WO2005077042A2 - Albumin fusion proteins - Google Patents
Albumin fusion proteins Download PDFInfo
- Publication number
- WO2005077042A2 WO2005077042A2 PCT/US2005/004041 US2005004041W WO2005077042A2 WO 2005077042 A2 WO2005077042 A2 WO 2005077042A2 US 2005004041 W US2005004041 W US 2005004041W WO 2005077042 A2 WO2005077042 A2 WO 2005077042A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- fragment
- albumin
- protein
- therapeutic protein
- albumin fusion
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/76—Albumins
- C07K14/765—Serum albumin, e.g. HSA
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/76—Albumins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/35—Fusion polypeptide containing a fusion for enhanced stability/folding during expression, e.g. fusions with chaperones or thioredoxin
Definitions
- the invention relates generally to Therapeutic proteins (including, but not limited to, at least one polypeptide, antibody, peptide, or fragment and variant thereof) fused to albumin or fragments or variants of albumin
- the invention encompasses polynucleotides encoding therapeutic albumin fusion proteins, therapeutic albumin fusion proteins, compositions, pharmaceutical compositions, formulations and kits
- Host cells transformed with the polynucleotides encoding therapeutic albumin fusion proteins are also encompassed by the invention, as are methods of making the albumin fusion proteins of the invention using these polynucleotides, and/or host cells
- HSA Human serum albumin
- SEQ ID NO 1 Human serum albumin
- the present invention encompasses albumin fusion proteins comprising a Therapeutic protein (e g , a polypeptide, antibody, or peptide, or fragment or variant thereof) fused to albumin or a fragment (portion) or variant of albumin
- the present invention also encompasses polynucleotides comprising, or alternatively consisting of, nucleic acid molecules encoding a Therapeutic protein (e g , a polypeptide, antibody, or peptide, or fragment or variant thereof) fused to albumin or a fragment (portion) or variant of albumin
- the present invention also encompasses polynucleotides, comprising, or alternatively consisting of, nucleic acid molecules encoding proteins comprising a Therapeutic protein (e g , a polypeptide, antibody, or peptide, or fragment or variant thereof) fused to albumin or a fragment (portion) or variant of albumin, that is sufficient to prolong the shelf life of the Therapeutic protein, to increase the plasma stability of the Therapeutic protein compared to its unfused state
- the present invention encompasses methods of preventing, treating, or ameliorating a disease or disorder
- the present invention encompasses a method of treating a disease or disorder listed in the "Preferred Indication Y" column of Table 1 comprising administering to a patient in which such treatment, prevention or amelioration is desired an albumin fusion protein of the invention that comprises a Therapeutic protein or portion corresponding to a Therapeutic protein (or fragment or vanant thereof) disclosed in the
- Therapeutic Protein X column of Table 1 (in the same row as the disease or disorder to be treated as listed in the "Preferred Indication Y” column of Table 1) in an amount effective to treat, prevent or ameliorate the disease or disorder
- an albumin fusion protein described in Table 1 or 2 has extended shelf life
- an albumin fusion protein described in Table 1 or 2 is more stable than the corresponding unfused Therapeutic molecule described in Table 1
- the present invention further includes transgenic organisms modified to contain the nucleic acid molecules of the invention (including, but not limited to, the polynucleotides descnbed in Tables 1 and 2), preferably modified to express an albumin fusion protein ofthe invention
- Figure 1A-D shows the amino acid sequence of the mature form of human albumin (SEQ ID NO 1) and a polynucleotide encoding it (SEQ ID NO 2) Nucleotides 1 to 1755 of SEQ ID NO 2 encode the mature form of human albumin (SEQ ID NO 1)
- Figure 2 shows the restriction map ofthe pPPC0005 cloning vector ATCC deposit PTA-3278
- Figure 3 shows the restriction map ofthe pSAC35 yeast S cerevisiae expression vector (Sleep et al , BioTechnology 8 42 (1990))
- Figure 4 shows the effect of various dilutions of IFNb albumin fusion proteins encoded by DNA compnsed in CID 2011 and 2053 on SEAP activity in the ISRE-SEAP/293F reporter cells (see Example 76) Proteins were senally diluted from 5e-7 to le-14 g/ml in DMEM 10% FBS and used to treat ISRE-SEAP/293F reporter cells After 24 hours supematants were removed from reporter cells and assayed for SEAP activity IFNb albumin fusion protein was punfied from three stable clones 293F/#201 1 , CHO/#2011 and NSO/#2053 Mammalian derived IFNb, Avonex, came from Biogen and was reported to have a specific activity of 2 0e5 IU/ug
- FIG. 5 compares the anti-prohferative activity of IFN albumin fusion protein encoded by CID 3165 (CID 3165 protein) and recombinant IFNa (rDrJa) on Hs294T melanoma cells
- Figure 6 shows the effect of vanous dilutions of IFNa albumin fusion proteins on SEAP activity in the ISRE-SEAP/293F reporter cells One preparation of IFNa fused upstream of albumin ( ⁇ ) was tested, as well as two different preparations of IFNa fused downstream of albumin (•) and ( ⁇ )
- FIG. 7 shows the effect of time and dose of IFNa albumin fusion protein encoded by DNA comprised in construct 2249 (CID 2249 protein) on the mRNA level of OAS (p41) in treated monkeys (see Example 78)
- Per time point first bar Vehicle control
- 2"' 1 bar 30 ug/kg CID 2249 protein day 1 IV
- third bar 30 ug/kg CID 2249 protein day 1 sc
- 4* bar 300 ug/kg CID 2249 protein day 1 sc
- 5* bar 40 ug/kg recombinant IFNa day 1 , 3 and 5 sc
- Figure 8 shows the dose-response relationship of BNP albumin fusion proteins encoded by DNA comprised in constructs CID 3691 and 3618 (CID 3691 and 3618 protein) on activating cGMP formation in NPR-A/293F reporter cells (see Examples 80 and 81) Both recombinant BNP ( ⁇ ), as well as, two different preparations of BNP fused upstream of albumin (D) and (•) were tested
- Figure 9 shows the effect of BNP albumin fusion protein on mean arterial pressure in spontaneously hypertensive rats (see Example 80)
- Vehicle (D), recombinant BNP protein (•), or BNP albumin fusion protein (O) were delivered via tail vein injection Systolic and diastolic blood pressures were recorded by cuff-tail method
- Figure 10 shows the plasma cGMP levels in eleven- to 12-week-old male C57/BL6 mice after intravenous in j ection of recombinant BNP protein (•) or BNP albumin fusion protein (O (see Example 80) cGMP levels were determined from plasma prepared from tail bleeds collected at several time points after intravenous injection
- Figure 1 1 shows the blood glucose levels in fasted ⁇ 8-week old diabetic db/db mice 24 hours after single administration of tandem GLP- l(7-36A8G)2x-HSA fusion (CID 3610) (O), monomer GLP-1(7-36A8G)-HSA fusion ( ⁇ ), or HSA alone (•) Blood glucose levels were measured by an oral glucose tolerance test Tandem GLP-l(7-36A8G)2x-HSA fusion (CID 3610) ( ) had an unexpected more potent glucose- normalizing activity than the monomer GLP-1(7-36A8G)-HSA fusion ( ⁇ ) 24 hours after a single administration in fasted ⁇ 8 week old diabetic db/db mice DETAILED DESCRIPTION Definitions [0026] The following definitions are provided to facilitate understanding of certain terms used throughout this specification [0027] As used herein, "polynucleotide” refers to a nucleic acid molecule having a g
- albumin fusion construct refers to a nucleic acid molecule comprising, or alternatively consisting of, a polynucleotide encoding at least one molecule of albumin (or a fragment or va ⁇ ant thereof) joined in frame to at least one polynucleotide encoding at least one molecule of a Therapeutic protein (or fragment or va ⁇ ant thereof), a nucleic acid molecule compnsing, or alternatively consisting of, a polynucleotide encoding at least one molecule of albumin (or a fragment or va ⁇ ant thereof) joined in frame to at least one polynucleotide encoding at least one molecule of a Therapeutic protein (or fragment or va ⁇ ant thereof) generated as descnbed in Table 2 or in the Examples, or a nucleic acid molecule compnsing, or alternatively consisting of, a polynucleotide encoding at least one molecule of albumin (or a fragment or va ⁇ ant thereof) generated as descnbed in Table
- albumin fusion protein refers to a protein formed by the fusion of at least one molecule of albumin (or a fragment or variant thereof) to at least one molecule of a Therapeutic protein (or fragment or variant thereof)
- An albumin fusion protein of the invention comprises at least a fragment or variant of a Therapeutic protein and at least a fragment or variant of human serum albumin, which are associated with one another by genetic fusion (l e , the albumin fusion protein is generated by translation of a nucleic acid m which a polynucleotide encoding all or a portion of a Therapeutic protein is joined in-frame with a polynucleotide encoding all or a portion of albumin)
- the Therapeutic protein and albumin refers to a protein formed by the fusion of at least one molecule of albumin (or a fragment or variant thereof) to at least one molecule of a Therapeutic protein (or fragment or variant thereof)
- An albumin fusion protein of the invention comprises at least a fragment or variant of a Therapeutic protein
- a representative clone containing an albumin fusion construct of the invention was deposited with the American Type Culture Collection (herein referred to as "ATCC®") Furthermore, it is possible to retrieve a given albumin fusion construct from the deposit by techniques known in the art and descnbed elsewhere herein
- the ATCC® is located at 10801 University Boulevard, Manassas, Virginia 20110- 2209, USA
- the ATCC® deposits were made pursuant to the terms of the Budapest Treaty on the international recognition of the deposit of microorganisms for the purposes of patent procedure
- the invention provides a polynucleotide encoding an albumin fusion protein comprising, or alternatively consisting of, a Therapeutic protein and a serum albumin protein
- the invention provides an albumin fusion protein compnsing, or alternatively consisting of, a Therapeutic protein and a serum albumin protein
- the invention provides an albumin fusion protein comprising, or alternatively consisting of, a Therapeutic protein and a serum albumin protein encoded by a polynucleotide described in Table 2
- the invention provides a polynucleotide encoding an albumin fusion protein whose sequence is shown as SEQ ID NO Y in Table 2
- the invention provides an albumin fusion protein comprising, or alternatively consisting of, a biologically active and/or therapeutically active fragment of a Therapeutic protein and a serum albumin protein
- the invention provides an albumin fusion protein comprising, or alternatively consisting of,
- the invention provides an albumin fusion protein comprising, or alternatively consisting of, a Therapeutic protein, and a biologically active and/or therapeutically active fragment of serum albumin
- the invention provides an albumin fusion protein compnsing, or alternatively consisting of, a Therapeutic protein and a biologically active and/or therapeutically active variant of serum albumin
- the Therapeutic protein portion of the albumin fusion protein is the mature portion of the Therapeutic protein
- the Therapeutic protein portion of the albumin fusion protein is the extracellular soluble domain of the Therapeutic protein
- the Therapeutic protein portion of the albumin fusion protein is the active form of the Therapeutic protein
- the invention further encompasses polynucleotides encoding these albumin fusion proteins
- the invention provides an albumin fusion protein comprising, or alternatively consisting of, a biologically active and or therapeutically active fragment or vanant of a Therapeutic protein and a biologically active and/or therapeutically active fragment or variant of serum albumin
- the invention provides an albumin fusion protein compnsing, or alternatively consisting of, the mature portion of a Therapeutic protein and the mature portion of serum albumin
- the invention further encompasses polynucleotides encoding these albumin fusion proteins Therapeutic proteins
- a polynucleotide of the invention encodes a protein comprising or alternatively consisting of, at least a fragment or va ⁇ ant of a Therapeutic protein and at least a fragment or vanant of human serum albumin, which are associated with one another, preferably by genetic fusion
- An additional embodiment includes a polynucleotide encoding a protein comprising or alternatively consisting of at least a fragment or variant of a Therapeutic protein and at least a fragment or variant of human serum albumin, which are linked with one another by chemical conjugation
- Therapeutic protein refers to proteins, polypeptides, antibodies, peptides or fragments or variants thereof, having one or more therapeutic and/or biological activities
- Therapeutic proteins encompassed by the invention include but are not limited to, proteins, polypeptides, peptides, antibodies, and biologies (The terms peptides, proteins, and polypeptides are used interchangeably herein ) It is specifically contemplated that the term “Therapeutic protein” encompasses antibodies and fragments and vanants thereof
- a protein of the invention may contain at least a fragment or variant of a Therapeutic protein, and/or at least a fragment or va ⁇ ant of an antibody
- the term “Therapeutic protein” may refer to the endogenous or naturally occurring correlate of a Therapeutic protein
- a polypeptide displaying a “therapeutic activity” or a protein that is “therapeutically active” is meant a polypeptide that possesses one or more known biological and/or therapeutic activities associated with a therapeutic protein such as one or more of the Therapeutic proteins described herein or otherwise known in the art
- a "Therapeutic protein” is a protein that is useful to treat, prevent or ameliorate a disease, condition or disorder
- a "Therapeutic protein” may be one that binds specifically to a particular cell type (normal (e g , lymphocytes) or abnormal e g , (cancer cells)) and therefore may be used to target a compound (drug, or cytotoxic agent) to that cell type specifically
- a non-exhaustive list of "Therapeutic protein" portions which may be comprised by an albumin fusion protein of the invention includes, but is not limited to, GLP-1, GLP-2, PACAP-27, PACAP-28, VIP, CD4M33, secretin, ghcentin, oxyntomodu n, PHM, IFN ⁇ , IFN ⁇ , ANP, BNP, NGF, BDNF, GDNF, and somatostatin
- Interferon hybrids may also be fused to the amino or carboxy terminus of albumin to form an interferon hybrid albumin fusion protein
- Interferon hybrid albumin fusion protein may have enhanced, or alternatively, suppressed interferon activity, such as antiviral responses, regulation of cell growth, and modulation of immune response (Lebleu et al , PNAS USA, 73 3107-3111 (1976), Gresser et al , Nature, 251 543-545 (1974), and Johnson, Texas Reports Biol Med, 35 357-369 (1977))
- Each interferon hyb ⁇ d albumin fusion protein can be used to treat, prevent, or ameliorate viral infections (e , hepatitis (e g , HCV), or HIV), multiple sclerosis, or cancer
- the interferon hyb ⁇ d portion ofthe interferon hyb ⁇ d albumin fusion protein comprises an interferon alpha-mterferon alpha hybrid (herein refened to as an alpha-alpha hybrid)
- the alpha-alpha hyb ⁇ d portion of the interferon hybrid albumin fusion protein consists, or alternatively comprises, of interferon alpha A fused to interferon alpha D
- the A D hybnd is fused at the common BgHI rest ⁇ ction site to interferon alpha D, wherein the N-terminal portion of the A D hyb ⁇ d corresponds to amino acids 1-62 of interferon alpha A and the C-terminal portion conesponds to amino acids 64-166 of interferon alpha D
- this A/D hybrid would comp ⁇ se the amino acid sequence
- CDLPQTHSLGSRRTLMLLAQMRX ISLFSCLK.DRHDFGFPQEEFGNQFQ AETIPVLHEMIQQIFNLFTTKDSSAAWDEDLLD
- FCTELYQQL NDLEACVMQEERVGETPLMNX 2 DSILAVKKYFRRITLYLTEKKYSPCAWEWRAEIMRSLSLSTNLQERLRRKE (SEQ ID NO 99), wherein the Xi is R or K and the X 2 is A or V (see, for example, Construct ID #2875)
- the A/D hybrid is fused at the common PvuIII restriction site, wherein the N-terminal portion of the A/D hybnd conesponds to ammo acids 1-91 of interferon alpha A and the C-terminal portion conesponds to amino acids 93-166 of interferon alpha D
- this A/D hyb ⁇ d would comp ⁇ se the amino acid sequence CDLPQTHSLGSRRTLMLLAQMRX
- the alpha-alpha hybrid portion of the interferon hyb ⁇ d albumin fusion protein consists, or alternatively comp ⁇ ses, of interferon alpha A fused to interferon alpha F
- the A/F hybrid is fused at the common PvuIII restnction site, wherein the N-terminal portion of the A/F hybrid corresponds to amino acids 1-91 of interferon alpha A and the C-terminal portion corresponds to amino acids 93-166 of interferon alpha F
- this A/F hybrid would compnse the ammo acid sequence
- the alpha-alpha hybnd portion of the interferon hybnd albumin fusion protein consists, or alternatively comprises, of interferon alpha A fused to interferon alpha B
- the A/B hyb ⁇ d is fused at the common PvuIII restriction site, wherein the N-terminal portion of the A/B hyb ⁇ d conesponds to amino acids 1-91 of interferon alpha A and the C- term al portion conesponds to ammo acids 93-166 of interferon alpha B
- this A/B hybrid would comprise an amino acid sequence CDLPQTHSLGSRRTIJvILI ⁇ QMRXiISLFSCLKDRHDFGFPQEEFGNQFQK ⁇ ETIPVLHEMIQQiTNLFST
- the interferon hybrid portion of the interferon hybnd albumin fusion protein comprises an interferon beta- lnterferon alpha hyb ⁇ d (herein refened to as a beta-alpha hybrid)
- the beta-alpha hyb ⁇ d portion of the interferon hybrid albumin fusion protein consists, or alternatively comp ⁇ ses, of interferon beta-1 fused to interferon alpha D (also refened to as interferon alpha-1)
- the beta-1/alpha D hybrid is fused wherein the N-terminal portion conesponds to ammo acids 1-73 of interferon beta-1 and the C-terminal portion corresponds to ammo acids 74-167 of interferon alpha D
- this beta-1/alpha D hybrid would comprise an amino acid sequence
- the interferon hybrid portion of the interferon hybrid albumin fusion protein comprises an interferon alpha- lnterferon beta hyb ⁇ d (herein refened to as a alpha-beta hyb ⁇ d)
- the alpha-beta hybrid portion ofthe interferon hybrid albumin fusion protein consists, or alternatively comp ⁇ ses, of
- the interferon hybrid portion of the interferon hybrid albumin fusion proteins may compnse additional combinations of alpha-alpha interferon hybrids, alpha-beta interferon hybrids, and beta-alpha interferon hybnds
- the interferon hyb ⁇ d portion of the interferon hyb ⁇ d albumin fusion protein may be modified to include mutations, substitutions, deletions, or additions to the amino acid sequence ofthe interferon hyb ⁇ d
- modifications to the interferon hyb ⁇ d albumin fusion proteins may be made, for example, to improve levels of production, increase stability, increase or decrease activity, or confer new biological properties
- interferon hybrid albumin fusion proteins are encompassed by the invention, as are host cells and vectors containing polynucleotides encoding the polypeptides
- a interferon hyb ⁇ d albumin fusion protein encoded by a polynucleotide as descnbed above has extended shelf life
- a interferon hyb ⁇ d albumin fusion protein encoded by a polynucleotide described above has a longer serum half-life and/or more stabilized activity in solution (or in a pharmaceutical composition) in vitro and/or in vivo than the conesponding unfused interferon hybnd molecule
- a "Therapeutic protein” is a protein that has a biological activity, and in particular, a biological activity that is useful for treating, preventing or ameliorating a disease
- a non-inclusive list of biological activities that may be possessed by a Therapeutic protein includes, inhibition of HIV-1 infection of cells, stimulation of intestinal epithelial cell proliferation, reducing intestinal epithelial cell permeability, stimulating insulin secretion, induction of bronchodilation and vasodilation, inhibition of aldosterone and renm secretion, blood pressure regulation, promoting neuronal growth, enhancing an immune response, enhancing inflammation, suppression of appetite, or any one or more of the biological activities described in the "Biological Activities" section below and/or as disclosed for a given Therapeutic protein in Table 1 (column 2)
- IFN-beta-HSA fusions are used to inhibit the activity of Ebola virus and the SARS virus (Toronto-2 strain)
- the in vitro antiviral activity of IFN-beta fused upstream of mature HSA was evaluated against Ebola virus and SARS virus in Vero cells
- CPE cytopathic effect
- the neutral red assay of cell viability In vitro signal transduction was assessed by analysis of gene expression
- the pharmacokinetics and pharmacodynamics of CID 2053 protein were evaluated in rhesus monkeys The results indicate that potent in vitro antiviral activity was achieved with a favorable safety index
- the IC50 for CID 2053 protein was 04 ng/ml against Ebola and 2 ng ml against the SARS virus Anay analysis showed that CID 2053 protein and IFN-beta induce the expression of a similar set of genes
- IFN-alpha-HSA fusions are used to treat patients with chronic Hepatitis C infection (HCV)
- Interferon alpha also known as interferon alfa or leukocyte inferon
- HCV chronic Hepatitis C infection
- interferon alpha refers to a family of highly homologous related polypeptides with anti-viral activity
- the interferon alpha portion of the IFN-alpha-HSA fusion consists or alternatively compnses any interferon alpha or fragment thereof known in the art
- Non-limiting examples of interferon alpha encompassed by the invention include, but are not limited to, the interferon alpha proteins disclosed in the Therapeutic protein column of Table 1
- the interferon alpha portion consists or alternatively comprises interferon alpha-2a, interferon alpha-2b, interferon alpha- 2c, consensus interferon, interferon alfacon-1, interferon alpha-nl, interferon alpha-2a, interferon alpha-2a,
- the Hepatitis C virus can be classified into four genotypes, genotype 1, 2, 3, or 4 Generally, the Hepatitis C virus that infects an HCV patient comprises a single genotype However, the Hepatitis virus can comp ⁇ se a combination of two or more genotypes In addition, the genotype of Hepatitis C virus may also be a variant of one of the known HCV genotypes In a further embodiment, the Hepatitis C virus of the HCV patient is genotype 1 or a vanant thereof However, as used herein, "HCV" refers to the Hepatitis C virus of any genotype, or combination or va ⁇ ants thereof
- the standard treatment regimen for patients with HCV involves treatment with interferon alpha in combination with an antiviral agent, such as, ⁇ bavi ⁇ n
- an antiviral agent such as, ⁇ bavi ⁇ n
- the interferon alpha is administered daily, twice-a-week, or weekly and the ⁇ bavi ⁇ n is administered daily
- recent studies have also used inteferon alpha in combination with other antiviral agents known in the art for the treatment of HCV
- the IFN-alpha-HSA fusion may be administered to the HCV patient either alone or in combination with an antiviral agent, such as, for example, ⁇ bavi ⁇ n
- the HCV patients are treated with an IFN-alpha-HSA fusion by administration once every 2-4 weeks alone or in combination with an effective amount of an antiviral agent
- the HCV patients are treated with an IFN-alpha-HSA fusion by administration once every 2-4 weeks in combination with an effective amount of an antiviral agent
- the IFN- alpha-HSA fusion is administered to the HCV patient once every 4 weeks
- the IFN-alpha-HSA fusion is administered to the HCV patient more than once every 4 weeks
- the IFN-alpha-HSA fusion is adminstered once every 4 weeks or more to an HCV patient, wherein the treatment also includes administration of an effective amount of an antiviral agent [0055]
- IFN-alpha-HSA fusions may be used for the treatment of other viral infections
- IFN-alpha-HSA fusions may be used for the treatment of Hepatitis B (HBV)
- IFN-alpha-HSA fusions may be used for the treatment of Human Papilloma Virus (HPV)
- IFN-alpha-HSA fusions may be used in the treatment of cancer, including, but not limited to hairy cell leukemia, malignant melanoma, follicular lymphoma, chronic myelogenous leukemia, AIDS related Kaposi's Sarcoma, multiple myeloma, or renal cell cancer
- GLP-1-HSA fusions are used to regulate blood glucose levels in diabetic patients
- tandem fusions of wild-type or mutant GLP-1 are used to regulate blood glucose levels in diabetic patients
