delivery vectors for treating or preventing diseases of the eye |
GB9916482D0 (en) | 1999-07-15 | 1999-09-15 | British Aerospace | Terrain navigation apparatus for a legged animal traversing terrain |
CA2311201A1 (fr) * | 1999-08-05 | 2001-02-05 | Genset S.A. | Sequences marqueurs exprimees et proteines humaines codees |
US7459540B1 (en) * | 1999-09-07 | 2008-12-02 | Amgen Inc. | Fibroblast growth factor-like polypeptides |
US7408047B1 (en) * | 1999-09-07 | 2008-08-05 | Amgen Inc. | Fibroblast growth factor-like polypeptides |
AU7368100A (en) | 1999-09-10 | 2001-04-10 | Curagen Corporation | Fibroblast growth factor polypeptide and nucleic acids encoding same |
WO2001032678A1 (fr) | 1999-11-05 | 2001-05-10 | Smithkline Beecham Corporation | sbgFGF-19a |
EP2163626A1 (fr) | 1999-11-18 | 2010-03-17 | Novartis Vaccines and Diagnostics, Inc. | Gène humain fgf-21 et produits d'expression génique |
US6716626B1 (en) * | 1999-11-18 | 2004-04-06 | Chiron Corporation | Human FGF-21 nucleic acids |
WO2001038357A2 (fr) | 1999-11-22 | 2001-05-31 | Millennium Pharmaceuticals, Inc. | Nouveau membre de la famille des facteurs de croissance des fibroblastes, appele jaffa, et utilisations correspondantes |
US7108984B2 (en) * | 2000-01-12 | 2006-09-19 | Mount Sinai School Of Medicine | Methods of identifying modulators of the FGF receptor |
US20020081663A1 (en) * | 2000-01-05 | 2002-06-27 | Conklin Darrell C. | Novel FGF homolog ZFGF11 |
AU2631001A (en) | 2000-01-05 | 2001-07-16 | Zymogenetics Inc. | Novel fgf homolog zfgf11 |
US20020001825A1 (en) | 2000-03-31 | 2002-01-03 | Nobuyuki Itoh | Fibroblast growth factor-like molecules and uses thereof |
IL139380A0 (en) | 2000-10-31 | 2001-11-25 | Prochon Biotech Ltd | Active variants of fibroblast growth factor |
US20060223114A1 (en) | 2001-04-26 | 2006-10-05 | Avidia Research Institute | Protein scaffolds and uses thereof |
US20030157561A1 (en) | 2001-11-19 | 2003-08-21 | Kolkman Joost A. | Combinatorial libraries of monomer domains |
US20040018499A1 (en) * | 2001-06-06 | 2004-01-29 | Lal Preeti G | Extracellular messengers |
DE60233509D1 (de) * | 2001-06-20 | 2009-10-08 | Fibron Ltd | Fgfr3 blockierende antikörper, verfahren zum screening darauf und verwendungen davon |
AU2002325819B2 (en) * | 2001-07-11 | 2008-06-19 | Maxygen, Inc. | G-CSF Conjugates |
WO2003011213A2 (fr) | 2001-07-30 | 2003-02-13 | Eli Lilly And Company | Methode de traitement du diabete et de l'obesite |
US20050187150A1 (en) * | 2001-10-31 | 2005-08-25 | New York University | Structure-based design and synthesis of FGF inhibitors and FGF modulator compounds |
WO2003059270A2 (fr) | 2002-01-15 | 2003-07-24 | Eli Lilly And Company | Methode de diminution de la morbidite et de la mortalite chez des patients gravement malades |
JP2005530687A (ja) * | 2002-01-31 | 2005-10-13 | マックス−プランク−ゲゼルシャフト・ツア・フェルデルング・デア・ヴィッセンシャフテン・エー・ファオ | Fgfrアゴニスト |
EP1332761A1 (fr) * | 2002-01-31 | 2003-08-06 | Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. | Agonistes des récepteurs du facteur de croissance des fibroblastes |
CN1162704C (zh) * | 2002-06-17 | 2004-08-18 | 北京大学 | 一种检测人血液中Klotho蛋白的方法 |
AU2003265057A1 (en) | 2002-09-04 | 2004-03-29 | Abtech | Anti-idiotypic antibodies as vegf or fgf agonists for bone therapy |
AU2003289716A1 (en) | 2002-09-12 | 2004-04-30 | Incyte Corporation | Molecules for diagnostics and therapeutics |
AU2003284357A1 (en) * | 2002-11-01 | 2004-06-07 | Genentech, Inc. | Compositions and methods for the treatment of immune related diseases |
EP1579218A2 (fr) * | 2002-12-20 | 2005-09-28 | Enkam Pharmaceuticals A/S | Methode de modulation de l'interaction d'un recepteur et d'un ligand |
TWI300430B (en) * | 2003-01-10 | 2008-09-01 | Ritek Corp | Optical recording medium dye and optical recording medium using thereof |
WO2004083381A2 (fr) | 2003-03-13 | 2004-09-30 | Indiana University Advanced Research & Technology Institute | Polynucleotides, polypeptides et mutants des recepteurs 1 du facteur de croissance des fibroblastes |
JP2006240990A (ja) | 2003-05-15 | 2006-09-14 | Kirin Brewery Co Ltd | klothoタンパク質および抗klothoタンパク質抗体ならびにそれらの用途 |
ES2298785T3 (es) | 2003-06-12 | 2008-05-16 | Eli Lilly And Company | Proteinas de fusion. |
CN1802386B (zh) * | 2003-06-12 | 2010-12-15 | 伊莱利利公司 | Glp-1类似物融合蛋白质 |
EA200601121A1 (ru) * | 2003-12-10 | 2006-10-27 | Эли Лилли Энд Компани | Мутеины фактора роста фибробластов 21 |
US20070248605A1 (en) | 2003-12-19 | 2007-10-25 | Five Prime Therapetutics, Inc. | Fibroblast Growth Factor Receptors 1,2,3, and 4 as Targets for Therapeutic Intervention |
WO2005072769A1 (fr) | 2004-01-26 | 2005-08-11 | Eli Lilly And Company | Utilisation du fgf-21 et d'une thiazolidinedione dans le traitement du diabete de type 2 |
EP1735340A2 (fr) | 2004-03-17 | 2006-12-27 | Eli Lilly And Company | Composes fgf-21 lies au glycol |
US7576190B2 (en) * | 2004-05-13 | 2009-08-18 | Eli Lilly And Company | FGF-21 fusion proteins |
EP2161281A1 (fr) * | 2004-09-02 | 2010-03-10 | Eli Lilly & Company | Mutéines de facteur de croissance de fibroblaste 21 |
SI2586456T1 (sl) | 2004-10-29 | 2016-05-31 | Ratiopharm Gmbh | Preoblikovanje in glikopegliacija fibroblastnega rastnega faktorja (FGF) |
JP2008528487A (ja) | 2005-01-21 | 2008-07-31 | イーライ リリー アンド カンパニー | 心臓血管疾患を治療する方法 |
JP2006246823A (ja) | 2005-03-11 | 2006-09-21 | Kyoto Univ | 造血因子としてのFgf21の使用 |
WO2006130527A2 (fr) | 2005-05-31 | 2006-12-07 | Novartis Ag | Mutations et polymorphismes de recepteur du facteur de croissance 1 des fibroblastes |
AU2006272759B2 (en) * | 2005-07-22 | 2012-01-12 | Five Prime Therapeutics, Inc. | Compositions and methods of treating disease with FGFR fusion proteins |
AU2006280321A1 (en) * | 2005-08-15 | 2007-02-22 | Genentech, Inc. | Gene disruptions, compositions and methods relating thereto |
US8043833B2 (en) | 2005-10-31 | 2011-10-25 | Novo Nordisk A/S | Expression of soluble therapeutic proteins |
US20090142336A1 (en) | 2006-02-28 | 2009-06-04 | Trustees Of Boston University | Metabolic regulators and uses thereof |
CA2655504A1 (fr) * | 2006-06-15 | 2007-12-21 | Fibron Ltd. | Anticorps bloquant l'activation du recepteur du facteur de croissance des fibroblastes et leurs procedes d'utilisation |