- monomer GLP-1(7-36A8G)-HSA and tandem GLP-1 (7-36A8G)-HSA (CID 3610) fusions were evaluated utilizing an oral glucose tolerance test (1 gram glucose/kg by oral gavage), following subcutaneous injection of GLP-1-HSA protein in ⁇ 8 week old diabetic db/db mice
- This glucose tolerance test consisted of the subcutaneous injection of a GLP-1-HSA fusion followed by administration of 1 gram glucose/kg by oral gavage Fasted diabetic db/db mice were administered equimolar doses (100 and 171 nmol/kg) of either the monomer or tandem GLP-1- HSA fusion protein and oral glucose tolerance tests were performed 6 or 24 hours after a single administration
- Therapeutic proteins conesponding to a Therapeutic protein portion of an albumin fusion protein of the invention are often modified by the attachment of one or more oligosaccha ⁇ de groups
- the modification, refened to as glycosylation can dramatically affect the physical properties of proteins and can be important in protein stability, secretion, and localization Glycosylation occurs at specific locations along the polypeptide backbone
- Therapeutic proteins conesponding to a Therapeutic protein portion of an albumin fusion protein ofthe invention may be modified so that glycosylation at one or more sites is altered as a result of mampulat ⁇ on(s) of their nucleic acid sequence, by the host cell in which they are expressed, or due to other conditions of their expression
- glycosylation isomers may be produced by abolishing or introducing glycosylation sites, e g , by substitution or deletion of amino acid residues, such as substitution of glutamine for asparagine, or unglycosylated recombinant proteins may be produced by expressing the proteins in host cells that will not glycosylate them, e g in E coli or glycosylation-deficient yeast
- Therapeutic proteins particularly those disclosed in Table 1, and their nucleic acid and amino acid sequences are well known in the art and available in public databases such as Chemical Abstracts Services Databases (e g , the CAS Registry), GenBank, and subscription provided databases such as GenSeq (e g , Derwent)
- Exemplary nucleotide sequences of Therapeutic proteins which may be used to derive a polynucleotide of the invention are shown in column 7, "SEQ ID NO X,” of Table 2
- Sequences shown as SEQ ID NO X may be a wild type polynucleotide sequence encoding a given Therapeutic protein (e g , either full length or mature), or in some instances the sequence may be a variant of said wild type polynucleotide sequence (eg , a polynucleotide which encodes the wild type Therapeutic protein, wherein the DNA sequence of said polynucleotide has been optimized, for example, for expression m a particular species, or a polynucleotide
- Additional Therapeutic proteins conesponding to a Therapeutic protein portion of an albumin fusion protein of the invention include, but are not limited to, one or more of the Therapeutic proteins or peptides disclosed in the "Therapeutic Protein X" column of Table 1 (column 1), or fragment or variable thereof
- Table 1 provides a non-exhaustive list of Therapeutic proteins that conespond to a Therapeutic protein portion of an albumin fusion protein of the invention, or an albumin fusion protein encoded by a polynucleotide of the invention
- the first column, "Therapeutic Protein X” discloses Therapeutic protein molecules that may be followed by parentheses containing scientific and brand names of proteins that comprise, or alternatively consist of, that Therapeutic protein molecule or a fragment or variant thereof "Therapeutic protein X" as used herein may refer either to an individual Therapeutic protein molecule, or to the entire group of Therapeutic proteins associated with a given Therapeutic protein molecule disclosed in this column
- the "Biological activity” column (column 2) describes Biological activities associated with the Therapeutic protein molecule
- Column 3 "Exemplary Activity Assay,” provides references that describe assays which may be used to test the therapeutic and/or biological activity of a Therapeutic protein X or an albumin fusion protein compnsing a Therapeutic protein X (or fragment thereof) portion Each of the references cited in the "
- Table 2 provides a non-exhaustive list of polynucleotides of the invention comprising, or alternatively consisting of, nucleic acid molecules encoding an albumin fusion protein
- Construct ID" provides a unique nume ⁇ cal identifier for each polynucleotide of the invention
- the Construct IDs may be used to identify polynucleotides which encode albumin fusion proteins comprising, or alternatively consisting of, a Therapeutic protein portion conesponding to a given Therapeutic Protein X listed in the conesponding row of Table 1 wherein that Construct ID is listed in column 5
- the "Construct Name” column (column 3) provides the name of a given albumin fusion construct or polynucleotide
- SEQ ID NO Y shows the unprocessed form of the albumin fusion protein encoded - in other words, SEQ ID NO Y shows the signal sequence, a HSA portion, and a therapeutic portion all encoded by the particular construct Specifically contemplated by the present invention are all polynucleotides that encode SEQ ID NO Y When these polynucleotides are used to express the encoded protein from a cell, the cell's natural secretion and processing steps produces a protein that lacks the signal sequence listed columns 4 and/or 11 of Table 2 The specific amino acid sequence of the listed signal sequence is shown later in the specification or is well known in the art Thus, most prefened embodiments of the present invention include the albumin fusion protein produced by a cell (which would lack the leader sequence shown in columns 4 and/or 11 of Table 2) Also most prefened are polypeptides comprising SEQ ID NO Y
- the seventh column, "SEQ ID NO X,” provides the parent nucleic acid sequence from which a polynucleotide encoding a Therapeutic protein portion of a given albumin fusion protein may be derived
- the parent nucleic acid sequence from which a polynucleotide encoding a Therapeutic protein portion of an albumin fusion protein may be derived comprises the wild type gene sequence encoding a Therapeutic protein shown in Table 1
- the parent nucleic acid sequence from which a polynucleotide encoding a Therapeutic protein portion of an albumin fusion protein may be derived comprises a variant or derivative of a wild type gene sequence encoding a Therapeutic protein shown in Table 1, such as, for example, a synthetic codon optimized variant of a wild type gene sequence encoding a Therapeutic protein
- SEQ ID NO Z provides a predicted translation of the parent nucleic acid sequence (SEQ ID NO X)
- This parent sequence can be a full length parent protein used to derive the particular construct, the mature portion of a parent protein, a variant or fragment of a wildtype protein, or an artificial sequence that can be used to create the described construct
- This amino acid sequence shown in SEQ ID NO Z can be used to determine which ammo acid residues of an albumin fusion protein encoded by a given construct are provided by the therapeutic protein
- it is well within the ability of the skilled artisan to use the sequence shown as SEQ ID NO Z to derive the construct described in the same row For example, if SEQ ID NO Z conesponds to a full length protein, but only a portion of that protein is used to generate the specific CID, it is within the skill o the art to rely on molecular biology techniques, such as PCR, to amplify the specific fragment and clone it into the appropriate vector
- Amplification primers provided in columns 9 and 10, "SEQ ID NO A” and “SEQ ID NO B” respectively, are exemplary primers used to generate a polynucleotide comprising or alternatively consisting of a nucleic acid molecule encoding the Therapeutic protein portion of a given albumin fusion protein
- oligonucleotide primers having the sequences shown in columns 9 and/or 10 are used to PCR amplify a polynucleotide encoding the Therapeutic protein portion of an albumin fusion protein using a nucleic acid molecule comprising or alternatively consisting of the nucleotide sequence provided in column 7 (SEQ ID NO X)of the conesponding row as the template DNA PCR methods are well-established in the art Additional useful p ⁇ mer sequences could readily be envisioned and utilized by those of ordinary skill in the art
- oligonucleotide primers may be used in overlapping PCR reactions to generate mutations within a template DNA sequence PCR methods are known in the art
- an "expression cassette" compnsing or alternatively consisting of one or more of (1) a polynucleotide encoding a given albumin fusion protein, (2) a leader sequence, (3) a promoter region, and (4) a transcriptional terminator can be moved or "subcloned" from one vector into another Fragments to be subcloned may be generated by methods well known in the art, such as, for example, PCR amplification (e g , using oligonucleotide p ⁇ mers having the sequence shown in S
- the albumin fusion proteins of the invention are capable of a therapeutic activity and/or biologic activity conesponding to the therapeutic activity and/or biologic activity of the Therapeutic protein conesponding to the Therapeutic protein portion of the albumin fusion protein listed in the conesponding row of Table 1
- the therapeutically active protein portions of the albumin fusion proteins of the invention are fragments or variants of the protein encoded by the sequence shown in SEQ ID NO X column of Table 2, and are capable ofthe therapeutic activity and/or biologic activity ofthe conesponding Therapeutic protein Polypeptide and Polynucleotide Fra ⁇ ments and Variants Fragments
- the present invention is further directed to fragments of the Therapeutic proteins described in Table 1, albumin proteins, and/or albumin fusion proteins ofthe invention
- the present invention is also directed to polynucleotides encoding fragments of the Therapeutic proteins descnbed in Table 1 , albumin proteins, and/or albumin fusion proteins ofthe invention
- fragments of a Therapeutic protein conesponding to a Therapeutic protein portion of an albumin fusion protein of the invention include the full length protein as well as polypeptides having one or more residues deleted from the ammo terminus of the amino acid sequence of the reference polypeptide (l e , a Therapeutic protein refened to in Table 1 , or a Therapeutic protein portion of an albumin fusion protein encoded by a polynucleotide or albumin fusion construct described in Table 2)
- N-termmal deletions may be described by the general formula m to q, where q is a whole integer representing the total number of amino acid residues in a reference polypeptide (e g , a Therapeutic protein refened to in Table 1, or a Therapeutic protein portion of an albumin fusion protein of the invention, or a Therapeutic protein portion of an albumin fusion protein encoded by a polynucleotide or albumin fusion construct described in Table 2), and m is defined as any integer ranging from 2 to q
- fragments of serum albumin polypeptides conesponding to an albumin protein portion of an albumin fusion protein of the invention include the full length protein as well as polypeptides having one or more residues deleted from the amino terminus of the ammo acid sequence of the reference polypeptide (I e , serum albumin, or a serum albumin portion of an albumin fusion protein encoded by a polynucleotide or albumin fusion construct described in Table 2)
- N-terminal deletions may be described by the general formula m to 585, where 585 is a whole integer representing the total number of amino acid residues in mature human serum albumm (SEQ ID NO 1), and m is defined as any integer ranging from 2 to 579 Polynucleotides encoding these polypeptides are also encompassed by the invention
- N-termmal deletions may be descnbed by the general formula m to 609, where 609 is a whole integer representing the total number of
- fragments of albumin fusion proteins of the invention include the full length albumin fusion protein as well as polypeptides having one or more residues deleted from the amino terminus of the albumin fusion protein (e , an albumin fusion protein encoded by a polynucleotide or albumin fusion construct described m Table 2, or an albumin fusion protein having the amino acid sequence disclosed in column 6 of Table 2)
- N-terminal deletions may be descnbed by the general formula m to q, where q is a whole integer representing the total number of amino acid residues in the albumin fusion protein, and m is defined as any integer ranging from 2 to q minus 6
- Polynucleotides encoding these polypeptides are also encompassed by the invention
- a reference polypeptide e g , a Therapeutic protein, serum albumin protein, or albumin fusion protein of the invention
- other functional activities e , biological activities, ability to multime ⁇ ze, ability to bind a ligand
- Therapeutic activities may still be retained
- the ability of polypeptides with C-termmal deletions to induce and/or bind to antibodies which recognize the complete or mature forms of the polypeptide generally will be retained when less than the majo ⁇ ty of the residues of the complete or mature polypeptide are removed from the C-terminus
- a particular polypeptide lacking the N-terminal and/or C-terminal residues of a reference polypeptide retains Therapeutic activity can readily be determined by routine methods described herein and/or otherwise known in the art
- the present invention further provides polypeptides having one or more residues deleted from the carboxy terminus of the amino acid sequence of a Therapeutic protein conesponding to a Therapeutic protein portion of an albumin fusion protein ofthe invention (e g , a Therapeutic protein refened to in Table 1, or a Therapeutic protein portion of an albumin fusion protein encoded by a polynucleotide or albumin fusion construct described in Table 2)
- C-terminal deletions may be descnbed by the general formula 1 to n, where n is any whole integer ranging from 6 to q minus 1, and where q is a whole integer representing the total number of amino acid residues in a reference polypeptide (e g , a Therapeutic protein refened to in Table 1 , or a Therapeutic protein portion of an albumm fusion protein encoded by a polynucleotide or albumin fusion construct described in Table 2)
- Polynucleotides encoding these polypeptides are also encompassed by the invention
- the present invention provides polypeptides having one or more residues deleted from the carboxy terminus of the ammo acid sequence of an albumin protein conesponding to an albumin protein portion of an albumin fusion protein of the invention (e g , serum albumin or an albumin protein portion of an albumm fusion protein encoded by a polynucleotide or albumin fusion construct descnbed in Table 2)
- C-terminal deletions may be described by the general formula 1 to n, where n is any whole integer ranging from 6 to 584, where 584 is the whole integer representing the total number of amino acid residues in mature human serum albumin (SEQ ID NO 1) minus I Polynucleotides encoding these polypeptides are also encompassed by the invention
- C-terminal deletions may be described by the general formula 1 to n, where n is any whole integer ranging from 6 to 608, where 608 is the whole integer representing the total number of amino acid residues in serum albumin (SEQ ID NO 1)
- the present invention provides polypeptides having one or more residues deleted from the carboxy terminus of an albumin fusion protein of the invention
- C-terminal deletions may be described by the general formula 1 to n, where n is any whole integer ranging from 6 to q minus 1, and where q is a whole integer representing the total number of amino acid residues in an albumin fusion protein ofthe invention
- Polynucleotides encoding these polypeptides are also encompassed by the invention
- any of the above described N- or C-terminal deletions can be combined to produce a N- and C-terminal deleted reference polypeptide
- the invention also provides polypeptides having one or more ammo acids deleted from both the ammo and the carboxyl termini, which may be described generally as having residues m to n of a reference polypeptide (e g , a Therapeutic protein refened to in Table 1, or a Therapeutic protein portion of an album fusion protein of the invention, or a Therapeutic protein portion encoded by a polynucleotide or albumin fusion construct descnbed in Table 2, or serum albumin (e g , SEQ ID NO 1), or an albumin protein portion of an albumm fusion protein of the invention, or an albumin protein portion encoded by a polynucleotide or albumin fusion construct described in Table 2, or an albumin fusion protein, or an albumin fusion protein encoded by a polynucleotide or albumin fusion construct of the invention) where
- the present application is also directed to proteins containing polypeptides at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a reference polypeptide sequence (e g , a Therapeutic protein refened to in Table 1 , or a Therapeutic protein portion of an albumin fusion protein of the invention, or a Therapeutic protein portion encoded by a polynucleotide or albumin fusion construct described in Table 2, or serum albumin (e g , SEQ ID NO 1), or an albumin protein portion of an albumin fusion protein of the invention, or an albumin protein portion encoded by a polynucleotide or albumin fusion construct described in Table 2, or an albumin fusion protein, or an albumin fusion protein encoded by a polynucleotide or albumm fusion construct ofthe invention) set forth herein, or fragments thereof
- a reference polypeptide sequence e g , a Therapeutic protein refened to in Table 1 , or a Therapeutic protein portion of an albumin
- Prefened polypeptide fragments of the invention are fragments comprising, or alternatively, consisting of, an amino acid sequence that displays a Therapeutic activity and/or functional activity (e g biological activity) of the polypeptide sequence of the Therapeutic protein or serum albumin protein of which the amino acid sequence is a fragment
- Biologically active fragments are those exhibiting activity similar, but not necessanly identical, to an activity of the polypeptide of the present invention
- the biological activity ofthe fragments may include an improved desired activity, or a decreased undesirable activity
- Variants refers to a polynucleotide or nucleic acid differing from a reference nucleic acid or polypeptide, but retaining essential properties thereof Generally, va ⁇ ants are overall closely similar, and, in many regions, identical to the reference nucleic acid or polypeptide
- va ⁇ ant refers to a Therapeutic protein portion of an albumin fusion protein of the invention, albumin portion of an albumin fusion protein of the invention, or albumin fusion protein of the invention differing m sequence from a Therapeutic protein (e g see "therapeutic” column of Table 1), albumm protein, and/or albumin fusion protein, respectively, but retaining at least one functional and
- the present invention is also directed to proteins which comp ⁇ se, or alternatively consist of, an amino acid sequence which is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%, identical to, for example, the amino acid sequence of a Therapeutic protein conesponding to a Therapeutic protein portion of an albumin fusion protein of the invention (e g , the amino acid sequence of a Therapeutic protein X disclosed in Table 1, or the ammo acid sequence of a Therapeutic protein portion of an albumin fusion protein encoded by a polynucleotide or albumin fusion construct described in Table 1 and 2, or fragments or variants thereof), albumin proteins conesponding to an albumin protein portion of an albumin fusion protein of the invention (e g , the ammo acid sequence of an albumin protein portion of an albumin fusion protein encoded by a polynucleotide or albumin fusion construct described in Table 1 and 2, the ammo acid sequence shown in SEQ ID NO 1, or fragments or variant
- a polypeptide having an amino acid sequence at least, for example, 95% "identical" to a query ammo acid sequence it is intended that the amino acid sequence of the subject polypeptide is identical to the query sequence except that the subject polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the query ammo acid sequence.
- the amino acid sequence of the subject polypeptide may include up to five amino acid alterations per each 100 amino acids of the query ammo acid sequence.
- up to 5% of the amino acid residues in the subject sequence may be inserted, deleted, or substituted with another amino acid
- These alterations of the reference sequence may occur at the amino- or carboxy-terminal positions of the reference ammo acid sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence
- any particular polypeptide is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to, for instance, the amino acid sequence of an albumin fusion protein of the invention or a fragment thereof (such as a Therapeutic protein portion of the albumin fusion protein or an albumin portion of the albumin fusion protein), can be determined conventionally using known computer programs
- a prefened method for determining the best overall match between a query sequence (a sequence of the present invention) and a subject sequence, also refened to as a global sequence alignment can be detennined using the FASTDB computer program based on the algo ⁇ thm of Brutlag et al (Comp App Biosci 6 237-245 (1990))
- the query and subject sequences are either both nucleotide sequences or both amino acid sequences
- the result of said global sequence alignment is expressed as percent identity
- the percent identity is corrected by calculating the number of residues of the query sequence that are N- and C-terminal of the subject sequence, which are not matched/aligned with a conesponding subject residue, as a percent of the total bases of the query sequence Whether a residue is matched/aligned is determined by results of the FASTDB sequence alignment This percentage is then subtracted from the percent identity, calculated by the above FASTDB program using the specified parameters, to ar ⁇ ve at a final percent identity score This final percent identity score is what is used for the pu ⁇ oses of the present invention Only residues to the N- and C-termini of the
- a 90 ammo acid residue subject sequence is aligned with a 100 residue query sequence to determine percent identity
- the deletion occurs at the N-terminus of the subject sequence and therefore, the FASTDB alignment does not show a matching/alignment of the first 10 residues at the N-terminus
- the 10 unpaired residues represent 10% of the sequence (number of residues at the N- and C- termini not matched/total number of residues in the query sequence) so 10% is subtracted from the percent identity score calculated by the FASTDB program If the remaining 90 residues were perfectly matched the final percent identity would be 90%
- a 90 residue subject sequence is compared with a 100 residue query sequence This time the deletions are internal deletions so there are no residues at the N- or C-termini of the subject sequence which are not matched/aligned with the query In this case the percent identity calculated by FASTDB is not manually conected Once again, only residue positions outside the N- and C-terminal ends of the subject sequence, as displayed in the FASTDB alignment
- the variant will usually have at least 75 % (preferably at least about 80%, 90%, 95% or 99%) sequence identity with a length of normal HA or Therapeutic protein which is the same length as the variant Homology or identity at the nucleotide or ammo acid sequence level is determined by BLAST (Basic Local Alignment Search Tool) analysis using the algorithm employed by the programs blastp, blastn, blastx, tblastn and tblastx (Karlin et al , Proc Natl Acad Sci USA 87 2264-2268 (1990) and Altschul, J Mol Evol 36 290-300 (1993), fully inco ⁇ orated by reference) which are tailored for sequence similarity searching
- BLAST Basic Local Alignment Search Tool
- the approach used by the BLAST program is to first consider similar segments between a query sequence and a database sequence, then to evaluate the statistical significance of all matches that are identified and finally to summarize only those matches which satisfy a preselected threshold of significance
- a preselected threshold of significance For a discussion of basic issues in similarity searching of sequence databases, see Altschul et al , (Nature Genetics 6 119-129 (1994)) which is fully inco ⁇ orated by reference
- the search parameters for histogram, descriptions, alignments, expect (I e , the statistical significance threshold for reporting matches against database sequences), cutoff, mat ⁇ x and filter are at the default settings
- the default scoring matrix used by blastp, blastx, tblastn, and tblastx is the BLOSUM62 matrix (Henikoff et al .
- the scoring mat ⁇ x is set by the ratios of M (l e , the reward score for a pair of matching residues) to N (I e , the penalty score for mismatching residues), wherein the default values for M and N are 5 and -4, respectively
- M and N are 5 and -4, respectively
- a polynucleotide of the invention which encodes the albumin portion of an albumin fusion protein is optimized for expression in yeast or mammalian cells
- a polynucleotide of the invention which encodes the Therapeutic protein portion of an albumin fusion protein is optimized for expression in yeast or mammalian cells
- a polynucleotide encoding an albumin fusion protein ofthe invention is optimized for expression m yeast or mammalian cells 100100]
- a codon optimized polynucleotide which encodes a Therapeutic protein portion of an albumm fusion protein does not hyb ⁇ dize to the wild type polynucleotide encoding the Therapeutic protein under stringent hybridization conditions as described herein
- a codon optimized polynucleotide which encodes an albumin portion of an albumm fusion protein does not hybndize to the wild
- Naturally occumng variants are called "allehc variants," and refer to one of several alternate forms of a gene occupying a given locus on a chromosome of an organism (Genes II, Lewm, B , ed , John Wiley & Sons, New York (1985))
- allehc va ⁇ ants can vary at either the polynucleotide and/or polypeptide level and are included in the present invention
- non-naturally occumng variants may be produced by mutagenesis techniques or by direct synthesis
- variants may be generated to improve or alter the characte ⁇ stics of the polypeptides of the present invention
- one or more ammo acids can be deleted from the N-terminus or C- terminus of the polypeptide of the present invention without substantial loss of biological function
- Ron et al J Biol Chem 268 2984-2988 (1993)
- va ⁇ ant KGF proteins having hepa ⁇ n binding activity even after deleting 3, 8, or 27 amino-termmal amino acid residues
- Interferon gamma exhibited up to ten times higher activity after deleting 8-10 ammo acid residues from the carboxy terminus of this protein (Dobeli et al , J Biotechnology 7 199-216 (1988) )
- va ⁇ ants often retain a biological activity similar to that of the naturally occumng protein
- Gayle and coworkers J Biol Chem 268 22105-22111 (1993) conducted extensive mutational analysis of human cytokine IL-la They used random mutagenesis to generate over 3,500 individual IL-la mutants that averaged 2 5 amino acid changes per variant over the entire length of the molecule Multiple mutations were examined at every possible amino acid position The investigators found that "[m]ost of the molecule could be altered with little effect on either [binding or biological activity) " In fact, only 23 unique amino acid sequences, out of more than 3,500 nucleotide sequences examined, produced a protein that significantly differed in activity from wild-type
- the invention further includes polypeptide variants which have a functional activity (e g , biological activity and/or therapeutic activity)
- the invention provides variants of albumin fusion proteins that have a functional activity (e g , biological activity and or therapeutic activity) that conesponds to one or more biological and/or therapeutic activities of the Therapeutic protein conesponding to the Therapeutic protein portion of the albumin fusion protein
- the invention provides variants of albumin fusion proteins that have a functional activity (e g , biological activity and/or therapeutic activity) that conesponds to one or more biological and/or therapeutic activities of the Therapeutic protein conesponding to the Therapeutic protein portion of the albumin fusion protein
- Such variants include deletions, insertions, inversions, repeats, and substitutions selected according to general rules known in the art so as have little effect on activity Polynucleotides encoding such variants are also encompassed by the invention
- va ⁇ ants of the invention have conservative substitutions
- conservative substitutions is intended swaps within groups such as replacement of the aliphatic or hydrophobic am o acids Ala, Val, Leu and He, replacement of the hydroxyl residues Ser and Thr, replacement of the acidic residues Asp and Glu, replacement ofthe amide residues Asn and Gin, replacement ofthe basic residues Lys, Arg, and His, replacement ofthe aromatic residues Phe, Tyr, and T ⁇ , and replacement of the small-sized amino acids Ala, Ser, Thr, Met, and Gly [0107]
- Guidance concerning how to make phenotypically silent amino acid substitutions is provided, for example, in Bowie et al , "Deciphering the Message in Protein Sequences Tolerance to Amino Acid Substitutions," Science 247 1306-1310 (1990), wherein the authors indicate that there are two main strategies for studying the tolerance of an amino acid sequence to change
- the second strategy uses genetic engmee ⁇ ng to introduce amino acid changes at specific positions of a cloned gene to identify regions cntical for protein function
- site directed mutagenesis or alanine-scanning mutagenesis introduction of single alanine mutations at every residue in the molecule
- the resulting mutant molecules can then be tested for biological activity
- variants of the present invention include (l) polypeptides containing substitutions of one or more of the non-
- polypeptide variants containing amino acid substitutions of charged amino acids with other charged or neutral amino acids may produce proteins with improved charactenstics, such as less aggregation Aggregation of pharmaceutical formulations both reduces activity and increases clearance due to the aggregate's immunogenic activity
- charactenstics such as less aggregation Aggregation of pharmaceutical formulations both reduces activity and increases clearance due to the aggregate's immunogenic activity
- the polypeptides of the invention comp ⁇ se, or alternatively, consist of, fragments or vanants of the amino acid sequence of an albumin fusion protein, the ammo acid sequence of a Therapeutic protein and/or human serum albumin, wherein the fragments or variants have 1-5, 5-10, 5-25, 5-50, 10-50 or 50-150, amino acid residue additions, substitutions, and/or deletions when compared to the reference am o acid sequence
- the amino acid substitutions are conservative Nucleic acids encoding these polypeptides are also encompassed by the invention
- the polypeptide of the present invention can be composed of amino acids joined to each other by peptide bonds or modified peptide bonds, l e , peptide isosteres, and may contain ammo acids other than the 20 gene-encoded amino acids
- the polypeptides may be modified by either natural processes, such as post-translational processing, or by chemical modification techniques which are well known in the art Such modifications are well descnbed in basic texts and in more detailed monographs, as well as in a voluminous research literature Modifications can occur anywhere in a polypeptide, including the peptide backbone, the ammo acid side-chains and the am o or carboxyl termini It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a given polypeptide Also, a given polypeptide may contain many types of modifications Polypeptides may be branched, for example, as a result of ubiquitmation, and they may be cyclic, with or without branching Cyc
- a polypeptide having biological activity refers to a polypeptide exhibiting activity similar to, but not necessarily identical to, an activity of a Therapeutic protein of the present invention, including mature forms, as measured in a particular biological assay, with or without dose dependency In the case where dose dependency does exist, it need not be identical to that of the polypeptide, but rather substantially similar to the dose-dependence in a given activity as compared to the polypeptide of the present invention (i e , the candidate polypeptide will exhibit greater activity or not more than about 25-fold less and, preferably, not more than about tenfold less activity, and most preferably, not more than about three-fold less activity relative to the polypeptide ofthe present invention)
- an albumin fusion protein ofthe invention has at least one biological and/or therapeutic activity associated with the Therapeutic protein portion (or fragment or variant thereof) when it is not fused to albumin
- the albumin fusion protein of the invention has an increased plasma stability compared to the Therapeutic protein portion (or fragment or variant thereof) in an unfused state
- Plasma stability of the albumin fusion protein ofthe invention or of the unfused Therapeutic protein portion (or fragment or va ⁇ ant thereof) can be assayed using or routinely modifying assays known in the art
- the albumin fusion proteins of the invention can be assayed for functional activity (e g , biological activity) using or routinely modifying assays known in the art, as well as assays described herein
- one of skill in the art may routinely assay fragments of a Therapeutic protein conesponding to a Therapeutic protein portion of an albumin fusion protein, for activity using assays referenced in its conesponding row of Table 1 (e g , in column 3 of Table 1)
- one of skill in the art may routinely assay fragments of an albumin protein conesponding to an albumin protein portion of an albumin fusion protein,
- a binding partner e g , a receptor or a ligand
- binding to that binding partner by an albumin fusion protein which comp ⁇ ses that Therapeutic protein as the Therapeutic protein portion of the fusion can be assayed, e g , by means well-known in the art, such as, for example, reducing and non-reducing gel chromatography, protein affinity chromatography, and affinity blotting See generally, Phizicky et al , Microbiol Rev 59 94-123 (1995)
- the ability of physiological conelates of an albumin fusion protein to bind to a substrate(s) of the Therapeutic polypeptide conesponding to the Therapeutic protein portion of the fusion can be routinely assayed using techniques known in the art
- association with other components of the multimer can be assayed, e g , by means well-known in the art, such as, for example, reducing and non-reducing gel chromatography, protein affinity chromatography, and affinity blotting See generally, Phizicky et al , supra
- an albumin fusion protein comprising all or a portion of an antibody that binds a Therapeutic protein, has at least one biological and/or therapeutic activity (e g , to specifically bind a polypeptide or epitope) associated with the antibody that binds a Therapeutic protein (or fragment or variant thereof) when it is not fused to albumin
- the biological activity and/or therapeutic activity of an albumin fusion protein comprising all or a portion of an antibody that binds a Therapeutic protein is the inhibition (l e , antagonism) or activation (I e , agonism) of one or more of the biological activities and/or therapeutic activities associated with the polypeptide that is specifically bound by antibody that binds a Therapeutic protein
- Albumin fusion proteins comprising at least a fragment or va ⁇ ant of an antibody that binds a Therapeutic protein may be characterized in a variety of ways
- albumin fusion proteins compnsing at least a fragment or va ⁇ ant of an antibody that binds a Therapeutic protein may be assayed for the ability to specifically bind to the same antigens specifically bound by the antibody that binds a Therapeutic protein conesponding to the Therapeutic protein portion of the albumin fusion protein using techniques descnbed herein or routinely modifying techniques known m the art
- albumin fusion proteins e g , comprising at least a fragment or variant of an antibody that binds a Therapeutic protein
- Assays for the ability of the albumin fusion proteins (e g , comprising at least a fragment or variant of an antibody that binds a Therapeutic protein) to (specifically) bind a specific protein or epitope may be performed in solution (e g , Houghten, Bio/Techniques 13 412 ⁇ 21(1992)), on beads (eg . Urn, Nature 354 82-84 (1991)), on chips (e g , Fodor, Nature 364 555-556 (1993)), on bacte ⁇ a (e g , U S Patent No 5,223,409), on spores (e g.
- Albumm fusion proteins comprising at least a fragment or va ⁇ ant of a Therapeutic antibody may also be assayed for their specificity and affinity for a specific protein or epitope using or routinely modifying techniques described herein or otherwise known in the art
- the albumin fusion proteins compnsing at least a fragment or variant of an antibody that binds a Therapeutic protein may
- Immunoassays which can be used to analyze (lmmunospecific) binding and cross-reactivity include, but are not limited to, competitive and non-competitive assay systems using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometnc assays, fluorescent immunoassays, and protein A immunoassays, to name but a few Such assays are routine and well known in the art (see, e g , Ausubel et al, eds, 1994, Cunent Protocols in Molecular Biology, Vol 1, John Wiley & Sons, Inc , New York, which is inco ⁇ orated by reference herein in its entirety) Exemplary immunoassays are routine and well
- Immunoprecipitation protocols generally comp ⁇ se Iysing a population of cells in a lysis buffer such as R1PA buffer (1% NP-40 or Triton X-100, 1% sodium deoxycholate, 0 1% SDS, 0 15 M NaCI, 001 M sodium phosphate at pH 7 2, 1% Trasylol) supplemented with protein phosphatase and/or protease inhibitors (eg , EDTA, PMSF, aprotinm, sodium vanadate), adding the albumin fusion protein of the invention (e g , comprising at least a fragment or variant of an antibody that binds a Therapeutic protein) to the cell lysate, incubating for a period of time (eg , 1 to 4 hours) at 40 degrees C, adding sepharose beads coupled to an anti-albumin antibody, for example, to the cell lysate, incubating for about an hour or more at 40 degrees C, washing the beads tn lysis buffer and
- Western blot analysis generally comprises prepanng protein samples, electrophoresis of the protein samples in a polyacrylamide gel (e g , 8%- 20% SDS-PAGE depending on the molecular weight of the antigen), transfe ng the protein sample from the polyacrylamide gel to a membrane such as nitrocellulose, PVDF or nylon, blocking the membrane in blocking solution (eg , PBS with 3% BSA or non-fat milk), washing the membrane in washing buffer (e g , PBS-Tween 20), applying the albumin fusion protein of the invention (diluted in blocking buffer) to the membrane, washing the membrane in washing buffer, applying a secondary antibody (which recognizes the albumin fusion protein, e g , an anti- human serum albumin antibody) conjugated to an enzymatic substrate (e g , horseradish peroxidase or alkaline phosphatase) or radioactive molecule (e g , 32 P or l25 I) diluted in blocking buffer, washing the membrane in wash buffer
- ELISAs comprise prepanng antigen, coating the well of a 96-well microtiter plate with the antigen, washing away antigen that did not bind the wells, adding the albumin fusion protein (e g , comprising at least a fragment or variant of an antibody that binds a Therapeutic protein) of the invention conjugated to a detectable compound such as an enzymatic substrate (eg , horseradish peroxidase or alkaline phosphatase) to the wells and incubating for a period of time, washing away unbound or non-specifically bound albumin fusion proteins, and detecting the presence of the albumin fusion proteins specifically bound to the antigen coating the well
- a second antibody which recognizes albumin fusion protein conjugated to a detectable compound may be added to the well
- the albumin fusion protein may be coated to the well
- the binding affinity of an albumin fusion protein to a protein, antigen, or epitope and the off-rate of an albumin fusion protem- protein antigen/epitope interaction can be determined by competitive binding assays
- a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen (e g , 3 H or 12S I) with the albumin fusion protein of the invention in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen
- the affinity of the albumin fusion protein for a specific protein, antigen, or epitope and the binding off-rates can be determined from the data by Scatchard plot analysis Competition with a second protein that binds the same protein, antigen or epitope as the albumin fusion protein, can also be determined using radioimmunoassays In this case, the protein, antigen or epitope is incubated with an albumin fusion protein conjugated to a labele
- BIAcore kinetic analysis is used to determine the binding on and off rates of albumin fusion proteins of the invention to a protein
- antigen or epitope BIAcore kinetic analysis comprises analyzing the binding and dissociation of albumin fusion proteins, or specific polypeptides, antigens or epitopes from chips with immobilized specific polypeptides, antigens or epitopes or albumin fusion proteins, respectively, on their surface
- Antibodies that bind a Therapeutic protein conesponding to the Therapeutic protein portion of an albumin fusion protein may also be described or specified in terms of their binding affinity for a given protein or antigen, preferably the antigen which they specifically bind
- Prefened binding affinities include those with a dissociation constant or Kd less than 5 X 10 2 M, 10 2 M, 5 X 10 3 M, 10 3 M, 5 X 10 "4 M, 10"* M
- More prefened binding affinities include those with a dissociation constant or Kd less than 5 X 10 5 M, 10 5 M, 5 X 10 M, 10 " *M, 5 X 10 7 M, 10 7 M, 5 X 10 s M or l0 8 M
- Even more preferred binding affinities include those with a dissociation constant or Kd less than 5 X 10 ' M, 10 ' M, 5 X 10 10 M, 10 " M, 5 X 10 12 M, 1IM2 M, 5 X
- An additional embodiment comprises at least a fragment or va ⁇ ant of a Therapeutic protein and at least a fragment or va ⁇ ant of human serum albumin, which are linked to one another by chemical conjugation
- HSA human serum albumin
- HA human albumin
- albumin and serum albumin are broader, and encompass human serum albumin (and fragments and variants thereof) as well as albumin from other species (and fragments and variants thereof)
- albumin refers collectively to albumin protein or amino acid sequence, or an albumin fragment or variant, having one or more functional activities (e g , biological activities) of albumin
- albumin refers to human albumin or fragments thereof (see for example, EP 201 239, EP 322 094 WO 97/24445, W095/23857) especially the mature form of human albumin as shown in Figure 1 and SEQ ID NO 1 , or albumin from other vertebrates or fragments thereof, or analogs or variants of these molecules or fragments thereof
- the human serum albumin protein used in the albumin fusion proteins of the invention contains one or both of the following sets of point mutations with reference to SEQ ID NO 1 Leu-407 to Ala, Leu-408 to Val, Val-409 to Ala, and Arg-410 to Ala, or Arg- 410 to A, Lys-413 to Gin, and Lys-414 to Gin (see, e g ,
- a portion of albumin sufficient to prolong the therapeutic activity or plasma stability or shelf-life of the Therapeutic protein refers to a portion of albumin sufficient in length or structure to stabilize or prolong the therapeutic activity or plasma stability ofthe protein so that the shelf life or plasma stability of the Therapeutic protein portion of the albumin fusion protein is prolonged or extended compared to the shelf-life or plasma stability in the non-fusion state
- the albumin portion of the albumin fusion proteins may comprise the full length of the HA sequence as described above, or may include one or more fragments thereof that are capable of stabilizing or prolonging the therapeutic activity Such fragments may be of 10 or more amino acids in length or may include about 15, 20, 25, 30, 50, or more contiguous amino acids from the HA sequence or may include part or all of specific domains of HA For instance, one or more fragments of HA spanning the first two lmmu ⁇ oglobuhn- hke domains may be used In a prefened embodiment, the HA fragment is the mature form of HA
- the albumin portion of the albumm fusion proteins of the invention may be a variant of normal HA
- the Therapeutic protein portion of the albumin fusion proteins of the invention may also be vanants of the Therapeutic proteins as described herein
- the term "va ⁇ ants” includes insertions, deletions and substitutions, either conservative or non conservative, where such changes do not substantially alter one or more of the oncotic, useful ligand-binding and non-immunogenic properties of albumin, or the active site, or active domain which confers the therapeutic activities ofthe Therapeutic proteins
- the albumin fusion proteins of the invention may include naturally occumng polymo ⁇ hic variants of human albumin and fragments of human albumin, for example those fragments disclosed in EP 322 094 (namely HA (Pn), where n is 369 to 419)
- the albumin may be derived from any vertebrate, especially any mammal, for example human, cow, sheep, or pig Non-mammalian albumins include, but are not limited to, hen and salmon
- the albumin portion ofthe albumin fusion protein may be from a different animal than the Therapeutic protein portion )0141]
- an HA fragment or va ⁇ ant will be at least 100 amino acids long, preferably at least 150 amino acids long
- the HA vanant may consist of or alternatively compnse at least one whole domain of HA, for example domains 1 (amino acids 1-194 of SEQ ID NO 1), domain 2 (amino acids 195-387 of SEQ ID NO 1), domain 3 (amino acids 388-585 of
- the albumin portion of an albumin fusion protein of the invention compnses at least one subdomain or domain of HA or conservative modifications thereof If the fusion is based on subdomains, some or all of the adjacent linker is preferably used to link to the Therapeutic protein moiety
- Antibodies that Specifically bind Therapeutic proteins are also Therapeutic proteins
- the present invention also encompasses albumm fusion proteins that comprise at least a fragment or vanant of an antibody that specifically binds a Therapeutic protein disclosed in Table 1 It is specifically contemplated that the term "Therapeutic protein” encompasses antibodies that bind a Therapeutic protein (e g , as Described in column I of Table 1) and fragments and va ⁇ ants thereof
- an albumin fusion protein ofthe invention may contain at least a fragment or variant of a Therapeutic protein, and/or at least a fragment or variant of an antibody that binds a Therapeutic protein Antibody structure and background
- the basic antibody structural unit is known to comprise a tetramer Each tetramer is
- an intact IgG antibody has two binding sites Except in bifunctional or bispecific antibodies, the two binding sites are the same
- the chains all exhibit the same general structure of relatively conserved framework regions (FR) joined by three hyperva ⁇ able regions, also called complementarity determining regions or CDRs
- the CDR regions are the portions of the antibody which make contact with the antigen and determine its specificity
- the CDRs from the heavy and the light chains of each pair are aligned by the framework regions, enabling binding to a specific epitope From N-terminal to C-terminal, both light and heavy chains variable regions comp ⁇ se the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4
- the variable regions are connected to the heavy or light chain constant region
- the assignment of amino acids to each domain is in accordance with the definitions of Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md (1987 and 1991)), or Chothia & Lesk J Mol Bio
- antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, I e , molecules that contain an antigen binding site that specifically binds an antigen (e g , a molecule containing one or more CDR regions of an antibody)
- Antibodies that may conespond to a Therapeutic protein portion of an albumin fusion protein include, but are not limited to, monoclonal, multispecific, human, humanized or chimeric antibodies, single chain antibodies (e g , single chain Fvs), Fab fragments, F(ab') fragments, fragments produced by a Fab expression library, anti-idiotypic (anti-Id) antibodies (including, e g , anti-Id antibodies specific to antibodies of the invention), and epitope-binding fragments of any ofthe above (e g , VH domains, VL domains, or one or more CDR regions) Antibodies that bind Therapeutic Proteins
- the present invention encompasses albumin molecules and immunologically active
- the antibody molecules that bind to a Therapeutic protein and that may conespond to a Therapeutic protein portion of an albumin fusion protein of the invention can be of any type (e g , IgG, IgE, IgM, IgD, IgA and IgY), class (e g , IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass of immunoglobulin molecule
- the antibody molecules that bind to a Therapeutic protein and that may conespond to a Therapeutic protein portion of an albumin fusion protein are IgGl
- the immunoglobulin molecules that bind to a Therapeutic protein and that may conespond to a Therapeutic protein portion of an albumin fusion protein are IgG2
- the immunoglobulin molecules that bind to a Therapeutic protein and that may conespond to a Therapeutic protein portion of an albumin fusion protein are IgG4
- the antibodies that bind to a Therapeutic protein and that may conespond to a Therapeutic protein portion of an albumin fusion protein are human antigen-binding antibody fragments of the present invention and include, but are not limited to, Fab, Fab' and F(ab')2, Fd, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv) and fragments comprising either a VL or VH domain
- Antigen-binding antibody fragments, including single-chain antibodies may comprise the vanable reg ⁇ on(s) alone or in combination with the entirety or a portion of the following hinge region, CHI, CH2, and CH3 domains
- the antibodies that bind to a Therapeutic protein and that may conespond to a Therapeutic protein portion of an albumin fusion protein may be monospecific, bispecific, tnspecific or of greater multispecificity Multispecific antibodies may be specific for different epitopes of a Therapeutic protein or may be specific for both a Therapeutic protein as well as for a heterologous epitope, such as a heterologous polypeptide or solid support material See, e g , PCT publications WO 93/17715, WO 92/08802, WO 91/00360, WO 92/05793, Tutt, et al , J Immunol 147 60-69 (1991), U S Patent Nos 4,474,893, 4,714,681, 4,925,648, 5,573,920, 5,601,819, Kostelny et al , J Immunol 148 1547-1553 (1992) [0153] Antibodies that bind a Therapeutic protein (or fragment or variant thereof) may be bispecific or bifunctional which means
- bispecific antibodies may be formed as "diabodies” (Holhger et al "'Diabodies' small bivalent and bispecific antibody fragments” PNAS USA 90 6444-6448 (1993)) or "Janusins” (Traunecker et al "Bispecific single chain molecules (Janusins) target cytotoxic lymphocytes on HIV infected cells” EMBO J 10 3655-3659 (1991) and Traunecker et al "Janusin new molecular design for bispecific reagents" Int J Cancer Suppl 7 51-52 (1992))
- the present invention also provides albumin fusion proteins that compnse, fragments or variants (including denvatives) of an antibody described herein or known elsewhere in the art Standard techniques known to those of skill in the art can be used to introduce mutations in the nucleotide sequence encoding a molecule of the invention, including, for example, site-directed mutagenesis and PCR-mediated mutagenesis which result in amino acid substitutions
- the variants (including derivatives) encode less than 50 ammo acid substitutions, less than 40 amino acid substitutions, less than 30 amino acid substitutions, less than 25 ammo acid substitutions, less than 20 amino acid substitutions, less than 15 amino acid substitutions, less than 10 amino acid substitutions, less than 5 amino acid substitutions, less than 4 amino acid substitutions, less than 3 amino acid substitutions, or less than 2 amino acid substitutions relative to the reference VH domain, VHCDRI, VHCDR2, VHCDR3, VL domain, VLCDR1, VLCDR2, or VLCDR3
- VHCDRI amino acid substitution
- Antibodies that bind to a Therapeutic protein and that may conespond to a Therapeutic protein portion of an albumin fusion protein may be descnbed or specified in terms of the ep ⁇ tope(s) or port ⁇ on(s) of a Therapeutic protein which they recognize or specifically bind Antibodies which specifically bind a Therapeutic protein or a specific epitope of a Therapeutic protein may also be excluded Therefore, the present invention encompasses antibodies that specifically bind Therapeutic proteins, and allows for the exclusion of the same
- albumin fusion proteins comprising at least a fragment or variant of an antibody that binds a Therapeutic protein, binds the same epitopes as the unfused fragment or variant of that antibody itself
- Antibodies that bind to a Therapeutic protein and that may conespond to a Therapeutic protein portion of an albumin fusion protein may also be described or specified in terms of their cross-reactivity
- Antibodies that do not bind any other analog, ortholog, or homolog of a Therapeutic protein are included
- Antibodies that bind polypeptides with at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, and at least 50% sequence identity (as calculated using methods known in the art and described herein) to a Therapeutic protein are also included in the present invention
- antibodies that bind to a Therapeutic protein and that may conespond to a Therapeutic protein portion of an albumin fusion protein cross-react with murine, rat and/or rabbit homologs of human proteins and the conesponding epitopes thereof
- antibodies which bind polypeptides encoded by polynucleotides which hybridize to a polynucleotide encoding a Therapeutic protein under stringent hybridization conditions (as described herein)
- Antibodies that bind to a Therapeutic protein and that may conespond to a Therapeutic protein portion of an albumin fusion protein of the invention may also be descnbed or specified in terms of their binding affinity to a polypeptide of the invention
- Prefened binding affinities include those with a dissociation constant or Kd less than 5 X 10 2 M, 10 2 M, 5 X 10 3 M, 10 3 M, 5 X 10 "4 M, 10 4 M
- More prefened binding affinities include those with a dissociation constant or Kd less than 5 X 10 5 M, 10 5 M, 5 X 10 6 M, 10 "M, 5 X 10 7 M, 10' M, 5 X 10 8 M or 10 8 M
- Even more prefened binding affinities include those with a dissociation
- the invention also provides antibodies that competitively inhibit binding of an antibody to an epitope of a Therapeutic protein as determined by any method known in the art for determining competitive binding, for example, the immunoassays descnbed herein
- the antibody competitively inhibits binding to the epitope by at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 60%, or at least 50%
- albumin fusion proteins comprising at least a fragment or variant of an antibody that binds a Therapeutic protein, competitively inhibits binding of a second antibody to an epitope of a Therapeutic protein
- albumin fusion proteins comprising at least a fragment or variant of an antibody that binds a Therapeutic protein, competitively inhibits binding of a second antibody to an epitope of a Therapeutic protein by at least 95%, at least 90%, at least 85 %, at least 80%, at least 75%, at least 70%, at least 60%, or
- Antibodies that bind to a Therapeutic protein and that may conespond to a Therapeutic protein portion of an albumin fusion protein of the invention may act as agonists or antagonists of the Therapeutic protein
- the present invention includes antibodies which disrupt the receptor/ligand interactions with the polypeptides of the invention either partially or fully
- the invention features both receptor-specific antibodies and ligand-specific antibodies
- the invention also features receptor-specific antibodies which do not prevent ligand binding but prevent receptor activation Receptor activation (I e , signaling) may be determined by techniques described herein or otherwise known m the art
- receptor activation can be determined by detecting the phosphorylation (e g , tyrosine or se ⁇ ne/threonine) of the receptor or its substrate by immunoprecipitation followed by western blot analysis (for example, as described supra)
- antibodies are provided that inhibit gand activity or receptor activity by at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%,
- Antibodies that bind to a Therapeutic protein and that may conespond to a Therapeutic protein portion of an albumin fusion protein include de ⁇ vatives that are modified, i e , by the covalent attachment of any type of molecule to the antibody
- the antibody derivatives include antibodies that have been modified, e g , by glycosylation, acetylation, pegylation, phosphorylation, amidation, denvatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc Any of numerous chemical modifications may be earned out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc Additionally, the denvative may contain one or more non-classical amino acids Albumin fusion proteins ofthe invention may also be modified as described above Methods of Producing Antibodies that bind Therapeutic Proteins [0163] The antibodies that bind to a Therapeutic Proteins
- Monoclonal antibodies can be prepared using a wide variety of techniques known in the art including the use of hyb ⁇ doma, recombinant, and phage display technologies, or a combination thereof
- monoclonal antibodies can be produced using hyb ⁇ doma techniques including those known in the art and taught, for example, in Harlow et al , Antibodies A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed 1988), Hammer ng, et al , in Monoclonal Antibodies and T-Cell Hybridomas 563-681 (Elsevier, N Y , 1981) (said references inco ⁇ orated by reference in their entireties)
- the term "monoclonal antibody” as used herein is not limited to antibodies produced through hybndoma technology
- the tenn "monoclonal antibody” refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clon
- mice can be immunized with a Therapeutic protein or fragment or variant thereof, an albumin fusion protein, or a cell expressing such a Therapeutic protein or fragment or variant thereof or albumin fusion protein
- an immune response e g
- antibodies specific for the antigen are detected in the mouse serum
- the mouse spleen is harvested and splenocytes isolated
- the splenocytes are then fused by well known techniques to any suitable myeloma cells, for example cells from cell line SP20 available from the ATCC Hybridomas are selected and cloned by limited dilution
- the hybridoma clones are then assayed by methods known in the art for cells that secrete antibodies capable of binding a polypeptide ofthe invention
- Ascites fluid which generally contains high levels of antibodies, can be generated by immunizing mice with positive hybridoma clones
- the present invention provides methods of generating monoclonal antibodies as well as antibodies produced by the method compnsing culturing a hybridoma cell secreting an antibody wherein, preferably, the hybridoma is generated by fusing splenocytes isolated from a mouse immunized with an antigen of the invention with myeloma cells and then screening the hybridomas resulting from the fusion for hybridoma clones that secrete an antibody able to bind a polypeptide ofthe invention
- EBV Epstein Ban Virus
- B cells for transformation are commonly human peripheral blood, but B cells for transformation may also be derived from other sources including, but not limited to, lymph nodes, tonsil, spleen, tumor tissue, and infected tissues Tissues are generally made into single cell suspensions prior to EBV transformation Additionally, steps may be taken to either physically remove or inactivate T cells (e g , by treatment with cyclospo ⁇ n A) in B cell-containing samples, because T cells from individuals seropositive for anti-EBV antibodies can suppress B cell immortalization by EBV [0168]
- Antibody fragments which recognize specific epitopes may be generated by known techniques
- Fab and F(ab')2 fragments of the invention may be produced by proteolytic cleavage of immunoglobulin molecules, using enzymes such as papam (to produce Fab fragments) or pepsin (to produce F(ab')2 fragments)
- F(ab')2 fragments contain the vanable region, the light chain constant region and the CHI domain of the heavy chain
- antibodies that bind to a Therapeutic protein can also be generated using various phage display methods known in the art
- phage display methods functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them
- such phage can be utilized to display antigen binding domains expressed from a repertoire or combinatorial antibody library (e g , human or murine)
- Phage expressing an antigen binding domain that binds the antigen of interest can be selected or identified with antigen, e g , using labeled antigen or antigen bound or captured to a solid surface or bead
- Phage used in these methods are typically filamentous phage including fd and Ml 3 binding domains expressed from phage with Fab, Fv or disulfide stabilized Fv antibody domains recombinantly fused to either the phage gene III or gene VIII protein
- Examples of phage display methods that can be used to make antibodies that bind to a Therapeutic protein include those
- the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including human antibodies, or any other desired antigen binding fragment, and expressed in any desired host, including mammalian cells, insect cells, plant cells, yeast, and bacteria, e g , as described in detail below
- techniques to recombinantly produce Fab, Fab' and F(ab')2 fragments can also be employed using methods known in the art such as those disclosed in PCT publication WO 92/22324, Mulhnax et al , BioTech ques 12(6) 864-869 (1992), and Sawai et al , AJRI 34 26-34 (1995), and Better et al , Science 240 1041-1043 (1988) (said references inco ⁇ orated by reference in their entireties)
- Completely human antibodies which recognize a selected epitope can be generated using a technique refened to as "guided selection" In this approach a selected non-human monoclonal antibody, e g , a mouse antibody, is used to guide the selection of a completely human antibody recognizing the same epitope (Jespers et al , Bio/technology 12 899-903 (1988)) Polynucleotides Encoding Antibodies [0176]
- the invention further provides polynucleotides comprising a nucleotide sequence encoding an antibody and fragments thereof
- the invention also encompasses polynucleotides that hybridize under st ⁇ ngent or alternatively, under lower stringency hybridization conditions, e g , as defined supra, to polynucleotides that encode an antibody, preferably, that specifically binds to a Therapeutic protein, and more preferably, an antibody that binds to a polypeptide having the amino acid sequence of a "Therapeutic protein X" as disclosed in the
- the polynucleotides may be obtained, and the nucleotide sequence of the polynucleotides determined, by any method known in the art
- a polynucleotide encoding the antibody may be assembled from chemically synthesized oligonucleotides (e g , as described in Kutmeier et al , BioTechmques 17 242 (1994)), which, bnefly, involves the synthesis of overlapping oligonucleotides containing portions of the sequence encoding the antibody, annealing and ligating of those oligonucleotides, and then amplification of the ligated oligonucleotides by PCR
- a polynucleotide encoding an antibody may be generated from nucleic acid from a suitable source If a clone containing a nucleic acid encoding a particular antibody is not available, but the sequence of the antibody molecule is known, a nucleic acid encoding the immunoglobulin may be chemically synthesized or obtained from a suitable source (e g , an antibody cDNA library, or a cDNA library generated from, or nucleic acid, preferably poly A+ RNA, isolated from, any tissue or cells expressing the antibody, such as hybridoma cells selected to express an antibody) by PCR amplification using synthetic primers hyb ⁇ dizable to the 3' and 5' ends of the sequence or by cloning using an oligonucleotide probe specific for the particular gene sequence to identify, e g , a cDNA clone from a cDNA library that encodes the antibody Amplified nucleic acids generated by a suitable source (e
- nucleotide sequence and conesponding amino acid sequence of the antibody may be manipulated using methods well known in the art for the manipulation of nucleotide sequences, e g , recombinant DNA techniques, site directed mutagenesis, PCR, etc (see, for example, the techniques described in Sambrook et al , 1990, Molecular Cloning, A Laboratory Manual, 2d Ed , Cold Sp ⁇ ng Harbor Laboratory, Cold Spring Harbor, NY and Ausubel et al , eds , 1998, Cunent Protocols in Molecular Biology, John Wiley & Sons, NY, which are both inco ⁇ orated by reference herein m their entireties ), to generate antibodies having a different amino acid sequence, for example to create ammo acid substitutions, deletions, and/or insertions [0180]
- the amino acid sequence of the heavy and/or light chain variable domains may be inspected to identify the amino acid sequence of the heavy and/or light chain variable domains.