CN101516388B (zh) | 2006-07-21 | 2012-10-31 | 诺和诺德公司 | 通过o-联糖基化序列的肽的糖基化 |
EP2054521A4 (fr) * | 2006-10-03 | 2012-12-19 | Novo Nordisk As | Méthodes de purification de conjugués de polypeptides |
BRPI0809583B1 (pt) * | 2007-03-30 | 2022-02-22 | Ambrx, Inc | Polipeptídeo fgf-21 modificado, composição compreendendo o mesmo, método para produzir o referido polipetídeo fgf-21 e célula compreendendo um polinucleotídeo |
EP2550972B1 (fr) * | 2007-04-02 | 2018-02-21 | Genentech, Inc. | Un anticorps agoniste de Klotho-béta à utiliser dans le traitement du diabète et de la résistance à l'insuline |
JP5187837B2 (ja) * | 2007-04-06 | 2013-04-24 | 独立行政法人産業技術総合研究所 | 補助因子による受容体の活性化方法並びにリガンド活性の利用方法 |
US7537903B2 (en) * | 2007-04-23 | 2009-05-26 | Board Of Regents, The University Of Texas System | FGF21 upregulates expression of GLUT-1 in a βklotho-dependent manner |
BRPI0812384A2 (pt) | 2007-05-22 | 2014-12-02 | Novartis Ag | Métodos de tratamento, diagnóstico e detecção de distúrbios associados a fgf21 |
EP2165715B1 (fr) | 2007-05-29 | 2013-12-18 | Sapporo Medical University | Agent thérapeutique contre le cancer et procédé de traitement du cancer |
WO2008151258A2 (fr) | 2007-06-04 | 2008-12-11 | Neose Technologies, Inc. | Glycosylation à liaisons o utilisant des n-acétylglucosaminyl transférases |
ES2646614T3 (es) | 2007-08-03 | 2017-12-14 | Eli Lilly And Company | Uso de un compuesto de FGF 21 y un compuesto de GLP 1 para el tratamiento de la obesidad |
SG187477A1 (en) | 2007-09-26 | 2013-02-28 | U3 Pharma Gmbh | Heparin-binding epidermal growth factor-like growth factor antigen binding proteins |
TW200936156A (en) * | 2008-01-28 | 2009-09-01 | Novartis Ag | Methods and compositions using Klotho-FGF fusion polypeptides |
JOP20190083A1 (ar) | 2008-06-04 | 2017-06-16 | Amgen Inc | بولي ببتيدات اندماجية طافرة لـfgf21 واستخداماتها |
WO2010006214A1 (fr) | 2008-07-09 | 2010-01-14 | Ambrx, Inc. | Anticorps de neutralisation de fgf-21 et leurs utilisations |
RU2509774C2 (ru) * | 2008-08-04 | 2014-03-20 | Файв Прайм Терапьютикс, Инк. | Мутеины кислотной зоны внеклеточного домена рецептора фактора роста фибробластов |
JP2012502649A (ja) | 2008-09-19 | 2012-02-02 | メディミューン,エルエルシー | Cd105を対象とする標的結合剤およびその使用 |
CA2742969A1 (fr) | 2008-11-07 | 2010-05-14 | Fabrus Llc | Anticorps anti-dll4 et utilisations associees |
SG10201402038WA (en) | 2009-05-05 | 2014-07-30 | Amgen Inc | FGF21 Mutants And Uses Thereof |
WO2011068893A1 (fr) * | 2009-12-02 | 2011-06-09 | Amgen Inc. | Protéines de liaison qui se lient au fgfr1c humain, au β-klotho humain et à la fois au fgfr1c humain et au β-klotho humain |
UA109888C2 (uk) * | 2009-12-07 | 2015-10-26 | ІЗОЛЬОВАНЕ АНТИТІЛО АБО ЙОГО ФРАГМЕНТ, ЩО ЗВ'ЯЗУЄТЬСЯ З β-КЛОТО, РЕЦЕПТОРАМИ FGF І ЇХНІМИ КОМПЛЕКСАМИ |
-
2010
- 2010-03-12 UA UAA201208326A patent/UA109888C2/ru unknown
- 2010-12-03 RS RS20170486A patent/RS56016B1/sr unknown
- 2010-12-03 ES ES10788204.5T patent/ES2633810T3/es active Active
- 2010-12-03 CN CN201711402977.6A patent/CN108586602A/zh active Pending
- 2010-12-03 MX MX2012006467A patent/MX341148B/es active IP Right Grant
- 2010-12-03 KR KR1020207015902A patent/KR20200067924A/ko not_active Application Discontinuation
- 2010-12-03 NZ NZ717847A patent/NZ717847A/en unknown
- 2010-12-03 JP JP2012543173A patent/JP5840619B2/ja active Active
- 2010-12-03 CA CA2782420A patent/CA2782420C/fr active Active
- 2010-12-03 HU HUE13183846A patent/HUE034727T2/en unknown
- 2010-12-03 EP EP10788204.5A patent/EP2510009B1/fr active Active
- 2010-12-03 MX MX2016010041A patent/MX360487B/es unknown
- 2010-12-03 MY MYPI2016000186A patent/MY191950A/en unknown
- 2010-12-03 DK DK13183846.8T patent/DK2711375T3/en active
- 2010-12-03 EP EP16207166.6A patent/EP3202787B1/fr active Active
- 2010-12-03 SG SG2012042008A patent/SG181568A1/en unknown
- 2010-12-03 PE PE2012000781A patent/PE20121686A1/es active IP Right Grant
- 2010-12-03 CN CN201080063309.5A patent/CN102858802B/zh active Active
- 2010-12-03 ME MEP-2017-108A patent/ME02807B/fr unknown
- 2010-12-03 KR KR1020127017717A patent/KR101865974B1/ko active IP Right Grant
- 2010-12-03 SI SI201031477A patent/SI2711375T1/sl unknown
- 2010-12-03 CR CR20180020A patent/CR20180020A/es unknown
- 2010-12-03 PL PL13183846T patent/PL2711375T3/pl unknown
- 2010-12-03 SG SG10201708609PA patent/SG10201708609PA/en unknown
- 2010-12-03 WO PCT/US2010/058984 patent/WO2011071783A1/fr active Application Filing
- 2010-12-03 US US12/960,407 patent/US9284378B2/en active Active
- 2010-12-03 KR KR1020187015615A patent/KR102121678B1/ko active IP Right Grant
- 2010-12-03 BR BR112012013876-6A patent/BR112012013876B1/pt active IP Right Grant
- 2010-12-03 AU AU2010328444A patent/AU2010328444B2/en active Active
- 2010-12-03 EP EP13183846.8A patent/EP2711375B1/fr active Active
- 2010-12-03 MY MYPI2012002532A patent/MY173097A/en unknown
- 2010-12-03 NZ NZ700473A patent/NZ700473A/en unknown
- 2010-12-03 LT LTEP13183846.8T patent/LT2711375T/lt unknown
- 2010-12-03 EA EA201270634A patent/EA026129B1/ru unknown
- 2010-12-03 PT PT131838468T patent/PT2711375T/pt unknown
- 2010-12-03 CA CA2981687A patent/CA2981687C/fr active Active
- 2010-12-03 EP EP20178046.7A patent/EP3760642A1/fr active Pending
- 2010-12-03 EA EA201691176A patent/EA033405B1/ru not_active IP Right Cessation
- 2010-12-03 ES ES13183846T patent/ES2631135T3/es active Active
- 2010-12-06 AR ARP100104498A patent/AR079274A1/es active IP Right Grant
- 2010-12-06 TW TW106117037A patent/TWI693234B/zh active
- 2010-12-06 UY UY0001033089A patent/UY33089A/es not_active Application Discontinuation
- 2010-12-06 TW TW108141373A patent/TW202033554A/zh unknown
- 2010-12-06 TW TW099142419A patent/TWI600761B/zh active
-
2012
- 2012-05-28 TN TNP2012000268A patent/TN2012000268A1/en unknown
- 2012-05-29 IL IL220048A patent/IL220048A0/en active IP Right Grant
- 2012-06-06 ZA ZA2012/04145A patent/ZA201204145B/en unknown
- 2012-06-07 CL CL2012001504A patent/CL2012001504A1/es unknown
- 2012-06-28 MA MA35017A patent/MA33854B1/fr unknown
- 2012-07-06 CR CR20120366A patent/CR20120366A/es unknown
-
2015
- 2015-11-10 JP JP2015220080A patent/JP6240138B2/ja active Active
-
2016
- 2016-02-02 US US15/012,939 patent/US9493577B2/en active Active
- 2016-09-29 US US15/280,662 patent/US10570205B2/en active Active
-
2017
- 2017-04-24 CY CY20171100456T patent/CY1119000T1/el unknown
- 2017-06-08 HR HRP20170882TT patent/HRP20170882T1/hr unknown
- 2017-11-02 JP JP2017212467A patent/JP6931590B2/ja active Active
-
2018
- 2018-09-04 IL IL261585A patent/IL261585B/en unknown
-
2019
- 2019-12-12 JP JP2019224298A patent/JP7065822B2/ja active Active
-
2020
- 2020-01-16 US US16/744,734 patent/US20200216546A1/en active Pending
-
2021
- 2021-03-10 UY UY0001039124A patent/UY39124A/es not_active Application Discontinuation
Patent Citations (89)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
EP0036676A1 (fr) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Procédé de préparation de liposomes de taille identique et les liposomes ainsi obtenus |
US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
EP0058481A1 (fr) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Compositions pharmaceutiques pour la libération continue de la substance active |
EP0088046A2 (fr) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipides en phase aqueuse |
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
EP0133988A2 (fr) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Préparations pharmaceutiques contenant des peptides régulateurs à libération retardée et procédé pour leur préparation |
EP0143949A1 (fr) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Composition pharmaceutique contenant de l'urokinase |
US4740461A (en) | 1983-12-27 | 1988-04-26 | Genetics Institute, Inc. | Vectors and methods for transformation of eucaryotic cells |
US4751180A (en) | 1985-03-28 | 1988-06-14 | Chiron Corporation | Expression using fused genes providing for protein product |
US4935233A (en) | 1985-12-02 | 1990-06-19 | G. D. Searle And Company | Covalently linked polypeptide cell modulators |
WO1987005330A1 (fr) | 1986-03-07 | 1987-09-11 | Michel Louis Eugene Bergh | Procede pour ameliorer la stabilite des glycoproteines |
US4959455A (en) | 1986-07-14 | 1990-09-25 | Genetics Institute, Inc. | Primate hematopoietic growth factors IL-3 and pharmaceutical compositions |
US4912040A (en) | 1986-11-14 | 1990-03-27 | Genetics Institute, Inc. | Eucaryotic expression system |
US5011912A (en) | 1986-12-19 | 1991-04-30 | Immunex Corporation | Hybridoma and monoclonal antibody for use in an immunoaffinity purification system |
US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
US4965195A (en) | 1987-10-26 | 1990-10-23 | Immunex Corp. | Interleukin-7 |
US4968607A (en) | 1987-11-25 | 1990-11-06 | Immunex Corporation | Interleukin-1 receptors |
US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
WO1990004036A1 (fr) | 1988-10-12 | 1990-04-19 | Medical Research Council | Production d'anticorps a partir d'animaux transgeniques |
EP0367566A1 (fr) | 1988-10-31 | 1990-05-09 | Immunex Corporation | Récepteurs d'interleukine-4 |
US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5683888A (en) | 1989-07-22 | 1997-11-04 | University Of Wales College Of Medicine | Modified bioluminescent proteins and their use |
US5418155A (en) | 1989-12-29 | 1995-05-23 | University Of Georgia Research Foundation, Inc. | Isolated Renilla luciferase and method of use thereof |
US5292658A (en) | 1989-12-29 | 1994-03-08 | University Of Georgia Research Foundation, Inc. Boyd Graduate Studies Research Center | Cloning and expressions of Renilla luciferase |
US6713610B1 (en) | 1990-01-12 | 2004-03-30 | Raju Kucherlapati | Human antibodies derived from immunized xenomice |
US6162963A (en) | 1990-01-12 | 2000-12-19 | Abgenix, Inc. | Generation of Xenogenetic antibodies |
US6673986B1 (en) | 1990-01-12 | 2004-01-06 | Abgenix, Inc. | Generation of xenogeneic antibodies |
WO1991010741A1 (fr) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation d'anticorps xenogeniques |
EP0460846A1 (fr) | 1990-06-05 | 1991-12-11 | Immunex Corporation | Récepteurs de type II de l'interleukine 1 |
US5877293A (en) | 1990-07-05 | 1999-03-02 | Celltech Therapeutics Limited | CDR grafted anti-CEA antibodies and their production |
US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
EP0546073A1 (fr) | 1990-08-29 | 1993-06-16 | Genpharm Int | Animaux non humains transgeniques capables de produire des anticorps heterologues. |
US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
WO1992003918A1 (fr) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Animaux non humains transgeniques capables de produire des anticorps heterologues |
US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
EP0546073B1 (fr) | 1990-08-29 | 1997-09-10 | GenPharm International, Inc. | production et utilisation des animaux non humains transgeniques capable de produire des anticorps heterologues |
US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US6255458B1 (en) | 1990-08-29 | 2001-07-03 | Genpharm International | High affinity human antibodies and human antibodies against digoxin |
US6300129B1 (en) | 1990-08-29 | 2001-10-09 | Genpharm International | Transgenic non-human animals for producing heterologous antibodies |
WO1992015673A1 (fr) | 1991-03-11 | 1992-09-17 | The University Of Georgia Research Foundation, Inc. | Clonage et expression de renilla luciferase |
WO1992022646A1 (fr) | 1991-06-14 | 1992-12-23 | Dnx Corp. | Procede d'utilisation de porcs transgeniques dans la production d'hemoglobine humaine |
US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
WO1993001227A1 (fr) | 1991-07-08 | 1993-01-21 | University Of Massachusetts At Amherst | Copolymere en masse segmentee a cristaux liquides thermotropiques |
WO1993010151A1 (fr) | 1991-11-22 | 1993-05-27 | Immunex Corporation | Recepteur de l'oncostatine m et facteur d'inhibition de la leucemie |
US5262522A (en) | 1991-11-22 | 1993-11-16 | Immunex Corporation | Receptor for oncostatin M and leukemia inhibitory factor |
US5426048A (en) | 1991-11-22 | 1995-06-20 | Immunex Corporation | DNA encoding a fusion receptor for oncostatin M and leukemia inhibitory factor |
US5886152A (en) | 1991-12-06 | 1999-03-23 | Sumitomo Pharmaceuticals Company, Limited | Humanized B-B10 |
WO1994002602A1 (fr) | 1992-07-24 | 1994-02-03 | Cell Genesys, Inc. | Production d'anticorps xenogeniques |