- the expression vector is transfened to a host cell by conventional techniques and the transfected cells are then cultured by conventional techniques to produce an antibody
- the invention includes host cells containing a polynucleotide encoding an antibody of the invention, or a heavy or light chain thereof, or a single chain antibody, operably linked to a heterologous promoter
- vectors encoding both the heavy and light chains may be co-expressed in the host cell for expression of the entire immunoglobulin molecule, as detailed below
- host-expression vector systems may be utilized to express the antibody molecules of the invention.
- Such host-expression systems represent vehicles by which the coding sequences of interest may be produced and subsequently purified, but also represent cells which may, when transformed or transfected with the appropriate nucleotide coding sequences, express an antibody molecule of the invention in situ
- microorganisms such as bacteria (e g , E coli, B subtihs) transformed with recombinant bacte ⁇ ophage DNA, plasmid DNA or cosmid DNA expression vectors containing antibody coding sequences, yeast (e g , Saccharomyces, Pichia) transformed with recombinant yeast expression vectors containing antibody coding sequences, insect cell systems infected with recombinant virus expression vectors (e g , baculovirus) containing antibody coding sequences, plant cell systems infected with recombinant virus expression vectors (e g , cauliflower mosaic virus, CaMV, tobacco
- a number of expression vectors may be advantageously selected depending upon the use intended for the antibody molecule being expressed
- vectors which direct the expression of high levels of fusion protein products that are readily purified may be desirable
- Such vectors include, but are not limited, to the E coli expression vector pUR278 (Ruther et al , EMBO J 2 1791 (1983)), in which the antibody coding sequence may be ligated individually into the vector in frame with the lac Z coding region so that a fusion protein is produced, pIN vectors (Inouye & Inouye, Nucleic Acids Res 13 3101-3109 (1985), Van Heeke & Schuster, J Biol Chem 24 5503-5509 (1989)), and the like pGEX vectors may also be used to express foreign polypeptides as fusion proteins with glutathione S-transferase
- Autographa californica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign genes
- the virus grows in Spodoptera frug ⁇ erda cells
- the antibody coding sequence may be cloned individually into non-essential regions (for example the polyhed ⁇ n gene) of the virus and placed under control of an AcNPV promoter (for example the polyhed ⁇ n promoter)
- the antibody coding sequence of interest may be ligated to an adenovirus transcription/translation control complex, e g , the late promoter and tripartite leader sequence
- This chime ⁇ c gene may then be inserted in the adenovirus genome by in vitro or in vivo recombination Insertion in a non- essential region of the viral genome (e g , region El or E3) will result m a recombinant virus that is viable and capable of expressing the antibody molecule in infected hosts (e g , see Logan & Shenk, Proc Natl Acad Sci USA 81 355-359 (1984))
- Specific initiation signals may also be required for efficient translation of inserted antibody coding sequences These signals include the ATG initiation codon and adjacent sequences Furthermore, the initiation codon must be in phase with the reading frame of the desired
- a host cell strain may be chosen which modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired Such modifications (e g , glycosylation) and processing (e g , cleavage) of protein products may be important for the function of the protein
- Different host cells have characte ⁇ stic and specific mechanisms for the post-translational processing and modification of proteins and gene products
- Appropriate cell lines or host systems can be chosen to ensure the conect modification and processing of the foreign protein expressed
- eukaryotic host cells which possess the cellular machinery for proper processing of the primary transcript, glycosylation, and phosphorylation of the gene product may be used
- mammalian host cells include but are not limited to CHO, VERY, BHK, Hela, COS, MDCK, 293, 3T3, WI38, and in particular, breast cancer cell lines such as, for example, BT483, Hs578T, HTB2, BT20 and T47D, and normal mammary gland cell
- cell lines which stably express the antibody molecule may be engineered Rather than using expression vectors which contain viral origins of replication, host cells can be transformed with DNA controlled by appropriate expression control elements (e g , promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc ), and a selectable marker Following the introduction of the foreign DNA, engineered cells may be allowed to grow for
- the selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci which in turn can be cloned and expanded into cell lines
- This method may advantageously be used to engineer cell lines which express the antibody molecule
- Such engineered cell lines may be particularly useful in screening and evaluation of compounds that interact directly or indirectly with the antibody molecule (0191)
- a number of selection systems may be used, including but not limited to the he ⁇ es simplex virus thymidine kinase (Wigler et al , Cell
- hypoxanthine-guanme phosphonbosyltransferase (Szybalska & Szybalski, Proc Natl Acad Sci USA 48 202 (1992)), and adenine phospho ⁇ bosyltransferase (Lowy et al , Cell 22 817 (1980)) genes can be employed in tk-, hgprt- or aprt- cells, respectively
- antimetabolite resistance can be used as the basis of selection for the following genes dhfr, which confers resistance to methotrexate (Wigler et al , Natl Acad Sci USA 77 357 (1980), O'Hare et al , Proc Natl Acad Sci USA 78 1527 (1981)), gpt, which confers resistance to mycophenolic acid (Mulligan & Berg, Proc Natl Acad Sci USA 78 2072 (1981)), neo, which confers resistance to mycophenolic
- the expression levels of an antibody molecule can be increased by vector amplification (for a review, see Bebbington and Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Vol 3 (Academic Press, New York, 1987))
- vector amplification for a review, see Bebbington and Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Vol 3 (Academic Press, New York, 1987)
- a marker in the vector system expressing antibody When a marker in the vector system expressing antibody is amplifiable, increase in the level of inhibitor present in culture of host cell will increase the number of copies of the marker gene Since the amplified region is associated with the antibody gene, production of the antibody will also increase (Crouse et al , Mol Cell Biol 3 257 (1983))
- Glutaminase GS
- DHFR DHFR
- An advantage of glutamine synthase based vectors are the availability of cell lines (e g , the mu ⁇ ne myeloma cell line, NS0) which are glutamine synthase negative Glutamine synthase expression systems can also function in glutamine synthase expressing cells (e g Chinese Hamster Ovary (CHO) cells) by providing additional inhibitor to prevent the functioning of the endogenous gene
- a glutamine synthase expression system and components thereof are detailed in PCT publications WO87/04462, WO86/05807, WO89/01036, WO89/10404, and WO91/06657 which are inco ⁇ orated in their entireties by reference herein Additionally, glutamine synthase expression vectors that may be used according to the present invention are commercially available from suppliers, including,
- the host cell may be co-transfected with two expression vectors of the invention, the first vector encoding a heavy chain denved polypeptide and the second vector encoding a light chain derived polypeptide
- the two vectors may contain identical selectable markers which enable equal expression of heavy and light chain polypeptides
- a single vector may be used which encodes, and is capable of expressing, both heavy and light chain polypeptides In such situations, the light chain should be placed before the heavy chain to avoid an excess of toxic free heavy chain (Proudfoot, Nature 322 52 (1986), Kohler, Proc Natl Acad Sci USA 77 2197 (1980))
- the coding sequences for the heavy and light chains may comprise cDNA or genomic DNA
- an antibody molecule of the invention may be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e g , ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins
- the antibodies that bind to a Therapeutic protein and that may conespond to a Therapeutic protein portion of an albumin fusion protein of the invention or fragments thereof can be fused to heterologous polypeptide sequences described herein or otherwise known in the art, to facilitate purification
- Antibodies that bind a Therapeutic protein or fragments or variants can be fused to marker sequences, such as a peptide to facilitate purification
- the marker amino acid sequence is a hexa-h
- the present invention further encompasses antibodies or fragments thereof conjugated to a diagnostic or therapeutic agent
- the antibodies can be used diagnostically to, for example, monitor the development or progression of a tumor as part of a clinical testing procedure to, e g , determine the efficacy of a given treatment regimen Detection can be facilitated by coupling the antibody to a detectable substance
- detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals using various positron emission tomographies, and nonradioactive paramagnetic metal ions
- the detectable substance may be coupled or conjugated either directly to the antibody (or fragment thereof) or indirectly, through an intermediate (such as, for example, a linker known in the art) using techniques known in the art See, for example, U S Patent No 4,741,900 for metal ions which can be conjugated to antibodies for use as diagnostics according to the present invention
- suitable enzymes include horseradish peroxidase, alkaline
- the conjugates of the invention can be used for modifying a given biological response, the therapeutic agent or drug moiety is not to be construed as limited to classical chemical therapeutic agents
- the drug moiety may be a protein or polypeptide possessing a desired biological activity
- proteins may include, for example, a toxin such as ab ⁇ n, ncin A, pseudomonas exotoxin, or diphthena toxin, a protein such as tumor necrosis factor, alpha-interferon, ⁇ -interferon, nerve growth factor, platelet derived growth factor, tissue plasminogen activator, an apoptotic agent, e g , TNF-alpha, TNF-beta, AIM I (See, International Publication No WO 97/33899), ADM II (See, International Publication No WO 97/34911), Fas Ligand (Takahashi et al , Int Immunol, 6 1567-1574 (1994)), VEGI (See,
- Antibodies may also be attached to solid supports, which are particularly useful for immunoassays or purification of the target antigen
- solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chlo ⁇ de or polypropylene
- Techniques for conjugating such therapeutic moiety to antibodies are well known See, for example, Amon et al , "Monoclonal Antibodies For Immunotargetmg Of Drugs In Cancer Therapy", in Monoclonal Antibodies And Cancer Therapy, Reisfeld et al (eds ), pp 243-56 (Alan R Liss, Inc 1985), Hellstrom et al , "Antibodies For Drug Delivery", in Controlled Drug Delivery (2nd Ed ), Robinson et al (eds ), pp 623- 53 (Marcel Dekker, Inc 1987), Tho ⁇ e, "Antibody Camers Of Cytotoxic Agents In Cancer Therapy A Review", in Monoclonal Antibodies
- an antibody can be conjugated to a second antibody to form an antibody heteroconjugate as described by Segal in U S Patent No 4,676,980, which is inco ⁇ orated herein by reference in its entirety
- an antibody, with or without a therapeutic moiety conjugated to it, administered alone or in combination with cytotoxic factor(s) and/or cytok ⁇ ne(s) can be used as a therapeutic Antibody-albumin fusion
- Antibodies that bind to a Therapeutic protein and that may conespond to a Therapeutic protein portion of an albumin fusion protein of the invention include, but are not limited to, antibodies that bind a Therapeutic protein disclosed in the "Therapeutic Protein X" column of Table 1, or a fragment or va ⁇ ant thereof
- the fragment or va ⁇ ant of an antibody that immunospecifcally binds a Therapeutic protein and that conesponds to a Therapeutic protein portion of an albumin fusion protein comprises, or alternatively consists of, the VH domain
- the fragment or variant of an antibody that immunospecifcally binds a Therapeutic protein and that conesponds to a Therapeutic protein portion of an albumin fusion protein comprises, or alternatively consists of, one, two or three VH CDRs
- the fragment or va ⁇ ant of an antibody that immunospecifcally binds a Therapeutic protein and that conesponds to a Therapeutic protein portion of an albumin fusion protein comprises, or alternatively consists of, the VH CDR1
- the fragment or variant of an antibody that immunospecifcally binds a Therapeutic protein and that conesponds to a Therapeutic protein portion of an albumin fusion protein comprises, or alternatively consists of, the VH CDR2
- the fragment or va ⁇ ant of an antibody that lmmunospecifically binds a Therapeutic protein and that conesponds to a Therapeutic protein portion of an albumin fusion protein comprises, or alternatively consists of, an scFv compnsing the VH domain of the Therapeutic antibody, linked to the VL domain ofthe therapeutic antibody by a peptide linker such as (Gly Ser) 3 (SEQ ID NO 4) Im unophenotyping
- the antibodies of the invention or albumin fusion proteins of the invention comprising at least a fragment or variant of an antibody that binds a Therapeutic protein (or fragment or variant thereof) may be utilized for immunophenotyping of cell lines and biological samples
- Therapeutic proteins of the present invention may be useful as cell-specific markers, or more specifically as cellular markers that are differentially expressed at various stages of differentiation and or maturation of particular cell types
- Monoclonal antibodies (or albumin fusion proteins compnsing at least a fragment or variant of an antibody that binds a Therapeutic protein) directed against a specific epitope, or combination of epitopes, will allow for the screening of cellular populations expressing the marker
- Various techniques can be utilized using monoclonal antibodies (or albumm fusion proteins compnsing at least a fragment or va ⁇ ant of an antibody that binds a Therapeutic protein) to screen for cellular populations expressing the marker(s), and include magnetic separation using antibody-coated magnetic beads, "panning" with antibody attached to a solid mat ⁇ x (I
- Lam Nature 354 82-84 (1991)), on chips (eg , Fodor, Nature 364 555-556 (1993)), on bacteria (e g U S Patent No 5,223,409), on spores (e g . Patent Nos 5,571,698, 5,403,484, and 5,223,409), on plasmids (eg .