WO1994010308A1 (fr) | 1992-10-23 | 1994-05-11 | Immunex Corporation | Procede de preparation de proteines oligomeres solubles |
US5457035A (en) | 1993-07-23 | 1995-10-10 | Immunex Corporation | Cytokine which is a ligand for OX40 |
WO1995007463A1 (fr) | 1993-09-10 | 1995-03-16 | The Trustees Of Columbia University In The City Of New York | Methodes d'utilisation de proteines fluorescentes vertes |
US5741668A (en) | 1994-02-04 | 1998-04-21 | Rutgers, The State University Of New Jersey | Expression of a gene for a modified green-fluorescent protein |
US5777079A (en) | 1994-11-10 | 1998-07-07 | The Regents Of The University Of California | Modified green fluorescent proteins |
WO1996033735A1 (fr) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Anticorps humains derives d'une xenosouris immunisee |
US5874304A (en) | 1996-01-18 | 1999-02-23 | University Of Florida Research Foundation, Inc. | Humanized green fluorescent protein genes and methods |
US5804387A (en) | 1996-02-01 | 1998-09-08 | The Board Of Trustees Of The Leland Stanford Junior University | FACS-optimized mutants of the green fluorescent protein (GFP) |
US5876995A (en) | 1996-02-06 | 1999-03-02 | Bryan; Bruce | Bioluminescent novelty items |
US5925558A (en) | 1996-07-16 | 1999-07-20 | The Regents Of The University Of California | Assays for protein kinases using fluorescent protein substrates |
WO1998014605A1 (fr) | 1996-10-04 | 1998-04-09 | Loma Linda University | Luciferase renilla et genes de fusion de proteines fluorescentes vertes |
WO1998024893A2 (fr) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | MAMMIFERES TRANSGENIQUES POSSEDANT DES LOCI DE GENES D'IMMUNOGLOBULINE D'ORIGINE HUMAINE, DOTES DE REGIONS VH ET Vλ, ET ANTICORPS PRODUITS A PARTIR DE TELS MAMMIFERES |
WO1998026277A2 (fr) | 1996-12-12 | 1998-06-18 | Prolume, Ltd. | Appareil permettant de detecter et d'identifier des agents infectieux et procede correspondant |
US6270964B1 (en) | 1997-01-31 | 2001-08-07 | Odyssey Pharmaceuticals Inc. | Protein fragment complementation assays for the detection of biological or drug interactions |
WO1999010494A2 (fr) | 1997-08-25 | 1999-03-04 | Genentech, Inc. | Anticorps agonistes envers le recepteur de thrombopoietine, et utilisation therapeutique de ces anticorps |
US6846634B1 (en) | 1997-10-20 | 2005-01-25 | Domantis Limited | Method to screen phage display libraries with different ligands |
US20050202512A1 (en) | 1997-10-20 | 2005-09-15 | Domantis Limited | Method to screen phage display libraries with different ligands |
US6696245B2 (en) | 1997-10-20 | 2004-02-24 | Domantis Limited | Methods for selecting functional polypeptides |
US20040038291A2 (en) | 1997-10-20 | 2004-02-26 | Domantis Limited | Method to screen phage display libraries with different ligands |
WO1999049019A2 (fr) | 1998-03-27 | 1999-09-30 | Prolume, Ltd. | Luciferases, proteines fluorescentes, acides nucleiques codant pour les luciferases et les proteines fluorescentes, et leur utilisation dans des diagnostics, des criblages a haut rendement et des articles nouveaux |
WO2000009560A2 (fr) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Production de molecules modifiees avec demi-vie serique prolongee |
WO2000076310A1 (fr) | 1999-06-10 | 2000-12-21 | Abgenix, Inc. | Animaux transgeniques servant a produire des isotypes specifiques d'anticorps humains via des regions de transition non parentes |
US20030039958A1 (en) | 1999-12-03 | 2003-02-27 | Domantis Limited | Direct screening method |
US20040009507A1 (en) | 2000-10-13 | 2004-01-15 | Domantis, Ltd. | Concatenated nucleic acid sequence |
US20040202995A1 (en) | 2003-04-09 | 2004-10-14 | Domantis | Nucleic acids, proteins, and screening methods |
WO2005037235A2 (fr) * | 2003-10-16 | 2005-04-28 | Imclone Systems Incorporated | Inhibiteurs du recepteur 1 du facteur de croissance du fibroblaste et methodes therapeutiques associees |
US20070299007A1 (en) * | 2004-09-02 | 2007-12-27 | Eli Lilly And Company | Muteins OF Fibroblast Growth Factor 21 |
US20070293430A1 (en) * | 2004-12-14 | 2007-12-20 | Frye Christopher C | Muteins of Fibroblast Growth Factor 21 |
US9401875B2 (en) | 2012-06-01 | 2016-07-26 | Nippon Telegraph And Telephone Corporation | Packet transfer processing method and packet transfer processing device |
US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
Non-Patent Citations (169)
Title |
---|
"Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS |
"Biocomputing Informatics and Genome Projects", 1993, NEW YORK: ACADEMIC PRESS |
"Computational Molecular Biology", 1988, NEW YORK: OXFORD UNIVERSITY PRESS |
"Computer Analysis of Sequence Data, Part I", 1994, NEW JERSEY: HUMANA PRESS |
"Current Protocols In Immunology", 1993, JOHN WILEY & SONS |
"Fundamental Immunology", 1989, RAVEN PRESS |
"Immunology-A Synthesis", 1991, SINAUER ASSOCIATES |
"Introduction to Protein Structure", 1991, NEW YORK: GARLAND PUBLISHING |
"Kabat Sequences of Proteins of Immunological Interest", 1987, NIH |
"Methods Enzymol.", vol. 185, 1990, NEW YORK: ACADEMIC PRESS |
"Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses", 1980, PLENUM PRESS |
"Proteins, Structures and Molecular Principles", 1984, W. H. NEW YORK: FREEMAN AND COMPANY |
"Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING COMPANY |
"Sequence Analysis Primer", 1991, NEW YORK: M. STOCKTON PRESS |
ADAMES ET AL., NATURE, vol. 318, 1985, pages 533 - 538 |
ALEXANDER ET AL., MOL. CELL. BIOL., vol. 7, 1987, pages 1436 - 1444 |
ANONYMOUS: "Monoclonal Anti-human/mouse Klotho beta Antibody", 6 February 2007 (2007-02-06), pages 1 - 1, XP002624719, Retrieved from the Internet <URL:http://www.rndsystems.com/pdf/MAB3738.pdf> [retrieved on 20110221] * |
APLIN; WRISTON, CRC CRIT. REV. BIOCHEM., 1981, pages 259 - 306 |
ASHKENAZI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 10535 |
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1992, GREENE PUBLISHING ASSOCIATES |
BAUM ET AL., EMBO J., vol. 13, 1994, pages 3992 - 4001 |
BEENKEN ANDREW ET AL: "The FGF family: biology, pathophysiology and therapy.", NATURE REVIEWS. DRUG DISCOVERY MAR 2009 LNKD- PUBMED:19247306, vol. 8, no. 3, March 2009 (2009-03-01), pages 235 - 253, XP002624720, ISSN: 1474-1784 * |
BENOIST; CHAMBON, NATURE, vol. 290, 1981, pages 304 - 310 |
BIANCHI; MCGREW, BIOTECH. BIOTECHNOL. BIOENG., vol. 84, 2003, pages 439 - 44 |
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 26 |
BIRD, SCIENCE, vol. 242, 1988, pages 423 |
BLOOM ET AL., PROTEIN SCIENCE, vol. 6, 1997, pages 407 |
BOWIE ET AL., SCIENCE, vol. 253, 1991, pages 164 - 170 |
BRENNER ET AL., CURR. OP. STRUCT. BIOL., vol. 7, 1997, pages 369 - 376 |
BRUGGERMANN ET AL., YEAR IN IMMUNOL., vol. 7, 1993, pages 33 |
BYRN ET AL., NATURE, vol. 344, 1990, pages 677 |
CARILLO ET AL., SIAMJ. APPLIED MATH., vol. 48, 1988, pages 1073 |
CHALFIE ET AL., SCIENCE, vol. 263, 1994, pages 802 - 805 |
CHEN ET AL., INTERNATIONAL IMMUNOLOGY, vol. 5, 1993, pages 647 - 656 |
CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546 - 552 |
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 - 883 |
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883 |
CHOTHIA; LESK, J. MOL. BIOL, vol. 196, 1987, pages 901 - 917 |
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
CHOU ET AL., ADV. ENZYMOL. RELAT. AREAS MOL. BIOL., vol. 47, 1978, pages 45 - 148 |
CHOU ET AL., ANN. REV. BIOCHEM., vol. 47, 1979, pages 251 - 276 |
CHOU ET AL., BIOCHEM., vol. 13, 1974, pages 222 - 245 |
CHOU ET AL., BIOCHEMISTRY, vol. 113, 1974, pages 211 - 222 |
CHOU ET AL., BIOPHYS. J., vol. 26, 1979, pages 367 - 384 |
CHU ET AL., GENE, vol. 13, 1981, pages 197 |
COSMAN ET AL., NATURE, vol. 312, 1984, pages 768 |
DAVIS ET AL.: "Basic Methods in Molecular Biology", 1986, ELSEVIER |
DAYHOFF ET AL., ATLAS OF PROTEIN SEQUENCE AND STRUCTURE, vol. 5, 1978, pages 345 - 352 |
DE GRAAF ET AL., METHODS MOL BIOL, vol. 178, 2002, pages 379 - 387 |
DEBOER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 80, 1983, pages 21 - 25 |
DEVEREUX ET AL., NUCL. ACID RES., vol. 12, 1984, pages 387 |
DUSKIN ET AL., J. BIOL. CHEM., vol. 257, 1982, pages 3105 |
EDGE ET AL., ANAL. BIOCHEM., vol. 118, 1981, pages 131 |
EPPSTEIN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 82, 1985, pages 3688 - 3692 |
EVANS ET AL., J. MED. CHEM., vol. 30, 1987, pages 1229 |
FANSLOW ET AL., SEMIN. IMMUNOL., vol. 6, 1994, pages 267 - 278 |
FAUCHERE, ADV. DRUG RES., vol. 15, 1986, pages 29 |
FISHWILD ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851 |
GENETICS COMPUTER GROUP |
GRAHAM ET AL., VIROLOGY, vol. 52, 1973, pages 456 |
GRIBSKOV ET AL., METH. ENZYM., vol. 183, 1990, pages 146 - 159 |
GRIBSKOV ET AL., PROC. NAT. ACAD. SCI., vol. 84, 1987, pages 4355 - 4358 |
GROSSCHEDL ET AL., CELL, vol. 38, 1984, pages 647 - 658 |
HAKIMUDDIN ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 259, 1987, pages 52 |
HAMMER ET AL., SCIENCE, vol. 253, 1987, pages 53 - 58 |
HANAHAN, NATURE, vol. 315, 1985, pages 115 - 122 |
HARDING; LONBERG, ANN. N.Y ACAD. SCI., vol. 764, 1995, pages 536 - 546 |
HARDING; LONBERG, ANN. N.YACAD. SCI., vol. 764, 1995, pages 536 - 546 |
HARLOW; LANE: "Antibodies, A Laboratory Manual", 1988, COLD SPRING HARBOR PRESS |
HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR |
HARLOW; LANE: "Antibodies: A Laboratory Manual", 1990, COLD SPRING HARBOR LABORATORY PRESS |
HEIM ET AL., CURR. BIOL., vol. 6, 1996, pages 178 - 182 |
HENIKOFF ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 89, 1992, pages 10915 - 10919 |
HOLLENBAUGH ET AL.: "Construction of Immunoglobulin Fusion Proteins", CURRENT PROTOCOLS IN IMMUNOLOGY, vol. 4, 1992, pages 10.19.1 - 10.19.11 |
HOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 48 |
HOLM ET AL., NUCL. ACID. RES., vol. 27, 1999, pages 244 - 247 |
HONEGGER; PLUCKTHUN, J. MOL. BIOL., vol. 309, 2001, pages 657 - 670 |
HOOGENBOOM ET AL., J. MOL. BIOL., vol. 227, 1991, pages 381 |
HOPP ET AL., BIO/TECHNOLOGY, vol. 2, 1988, pages 1204 |
HOPPE ET AL., FEBS LETTERS, vol. 344, 1994, pages 191 |
HUSTON ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 5879 |
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 83 |
ICHIKI ET AL., J. IMMUNOL., vol. 150, 1993, pages 5408 - 5417 |
INVEST. OPHTHALMOL VIS SCI, vol. 43, 2002, pages 3292 - 3298 |
ITOH ET AL., TREND GENET., vol. 20, 2004, pages 563 - 69 |
JAKOBOVITS ET AL., NATURE, vol. 362, 1993, pages 255 - 258 |
JAKOBOVITS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2551 - 2555 |
JALKANEN ET AL., J. CELL BIOL., vol. 105, 1987, pages 3087 - 3096 |
JALKANEN ET AL., J. CELL. BIOL., vol. 101, 1985, pages 976 - 985 |
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
JONES, CURR. OPIN. STRUCT. BIOL., vol. 7, 1997, pages 377 - 387 |
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PHS, NIH, NIH PUBLICATION |
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE N.I.H. |
KEARNEY ET AL., J. IMMUNOL., vol. 123, 1979, pages 1548 - 1550 |
KELSEY ET AL., GENES AND DEVEL., vol. 1, 1987, pages 161 - 171 |
KHARITONENKOV ALEXEI ET AL: "THE METABOLIC STATE OF DIABETIC MONKEYS IS REGULATED BY FIBROBLAST GROWTH FACTOR-21", ENDOCRINOLOGY SOCIETY, BALTIMORE, MD, US, vol. 148, no. 2, 1 February 2007 (2007-02-01), pages 774 - 781, XP009078947, ISSN: 0013-7227, DOI: DOI:10.1210/EN.2006-1168 * |
KHARITONENKOV ET AL., BIODRUGS, vol. 22, 2008, pages 37 - 44 |
KHARITONENKOV ET AL., J. CELL PHYSIOL., vol. 215, 2008, pages 1 - 7 |
KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614 - 3619 |
KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 |
KOLLIAS ET AL., CELL, vol. 46, 1986, pages 89 - 94 |
KORNDORFER ET AL., PROTEINS: STRUCTURE, FUNCTION, AND BIOINFORMATICS, vol. 53, no. 1, 2003, pages 121 - 129 |
KORTT ET AL., BIOMOL. ENG., vol. 18, 2001, pages 95 - 108 |
KORTT ET AL., PROT. ENG., vol. 10, 1997, pages 423 |
KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553 |
KRIANGKUM ET AL., BIOMOL. ENG., vol. 18, 2001, pages 31 - 40 |
KRUMLAUF ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 1639 - 1648 |
KURO-O ET AL: "Endocrine FGFs and Klothos: emerging concepts", TRENDS IN ENDOCRINOLOGY AND METABOLISM, ELSEVIER SCIENCE PUBLISHING, NEW YORK, NY, US, vol. 19, no. 7, 1 September 2008 (2008-09-01), pages 239 - 245, XP023980904, ISSN: 1043-2760, [retrieved on 20080807], DOI: DOI:10.1016/J.TEM.2008.06.002 * |
KUROSU ET AL., J. BIOL. CHEM., vol. 282, 2007, pages 26687 - 26695 |