- the antibodies of the invention or albumin fusion proteins of the invention comprising at least a fragment or variant of an antibody that binds a Therapeutic protein (or fragment or variant thereof) may also be assayed for their specificity and affinity for a specific protein or epitope using or routinely modifying techniques described herein or otherwise known in the art
- the albumin fusion proteins of the invention compnsing at least a fragment or variant of an antibody that binds a Therapeutic protein may be assayed for cross-reactivity with other antigens (e g , molecules that have sequence/structure conservation with the molecule(s) specifically bound by the antibody that binds a Therapeutic protein (or fragment or variant thereof) conesponding to the Therapeutic protein portion of the albumin fusion protein ofthe invention) by any method known in the art
- Immunoassays which can be used to analyze (immunospecific) binding and cross-reactivity include, but are not limited to, competitive and non-competitive assay systems using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometnc assays, fluorescent immunoassays, and protein A immunoassays, to name but a few Such assays are routine and well known in the art (see, eg , Ausubel et al, eds, 1994, Cunent Protocols in Molecular Biology, Vol 1, John Wiley & Sons, Inc , New York, which is inco ⁇ orated by reference herein in its entirety) Exemplary immunoassays are described
- Immunoprecipitation protocols generally comprise lysing a population of cells in a lysis buffer such as RIPA buffer (1% NP-40 or Triton X-100, 1% sodium deoxycholate, 0 1% SDS, 0 15 M NaCI, 0 01 M sodium phosphate at pH 7 2, 1% Trasylol) supplemented with protein phosphatase and/or protease inhibitors (e g , EDTA, PMSF, aprotimn, sodium vanadate), adding an antibody of the invention or albumin fusion protein of the invention compnsing at least a fragment or variant of an antibody that binds a Therapeutic protein (or fragment or vanant thereof) to the cell lysate, incubating for a period of time (e , 1 to 4 hours) at 40 degrees C, adding protein A and/or protein G sepharose beads (or beads coated with an appropriate anti-idiotypic antibody or anti-albumin antibody in the case when an albumin fusion protein comprising at least
- Western blot analysis generally comp ⁇ ses preparing protein samples, electrophoresis ofthe protein samples in a polyacrylamide gel (e g , 8%- 20% SDS-PAGE depending on the molecular weight of the antigen), transfemng the protein sample from the polyacrylamide gel to a membrane such as nitrocellulose, PVDF or nylon, blocking the membrane in blocking solution (e g , PBS with 3% BSA or non-fat milk), washing the membrane in washing buffer (e g , PBS-Tween 20), applying the antibody or albumin fusion protein ofthe invention (diluted in blocking buffer) to the membrane, washing the membrane in washing buffer, applying a secondary antibody (which recognizes the albumin fusion protein, e g , an anti-human serum albumin antibody) conjugated to an enzymatic substrate (eg , horseradish peroxidase or alkaline phosphatase) or radioactive molecule (eg , 32 P or 125 I) diluted in blocking buffer, washing the membrane in wash
- ELISAs comprise preparing antigen, coating the well of a 96-well microtiter plate with the antigen, washing away antigen that did not bind the wells, adding the antibody or albumin fusion protein (comprising at least a fragment or vanant of an antibody that binds a Therapeutic protein) of the invention conjugated to a detectable compound such as an enzymatic substrate (e g , horseradish peroxidase or alkaline phosphatase) to the wells and incubating for a penod of time, washing away unbound or non-specifically bound albumin fusion proteins, and detecting the presence of the antibody or albumin fusion proteins specifically bound to the antigen coating the well
- a detectable compound such as an enzymatic substrate (e g , horseradish peroxidase or alkaline phosphatase)
- BIAcore kinetic analysis is used to determine the binding on and off rates of antibody or albumin fusion proteins of the invention to a protein
- antigen or epitope BIAcore kinetic analysis comprises analyzing the binding and dissociation of antibodies, albumin fusion proteins, or specific polypeptides, antigens or epitopes from chips with immobilized specific polypeptides, antigens or epitopes, antibodies or albumin fusion proteins, respectively, on their surface Therapeutic Uses
- the present invention is further directed to antibody-based therapies which involve administering antibodies of the invention or albumin fusion proteins of the invention comprising at least a fragment or variant of an antibody that binds a Therapeutic protein to an animal, preferably a mammal, and most preferably a human, patient for treating one or more of the disclosed diseases, disorders, or conditions
- Therapeutic compounds o ne invention inciu ⁇ e, u are o, an i o ies o e invention inc u ing , an
- Therapeutic protein may be provided in pharmaceutically acceptable compositions as known in the art or as descnbed herein
- the present invention is directed to antibody-based therapies which involve administe ⁇ ng antibodies of the invention or albumin fusion proteins of the invention compnsing at least a fragment or va ⁇ ant of an antibody that binds a
- Therapeutic protein to an animal, preferably a mammal, and most preferably a human, patient for treating one or more diseases, disorders, or conditions, including but not limited to neural disorders, immune system disorders, muscular disorders, reproductive disorders, gastrointestinal disorders, pulmonary disorders, cardiovascular disorders, renal disorders, proliferative disorders, and/or cancerous diseases and conditions , and/or as descnbed elsewhere herein
- Therapeutic compounds of the invention include, but are not limited to, antibodies ofthe invention (e , antibodies directed to the full length protein expressed on the cell surface of a mammalian cell, antibodies directed to an epitope of a Therapeutic protein and nucleic acids encoding antibodies of the invention (including fragments, analogs and derivatives thereof and anti-idiotypic antibodies as described herein)
- the antibodies ofthe invention can be used to treat, inhibit or prevent diseases, disorders or conditions associated with abenant expression and/or activity of a Therapeutic protein, including, but not limited to, any one or more of the diseases, disorders, or conditions described herein
- the treatment and/or prevention of diseases, disorders, or conditions associated with aberrant expression and/or activity of a Therapeutic protein includes, but is not limited to, alleviating symptoms associated with those diseases, disorders or conditions
- Antibodies of the invention or albumin fusion proteins of the invention compnsing at least a fragment or va ⁇ ant of an antibody that binds a Therapeutic protein may be provided in pharmaceutically acceptable compositions as known in the art or as described herein
- a summary of the ways in which the antibodies of the invention or albumin fusion proteins of the invention compnsing at least a fragment or variant of an antibody that binds a Therapeutic protein may be used therapeutically includes binding Therapeutic proteins locally or systemically in the body or by direct cytotoxicity of the antibody, e g as mediated by complement (CDC) or by effector cells (ADCC) Some of these approaches are described in more detail below Armed with the teachings provided herein, one of ordinary skill in the art will know how to use the antibodies of the invention or albumin fusion proteins of the invention comprising at least a fragment or vanant of an antibody that binds a
- Therapeutic protein for diagnostic, momton ⁇ g or therapeutic pu ⁇ oses without undue expenmentation
- the antibodies of the invention or albumin fusion proteins of the invention comprising at least a fragment or variant of an antibody that binds a Therapeutic protein may be advantageously utilized in combination with other monoclonal or chime ⁇ c antibodies, or with lymphokines or hematopoietic growth factors (such as, e g , IL-2, IL-3 and IL-7), for example, which serve to increase the number or activity of effector cells which interact with the antibodies
- the antibodies of the invention or albumin fusion proteins o the invention compnsing at least a fragment or variant of an antibody that binds a Therapeutic protein may be administered alone or m combination with other types of treatments (e g , radiation therapy, chemotherapy, hormonal therapy, immunotherapy and anti-tumor agents) Generally, administration of products of a species origin or species reactivity (in the case of antibodies) that is the same species as that of the patient is prefened Thus, in a prefened embodiment, human antibodies, fragments derivatives, analogs, or nucleic acids, are administered to a human patient for therapy or prophylaxis
- Prefened binding affinities include dissociation constants or Kd's less than 5 X 10 2 M, 10 2 M, 5 X 10 3 M, 10 3 M, 5 X 10" M, 10 "4 M More prefened binding affinities include those with a dissociation constant or Kd less than 5 X 10 5 M, 10 5 M, 5 X 10 6 M, 10 6 M, 5 X 10 7 M, 10 7 M, 5 X 10 8 M or 10 s M Even more prefened binding affin
- nucleic acids compnsing sequences encoding antibodies that bind therapeutic proteins or albumin fusion proteins compnsing at least a fragment or va ⁇ ant of an antibody that binds a Therapeutic protein are administered to treat, inhibit or prevent a disease or disorder associated with aberrant expression and/or activity of a Therapeutic protein, by way of gene therapy
- Gene therapy refers to therapy performed by the administration to a subject of an expressed or expressible nucleic acid
- the nucleic acids produce their encoded protein that mediates a therapeutic effect
- in vitro assays to demonstrate the therapeutic or prophylactic utility of a compound or pharmaceutical composition include, the effect of a compound on a cell line or a patient tissue sample
- the effect ofthe compound or composition on the cell line and/or tissue sample can be determined utilizing techniques known to those of skill in the art including, but not limited to, rosette formation assays and cell lysis assays
- in vitro assays which can be used to determine whether administration of a specific compound is indicated include in vitro cell culture assays in which a patient tissue sample is grown in culture, and exposed to or otherwise administered a compound, and the effect of such compound upon the
- Formulations and methods of administration that can be employed when the compound comprises a nucleic acid or an immunoglobulin are described above, additional approp ⁇ ate formulations and routes of administration can be selected from among those descnbed herein below
- Va ⁇ ous delivery systems are known and can be used to administer a compound of the invention, e g , encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the compound, receptor-mediated endocytosis (see, e g , Wu and Wu, J Biol Chem 262 4429-4432 ( 1987)), construction of a nucleic acid as part of a retroviral or other vector, etc
- Methods of introduction include but are not limited to intradermal, intramuscular, intrape ⁇ toneal, intravenous, subcutaneous, intranasal, epidural, and oral routes
- the compounds or compositions may be administered by any convenient route, for example by infusion or bolus injection, by abso
- the pharmaceutical compounds or compositions of the invention may be desirable to administer the pharmaceutical compounds or compositions of the invention locally to the area in need of treatment, this may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, e g , in conjunction with a wound dressing after surgery, by injection, by means of a catheter, by means of a suppository, or by means of an implant, said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers
- the compound or composition can be delivered in a vesicle, in particular a hposome (see Langer, Science 249 1527-1533 (1990), Treat et al , in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (
- the compound or composition can be delivered in a controlled release system
- a pump may be used (see Langer, supra, Sefton, CRC C ⁇ t Ref Biomed Eng 14 201 (1987), Buchwald et al , Surgery 88 507 (1980), Saudek et al , N Engl J Med 321 574 (1989))
- polymeric materials can be used (see Medical Applications of Controlled Release, Langer and Wise (eds ), CRC Pres , Boca Raton, Florida (1974), Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds ), Wiley, New York (1984), Ranger and Peppas, J , Macromol Sci Rev Macromol Chem 23 61 (1983), see also Levy et al , Science 228 190 (1985), During et al , Ann Neurol 25 351 (1989), Howard et al , J Neurosurg 71 105 (1985), During et al , Ann Neuro
- the nucleic acid can be administered in vivo to promote expression of its encoded protein, by constructing it as part of an appropriate nucleic acid expression vector and administering it so that it becomes intracellular, e g , by use of a retroviral vector (see U S Patent No 4,980,286), or by direct injection, or by use of microparticle bombardment (e g , a gene gun, Bio stic, Dupont), or coating with lipids or cell-surface receptors or transfectmg agents, or by administering it in linkage to a homeobox- like peptide which is known to enter the nucleus (see e g , Joliot et al , Proc Natl Acad Sci USA 88 1864-1868 (1991)), etc
- a nucleic acid can be introduced intracellulariy and inco ⁇ orated within host cell DNA for expression, by homolog
- compositions comprise a therapeutically effective amount of a compound, and a pharmaceutically acceptable earner
- pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U S Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans
- the term "earner” refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered
- Such pharmaceutical earners can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like Water is a prefened earner when the pharmaceutical composition is administered intravenously Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid earners, particularly for injectable solutions Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt,
- the composition is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings
- compositions for intravenous administration are solutions in stenle isotonic aqueous buffer
- the composition may also include a solubilizing agent and a local anesthetic such as gnocai ⁇ e to ease pain at the site of the injection
- the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophi zed powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent
- the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline
- an ampoule of stenle water for injection or saline can be provided so that the ingredients may be mixed prior to administration
- the compounds of the invention can be formulated as neutral or salt forms
- Pharmaceutically acceptable salts include those formed with anions such as those de ⁇ ved from hydrochloric, phosphoric, acetic, oxalic, tarta ⁇ c acids, etc , and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, feme hydroxides, isopropyiamine, t ⁇ ethylamine, 2-ethylam ⁇ no ethanol, histidine, procaine, etc
- the amount of the compound of the invention which will be effective in the treatment, inhibition and prevention of a disease or disorder associated with aberrant expression and/or activity of a Therapeutic protein can be determined by standard clinical techniques In addition, in vitro assays may optionally be employed to help identify optimal dosage ranges
- the precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances Effective doses may be extra
- the invention provides a diagnostic assay for diagnosing a disorder, comprising (a) assaying the expression of the Therapeutic protein in cells or body fluid of an individual using one or more antibodies specific to the Therapeutic protein or albumin fusion proteins comprising at least a fragment of variant of an antibody specific to a Therapeutic protein, and (b) compa ⁇ ng the level of gene expression with a standard gene expression level, whereby an increase or decrease in the assayed Therapeutic protein gene expression level compared to the standard expression level is indicative of a particular disorder
- the presence of a relatively high amount of transc ⁇ pt in biopsied tissue from an individual may indicate a predisposition for the development of the disease, or may provide a means for detecting the disease p ⁇ or to the appearance of actual clinical symptoms
- a more definitive diagnosis of this type may allow health professionals to employ preventative measures or aggressive treatment earlier thereby preventing the development or further progression of the cancer
- Antibodies of the invention or albumin fusion proteins comprising at least a fragment of variant of an antibody specific to a Therapeutic protein can be used to assay protein levels in a biological sample using classical immunohistological methods known to those of skill in the art (e g , see Jalkanen et al , J Cell Biol 101 976-985 (1985), Jalkane ⁇ et al , J Cell Biol 105 3087-3096 (1987))
- Other antibody-based methods useful for detecting protein gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA)
- Suitable antibody assay labels are known in the art and include enzyme labels, such as, glucose oxidase, radioisotopes, such as iodine (1251, 1211), carbon (14C), sulfur (35S), tritium (3H), indium (112In), and technetium (99Tc), luminescent labels, such as luminol, and fluorescent labels
- diagnosis comprises a) administe ⁇ ng (for example, parenterally, subcutaneously, or intrape ⁇ toneally) to a subject an effective amount of a labeled molecule which specifically binds to the polypeptide of interest, b) waiting for a time interval following the administering for permitting the labeled molecule to preferentially concentrate at sites in the subject where the Therapeutic protein is expressed (and for unbound labeled molecule to be cleared to background level), c) determining background level, and d) detecting the labeled molecule m the subject, such that detection of labeled molecule above the background level indicates that the subject has a particular disease or disorder associated with aberrant expression of the therapeutic protein Background level can be determined by various methods including, comparing the amount of labeled molecule detected to a standard value previously determined for a particular system
- the quantity of the subject and the imaging system used will determine the quantity of imaging moiety needed to produce diagnostic images
- the quantity of radioactivity injected will normally range from about 5 to 20 millicu ⁇ es of 99mTc
- the labeled antibody, antibody fragment, or albumin fusion protein compnsing at least a fragment or vanant of an antibody that binds a Therapeutic protein will then preferentially accumulate at the location of cells which contain the specific Therapeutic protein
- S W Burchiel et al "Immunopharmacokinetics of Radiolabeled Antibodies and Their Fragments" (Chapter 13 in Tumor Imaging The Radiochemical Detection of Cancer, S W Burchiel and B A Rhodes, eds , Masson Publishing Inc (1982))
- the time interval following the administration for permitting the labeled molecule to preferentially concentrate at sites in the subject and for unbound labeled molecule to be cleared to background level is 6 to 48 hours or 6 to 24 hours or 6 to 12 hours In another embodiment the time interval following administration is 5 to 20 days or 5 to 10 days
- monito ⁇ ng of the disease or disorder is earned out by repeating the method for diagnosing the disease or disease, for example, one month after initial diagnosis, six months after initial diagnosis, one year after initial diagnosis, etc
- Presence of the labeled molecule can be detected in the patient using methods known in the art for in vivo scanning These methods depend upon the type of label used Skilled artisans will be able to determine the appropriate method for detecting a particular label
- Methods and devices that may be used in the diagnostic methods of the invention include, but are not limited to, computed tomography (CT), whole body scan such as position emission tomography (PET), magnetic resonance imaging (MRI), and sonography
- the molecule is labeled with a radioisotope and is detected in the patient using a radiation responsive surgical instrument (Thurston et al , U S Patent No 5,441,050)
- the molecule is labeled with a fluorescent compound and is detected in the patient using a fluorescence responsive scanning instrument
- the molecule is labeled with a positron emitting metal and is detected in the patent using positron emission-tomography
- the molecule is labeled with a paramagnetic label and is detected in a patient using magnetic resonance imaging (MRI)
- MRI magnetic resonance imaging
- the kit is a diagnostic kit for use in screening serum containing antibodies specific against proliferative and/or cancerous polynucleotides and polypeptides
- a kit may include a control antibody that does not react with the polypeptide of interest
- a kit may include a substantially isolated polypeptide antigen comprising an epitope which is specifically immunoreactive with at least one anti-polypeptide antigen antibody
- a kit includes means for detecting the binding of said antibody to the antigen (e g , the antibody may be conjugated to a fluorescent compound such as fluorescein or rhodamine which can be detected by flow cytometry)
- the kit may include a recombinantly produced or chemically synthesized polypeptide antigen
- the polypeptide antigen ofthe kit may also be attached to a solid support
- the detecting means of the above-described kit includes a solid support to which said polypeptide antigen is attached Such a kit may also include a non-attached reporter-labeled anti-human antibody In this embodiment, binding of the antibody to the polypeptide antigen can be detected by binding ofthe said reporter-labeled antibody
- the invention includes a diagnostic kit for use in screening serum containing antigens of the polypeptide of the invention
- the diagnostic kit includes a substantially isolated antibody specifically immunoreactive with polypeptide or polynucleotide antigens, and means for detecting the binding of the polynucleotide or polypeptide antigen to the antibody
- the antibody is attached to a solid support
- the antibody may be a monoclonal antibody
- the detecting means of the kit may include a second, labeled monoclonal antibody Alternatively, or in addition, the detecting means may include a labeled, competing antigen
- test serum is reacted with a solid phase reagent having a surface-bound antigen obtained by the methods of the present invention
- a solid phase reagent having a surface-bound antigen obtained by the methods of the present invention
- reporter-labeled anti-human antibody to bind reporter to the reagent in proportion to the amount of bound anti-antigen antibody on the solid support
- the reagent is again washed to remove unbound labeled antibody, and the amount of reporter associated with the reagent is determined
- the reporter is an enzyme which is detected by incubating the solid phase in the presence of a suitable fluorometnc, luminescent or colo ⁇ met ⁇ c substrate (Sigma, St Louis, MO)
- the solid surface reagent in the above assay is prepared by known techniques for attaching protein material to solid support material, such as polymeric beads, dip sticks, 96-well plate or filter material
- attachment methods generally include non-specific adso ⁇ tion of the protein to the support or covalent attachment ofthe protein, typically through a free amine group, to a chemically reactive group on the solid support, such as an activated carboxyl, hydroxyl, or aldehyde group
- streptavidin coated plates can be used in conjunction with biotinylated ant ⁇ gen(s)
- the invention provides an assay system or kit for carrying out this diagnostic method
- the kit generally includes a support with surface-bound recombinant antigens, and a reporter-labeled anti-human antibody for detecting surface-bound anti-antigen antibody
- Albumin Fusion Proteins refers generally to albumin fusion proteins and methods of treating, preventing, or ameliorating diseases or disorders
- "albumin fusion protein” refers to a protein formed by the fusion of at least one molecule of albumin (or a fragment or variant thereof) to at least one molecule of a Therapeutic protein (or fragment or variant thereof)
- An albumin fusion protein of the invention comprises at least a fragment or variant of a Therapeutic protein and at least a fragment or variant of human serum albumin, which are associated with one another, preferably by genetic fusion (l e , the albumin fusion protein is generated by translation of a nucleic acid in which a polynucleotide encoding all or a portion of a Therapeutic protein is
- albumin fusion protein encoded by a polynucleotide or albumin fusion construct described in Table 1 or Table 2
- Polynucleotides encoding these albumin fusion proteins are also encompassed by the invention
- Prefened albumin fusion proteins of the invention include, but are not limited to, albumin fusion proteins encoded by a nucleic acid molecule comprising, or alternatively consisting of, a polynucleotide encoding at least one molecule of albumin (or a fragment or variant thereof) joined in frame to at least one polynucleotide encoding at least one molecule of a Therapeutic protein (or fragment or variant thereof), a nucleic acid molecule comprising, or alternatively consisting of, a polynucleotide encoding at least one molecule of albumin (or a fragment or variant thereof) joined in frame to at least one polynucleotide encoding at least one molecule of a
- the invention provides an albumin fusion protein comprising, or alternatively consisting of, a Therapeutic protein (e g , as descnbed in Table 1) and a serum albumin protein
- the invention provides an albumin fusion protein comprising, or alternatively consisting of, a biologically active and/or therapeutically active fragment of a Therapeutic protein and a serum albumin protein
- the invention provides an albumin fusion protein compnsing, or alternatively consisting of, a biologically active and/or therapeutically active vanant of a Therapeutic protein and a serum albumin protein
- the serum albumin protein component of the albumin fusion protein is the mature portion of serum albumin
- the invention provides an albumin fusion protein comprising, or alternatively consisting of, a Therapeutic protein, and a biologically active and/or therapeutically active fragment of serum albumin
- the invention provides an albumin fusion protein compnsing, or alternatively consisting of, a Therapeutic protein and a biologically active and/or therapeutically active variant of serum albumin
- the Therapeutic protein portion of the albumin fusion protein is the mature portion of the Therapeutic protein
- the invention provides an albumin fusion protein comprising, or alternatively consisting of, a biologically active and/or therapeutically active fragment or variant of a Therapeutic protein and a biologically active and/or therapeutically active fragment or variant of serum albumin
- the invention provides an albumin fusion protein comprising, or alternatively consisting of, the mature portion of a Therapeutic protein and the mature portion of serum albumin
- the albumin fusion protein comp ⁇ ses HA as the N-terminal portion, and a Therapeutic protein as the C-terminal portion
- a Therapeutic protein as the C-terminal portion may also be used
- the albumin fusion protein has a Therapeutic protein fused to both the N-terminus and the C-terminus of albumin
- the Therapeutic proteins fused at the N- and C- termini are the same Therapeutic proteins
- the Therapeutic proteins fused at the N- and C- termini are different Therapeutic proteins
- the Therapeutic proteins fused at the N- and C- termini are different Therapeutic proteins which may be used to treat or prevent the same or a related disease, disorder, or condition (e g as listed in the "Prefened Indication Y" column of Table 1)
- the Therapeutic proteins fused at the N- and C- termini are different Therapeutic proteins which may be used to treat, ameliorate, or prevent diseases or disorders (e g as listed in the "Prefened Indication Y" column of Table 1) which are known in the art to commonly occur in patients simultaneously, concunently, or consecutively, or which commonly occur in patients in association with one another
- Albumin fusion proteins of the invention encompass proteins containing one, two, three, four, or more molecules of a given Therapeutic protein X or variant thereof fused to the N- or C- terminus of an albumin fusion protein of the invention, and/or to the N- and/or C- terminus of albumin or variant thereof
- Molecules of a given Therapeutic protein X or variants thereof may be in any number of orientations, including, but not limited to, a 'head to head' orientation (e g , wherein the N-terminus of one molecule of a Therapeutic protein X is fused to the N-terminus of another molecule of the Therapeutic protein X), or a 'head to tail' orientation (e g , wherein the C-terminus of one molecule of a Therapeutic protein X is fused to the N-terminus of another molecule of Therapeutic protein X)
- one, two, three, or more tandemly oriented Therapeutic protein X polypeptides are fused to the N- or C- terminus of an albumin fusion protein ofthe invention, and/or to the N- and/or C- terminus of albumin or variant thereof
- Albumin fusion proteins of the invention further encompass proteins containing one, two, three, four, or more molecules of a given Therapeutic protein X or va ⁇ ant thereof fused to the N- or C- terminus of an albumin fusion protein of the invention, and/or to the N- and/or C- terminus of albumin or variant thereof, wherein the molecules are joined through peptide linkers Examples include those peptide linkers described in U S Pat No 5,073,627 (hereby inco ⁇ orated by reference) Albumin fusion proteins comprising multiple Therapeutic protein X polypeptides separated by peptide linkers may be produced using conventional recombinant DNA technology Linkers are particularly important when fusing a small peptide
- albumin fusion proteins of the invention may also be produced by fusing a Therapeutic protein X or variants thereof to the N- terminal and/or C-terminal of albumin or variants thereof in such a way as to allow the formation of intramolecular and/or intermolecular multime ⁇ c forms
- albumin fusion proteins may be in monome ⁇ c or multime ⁇ c forms (i e , dimers, t ⁇ mers, tetramers and higher multimers)
- the Therapeutic protein portion of an albumin fusion protein may be in monome ⁇ c form or multime ⁇ c form (I e , dimers, t ⁇ mers, tetramers and higher multimers)
- the Therapeutic protein portion of an albumm fusion protein is in multime ⁇ c form (i e , dimers, t ⁇ mers, tetramers and higher multimers), and the albumm protein portion is in monome ⁇ c form
- albumin fusion proteins ofthe invention may also be produced by inserting the Therapeutic protein or peptide of interest (e g , a Therapeutic protein X as disclosed in Table 1 , or an antibody that binds a Therapeutic protein or a fragment or variant thereof) into an internal region of HA
- the Therapeutic protein or peptide of interest e g , a Therapeutic protein X as disclosed in Table 1 , or an antibody that binds a Therapeutic protein or a fragment or variant thereof
- Loops in human albumin structure into which peptides or polypeptides may be inserted to generate albumin fusion proteins of the invention include Val54-Asn61, Thr76-Asp89, Ala92-Glul00, Glnl70-Alal76, His 247 - Glu252, Glu 266 - Glu277, Glu 280-H ⁇ s288, Ala362-
- peptides or polypeptides are inserted into the Val54-Asn61, Glnl70-Alal76, and/or Lys560-Thr566 loops of mature human albumin (SEQ ID NO 1)
- Peptides to be inserted may be derived from either phage display or synthetic peptide libraries screened for specific biological activity or from the active portions of a molecule with the desired function Additionally, random peptide hbranes may be generated within particular loops or by insertions of randomized peptides into particular loops of the HA molecule and in which all possible combinations of amino acids are represented
- Such l ⁇ brary(s) could be generated on HA or domain fragments of HA by one ofthe following methods randomized mutation of amino acids within one or more peptide loops of HA or HA domain fragments Either one, more or all the residues within a loop could be mutated in this manner, replacement of, or insertion into one or more loops of HA or HA domain fragments (i e , internal fusion) of a randomized pept ⁇ de(s) of length X tract (where X is an amino acid and n is the number of residues, N-, C- or N- and C- terminal peptide/protein fusions m addition to (a) and/or (b)
- the HA or HA domain fragment may also be made multifunctional by grafting the peptides derived from different screens of different loops against different targets into the same HA or HA domain fragment
- peptides inserted into a loop of human serum albumin are peptide fragments or peptide va ⁇ ants of the
- the invention encompasses albumin fusion proteins which comp ⁇ se peptide fragments or peptide vanants at least 7 at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 20, at least 25, at least
- albumin fusion proteins which compnse peptide fragments or peptide variants at least 7 at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least
- albumin fusion proteins which comprise peptide fragments or peptide variants at least 7 at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 20, at least 25, at least 30, at least 35, or at least 40 amino acids fused to the C- terminus of human serum albumin
- short peptides descnbed in Table 1 and 2 e g , Therapeutic Y
- Therapeutic Y can be inserted into the albumin loops
- albumin fusion proteins of the invention may have one HA-de ⁇ ved region and one Therapeutic protein-derived region
- each protein may be used to make an albumin fusion protein of the invention
- more than one Therapeutic protein may be used to make an albumin fusion protein of the invention
- a Therapeutic protein may be fused to both the N- and C- terminal ends of the HA
- the Therapeutic protein portions may be the same or different Therapeutic protein molecules
- the structure of bifunctional albumin fusion proteins may be represented as X-HA-Y or Y-HA-X
- an anti-BLySTM scFv-HA-IFN ⁇ -2b fusion may be prepared to modulate the immune response to IFN ⁇ -2b by anti-BLySTM scFv
- An alternative is making a bl (or even multi) functional dose of HA-fusions e g HA-IFN ⁇ -2b fusion mixed with HA-anti-BLySTM scFv fusion or other HA-fusions in various ratio's depending on function, half-life etc
- Bi- or multi-functional albumin fusion proteins may also be prepared to target the Therapeutic protein portion of a fusion to a target organ or cell type via protein or peptide at the opposite terminus of HA
- the peptides could be obtained by screening libraries constructed as fusions to the N-, C- or N- and C- termini of HA, or domain fragment of HA, of typically 6, 8, 12, 20 or 25 or X bond (where X is an amino acid (aa) and n equals the number of residues) randomized amino acids, and in which all possible combinations of amino acids were represented
- X is an amino acid (aa) and n equals the number of residues
- peptides may be selected in situ on the HA molecule and the properties of the peptide would therefore be as selected for rather than, potentially, modified as might be the case for a peptide de ⁇ ved by any other method then being attached to
- the albumin fusion proteins of the invention may include a linker peptide between the fused portions to provide greater physical separation between the moieties and thus maximize the accessibility of the Therapeutic protein portion, for instance, for binding to its cognate receptor
- the linker peptide may consist of ammo acids such that it is flexible or more ⁇ gid [0281]
- the linker sequence may be cleavable by a protease or chemically to yield the growth hormone related moiety
- the protease is one which is produced naturally by the host, for example the S cerevisiae protease kex2 or equivalent proteases
- albumin fusion proteins of the invention may have the following formula R1-L-R2, R2-L-R1, or Rl-
- Rl is at least one Therapeutic protein, peptide or polypeptide sequence, and not necessarily the same Therapeutic protein, L is a linker and R2 is a serum albumin sequence
- albumin fusion proteins of the invention comprising a Therapeutic protein have a higher plasma stability compared to the plasma stability of the same Therapeutic protein when not fused to albumin
- Plasma stability typically refers to the time penod between when the Therapeutic protein is administered in vivo and earned into the bloodstream and when the therapeutic protein is degraded and cleared from the bloodstream, into an organ, such as the kidney or liver, that ultimately clears the Therapeutic protein from the body Plasma stability is calculated in terms of the half-life of the Therapeutic protein in the bloodstream The half-life of the Therapeutic protein in the bloodstream can be readily determined by common assays known in the art
- Albumin fusion proteins of the invention compnsing a Therapeutic protein have extended shelf life compared to the shelf life the same Therapeutic protein when not fused to albumin Shelf-life typically refers to the time penod over which the therapeutic activity of a Therapeutic protein in solution or in some other storage formulation, is stable without undue loss of therapeutic activity Many of the
- Therapeutic proteins are highly labile in their unfused state As described below, the typical shelf-life of these Therapeutic proteins is markedly prolonged upon inco ⁇ oration into the albumin fusion protein ofthe invention
- Albumm fusion proteins of the invention with "prolonged” or “extended” shelf-life exhibit greater therapeutic activity relative to a standard that has been subjected to the same storage and handling conditions
- the standard may be the unfused full-length Therapeutic protein
- an albumin fusion protein of the invention may retain greater than about 100% of the therapeutic activity, or greater than about 105%, 110%, 120%, 130%, 150% or 200% of the therapeutic activity of a standard when subjected to the same storage and handling conditions as the standard when compared at a given time point
- albumin fusion proteins of the invention may be produced as recombinant molecules by secretion from yeast, a microorganism such as a bacterium, or a human or animal cell line
- the polypeptide is secreted from the host cells
- a particular embodiment of the invention compnses a DNA construct encoding a signal sequence effective for directing secretion in yeast, particularly a yeast-de ⁇ ved signal sequence (especially one which is homologous to the yeast host), and the fused molecule of the first aspect ofthe invention, there being no yeast-de ⁇ ved pro sequence between the signal and the mature polypeptide
- a yeast-de ⁇ ved signal sequence especially one which is homologous to the yeast host
- the Saccharomyces cerevisiae invertase signal is a prefened example of a yeast-de ⁇ ved signal sequence
- the present invention also includes a cell, preferably a yeast cell transformed to express an albumin fusion protein of the invention
- a culture of those cells preferably a monoclonal (clonally homogeneous) culture, or a culture derived from a monoclonal culture, in a nutrient medium If the polypeptide is secreted, the medium will contain the polypeptide, with the cells, or without the cells if they have been filtered or centrifuged away
- Many expression systems are known and may be used, including bacteria (for example E coli and Bacillus subtilis), yeasts (for example Saccharomyces cerevisiae, Kluyveromyces lactis and Pichia pastons, filamentous fungi (for example Aspergillus), plant cells, animal cells and insect cells
- Prefened yeast strains to be used in the production of albumin fusion proteins are D88, DXY1 and BXP10 D88 [leu2-3, leu2-122, canl, pral, ubc4] is a denvative of parent strain AH22 ⁇ s + (also known as DB1, see, e g , Sleep et al Biotechnology 8 42-46 (1990))
- the strain contains a leu2 mutation which allows for auxotropic selection of 2 micron-based plasmids that contain the LEU2 gene D88 also exhibits a derepression of PRB1 in glucose excess
- the PRB1 promoter is normally controlled by two checkpoints that monitor glucose levels and growth stage The promoter is activated in wild type yeast upon glucose depletion and entry into stationary phase Strain D88 exhibits the repression by glucose but maintains the induction upon entry into stationary phase
- the PRA1 gene encodes a yeast vacuolar protease, YscA endoprotease A, that is local
- DXY1 a derivative of D88, has the following genotype [leu2-3, leu2-122, canl. pral, ubc4, ura3 yap3]
- this strain also has a knockout ofthe YAP3 protease
- This protease causes cleavage of mostly di-basic residues (RR, RK, KR, KK) but can also promote cleavage at single basic residues in proteins Isolation of this yap3 mutation resulted in higher levels of full length HSA production (see, e g , U S Patent No 5,965,386 and Kerry-Williams et al , Yeast 14 161-169 (1998), hereby inco ⁇ orated in their entireties by reference herein)
- BXP10 has the following genotype leu2-3, leu2-122, canl, pral, ubc4, ura3, yap3 URA3, lys2, hsp!50 LYS2, pmtl URA3
- this strain also has a knockout ofthe PMT1 gene and the HSP150 gene
- the PMT1 gene is a member of the evolutionanly conserved family of dohchyl-phosphate-D-mannose protein O-mannosyltransferases (Pmts) The transmembrane topology of
- Pmtlp suggests that it is an integral membrane protein ofthe endoplasmic reticulum with a role in 0-hnked glycosylation This mutation serves to reduce/eliminate O-linked glycosylation of HSA fusions (see, e g , International Publication No WOOO/44772, hereby inco ⁇ orated in its entirety by reference herein) Studies revealed that the Hspl50 protein is inefficiently separated from rHA by ion exchange chromatography The mutation in the HSP 150 gene removes a potential contaminant that has proven difficult to remove by standard purification techniques See, e g , U S Patent No
- the desired protein is produced in conventional ways, for example from a coding sequence inserted in the host chromosome or on a free plasmid
- the yeasts are transformed with a coding sequence for the desired protein in any ofthe usual ways, for example electroporation Methods for transformation of yeast by electroporation are disclosed in Becker & Guarente (1990) Methods Enzymol 194, 182
- Successfully transformed cells i e , cells that contain a DNA construct of the present invention, can be identified by well known techniques For example, cells resulting from the introduction of an expression construct can be grown to produce the desired polypeptide Cells can be harvested and lysed and their DNA content examined for the presence ofthe DNA using a method such as that descnbed by Southern (1975)
- Useful yeast plasmid vectors include pRS403-406 and pRS413-416 and are generally available from Stratagene Cloning Systems, La
- Plasmids pRS403, pRS404, pRS405 and pRS406 are Yeast Integrating plasmids (Yips) and mco ⁇ orate the yeast selectable markers HIS3, 7RP1, LEU2 and URA3
- Plasmids pRS413 ⁇ U6 are Yeast Centromere plasmids (Ycps)
- Prefened vectors for making albumin fusion proteins for expression in yeast include pPPC0005, pScCHSA, pScNHSA, and pC4 HSA which are described in detail in Example 1
- Figure 2 shows a map of the pPPC0005 plasmid that can be used as the base vector into which polynucleotides encoding Therapeutic proteins may be cloned to form HA-fusions It contains a PRB1 S cerevisiae promoter (PRBlp), a Fusion leader sequence (FL), DNA encoding HA (rHA) and an ADM S cerevisiae terminator sequence
- PRBlp PRB1 S cerevisiae promoter
- FL Fusion leader sequence
- DNA encoding HA rHA
- ADM S cerevisiae terminator sequence The sequence of the fusion leader sequence consists of the first 19 amino acids of the signal peptide of human serum albumin (SEQ ID NO 3) and the last five ammo acids of the mating factor
- a yeast promoter that can be used to express the albumin fusion protein is the MET 25 promoter See, for example, Dominik Mumburg,
- Met25 promoter is 383 bases long (bases -382 to -1) and the genes expressed by this promoter are also known as Metl5, Metl7, and YLR303W
- a prefened embodiment uses the sequence below, where, at the 5' end of the sequence below, the Not 1 site used in the cloning is underlined and at the 3' end, the ATG start codon is underlined
- Additional promoters that can be used to express the albumin fusion protein in yeast include the following a) the cbhl promoter TCTAGAGTTGTGAAGTCGGTAATCCCGCTGTATAGTAATACGAGTCGCATCTAAATACTCCGAAGCTGCTGCGAACCCGGA GAATCGAGATGTGCTGGAAAGCTTCTAGCGAGCGGCTAAATTAGCATGAAAGGCTATGAGAAATTCTGGAGACGGCTTGT TGAATCATGGCGTTCCATTCTTCGACAAGCAAAGCGTTCCGTCGCAGTAGCAGGCACTCATTCCCGAAAAAACTCGGAGA TTCCTAAGTAGCGATGGAACCGGAATAATATAATAGGCAATACATTGAGTTGCCTCGACGGTTGCAATGCAGGGGTACTG AGCTTGGACA I AAC I G ⁇ TCCGTACCCCACCTCTTCTCAACCTTTGGCGTTTCCCTGATTCAGCGTACCCGTACAAGTCGTAA TCACTGACCGACCGACCGACCGACCGACCGACCGATAATAGGCA
- Synthetic linkers containing one or more restriction sites provide an alternative method of joining the DNA segment to vectors
- the DNA segment, generated by endonuclease rest ⁇ ction digestion, is treated with bacte ⁇ ophage T4 DNA polymerase or E coli DNA polymerase I, enzymes that remove protruding, gamma-single-stranded termini with their 3' 5'-exonucleolyt ⁇ c activities, and fill in recessed 3'-ends with their polymerizing activities
- Synthetic linkers containing a va ⁇ ety of rest ⁇ ction endonuclease sites are commercially available from a number of sources including International Biotechnologies Inc, New Haven, CT, USA
- a desirable way to modify the DNA in accordance with the invention is to use the polymerase chain reaction as disclosed by Saiki et al (1988) Science 239, 487-491
- the DNA to be enzymatically amplified is flanked by two specific oligonucleotide primers which themselves become inco ⁇ orated into the amplified DNA
- the specific primers may contain restriction endonuclease recognition sites which can be used for cloning into expression vectors using methods known in the art
- Exemplary genera of yeast contemplated to be useful in the practice of the present invention as hosts for expressing the albumin fusion proteins are Pichia (Hansenula), Saccharomyces, Kluyveromyces, Candida, Torulopsis, Torulaspora, Schizosaccharomyces, Citeromyces, Pachysolen, Debaromyces, Metschumkowia, Rhodosporidium, Le
- Examples of Kluyveromyces spp are K fragihs, K lactis and K marxianus
- a suitable Torulaspora species is T delbrueckn
- Examples of Pichia (Hansenula) spp are P angusta (formerly H polymo ⁇ ha), P anomala (formerly H anomala) and P pasto ⁇ s
- Methods for the transformation of S cerevisiae are taught generally in EP 251 744, EP 258 067 and WO 90/01063, all of which are inco ⁇ orated herein by reference
- Prefened exemplary species of Saccharomyces include S cerevisiae, S italicus, S diastaticus, and Zygosaccharomyces rouxu
- Prefened exemplary species of Kluyveromyces include K fragihs and K lactis
- Prefened exemplary species of Hansenula include H polymo ⁇ ha (now Pichia angusta), H anomala (now Pichia
- Suitable promoters for S cerevisiae include those associated with the PGKI gene, GAL1 or GAL10 genes, CYCI, PH05, TRPI, ⁇ DHI, ADH2, the genes for glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvatc decarboxylase, phosphofructokinase, t ⁇ ose phosphate isomerase, phosphoglucose isomerase, glucokinase, alpha-mating factor pheromone, [a mating factor pheromone], the PRBI promoter, the GUT2 promoter, the GPDI promoter, and hybrid promoters involving hybrids of parts of 5' regulatory regions with parts of 5' regulatory regions of other promoters or with upstream activation sites (eg the promoter of EP-A-258 067)
- Convenient regulatable promoters for use in Schizosaccharomyces pombe are the thiamine-repressible promoter from the nmt gene as described by Maundrell (1990) J Biol Chem 265, 10857-10864 and the glucose repressible jbpl gene promoter as described by Hoffman & Winston (1990) Genetics 124, 807-816
- the transcription termination signal is preferably the 3' flanking sequence of a eukaryotic gene which contains proper signals for transcnption termination and polyadenylation Suitable 3' flanking sequences may, for example, be those of the gene naturally linked to the expression control sequence used, i e may conespond to the promoter Alternatively, they may be different in which case the termination signal of the S cerevisiae ADHI gene is prefened
- the desired albumin fusion protein may be initially expressed with a secretion leader sequence, which may be any leader effective in the yeast chosen Leaders useful in yeast include any ofthe following a) the MPIF-1 signal sequence (e g , ammo acids 1-21 ofGenBank Accession number AAB51134) MKVSVAALSCLMLVTALGSQA (SEQ ID NO 6) b) the stanniocalcin signal sequence (MLQNSAVLLLLVISASA, SEQ ID NO 7) c) the pre-pro region ofthe HSA signal sequence (e g , MKWVTFISLLFLFSSAYSRGVFRR, SEQ ID NO 8) d) the pre region ofthe HSA signal sequence (e g , MKWVTFISLLFLFSSAYS, SEQ ID NO 9) or variants thereof, such as, for example, MKWVSFISLLFLFSSAYS, (SEQ ID NO 10) e) the invertase signal sequence (e g , MLLQAFLFLLAGFAAKISA,
- the polynucleotides encoding albumin fusion proteins of the invention may be joined to a vector containing a selectable marker for propagation in a host Generally, a plasmid vector is introduced in a precipitate, such as a calcium phosphate precipitate, or in a complex with a charged lipid If the vector is a virus, it may be packaged in vitro using an appropnate packaging cell line and then transduced into host cells [0317]
- the polynucleotide insert should be operatively linked to an appropriate promoter, such as the phage lambda PL promoter, the E coli lac, trp, phoA and tac promoters, the SV40 early and late promoters and promoters of retroviral LTRs, to name a few Other suitable promoters will be known to the skilled artisan
- the expression constructs will further contain sites for transcription initiation, termination, and, in the transcribed region, a ⁇ bosome binding site for translation
- the expression vectors will preferably include at least one selectable marker
- markers include dihydrofolate reductase, G418, glutamine synthase, or neomycin resistance for eukaryotic cell culture, and tetracychne, kanamycin or ampicillin resistance genes for culturing in E coli and other bacteria
- Representative examples of appropnate hosts include, but are not limited to, bacte ⁇ al cells, such as E coli, Streptomyces and Salmonella typhimurium cells, fungal cells, such as yeast cells (e g , Saccharomyces cerevisiae or Pichia pastoris (ATCC Accession No 201178)), insect cells such as Drosophila S2 and Spodoptera Sf9 cells, animal cells such as CHO, COS, NSO, 293, and Bowes melanoma cells, and plant cells Appropriate culture mediums and conditions for the above-described host cells are known in the art [0319] Among vector
- Examples of signal peptides that may be fused to an albumin fusion protein of the invention in order to direct its secretion in mammalian cells include, but are not limited to a) the M IJ--1 signal sequence (e g , amino acids 1-21 of GenBank Accession number AAB51134) MKVSVAALSCLMLVTALGSQA (SEQ ID NO 6) b) the stanmocalcin signal sequence (MLQNSAVLLLLVISASA, SEQ ID NO 7) c) the pre-pro region ofthe HSA signal sequence (e g , MKWVTFISLLFLFSSAYSRGVFRR, SEQ ID NO 8) d) the pre region ofthe HSA signal sequence (e g , MKWVTFISLLFLFSSAYS, SEQ ID NO 9) or va ⁇ ants thereof, such as, for example, MKWVSFISLLFLFSSAYS, (SEQ ID NO 10) e) the invertase signal sequence (e g , MLLQAFLFLLAGFA
- Fibulin B precursor signal sequence e g , MERAAPSRRVPLPLLLLGGLALLAAGVDA, SEQ ID NO 17
- clustenn precursor signal sequence e g , MMKTLLLFVGLLLTWESGQVLG, SEQ ID NO 18
- insulin-like growth factor-binding protein 4 signal sequence e g , MLPLCLVAALLLAAGPGPSLG, SEQ ID NO 19
- va ⁇ ants ofthe pre-pro-region ofthe HSA signal sequence such as, for example, MKWVSFISLLFLFSSAYSRGVFRR (SEQ ID NO 20), MKWVTFISLLFLFAGVLG (SEQ ID NO 21), MKWVTFISLLFLFSGVLG (SEQ ID NO 22), MKWVTFISLLFLFGGVLG (SEQ ID NO 23), a Modified HSA leader HSA #64 - MKWVTFISLLFLFAGVSG (SEQ ID NO 24), Modified HSA leader HSA #66 - MKWVTFIS
- Glutaminase GS
- DHFR DHFR
- An advantage of glutamine synthase based vectors are the availability of cell lines (e g , the munne myeloma cell line, NSO) which are glutamine synthase negative Glutamine synthase expression systems can also function in glutamine synthase expressing cells (e g , Chinese Hamster Ovary (CHO) cells) by providing additional inhibitor to prevent the functioning of the endogenous gene
- a glutamine synthase expression system and components thereof are detailed in PCT publications WO87/04462, WO86/05807, WO89/01036, WO89/10404, and WO91/06657, which are hereby inco ⁇ orated in their entireties by reference herein Additionally, glutamine synthase expression vectors can be obtained from Lonza Biologies, Inc (Port
- the present invention also relates to host cells containing the above-described vector constructs descnbed herein, and additionally encompasses host cells containing nucleotide sequences of the invention that are operably associated with one or more heterologous control regions (e g , promoter and/or enhancer) using techniques known of in the art
- the host cell can be a higher eukaryotic cell, such as a mammalian cell (e g , a human derived cell), or a lower eukaryotic cell, such as a yeast cell, or the host cell can be a prokaryotic cell, such as a bacterial cell
- a host strain may be chosen which modulates the expression of the inserted gene sequences, or modifies and processes the gene product in the specific fashion desired Expression from certain promoters can be elevated in the presence of certain inducers, thus expression of the genetically engineered polypeptide may be controlled
- different host cells have characteristics and specific mechanisms for the translational and post- translational processing and modification (e g , phospho
- nucleic acids and nucleic acid constructs of the invention into the host cell can be effected by calcium phosphate transfection, DEAE-dextran mediated transfection, cationic hpid-mediated transfection, electroporation, transduction, infection, or other methods Such methods are described in many standard laboratory manuals, such as Davis et al , Basic Methods In Molecular Biology (1986) It is specifically contemplated that the polypeptides ofthe present invention may in fact be expressed by a host cell lacking a recombinant vector.