KYTE ET AL., J. MOL. BIOL., vol. 157, 1982, pages 105 - 131 |
LANDSCHULZ ET AL., SCIENCE, vol. 240, 1988, pages 1759 |
LANGER ET AL., J. BIOMED. MATER. RES., vol. 15, 1981, pages 167 - 277 |
LANGER, CHEM. TECH., vol. 12, 1982, pages 98 - 105 |
LANTTO ET AL., METHODS MOL. BIOL., vol. 178, 2002, pages 303 - 316 |
LEDER ET AL., CELL, vol. 45, 1986, pages 485 - 495 |
LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859 |
LONBERG: "Handbook of Exp. Pharmacology", vol. 113, 1994, pages: 49 - 101 |
LONBERG; HUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93 |
MACDONALD, HEPATOLOGY, vol. 2, 1987, pages 425 - 515 |
MARKS ET AL., BIOTECHNOLOGY, vol. 10, 1992, pages 779 |
MARKS ET AL., J. MOL. BIOL, vol. 222, 1991, pages 581 |
MASON ET AL., SCIENCE, vol. 234, 1986, pages 1372 - 1378 |
MENDEZ ET AL., NATURE GENETICS, vol. 15, 1997, pages 146 - 156 |
MOGRAM ET AL., NATURE, vol. 315, 1985, pages 338 - 340 |
MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77 - 82 |
MOREL ET AL., MOLEC. IMMUNOL., vol. 25, 1988, pages 7 - 15 |
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1985, pages 6851 - 6855 |
MOULT, CURR. OP. IN BIOTECH., vol. 7, 1996, pages 422 - 427 |
NANEVICZ ET AL., J. BIOL. CHEM., vol. 270, no. 37, 1995, pages 21619 - 21625 |
NEEDLEMAN ET AL., J. MOL. BIOL, vol. 48, 1970, pages 443 - 453 |
NOLAN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 2603 - 2607 |
OGAWA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 104, 2007, pages 7432 - 7437 |
ORNITZ ET AL., COLD SPRING HARBOR SYMP. QUANT. BIOL., vol. 50, 1986, pages 399 - 409 |
PINKERT ET AL., GENES AND DEVEL., vol. 1, 1987, pages 268 - 276 |
POLJAK ET AL., STRUCTURE, vol. 2, 1994, pages 1121 - 23 |
PRINSTER ET AL., NATURE, vol. 296, 1982, pages 39 - 42 |
PROC. NATL. ACAD. SCIENCES USA, vol. 103, 2006, pages 3896 - 3901 |
READHEAD ET AL., CELL, vol. 48, 1987, pages 703 - 712 |
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 27 |
RIZO; GIERASCH, ANN. REV. BIOCHEM., vol. 61, 1992, pages 387 |
ROQUE ET AL., BIOTECHNOL. PROG., vol. 20, 2004, pages 639 - 654 |
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 2001 |
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS |
SANI, NATURE, vol. 314, 1985, pages 283 - 286 |
SIDMAN ET AL., BIOPOLYMERS, vol. 2, 1983, pages 547 - 556 |
SIPPL ET AL., STRUCTURE, vol. 4, 1996, pages 15 - 19 |
SONGSIVILAI; LACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321 |
STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 2, 1983, pages 242 - 253 |
STAUBER, BIOTECHNIQUES, vol. 24, 1998, pages 462 - 471 |
SUZUKI MASASHI ET AL: "betaKlotho is required for fibroblast growth factor (FGF) 21 signaling through FGF receptor (FGFR) 1c and FGFR3c.", MOLECULAR ENDOCRINOLOGY (BALTIMORE, MD.) APR 2008 LNKD- PUBMED:18187602, vol. 22, no. 4, April 2008 (2008-04-01), pages 1006 - 1014, XP002624718, ISSN: 0888-8809 * |
SWIFT ET AL., CELL, vol. 38, 1984, pages 639 - 646 |
TAYLOR ET AL., INTERNATIONAL IMMUNOLOGY, vol. 6, 1994, pages 579 - 591 |
TAYLOR ET AL., NUCLEIC ACIDS RESEARCH, vol. 20, 1992, pages 6287 - 6295 |
THORNSEN ET AL., PROC. NATL. ACAD. U.S.A., vol. 81, 1984, pages 659 - 663 |
THORNTON ET AL., NATURE, vol. 354, 1991, pages 105 |
THOTAKURA ET AL., METH. ENZYMOL., vol. 138, 1987, pages 350 |
TIJSSEN: "Practice and Theory of Enzyme Immunoassays", vol. 15, 1993, ELSEVIER |
TUAILLON ET AL., J. IMMUNOL., vol. 152, 1994, pages 2912 - 2920 |
VEBER; FREIDINGER, TINS, 1985, pages 392 |
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
VILLA-KAMAROFF ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 75, 1978, pages 3727 - 3731 |
VON HEINJE, G.: "Sequence Analysis in Molecular Biology", 1987, NEW YORK: ACADEMIC PRESS |
WAGNER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 78, 1981, pages 1444 - 1445 |
WARD ET AL., NATURE, vol. 334, 1989, pages 544 |
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
XU JING ET AL: "Fibroblast Growth Factor 21 Reverses Hepatic Steatosis, Increases Energy Expenditure, and Improves Insulin Sensitivity in Diet-Induced Obese Mice", DIABETES, AMERICAN DIABETES ASSOCIATION, US, vol. 58, no. 1, 1 January 2009 (2009-01-01), pages 250 - 259, XP009144078, ISSN: 0012-1797 * |
YAMAMOTO ET AL., CELL, vol. 22, 1980, pages 787 - 797 |
ZOLA: "Monoclonal Antibodies: A Manual of Techniques", 1987, CRC PRESS, INC., pages: 147 - 158 |
ZUPNICK ET AL., J. BIOL. CHEM., vol. 281, no. 29, 2006, pages 20464 - 20473 |
Cited By (82)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11840558B2 (en) | 2008-06-04 | 2023-12-12 | Amgen Inc. | Methods of treating non-alcoholic steatohepatitis using FGF21 mutants |
US11072640B2 (en) | 2008-06-04 | 2021-07-27 | Amgen Inc. | Methods of treating non-alcoholic steatohepatitis using FGF21 mutants |
US9284378B2 (en) | 2009-12-07 | 2016-03-15 | Shaw-Fen Sylvia Hu | Human antigen binding proteins that bind β-Klotho, FGF receptors and complexes thereof |
US10570205B2 (en) | 2009-12-07 | 2020-02-25 | Amgen, Inc. | Human antigen binding proteins that bind β-Klotho, FGF receptors and complexes thereof |
US9493577B2 (en) | 2009-12-07 | 2016-11-15 | Amgen Inc. | Human antigen binding proteins that bind β-klotho, FGF receptors and complexes thereof |
US9845359B2 (en) | 2011-05-16 | 2017-12-19 | Genentech, Inc. | FGFR1 agonists and methods of use |
US9085626B2 (en) | 2011-05-16 | 2015-07-21 | Genentech, Inc. | FGFR1 agonists and methods of use |
WO2012170438A3 (fr) * | 2011-06-06 | 2013-04-11 | Amgen Inc. | Protéines de liaison à un antigène humain qui se lient à un complexe comprenant bêta-klotho et un récepteur de fgf |
EP3447074A3 (fr) * | 2011-06-06 | 2019-08-28 | Amgen, Inc | Protéines de liaison à un antigène humain qui se lient à un complexe comprenant bêta-klotho et un récepteur de fgf |
US11248052B2 (en) | 2011-06-06 | 2022-02-15 | Amgen Inc. | Antigen binding proteins that bind to a complex comprising β-Klotho and an FGF receptor |
US9574002B2 (en) | 2011-06-06 | 2017-02-21 | Amgen Inc. | Human antigen binding proteins that bind to a complex comprising β-Klotho and an FGF receptor |
US9089525B1 (en) | 2011-07-01 | 2015-07-28 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject |
US10413590B2 (en) | 2011-07-01 | 2019-09-17 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants of FGF19 polypeptides for reducing body mass in a subject |
US9670260B2 (en) | 2011-07-01 | 2017-06-06 | Ngm Biopharmaceuticals, Inc. | Compositions comprising fusion variants of FGF19 polypeptides |
US9751924B2 (en) | 2011-07-01 | 2017-09-05 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising fusion variants of FGF19 polypeptides for reducing glucose levels in a subject |
US9580483B2 (en) | 2011-07-01 | 2017-02-28 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of diabetes |
US11065302B2 (en) | 2011-07-01 | 2021-07-20 | Ngm Biopharmaceuticals, Inc. | Compositions comprising fusion variants of FGF19 polypeptides |
WO2013033452A2 (fr) | 2011-08-31 | 2013-03-07 | Amgen Inc. | Procédé de traitement ou d'amélioration du diabète type i employant fgf21 |
US9963494B2 (en) | 2012-11-28 | 2018-05-08 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject |
US9290557B2 (en) | 2012-11-28 | 2016-03-22 | Ngm Biopharmaceuticals, Inc. | Compositions comprising variants and fusions of FGF19 polypeptides |
US11066454B2 (en) | 2012-11-28 | 2021-07-20 | Ngm Biopharmaceuticals, Inc. | Compositions comprising variants and fusions of FGF19 polypeptides |
US10758590B2 (en) | 2012-11-28 | 2020-09-01 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF 19 polypeptides for treating diabetes |
US9878009B2 (en) | 2012-12-27 | 2018-01-30 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having error of bile acid synthesis |
US9878008B2 (en) | 2012-12-27 | 2018-01-30 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having bile acid diarrhea or bile acid malabsorption |
US9925242B2 (en) | 2012-12-27 | 2018-03-27 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of nonalcoholic steatohepatitis |
US9895416B2 (en) | 2012-12-27 | 2018-02-20 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having cholestasis |
US9974833B2 (en) | 2012-12-27 | 2018-05-22 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having pregnancy intrahepatic cholestasis |
US11103554B2 (en) | 2012-12-27 | 2021-08-31 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants of FGF19 polypeptides for reducing bile acid synthesis in a subject having cirrhosis |
US9889177B2 (en) | 2012-12-27 | 2018-02-13 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having primary sclerosing cholangitis |
US11564972B2 (en) | 2012-12-27 | 2023-01-31 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants of FGF19 polypeptides for treating primary biliary cirrhosis in a subject |
US9889178B2 (en) | 2012-12-27 | 2018-02-13 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having nonalcoholic steatohepatitis |
US9273107B2 (en) | 2012-12-27 | 2016-03-01 | Ngm Biopharmaceuticals, Inc. | Uses and methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
US10369199B2 (en) | 2013-10-28 | 2019-08-06 | Ngm Biopharmaceuticals, Inc. | Methods of using variants of FGF19 polypeptides for the treatment of cancer |
WO2015100366A1 (fr) * | 2013-12-23 | 2015-07-02 | Genentech, Inc. | Anticorps et leurs procédés d'utilisation |
US9873748B2 (en) | 2013-12-23 | 2018-01-23 | Genentech, Inc. | Bispecific antibodies binding to beta-klotho and fibroblast growth factor receptor 1 |
US10882921B2 (en) | 2013-12-23 | 2021-01-05 | Genentech, Inc. | Host cell comprising nucleic acids encoding bispecific antibodies binding to beta-klotho and fibroblast growth factor receptor 1 and antibody production |
US10246518B2 (en) | 2013-12-23 | 2019-04-02 | Genentech, Inc. | Nucleic acids encoding bispecific antibodies binding to beta-Klotho and fibroblast growth factor receptor 1 |
AU2014369872B2 (en) * | 2013-12-23 | 2019-03-14 | Genentech, Inc. | Antibodies and methods of use |
IL277633A (en) * | 2013-12-23 | 2020-11-30 | Genentech Inc | Antibodies and methods of use |
KR20160102030A (ko) * | 2013-12-23 | 2016-08-26 | 제넨테크, 인크. | 항체 및 사용 방법 |
AU2019204128B2 (en) * | 2013-12-23 | 2021-05-13 | Genentech, Inc. | Antibodies and methods of use |
EP4219555A1 (fr) | 2013-12-23 | 2023-08-02 | F. Hoffmann-La Roche AG | Anticorps et procédés d'utilisation |
US9884919B2 (en) | 2013-12-23 | 2018-02-06 | Genentech, Inc. | Methods of treatment with bispecific antibodies binding to beta-klotho and fibroblast growth factor receptor 1 |
EA036107B1 (ru) * | 2013-12-23 | 2020-09-29 | Дженентек Инк. | Антитела и способы их применения |
KR102329693B1 (ko) | 2013-12-23 | 2021-11-23 | 제넨테크, 인크. | 항체 및 사용 방법 |
US11596676B2 (en) | 2014-01-24 | 2023-03-07 | Ngm Biopharmaceuticals, Inc. | Methods of treating nonalcoholic steatohepatitis comprising administering an anti-human beta klotho antibody or binding fragment thereof |
US10744191B2 (en) | 2014-01-24 | 2020-08-18 | Ngm Biopharmaceuticals, Inc. | Beta klotho-binding proteins and methods of use thereof |
RU2701434C2 (ru) * | 2014-01-24 | 2019-09-26 | Нгм Биофармасьютикалс, Инк. | Связывающие белки и способы их применения |
US10093735B2 (en) | 2014-01-24 | 2018-10-09 | Ngm Biopharmaceuticals, Inc. | Beta-klotho binding proteins |
US11963999B2 (en) | 2014-03-11 | 2024-04-23 | Novartis Ag | Methods of treating HIV-HAART induced partial lipodystrophy with FGF21 protein variant FC fusion proteins |
US10519240B2 (en) | 2014-03-25 | 2019-12-31 | Regeneron Pharmaceuticals, Inc. | Anti-FGFR1c antibody-FGF21 fusion proteins |
US10398758B2 (en) | 2014-05-28 | 2019-09-03 | Ngm Biopharmaceuticals, Inc. | Compositions comprising variants of FGF19 polypeptides and uses thereof for the treatment of hyperglycemic conditions |
US11241481B2 (en) | 2014-06-16 | 2022-02-08 | Ngm Biopharmaceuticals, Inc. | Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
US10456449B2 (en) | 2014-06-16 | 2019-10-29 | Ngm Biopharmaceuticals, Inc. | Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
US10517929B2 (en) | 2014-10-23 | 2019-12-31 | Ngm Biopharmaceuticals, Inc. | Pharmaceutical compositions comprising FGF19 variants |
US10434144B2 (en) | 2014-11-07 | 2019-10-08 | Ngm Biopharmaceuticals, Inc. | Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders |
US11141460B2 (en) | 2014-11-07 | 2021-10-12 | Ngm Biopharmaceuticals, Inc. | Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders |
US10800843B2 (en) | 2015-07-29 | 2020-10-13 | Ngm Biopharmaceuticals, Inc. | Beta klotho-binding proteins |
US11667708B2 (en) | 2015-07-29 | 2023-06-06 | Ngm Biopharmaceuticals, Inc. | Anti-human beta klotho antibody or binding fragment thereof and methods of their use |
US11236159B2 (en) | 2015-08-03 | 2022-02-01 | Novartis Ag | Methods of treating FGF21-associated disorders |
US11802152B2 (en) | 2015-08-03 | 2023-10-31 | Novartis Ag | Methods of treating FGF21-associated disorders |
WO2017079768A1 (fr) | 2015-11-08 | 2017-05-11 | Genentech, Inc. | Procédés de criblage d'anticorps multispécifiques |
US10744185B2 (en) | 2015-11-09 | 2020-08-18 | Ngm Biopharmaceuticals, Inc. | Methods of using variants of FGF19 polypeptides for the treatment of pruritus |
US10947299B2 (en) | 2016-03-23 | 2021-03-16 | Seoul National University R&Db Foundation | Antibody that binds to envelope glycoprotein of severe fever with thrombocytopenia syndrome virus and use for same |
EP3434690A4 (fr) * | 2016-03-23 | 2020-04-01 | Seoul National University R&DB Foundation | Anticorps qui se lie à la protéine d'enveloppe du virus du syndrome de fièvre sévère avec thrombocytopénie, et son utilisation |
US11123438B2 (en) | 2016-08-19 | 2021-09-21 | Ampsource Biopharma Shanghai Inc. | Linker peptide for constructing fusion protein |
WO2018032785A1 (fr) | 2016-08-19 | 2018-02-22 | 安源医药科技(上海)有限公司 | Protéine de fusion du facteur 21 de croissance des fibroblastes humains (hfgf21), son procédé de préparation et son utilisation |
US11833212B2 (en) | 2016-08-19 | 2023-12-05 | Ampsource Biopharma Shanghai Inc. | Linker peptide for constructing fusion protein |
US11472863B2 (en) | 2016-08-19 | 2022-10-18 | Ampsource Biopharma Shanghai Inc. | Human coagulation factor IX (FIX) fusion protein, preparation method therefor, and use thereof |
US11471513B2 (en) | 2016-08-19 | 2022-10-18 | Ampsource Biopharma Shanghai Inc. | Highly glycosylated human blood-clotting factor VIII fusion protein, and manufacturing method and application of same |
US11370841B2 (en) | 2016-08-26 | 2022-06-28 | Ngm Biopharmaceuticals, Inc. | Methods of treating fibroblast growth factor 19-mediated cancers and tumors |
KR20190115471A (ko) * | 2017-02-08 | 2019-10-11 | 노파르티스 아게 | Fgf21 모방 항체 및 이의 용도 |
AU2018218557B9 (en) * | 2017-02-08 | 2021-06-24 | Novartis Ag | FGF21 mimetic antibodies and uses thereof |
US11692046B2 (en) | 2017-02-08 | 2023-07-04 | Novartis Ag | FGF21 mimetic antibodies and uses thereof |
CN110520443B (zh) * | 2017-02-08 | 2023-07-25 | 诺华股份有限公司 | Fgf21模拟抗体及其用途 |
WO2018146594A1 (fr) * | 2017-02-08 | 2018-08-16 | Novartis Ag | Anticorps mimétiques du fgf21 et leurs utilisations |
KR102572663B1 (ko) | 2017-02-08 | 2023-09-01 | 노파르티스 아게 | Fgf21 모방 항체 및 이의 용도 |
CN110520443A (zh) * | 2017-02-08 | 2019-11-29 | 诺华股份有限公司 | Fgf21模拟抗体及其用途 |
US10899844B2 (en) | 2017-02-08 | 2021-01-26 | Novartis Ag | FGF21 mimetic antibodies and uses thereof |
AU2018218557B2 (en) * | 2017-02-08 | 2021-05-27 | Novartis Ag | FGF21 mimetic antibodies and uses thereof |
US11981718B2 (en) | 2020-05-27 | 2024-05-14 | Ampsource Biopharma Shanghai Inc. | Dual-function protein for lipid and blood glucose regulation |
WO2022003169A1 (fr) | 2020-07-02 | 2022-01-06 | Sanofi | Protéines agonistes de liaison à l'antigène ciblant fgfr1/klb et leurs conjugués avec des peptides agonistes de glp-1 r |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20200216546A1 (en) | Human Antigen Binding Proteins That Bind Beta-Klotho, FGF Receptors and Complexes Thereof | |
US11248052B2 (en) | Antigen binding proteins that bind to a complex comprising β-Klotho and an FGF receptor | |
US9517264B2 (en) | Human FGF receptor and β-Klotho binding proteins | |
AU2017200115B2 (en) | Human antigen binding proteins that bind beta-Klotho, FGF receptors and complexes thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
WWE | Wipo information: entry into national phase |
Ref document number: 201080063309.5 Country of ref document: CN |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10788204 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 220048 Country of ref document: IL |
|
ENP | Entry into the national phase |
Ref document number: 2782420 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 12012501101 Country of ref document: PH |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2010328444 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: /P/2012/00011 Country of ref document: BW Ref document number: 2012543173 Country of ref document: JP Ref document number: 000781-2012 Country of ref document: PE Ref document number: MX/A/2012/006467 Country of ref document: MX |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2012001504 Country of ref document: CL Ref document number: 1201002601 Country of ref document: TH |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 12097413 Country of ref document: CO |
|
WWE | Wipo information: entry into national phase |
Ref document number: 201270634 Country of ref document: EA |
|
ENP | Entry into the national phase |
Ref document number: 2010328444 Country of ref document: AU Date of ref document: 20101203 Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 5965/DELNP/2012 Country of ref document: IN |
|
REEP | Request for entry into the european phase |
Ref document number: 2010788204 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2010788204 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref document number: 20127017717 Country of ref document: KR Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: A201208326 Country of ref document: UA Ref document number: CR2012-000366 Country of ref document: CR |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112012013876 Country of ref document: BR |
|
WWE | Wipo information: entry into national phase |
Ref document number: IDP00201604339 Country of ref document: ID |
|
ENP | Entry into the national phase |
Ref document number: 112012013876 Country of ref document: BR Kind code of ref document: A2 Effective date: 20120608 |
|
WWE | Wipo information: entry into national phase |
Ref document number: CR2018-000020 Country of ref document: CR |