- the invention also encompasses primary, secondary, and immortalized host cells of vertebrate origin, particularly mammalian origin, that have been engineered to delete or replace endogenous genetic material (e g , the coding sequence conesponding to a Therapeutic protein may be replaced with an albumin fusion protein conesponding to the Therapeutic protein), and/or to include genetic material (e g , heterologous polynucle
- heterologous polynucleotides e g , polynucleotides encoding an albumin protein, or a fragment or va ⁇ ant thereof
- heterologous control regions e g , promoter and/or enhancer
- endogenous polynucleotide sequences encoding a Therapeutic protein via homologous recombination see, e g , US Patent Number 5,641,670, issued June 24, 1997, International Publication Number WO 96/2941 1, International Publication Number WO 94/12650, Koller et al , Proc Natl Acad Sci USA 56 8932-8935 (1989), and Zijlstra et al , Nature 342435-438 (1989), the disclosures of each of which are inco ⁇ orated by reference in their entireties
- albumin fusion proteins of the invention can be recovered and purified from recombinant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography, hydrophobic charge interaction chromatography and lecti ⁇ chromatography Most preferably, high performance liquid chromatography (“HPLC”) is employed for purification
- the albumin fusion proteins of the invention are purified using Amon Exchange Chromatography including, but not limited to, chromatography on Q-sepharose, DEAE sepharose, poros HQ, poros DEAE, Toyopearl Q, Toyopearl QAE, Toyopearl DEAE, Resource/Source Q and DEAE, Fractogel Q and DEAE columns
- albumin fusion proteins of the invention are purified using Cation Exchange Chromatography including, but not limited to, SP-sepharose, CM sepharose, poros HS, poros CM, Toyopearl SP, Toyopearl CM, Resource/Source S and CM, Fractogel S and CM columns and their equivalents and comparables
- albumin fusion proteins of the invention are punfied using Hydrophobic Interaction Chromatography including, but not limited to, Phenyl, Butyl, Methyl, Octyl, Hexyl-sepharose, poros Phenyl, Butyl, Methyl, Octyl, Hexyl, Toyopearl Phenyl, Butyl, Methyl, Octyl, Hexyl Resource/Source Phenyl, Butyl, Methyl, Octyl, Hexyl, Fractogel Phenyl, Butyl, Methyl, Octyl, Hexyl columns and their equivalents and comparables
- albumin fusion proteins of the invention are punfied using Size Exclusion Chromatography including, but not limited to, sepharose SI 00, S200, S300, superdex resin columns and their equivalents and comparables
- albumin fusion proteins of the invention are punfied using Affinity Chromatography including, but not limited to, Mimetic Dye affinity, peptide affinity and antibody affinity columns that are selective for either the HSA or the "fusion target" molecules
- Affinity Chromatography including, but not limited to, Mimetic Dye affinity, peptide affinity and antibody affinity columns that are selective for either the HSA or the "fusion target" molecules
- albumin fusion proteins of the invention are purified using one or more Chromatography methods listed above
- albumin fusion proteins of the invention are purified using one or more of the following Chromatography columns, Q sepharose FF column, SP Sepharose FF column, Q Sepharose High Performance Column, Blue Sepharose FF column , Blue Column, Phenyl Sepharose FF column, DEAE Sepharose FF, or Methyl Column
- albumin fusion proteins of the invention may be punfied using the process described in PCT International Publication WO 00/44772 which is herein inco ⁇ orated by reference in its entirety
- PCT International Publication WO 00/44772 which is herein inco ⁇ orated by reference in its entirety
- One of skill in the art could easily modify the process described therein for use in the purification of albumin fusion proteins ofthe invention
- Albumin fusion proteins of the present invention may be recovered from products of chemical synthetic procedures, and products produced by recombinant techniques from a prokaryotic or eukaryotic host, including, for example, bactenal, yeast, higher plant, insect, and mammalian cells Depending upon the host employed m a recombinant production procedure, the polypeptides of the present 'invention may be glycosylated or may be non-glycosylated In addition, albumin fusion proteins of the invention may also include an initial modified methionine residue, in some cases as a result of host-mediated processes Thus, it is well known in the art that the N-terminal methionine encoded by the translation initiation codon generally is removed with high efficiency from any protein after translation in all eukaryotic cells While the N-termmal methionine on most proteins also is efficiently removed in most prokaryotes, for some proteins, this prokaryotic removal process is inefficient, depending on the nature of the amino acid to which the N-termmal
- the yeast Pichia pastoris is used to express albumin fusion proteins of the invention in a eukaryotic system
- Pichia pastons is a methylotrophic yeast which can metabolize methanol as its sole carbon source
- a main step in the methanol metabolization pathway is the oxidation of methanol to formaldehyde using O 2 This reaction is catalyzed by the enzyme alcohol oxidase
- Pichia pastoris In order to metabolize methanol as its sole carbon source, Pichia pastoris must generate high levels of alcohol oxidase due, in part, to the relatively low affinity of alcohol oxidase for O 2 Consequently, in a growth medium depending on methanol as a mam carbon source, the promoter region of one of the two alcohol oxidase genes (AOXI) is highly active In the presence of methanol, alcohol oxidase produced from the AOXI gene comprises up to approximately 30% of the total soluble protein in Pichia pastoris See Ellis, S B
- the plasmid vector pPIC9K is used to express DNA encoding an albumin fusion protein of the invention, as set forth herein, in a Pichea yeast system essentially as descnbed in "Pichia Protocols Methods in Molecular Biology," D R Higgins and J Cregg, eds The Humana Press, Totowa, NJ, 1998
- This expression vector allows expression and secretion of a polypeptide of the invention by virtue of the strong AOXI promoter linked to the Pichia pastoris alkaline phosphatase (PHO) secretory signal peptide (1 e , leader) located upstream of a multiple cloning site
- yeast vectors could be used in place of pPIC9K, such as, pYES2, pYDl, pTEFl/Zeo, pYES2/GS, pPICZ, pGAPZ, pGAPZalpha, pPIC9, pPIC3 5, pHlL-D2, pHIL-Sl, pPIC3 5K, and PA0815, as one skilled in the art would readily appreciate, as long as the proposed expression construct provides appropnately located signals for transcription, translation, secretion (if desired), and the like, including an in-frame AUG as required
- high-level expression of a heterologous coding sequence such as, for example, a polynucleotide encoding an albumin fusion protein ot tne present invention, may be achieved by cloning the heterologous polynucleotide of the invention into an expression vector such as, for example, pGAPZ or pGAPZalpha, and growing the yeast culture in the absence of methanol
- albumin fusion proteins of the invention can be chemically synthesized using techniques known in the art (e g , see Creighton, 1983, Proteins Structures and Molecular P ⁇ nciples, W H Freeman & Co , N Y , and Hunkapiller et al , Nature, 310 105-111 (1984))
- a polypeptide conesponding to a fragment of a polypeptide can be synthesized by use of a peptide synthesizer
- nonclassical amino acids or chemical amino acid analogs can be introduced as a substitution or addition into the polypeptide sequence
- Non-classical amino acids include, but are not limited to, to the D-isomers of the common amino acids, 2,4-d ⁇ am ⁇ nobuty ⁇ c acid, a-amino isobuty ⁇ c acid, 4-am ⁇ nobuty ⁇ c acid, Abu, 2-am ⁇ no butyric acid, g-Abu, e-Ahx, 6-
- the invention encompasses albumin fusion proteins of the present invention which are differentially modified during or after translation, e g , by glycosylation, acetylation, phosphorylation, amidation, denvatization by known protecting/blocking groups, proteolytic cleavage, linkage to an antibody molecule or other cellular ligand, etc Any of numerous chemical modifications may be earned out by known techniques, including but not limited, to specific chemical cleavage by cyanogen bromide, trypsin, chymotrypsin, papain, V8 protease, NaBH , acetylation, formylation, oxidation, reduction, metabolic synthesis in the presence of tunicamycin, etc
- Additional post-translational modifications encompassed by the invention include, for example, e g , N-hnked or O-linked carbohydrate chains, processing of N-terminal or C-terminal ends), attachment of chemical moieties to the amino acid backbone, chemical modifications of N-linked or O-linked carbohydrate chains, and addition or deletion of an N-terminal methionine residue as a result of procaryotic host cell expression
- the albumin fusion proteins may also be modified with a detectable label, such as an enzymatic, fluorescent, isotopic or affinity label to allow for detection and isolation ofthe protein
- Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcho nesterase
- examples of suitable prosthetic group complexes include streptavidin/biot and avidin/biotin
- examples of suitable fluorescent mate ⁇ als include umbelhferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorot ⁇ azinylamine fluorescein, dansyl chloride or phycoeryth ⁇ n
- an example of a luminescent material includes luminol
- examples of bioluminescent materials include luciferase, lucifenn, and aequonn
- examples of suitable radioactive mate ⁇ al include iodine ( ,21 1, 123 I, 125 I, 131 1), carbon ( 14 C), sulfur ( 3S S), tritium ( 3 H), indium ('"in, " 2 ln, ,13m In
- albumin fusion proteins of the present invention or fragments or variants thereof are attached to macrocychc chelators that associate with radiometal ions, including but not limited to, l77 Lu, " ⁇ , 166 Ho, and IS3 Sm, to polypeptides
- the radiometal ion associated with the macrocychc chelators is '"In
- the radiometal ion associated with the macrocychc chelator is " ⁇
- the macrocychc chelator is l,4,7,10-tetraazacyclododecane-N,N',N",N"'-tetraacet ⁇ c acid (DOTA)
- DOTA is attached to an antibody of the invention or fragment thereof via linker molecule Examples of linker molecules useful for conjugating DOTA to a polypeptide are commonly known in the art - see, for example, DeNardo et al , Clin Cancer Res 4
- albumin fusion proteins of the invention may be modified by either natural processes, such as post-translational processing, or by chemical modification techniques which are well known in the art It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a given polypeptide
- Polypeptides of the invention may be branched, for example, as a result of ubiquitmation, and they may be cyclic, with or without branching Cyclic, branched, and branched cyclic polypeptides may result from posttranslation natural processes or may be made by synthetic methods Modifications include acetylation, acylation, ADP-nbosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidyhnositol, cross-linking, cychzation, dis
- Albumin fusion proteins of the invention and antibodies that bind a Therapeutic protein or fragments or vanants thereof can be fused to marker sequences, such as a peptide to facilitate purification
- the marker amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (QIAGEN, Inc , 9259 Eton Avenue, Chatsworth, CA, 91311), among others, many of which are commercially available As described in Gentz et al , Proc Natl Acad Sci USA 86 821-824 (1989), for instance, hexa-histidine provides for convenient purification of the fusion protein
- Other peptide tags useful for purification include, but are not limited to, the "HA” tag, which conesponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al , Cell 37 767 (1984)) and the "flag" tag
- an albumin fusion protein of the invention may be conjugated to a therapeutic moiety such as a cytotoxin, e g , a cytostatic or cytocidal agent, a therapeutic agent or a radioactive metal ion, e g , alpha-emitters such as, for example, 213B ⁇
- a cytotoxin or cytotoxic agent includes any agent that is detrimental to cells Examples include paclitaxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vinc ⁇ stine, vinblastme, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1 -dehydrotestosterone, glucocorticoids, procaine, tetracaine, hdocaine, propranolol,
- the conjugates of the invention can be used for modifying a given biological response, the therapeutic agent or drug moiety is not to be construed as limited to classical chemical therapeutic agents
- the drug moiety may be a protein or polypeptide possessing a desired biological activity
- proteins may include, for example, a toxin such as ab ⁇ n, ricin A, pseudomonas exotoxin, or diphtheria toxin, a protein such as tumor necrosis factor, alpha-interferon, ⁇ -interferon, nerve growth factor, platelet de ⁇ ved growth factor, tissue plasminogen activator, an apoptotic agent, e g , TNF-alpha, TNF-beta, AIM I (See, International Publication No WO 97/33899), AIM II (See, International Publication No WO 97/34911), Fas Ligand (Takahashi et al , Int Immunol , 6 1567-1574 (1994)), VEGI (See,
- Albumin fusion proteins may also be attached to solid supports, which are particularly useful for immunoassays or purification of polypeptides that are bound by, that bind to, or associate with albumin fusion proteins of the invention
- solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene
- Albumin fusion proteins with or without a therapeutic moiety conjugated to it, administered alone or in combination with cytotoxic factor(s) and/or cytok ⁇ ne(s) can be used as a therapeutic
- the albumin fusion protein of the invention comprises only the VH domain of an antibody that binds a Therapeutic protein, it may be necessary and/or desirable to coexpress the fusion protein with the VL domain of the same antibody that binds a Therapeutic protein, such that the VH-albumin fusion protein and VL protein will associate (either covalently or non-covalently) post-translationally [0355]
- I" 1 embodiments where the albumin fusion protein of the invention comprises only the VL domain of an antibody that binds a Therapeutic protein it may be necessary and/or desirable to coexpress the fusion protein with the VH domain of the same antibody that binds a Therapeutic protein, such that the VL-albumm fusion protein and VH protein will associate (either covalently or non-covalently) post-translationally
- Some Therapeutic antibodies are bispecific antibodies, meaning the antibody that binds a Therapeutic protein is an artificial hyb ⁇ d antibody having two different heavy/light chain pairs and two different
- the chemical moieties for de ⁇ vitization may be selected from water soluble polymers such as polyethylene glycol, ethylene glycol/propylene glycol copolymers, carboxymethylcellulose, dextran, polyvinyl alcohol and the like
- the albumin fusion proteins may be modified at random positions within the molecule, or at predetermined positions within the molecule and may include one, two, three or more attached chemical moieties
- the polymer may be of any molecular weight, and may be branched or unbranched
- the prefened molecular weight is between about lkDa and about 100 kDa (the term "about” indicating that in preparations of polyethylene glycol, some molecules will weigh more, some less, than the stated molecular weight) for ease in handling and manufacturing
- Other sizes may be used, depending on the desired therapeutic profile (e g , the duration of sustained release desired, the effects, if any on biological activity, the ease in handling, the degree or lack of antigenicity and other known effects of the polyethylene glycol to a Therapeutic protein or analog)
- the polyethylene glycol may have an average molecular weight of about 200, 500, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 8500, 9000, 9500, 10,000, 10,500, 11,000, 11,500, 12,000, 12,500, 13,000,
- the polyethylene glycol may have a branched structure
- Branched polyethylene glycols are described, for example, in U S Patent No 5,643,575, Mo ⁇ urgo et al , Appl Biochem Biotechnol 56 59-72 (1996), Vorobjev et al Nucleosides Nucleotides / ⁇ 2745-2750 (1999), and Caliceti et al Bioconjug Chem 10 638-646 (1999), the disclosures of each of which are inco ⁇ orated herein by reference [0360]
- the polyethylene glycol molecules (or other chemical moieties) should be attached to the protein with consideration of effects on functional or antigenic domains ofthe protein There are a number of attachment methods available to those skilled in the art, such as, for example, the method disclosed in EP 0 401 384 (coupling PEG to G-CSF), herein inco ⁇ orated by reference, see also Malik et al , Exp Hematol 20 1028-1035 (1992
- polyethylene glycol may be attached to proteins via linkage to any of a number of amino acid residues
- polyethylene glycol can be linked to proteins via covalent bonds to lysine, histidine, aspartic acid, glutamic acid, or cysteine residues
- One or more reaction chemist ⁇ es may be employed to attach polyethylene glycol to specific amino acid residues (e g , lysine, histidine, aspartic acid, glutamic acid, or cysteine) of the protein or to more than one type of amino acid residue (e g , lysine, histidine, aspartic acid, glutamic acid, cysteine and combinations thereof) of the protein
- the method of obtaining the N-terminally pegylated preparation (l e , separating this moiety from other monopegylated moieties if necessary) may be by purification of the N-terminally pegylated material from a population of pegylated protein molecules
- Selective proteins chemically modified at the N-terminus modification may be accomplished by reductive alkylation which exploits differential reactivity of different types of p ⁇ mary amino groups (lysine versus the N-terminal) available for denvatization in a particular protein Under the appropnate reaction conditions
- pegylation of the albumin fusion proteins of the invention may be accomplished by any number of means
- polyethylene glycol may be attached to the albumin fusion protein either directly or by an intervening linker
- Linkerless systems for attaching polyethylene glycol to proteins are described in Delgado et al , C ⁇ t Rev Thera Drug Camer Sys 9 249-304 (1992), Francis et al , Intern J of Hematol 68 1-18 (1998), U S Patent No 4,002,531, U S Patent No 5,349,052, WO 95/06058, and WO 98/32466, the disclosures of each of which are inco ⁇ orated herein by reference
- One system for attaching polyethylene glycol directly to amino acid residues of proteins without an intervening linker employs tresylated MPEG, which is produced by the modification of monmethoxy polyethylene glycol (MPEG) using tresylchlo ⁇ de (CISO 2 CH 2 CF 3 )
- MPEG monmethoxy polyethylene glycol
- tresylchlo ⁇ de CISO 2 CH 2 CF 3
- polyethylene glycol is directly attached to amine groups of the protein
- the invention includes protein- polyethylene glycol conjugates produced by reacting proteins of the invention with a polyethylene glycol molecule having a 2,2,2-t ⁇ fluoreothane sulphonyl group
- Polyethylene glycol can also be attached to proteins using a number of different intervening linkers
- U S Patent No 5,612,460 discloses urethane linkers for connecting polyethylene glycol to proteins
- Protein-polyethylene glycol conjugates wherein the polyethylene glycol is attached to the protein by a linker can also be produced by reaction of proteins with compounds such as MPEG-succinimidylsuccinate, MPEG activated with l,l'-carbonyld ⁇ m ⁇ dazole, MPEG- 2,4,5-t ⁇ chloropenylcarbonate, MPEG-p-nitrophenolcarbonate, and va ⁇ ous MPEG-succinate derivatives
- a number of additional polyethylene glycol derivatives and reaction chemist ⁇ es for attaching polyethylene glycol to proteins are descnbed in International Publication No WO 98/32466, the entire disclosure of which is inco ⁇ orated herein by reference Pegylated protein products produced using the reaction chemistries
- the number of polyethylene glycol moieties attached to each albumin fusion protein ofthe invention may also vary
- the pegylated proteins of the invention may be linked, on average, to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 17, 20, or more polyethylene glycol molecules
- the average degree of substitution within ranges such as 1-3, 2-4, 3-5, 4-6, 5-7, 6-8, 7-9, 8-10, 9-11, 10- 12, 11-13, 12-14, 13-15, 14-16, 15-17, 16-18, 17-19, or 18-20 polyethylene glycol moieties per protein molecule
- Methods for determining the degree of substitution are discussed, for example, in Delgado et al , C ⁇ t Rev Thera Drug Car ⁇ er Sys 9 249-304 (1992)
- polypeptides of the invention can be recovered and punfied from chemical synthesis and recombinant cell cultures by standard methods which include, but are not limited to, ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectm chromatography Most preferably, high performance liquid chromatography (“HPLC”) is employed for purification.
- HPLC high performance liquid chromatography
- Well known techniques for refolding protein may be employed to regenerate active conformation when the polypeptide is denatured during isolation and/or purification
- the presence and quantity of albumin fusion proteins of the invention may be determined using ELISA, a well known immunoassay known in the art
- ELISA protocol that would be useful for detecting/quantifying albumin fusion proteins of the invention, comp ⁇ ses the steps of coating an ELISA plate with an anti-human serum albumin antibody, blocking the plate to prevent non-specific binding, washing the ELISA plate, adding a solution containing the albumin fusion protein of the invention (at one or more different concentrations), adding a secondary anti- Therapeutic protein specific antibody coupled to a detectable label (as descnbed herein or otherwise known in the art), and detecting the presence of the secondary antibody
- the ELISA plate might be coated with the anti-Therapeutic protein specific antibody and the labeled secondary reagent might be the anti-human albumin specific antibody
- Uses ofthe Polynucleotides (0369] Each of the polynucleotides identified herein can be used in numerous ways as reagents The following description should
- polynucleotides of the present invention are useful to produce the albumin fusion proteins of the invention
- polynucleotides of the invention encoding albumin fusion proteins
- polynucleotides of the invention may be used in recombinant DNA methods useful in genetic enginee ⁇ ng to make cells, cell lines, or tissues that express the albumin fusion protein encoded by the polynucleotides encoding albumin fusion proteins ofthe invention
- Polynucleotides of the present invention are also useful in gene therapy
- One goal of gene therapy is to insert a normal gene into an organism having a defective gene, in an effort to conect the genetic defect
- the polynucleotides disclosed in the present invention offer a means of targeting such genetic defects in a highly accurate manner
- Another goal is to insert a new gene that was not present in the host genome, thereby producing a new trait in the host cell
- Additional non-limiting examples of gene therapy methods encompassed by the present invention are more thoroughly described elsewhere herein (see, e g , the sections labeled "Gene Therapy", and Examples 61 and 62)
- Uses ofthe Polypeptides [0372]
- Each of the polypeptides identified herein can be used in numerous ways The following desc ⁇ ption should be considered exemplary and utilizes known techniques
- Albumin fusion proteins of the invention are useful to provide immunological probes for differential identification of the t ⁇ ssue(s) (e g , immunohistochemistry assays such as, for example, ABC lmmunoperoxidase (Hsu et al , J Histochem Cytochem 29 577-580 (1981)) or cell type(s) (e g , immunocytochemistry assays)
- immunohistochemistry assays such as, for example, ABC lmmunoperoxidase (Hsu et al , J Histochem Cytochem 29 577-580 (1981)) or cell type(s) (e g , immunocytochemistry assays)
- Albumin fusion proteins can be used to assay levels of polypeptides in a biological sample using classical immunohistological methods known to those of skill in the art (e g , see Jalkanen, et al , J Cell Biol 101 976-985 (1985), Jalkanen, et al , J Cell Biol 105 3087-3096 (1987))
- Other methods useful for detecting protein gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA)
- Suitable assay labels are known in the art and include enzyme labels, such as, glucose oxidase, radioisotopes, such as iodine ("'I, l25 I, l23 I, 12I I), carbon ( l4 C), sulfur ( 35 S), tritium ( 3 H), indium (“ 5n, In, " 3 ⁇ , In, “ 2 In, “'in), and technetium (“Tc, Tc), thallium ( ⁇
- An albumin fusion protein which has been labeled with an appropriate detectable imaging moiety, such as a radioisotope (for example, 13 'I, " 2 ln, Tc, ("'1, 125 I, 123 I, 12, I), carbon ( l C), sulfur ( 3i S), tritium ( 3 H), indium (" 5m In, “ 3 °In, " 2 In, '”in), and technetium ("Tc, Tc), thallium ( 20l T ⁇ ), gallium ( 68 Ga, 67 Ga), palladium ( ,03 Pd), molybdenum ( 99 Mo), xenon ( ,33 Xe), fluorine ( 18 F, 153 Sm, ,77 Lu, ,59 Gd, , 9 Pm, 140 La, l75 Yb, '"Ho, " ⁇ , 47 Sc, 186 Re, l88 Re, 142 Pr, 10S Rh, 97 Ru), a radio-opaque substance, or a radio-op
- the invention provides a method for the specific delivery of albumin fusion proteins of the invention to cells by administering albumin fusion proteins of the invention (e g , polypeptides encoded by polynucleotides encoding albumin fusion proteins of the invention and/or antibodies) that are associated with heterologous polypeptides or nucleic acids
- the invention provides a method for delivering a Therapeutic protein into the targeted cell
- the invention provides a method for dehve ⁇ ng a single stranded nucleic acid (e g , antisense or nbozymes) or double stranded nucleic acid (e g , DNA that can integrate into the cell's genome or replicate episomally and that can be transc ⁇ bed) into the targeted cell
- the invention provides a method for the specific destruction of cells (e g , the destruction of tumor cells) by administering albumin fusion proteins of the invention in association with toxins or cytotoxic prodrugs
- toxin is meant one or more compounds that bind and activate endogenous cytotoxic effector systems, radioisotopes, holotoxms, modified toxins, catalytic subunits of toxins, or any molecules or enzymes not normally present in or on the surface of a cell that under defined conditions cause the cell's death
- Toxins that may be used according to the methods of the invention include, but are not limited to, radioisotopes known in the art, compounds such as, for example, antibodies (or complement fixing containing portions thereof) that bind an inherent or induced endogenous cytotoxic effector system, thymidine kinase, endonuclease, RNAse, alpha toxin, ⁇ cin, ab ⁇ n, Pseudomonas exotoxin A, diphthe ⁇ a toxin, sapo ⁇ n, momordin, gelonin, pokeweed antiviral protein, alpha-sarcin and cholera toxin "
- the invention provides a diagnostic method of a disorder, which involves (a) assaying the expression level of a certain polypeptide in cells or body fluid of an individual using an albumin fusion protein of the invention, and (b) comparing the assayed polypeptide expression level with a standard polypeptide expression level, whereby an increase or decrease in the assayed polypeptide expression level compared to the standard expression level is indicative of a disorder
- a diagnostic method of a disorder involves (a) assaying the expression level of a certain polypeptide in cells or body fluid of an individual using an albumin fusion protein of the invention, and (b) comparing the assayed polypeptide expression level with a standard polypeptide expression level, whereby an increase or decrease in the assayed polypeptide expression level compared to the standard expression level is indicative of a disorder
- the presence of a relatively high amount of transcript in biopsied tissue from an individual may indicate a predisposition for the development of the disease, or may provide a means for detecting the disease
- albumin fusion proteins of the present invention can be used to treat or prevent diseases or conditions such as, for example, neural disorders, immune system disorders, muscular disorders, reproductive disorders, gastrointestinal disorders, pulmonary disorders, cardiovascular disorders, renal disorders, proliferative disorders, and/or cancerous diseases and conditions
- patients can be administered a polypeptide of the present invention in an effort to replace absent or decreased levels ofthe polypeptide (e g , insulin), to supplement absent or decreased levels of a different polypeptide (e g , hemoglobin S for hemoglobin B, SOD, catalase, DNA repair proteins), to inhibit the activity of a polypeptide (e g , an oncogene or tumor supressor), to activate the activity of a polypeptide (e g , by binding to a receptor), to reduce the activity of a membrane bound receptor by competing with it for free ligand (e g , soluble TNF receptors used m reducing inflammation), or to bring about a desired response (e g , blood vessel
- the albumin fusion proteins of the invention of the present invention can be used as molecular weight markers on SDS- PAGE gels or on molecular sieve gel filtration columns using methods well known to those of skill in the art
- Albumin fusion proteins of the invention can also be used to raise antibodies, which in turn may be used to measure protein expression of the Therapeutic protein, albumin protein, and/or the albumin fusion protein of the invention from a recombinant cell, as a way of assessing transformation of the host cell, or in a biological sample
- the albumin fusion proteins ofthe present invention can be used to test the biological activities descnbed herein Diagnostic Assays
- the compounds of the present invention are useful for diagnosis, treatment, prevention and/or prognosis of various disorders in mammals, preferably humans Such disorders include, but are not limited to, those described for each Therapeutic protein in the conesponding row of Table 1 and herein under the section headings "Immune Activity,” "Blood Related Disorders," "Hy
- substantially altered (increased or decreased) levels of gene expression can be detected in tissues, cells or bodily fluids (e g , sera, plasma, urine, semen, synovial fluid or spinal fluid) taken from an individual having such a disorder, relative to a "standard" gene expression level, that is, the expression level m tissues or bodily fluids from an individual not having the disorder
- a diagnostic method useful during diagnosis of a disorder which involves measuring the expression level of the gene encoding a polypeptide in tissues, cells or body fluid from an individual and comparing the measured gene expression level with a standard gene expression level, whereby an increase or decrease in the gene expression level(s) compared to the standard is indicative of a disorder
- diagnostic assays may be performed in vivo or m vitro, such as, for example, on blood samples, biopsy tissue or autopsy tissue
- the present invention is also useful as a prognostic indicator, whereby patients exhibiting enhanced or depressed gene expression will experience a worse clinical outcome
- the expression level of the gene encoding a polypeptide is intended qualitatively or quantitatively measuring or estimating the level of a particular polypeptide (e g a polypeptide conesponding to a Therapeutic protein disclosed in Table 1) or the level of the mRNA encoding the polypeptide of the invention in a first biological sample either directly (e g , by determining or estimating absolute protein level or mRNA level) or relatively (e g , by comparing to the polypeptide level or mRNA level in a second biological sample)
- the polypeptide expression level or mRNA level in the first biological sample is measured or estimated and compared to a standard polypeptide level or mRNA level, the standard being taken from a second biological sample obtained from an individual not having the disorder or being determined by averaging levels from a population of individuals not having the disorder
- a standard polypeptide level or mRNA level is known, it can be used repeatedly as a standard for comparison
- biological sample any biological sample obtained from an individual, cell line, tissue culture, or other source containing polypeptides of the invention (including portions thereof) or mRNA
- biological samples include body fluids (such as sera, plasma, urine, synovial fluid and spinal fluid) and tissue sources found to express the full length or fragments thereof of a polypeptide or mRNA
- body fluids such as sera, plasma, urine, synovial fluid and spinal fluid
- tissue sources found to express the full length or fragments thereof of a polypeptide or mRNA
- Total cellular RNA can be isolated from a biological sample using any suitable technique such as the single-step guanidinium-thiocyanate-phenol-chloroform method described in Chomczynski and Sacchi, Anal Biochem 162 156-159 (1987) Levels of mRNA encoding the polypeptides of the invention are then assayed using any appropriate method These include Northern blot analysis, SI nuclease mapping, the polymerase chain reaction (PCR), reverse transcnption in combination with the polymerase chain reaction (RT-PCR), and reverse transcription in combination with the gase chain reaction (RT-LCR)
- PCR polymerase chain reaction
- RT-PCR reverse transcnption in combination with the polymerase chain reaction
- RT-LCR reverse transcription in combination with the gase chain reaction
- the present invention also relates to diagnostic assays such as quantitative and diagnostic assays for detecting levels of polypeptides that bind to, are bound by, or associate with albumin fusion proteins of the invention, in a biological sample (e g , cells and tissues), including determination of normal and abnormal levels of polypeptides
- a diagnostic assay in accordance with the invention for detecting abnormal expression of polypeptides that bind to, are bound by, or associate with albumin fusion proteins compared to normal control tissue samples may be used to detect the presence of tumors
- Assay techniques that can be used to determine levels of a polypeptide that bind to, are bound by, or associate with albumin fusion proteins of the present invention in a sample denved from a host are well-known to those of skill in the art
- Such assay methods include radioimmunoassays, competitive-binding assays, Western Blot analysis and ELISA assays Assaying polypeptide levels in a biological sample can occur using any art-known method
- Assaying polypeptide levels in a biological sample can occur using a vanety of techniques
- polypeptide expression in tissues can be studied with classical immunohistological methods (Jalkanen et al , J Cell Biol 101 976-985 (1985), Jalkanen, M , et al , J Cell Biol 105 3087-3096 (1987))
- immunoassays such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA)
- ELISA enzyme linked immunosorbent assay
- RIA radioimmunoassay
- Suitable antibody assay labels are known in the art and include enzyme labels, such as, glucose oxidase, and radioisotopes, such as iodine ( 125 1, 121 I), carbon ( l4 C), sulfur ( 35 S), tntium ( 3 H), indium ( 1,2 In), and technetium (Tc), and fluorescent labels, such as fluorescein and rhodamine,
- the tissue or cell type to be analyzed will generally include those which are known, or suspected, to express the gene of interest (such as, for example, cancer)
- the protein isolation methods employed herein may, for example, be such as those descnbed in Harlow and Lane (Harlow, E and Lane, D , 1988, “Antibodies A Laboratory Manual", Cold Spnng Harbor Laboratory Press, Cold Spring Harbor, New York), which is inco ⁇ orated herein by reference in its entirety
- the isolated cells can be derived from cell culture or from a patient
- the analysis of cells taken from culture may be a necessary step in the assessment of cells that could be used as part of a cell-based gene therapy technique or, alternatively, to test the effect of compounds on the expression ofthe gene
- albumin fusion proteins may be used to quantitatively or qualitatively detect the presence of polypeptides that bind to, are bound by, or associate with albumin fusion proteins of the present invention This can be accomplished, for example, by immunofluorescence techniques employing a fluorescently labeled albumin fusion protein coupled with light microscopic, flow cytomet ⁇ c, or fluo ⁇ met ⁇ c detection
- albumin fusion proteins compnsing at least a fragment or variant of an antibody that specifically binds at least a Therapeutic protein disclosed herein e g , the Therapeutic proteins disclosed in Table 1
- albumin fusion proteins compnsing at least a fragment or variant of an antibody that specifically binds at least a Therapeutic protein disclosed herein (e g , the Therapeutic proteins disclosed in Table 1) or otherwise known in the art may be used to quantitatively or qualitatively detect the presence of gene products or conserved va ⁇ ants or peptide fragments thereof This can be accomplished, for example, by immunofluorescence techniques employing a fluorescently labeled antibody coupled with light microscopic,
- the albumin fusion proteins of the present invention may, additionally, be employed histologically, as in immunofluorescence, immunoelectron microscopy or non-immunological assays, for in situ detection of polypeptides that bind to, are bound by, or associate with an albumin fusion protein of the present invention
- In situ detection may be accomplished by removing a histological specimen from a patient, and applying thereto a labeled antibody or polypeptide of the present invention
- the albumin fusion proteins are preferably applied by overlaying the labeled albumin fusion proteins onto a biological sample Through the use of such a procedure, it is possible to determine not only the presence of the polypeptides that bind to, are bound by, or associate with albumin fusion proteins, but also its dist ⁇ bution in the examined tissue Using the present invention, those of ordinary skill will readily perceive that any of a wide variety of histological methods (such as staining procedures) can be modified in order to achieve such in situ detection
- Immunoassays and non-immunoassays that detect polypeptides that bind to, are bound by, or associate with albumin fusion proteins will typically comprise incubating a sample, such as a biological fluid, a tissue extract, freshly harvested cells, or lysates of cells which have been incubated in cell culture, in the presence of a detectably labeled antibody capable of binding gene products or conserved variants or peptide fragments thereof, and detecting the bound antibody by any of a number of techniques well-known in the art
- the biological sample may be brought in contact with and immobilized onto a solid phase support or earner such as nitrocellulose, or other solid support which is capable of immobilizing cells, cell particles or soluble proteins
- a solid phase support or earner such as nitrocellulose, or other solid support which is capable of immobilizing cells, cell particles or soluble proteins
- the support may then be washed with suitable buffers followed by treatment with the detectably labeled albumin fusion protein of the invention
- the solid phase support may then be washed with the buffer a second time to remove unbound antibody or polypeptide
- the antibody is subsequently labeled
- the amount of bound label on solid support may then be detected by conventional means
- solid phase support or earner any support capable of binding a polypeptide (e g , an albumin fusion protein, or polypeptide that binds, is bound by, or associates with an albumin fusion protein of the invention )
- Well-known supports or earners include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, gabbros, and magnetite
- the nature of the earner can be either soluble to some extent or insoluble for the pu ⁇ oses of the present invention
- the support mate ⁇ al may have virtually any possible structural configuration so long as the coupled molecule is capable of binding to a polypeptide
- the support configuration may be spherical, as in a bead, or cylindrical, as in the inside surface of a test tube, or the external surface of a rod Alternatively, the surface may be flat such as a sheet, test stnp, etc
- Prefened supports include polystyrene
- albumin fusion proteins ofthe invention are used to image diseased or neoplastic cells
- Labels or markers for m vivo imaging of albumin fusion proteins of the invention include those detectable by X-radiography, NMR, MRI, CAT-scans or ESR
- suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to the subject
- suitable markers for NMR and ESR include those with a detectable characte ⁇ stic spin, such as deuterium, which may be inco ⁇ orated into the albumin
- a polypeptide-specific antibody or antibody fragment which has been labeled with an appropnate detectable imaging moiety such as a radioisotope (for example, l3l I, " 2 In, "Tc), a radio-opaque substance, or a matenal detectable by nuclear magnetic resonance, is introduced (for example, parenterally, subcutaneously or intrape ⁇ toneally) into the mammal to be examined for a disorder
- a radioisotope for example, l3l I, " 2 In, "Tc
- Tc radio-opaque substance
- an albumin fusion protein ofthe present invention can be detectably labeled is by linking the same to a reporter enzyme and using the linked product in an enzyme immunoassay (EIA) (Voller, A , "The Enzyme Linked Immunosorbent Assay (ELISA)", 1978, Diagnostic Ho ⁇ zons 2 1-7, Microbiological Associates Quarterly Publication, WalkersviUe, MD), Voller et al , J Clin Pathol 31 507-520 (1978), Butler, J E , Meth Enzymol 73 482-523 (1981), Maggio, E (ed ), 1980, Enzyme Immunoassay, CRC Press, Boca Raton, FL directions Ishikawa, E et al , (eds ), 1981 , Enzyme Immunoassay, Kgaku Shorn, Tokyo)
- EIA enzyme immunoassay
- the reporter enzyme which is bound to the antibody will react with an appropriate substrate, preferably a chromogenic substrate, in such a manner as to produce a
- Albumin fusion proteins may also be radiolabelled and used in any of a variety of other immunoassays
- RIA radioimmunoassay
- the radioactive isotope can be detected by means including, but not limited to, a gamma counter, a scintillation counter, or autoradiography
- chelator molecules are known in the art and can be used to label the Albumin fusion proteins
- Chelator molecules may be attached Albumin fusion proteins of the invention to facilitate labeling said protein with metal ions including radionuclides or fluorescent labels
- metal ions including radionuclides or fluorescent labels
- Chelator molecules may be attached Albumin fusion proteins of the invention to facilitate labeling said protein with metal ions including radionuclides or fluorescent labels
- metal ions including radionuclides or fluorescent labels
- the Albumin fusion protein of the invention are attached to an acyclic chelator such as diethylene t ⁇ amine- N,N,N',N",N"-pentaacet ⁇ c acid (DPTA), analogues of DPTA, and de ⁇ vatives of DPTA
- the chelator may be 2-(p- ⁇ soth ⁇ ocyanatobenzyl)-6- methyldiethylenetnam epentaacetic acid (1B4M-DPTA, also known as MX-DTPA), 2-methyI-6-(rho-n ⁇ trobenzyl)- 1,4,7- t ⁇ azaheptane-N,N,N',N",N"-pentaacet ⁇ c acid (nitro- 1B4M-DTPA or mtro-MX-DTPA), 2-(p- ⁇ soth ⁇ ocyanatobenzyl)- cyclohexyldiethylenet ⁇ aminepenta
- DPTA diethylene t ⁇ amine
- the Album fusion protein of the invention are attached to an acyclic te ⁇ y ⁇ dme chelator such as 6,6"- b ⁇ s[[N,N,N",N"- tetra(carboxymethyl)am ⁇ no]methyl]-4'-(3-am ⁇ no-4-methoxyphenyl)-2,2' 6',2 "- te ⁇ y ⁇ dine (TMT-amine)
- an acyclic te ⁇ y ⁇ dme chelator such as 6,6"- b ⁇ s[[N,N,N",N"- tetra(carboxymethyl)am ⁇ no]methyl]-4'-(3-am ⁇ no-4-methoxyphenyl)-2,2' 6',2 "- te ⁇ y ⁇ dine (TMT-amine)
- the macrocychc chelator which is attached to the the Albumin fusion protein of the invention is 1,4,7,10- tetraazacyclododecane-N,N',N",N'"-tetraacet ⁇ c acid (DOTA)
- DOTA is attached to the the Albumin fusion protein of the invention via a linker molecule Examples of linker molecules useful for conjugating DOTA to a polypeptide are commonly known in the art
- Bifunctional chelators based on macrocychc ligands m which conjugation is via an activated arm, or functional group, attached to the carbon backbone of the ligand can be employed as described by M Moi et al , J Amer Chem Soc 49 2639 (1989) (2-p-n ⁇ trobenzyl- 1,4,7, 10- tetraazacyclododecane-N,N',N",N'"-tetraacet ⁇ c acid), S V Deshpande et al , J Nucl Med 31 473 (1990), G Ruser et al , Bioconj Chem 1 345
- a macrocychc chelator such as polyazamacrocychc chelators, optionally containing one or more carboxy, amino, hydroxamate, phosphonate, or phosphate groups, are attached to the Album fusion protein of the invention
- the chelator is a chelator selected from the group consisting of DOTA, analogues of DOTA, and denvatives of DOTA
- suitable chelator molecules that may be attached to the the Albumin fusion protein of the invention include DOXA
- suitable macrocychc carboxylic acid chelators which can be used in the present invention include 1,4,7,10- tetraazacyclododecane-A/ ⁇ V ⁇ V" ⁇ V"-tetraacet ⁇ c acid (DOTA), l,4,8,12-tetraazacyclopentadecane-N,/V,/V", V"-tetraacetic acid (15N4), 1,4,7- t ⁇ azacyclononane-N,N',N"-t ⁇ acet ⁇ c acid (9N3), l,5,9-t ⁇ azacyc!ododecane-N,N',N"-t ⁇ acet ⁇ c acid (12N3), and 6-bromoacetam ⁇ do-benzyl-l, 4,8,1 1- tetraazacyclotetradecane- V ⁇ V ⁇ V' ⁇ V'-tetraacetic acid (BAT)
- DOTA 1,4,7,10- tetraazacyclododecane-A
- a prefened chelator that can be attached to the Albumin Fusion protein of the invention is ⁇ -(5- ⁇ soth ⁇ ocyanato- 2-methoxyphenyl)-
- 1,4,7, 10-tetraazacyclododecane-l,4,7,10-tetraacet ⁇ c acid which is also known as MeO-DOTA-NCS A salt or ester of ⁇ -(5- ⁇ soth ⁇ ocyanato- 2- methoxyphenyl)- l,4,7,10-tetraazacyclododecane-l,4,7,10-tetraacet ⁇ c acid may also be used
- Albumin fusion proteins of the invention to which chelators such as those dec ⁇ bed are covalently attached may be labeled (via the coordination site of the chelator) with radionuclides that are suitable for therapeutic, diagnostic, or both therapeutic and diagnostic pu ⁇ oses
- Examples of appropriate metals include Ag, At, Au, Bi, Cu, Ga, Ho, In, Lu, Pb, Pd, Pm, Pr, Rb, Re, Rh, Sc, Sr, Tc, TI, Y, and Yb
- Examples ofthe radionuclide used for diagnostic pu ⁇ oses are Fe, Gd, "'In, 67 Ga, or 68 Ga In another embodiment, the radionuchde used for diagnostic pu ⁇ oses is
- the radionuclide used for therapeutic pu ⁇ oses are '"Ho, l ⁇ 5 Dy, “ ⁇ , " s “Tn, S2 Fe, or 72 Ga
- the radionuchde used for diagnostic pu ⁇ oses is l66 Ho or " ⁇
- Examples of the radionuclides used for both therapeutic and diagnostic pu ⁇ oses include
- the radionuchde is 153 Sm, 177 Lu, 17s Yb, or ,59 Gd
- Prefened metal radionuclides include 90 Y, "Tc, "'In, 7 Sc, “Ga, 5, Cr, 177m Sn, 67 Cu, ,67 Tm, 97 Ru, 188 Re, 177 Lu, '"Au, 47 Sc, "Ga, s 'Cr,
- Albumin fusion proteins of the invention to which chelators are covalently attached may be labeled with a metal ion selected from the group consisting of *Y, '"In, 177 Lu, ⁇ Ho, 21s B ⁇ , and 225 Ac
- radionuclides such as “Tc, "'In, 67 Ga, and '"Yb have been approved or under investigation for diagnostic imaging, while ⁇ -emitters, such as 6 Cu, "'Ag, 186 Re, and * ⁇ are useful for the applications in tumor therapy
- ⁇ -emitters such as 6 Cu, "'Ag, 186 Re, and * ⁇ are useful for the applications in tumor therapy
- other useful radionuclides include ⁇ -emifters, such as “Tc, '"In, 67 Ga, and ,69 Yb, and ⁇ -emitters, such as 67 Cu, " ⁇ g, 186 Re, l88 Re and "Y, as well as other radionuclides of interest such as 2,, At, 212 B ⁇ , 177 Lu, 86 Rb , ,05 Rh, 153 Sm, ,98 Au, l49 Pm, S5 Sr, l42 Pr, 2,4 Pb, ,0!> Pd, '"Ho,
- Albumin fusion proteins of the invention to which chelators are covalently attached may be labeled with paramagnetic metal ions including ions of transition and lanthanide metal, such as metals having atomic numbers of 21-29, 42, 43, 44, or 57-71, in particular ions of Cr, V, Mn, Fe, Co, Ni, Cu, La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, and Lu
- paramagnetic metals used in compositions for magnetic resonance imaging include the elements having atomic numbers of 22 to 29, 42, 44 and 58-70
- Albumin fusion proteins of the invention to which chelators are covalently attached may be labeled with fluorescent metal ions including lanthamdes, in particular La, Ce, Pr, Nd, Pm, Sm, Eu (e g , 152 Eu), Gd, Tb, Dy, Ho, Er, Tm, Yb, and Lu
- Albumin fusion proteins of the invention to which chelators are covalently attached may be labeled with heavy metal-containing reporters may include atoms of Mo, Bi, Si, and W
- the albumm fusion protein can also be detectably labeled using fluorescence emitting metals such as 152 Eu, or others of the lanthamde se ⁇ es These metals can be attached to the antibody using such metal chelating groups as diethylenet ⁇ aminepentacetic acid (DTPA) or ethylenediaminetetraacetic acid (EDTA)
- DTPA diethylenet ⁇ aminepentacetic acid
- EDTA ethylenediaminetetraacetic acid
- the albumm fusion proteins can also can be detectably labeled by coupling it to a chemiluminescent compound The presence of the chemiluminescent-tagged albumin fusion protein is then determined by detecting the presence of luminescence that arises during the course of a chemical reaction
- chemiluminescent labeling compounds are luminol, isoluminol, theromatic acndinium ester, lmidazole, acndinium salt and oxalate ester
- a bioluminescent compound may be used to label albumin fusion proteins ofthe present invention
- Bioluminescence is a type of chemiluminescence found in biological systems in, which a catalytic protein increases the efficiency of the chemiluminescent reaction The presence of a bioluminescent protein is determined by detecting the presence of luminescence
- Important bioluminescent compounds for pu ⁇ oses of labeling are lucifenn, luciferase and aequonn Transgenic Organisms
- Transgenic organisms that express the albumin fusion proteins of the invention are also included in the invention
- Transgenic organisms are genetically modified organisms into which recombinant, exogenous or cloned genetic material has been transfened Such genetic matenal is often refened to as a transgene
- the nucleic acid sequence ofthe transgene may include one or more transc ⁇ ptional regulatory sequences and other nucleic acid sequences such as introns, that may be necessary for optimal expression and secretion of the
- a transgenic organism may be a transgenic animal or a transgenic plant
- Transgenic animals can be produced by a variety of different methods including transfection, electroporation, microinjection, gene targeting in embryonic stem cells and recombinant viral and retroviral infection (see, eg , U S Patent No 4,736,866, U S Patent No 5,602,307, Mullins et al (1993) Hypertension 22(4) 630-633, Brenin et al (1997) Surg Oncol 6(2)99-1 10, Tuan (ed ), Recombinant Gene Expression Protocols, Methods in Molecular Biology No 62, Humana Press (1997))
- the method of introduction of nucleic acid fragments into recombination competent mammalian cells can be by any method which favors co-transformation of multiple nucleic acid molecules Detailed procedures for producing transgenic animals are readily available to one skilled in the art, including the disclosures in U S Patent No 5,489,743 and U S Patent No 5,602,307
- mice A number of recombinant or transgenic mice have been produced, including those which express an activated oncogene sequence (U S Patent No 4,736,866), express simian SV40 T-antigen (U S Patent No 5,728,915), lack the expression of interferon regulatory factor 1 (IRF-1) (U S Patent No 5,731,490), exhibit dopaminergic dysfunction (U S Patent No 5,723,719), express at least one human gene which participates in blood pressure control (U S Patent No 5,731,489), display greater similarity to the conditions existing in naturally occumng Alzheimer's disease (U S Patent No 5,720,936), have a reduced capacity to mediate cellular adhesion (U S Patent No 5,602,307), possess a bovine growth hormone gene (Clutter et al (1996) Genetics 143(4) 1753-1760), or, are capable of generating a fully human antibody response (McCarthy (1997) The Lancet 349(9049) 405)
- mice and rats remain the animals of choice for most transgenic experimentation, in some instances it is preferable or even necessary to use alternative animal species Transgenic procedures have been successfully utilized in a variety of non-mu ⁇ ne animals, including sheep, goats, pigs, dogs, cats, monkeys, chimpanzees, hamsters, rabbits, cows and guinea pigs (see, eg, Kim et al (1997) Mol Reprod Dev 46(4) 515-526, Houdebine (iw ) ⁇ eprod Nutr Dev 35(6) 609-617, Petters (1994) Reprod Fertil Dev 6(5) 643-645, Schnieke et al (1997) Science 278(5346) 2130-2133, and Amoah (1997) J Animal Science 75(2) 578-585)
- transgenic mammals To direct the secretion of the transgene-encoded protein of the invention into the milk of transgenic mammals, it may be put under the control of a promoter that is preferentially activated in mammary epithelial cells Promoters that control the genes encoding milk proteins are prefened, for example the promoter for casein, beta lactoglobulin, whey acid protein, or lactalbumin (see, eg , DiTullio (1992) BioTechnology 10 74-77, Clark et al (1989) BioTechnology 7 487 ⁇ 192, Gorton et al (1987) BioTechnology 5 1183-1187, and Soulier et al (1992) FEBS Letts 297 13)
- the transgenic mammals of choice would produce large volumes of milk and have long lactating periods, for example goats, cows, camels or sheep
- An albumin fusion protein of the invention can also be expressed in a transgenic plant, eg a plant in which the DNA transgene is inserted into the nuclear or plastidic genome Plant transformation procedures used to introduce foreign nucleic acids into plant cells or protoplasts are known in the art See, in general, Methods in Enzymology Vol 153 ("Recombinant DNA Part D") 1987, Wu and Grossman Eds , Academic Press and European Patent Application EP 693554 Methods for generation of genetically engineered plants are further descnbed in US Patent No 5,283,184, US Patent No 5, 482,852, and European Patent Application EP 693 554, all of which are hereby inco ⁇ orated by reference Pharmaceutical or Therapeutic Compositions [0435]
- the albumin fusion proteins of the invention or formulations thereof may be administered by any conventional method including parenteral (e g subcutaneous or intramuscular) injection or intravenous infusion
- the treatment may consist of a single dose or a plurality of doses over a period of time
- albumin fusion protein of the invention While it is possible for an albumm fusion protein of the invention to be administered alone, it is preferable to present it as a pharmaceutical formulation, together with one or more acceptable earners
- the camer(s) must be "acceptable” in the sense of being compatible with the albumin fusion protein and not deleterious to the recipients thereof
- the earners will be water or saline which will be sterile and pyrogen free
- Albumin fusion proteins of the invention are particularly well suited to formulation in aqueous earners such as sterile pyrogen free water, saline or other isotonic solutions because of their extended shelf-life in solution
- pharmaceutical compositions of the invention may be formulated well in advance in aqueous form, for instance, weeks or months or longer time pe ⁇ ods before being dispensed
- formulations containing the albumin fusion protein may be prepared taking into account the extended shelf-life of the albumin fusion protein in aqueous formulations As discussed above, the shelf-life of many of these
- the albumin fusion proteins of the invention can be formulated as aerosols using standard procedures
- aerosol includes any gas-borne suspended phase of an albumin fusion protein of the instant invention which is capable of being inhaled into the bronchioles or nasal passages
- aerosol includes a gas-borne suspension of droplets of an albumin fusion protein of the instant invention, as may be produced in a metered dose inhaler or nebulizer, or in a mist sprayer Aerosol also includes a dry powder composition of a compound of the instant invention suspended in air or other earner gas, which may be delivered by insufflation from an inhaler device, for example See Ganderton & Jones, Drug Delivery to the Respiratory Tract, Ellis Horwood (19 87), Gonda (1990) Critical Reviews in Therapeutic Drug Carrier Systems 6 273-313, and Raebum et al (1992) Pharmacol Toxicol Methods ll 143-159 [0439]
- Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacte ⁇ ostats and solutes which render the formulation appropriate for the intended recipient, and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents
- the formulations may be presented in unit-dose or multi-dose containers, for example sealed ampules, vials or syringes, and may be stored in a freeze-d ⁇ ed (lyophihsed) condition requiring only the addition of the sterile liquid earner, for example water for injections, immediately prior to use
- Extemporaneous injection solutions and suspensions may be prepared from sterile powders
- Dosage formulations may contain the Therapeutic protein portion at a lower molar concentration or lower dosage compared to the non-fused standard formulation for the Therapeutic protein given the extended serum half-life exhibited by many of the albumin fusion proteins of the invention
- an albumm fusion protein of the invention comprises one of the proteins listed in the "Therapeutic Protein X" column of Table 1 as one or more of the Therapeutic protein regions
- the dosage form can be calculated on the basis of the potency of the albumin fusion protein relative to the potency ot the therapeutic protein alone, while taking into account the prolonged serum half-life and shelf-life of the albumin fusion proteins compared to that of native therapeutic protein
- the therapeutic protein is typically administered at 0 3 to 30 0 IU/kg/week, or 0 9 to 12 0 IU/kg/week, given in three or seven divided doses for a year or more
- an equivalent dose in terms of units would represent a greater weight of agent but the dosage frequency can be reduced, for example to twice a week, once a week or less
- Formulations or compositions of the invention may be packaged together with, or included in a kit with, instructions or a package insert refening to the extended shelf-life of the albumin fusion protein component
- instructions or package inserts may address recommended storage conditions, such as time, temperature and light, taking into account the extended or prolonged shelf-life of the albumin fusion proteins of the invention
- Such instructions or package inserts may also address the particular advantages of the albumin fusion proteins of the inventions, such as the ease of storage for formulations that may require use in the field, outside of controlled hospital, clinic or office conditions
- formulations of the invention may be in aqueous form and may be stored under less than ideal circumstances without significant loss of therapeutic activity
- albumin fusion proteins of the invention can also be included in nutraceuticals
- certain albumin fusion proteins of the invention may be administered in natural products, including milk or milk product obtained from a transgenic mammal which expresses albumin fusion protein
- Such compositions can also include plant or plant products obtained from a transgenic plant which expresses the albumin fusion protein
- the albumin fusion protein can also be provided in powder or tablet form, with or without other known additives, earners, fillers and diluents Nutraceuticals are descnbed in Scott Hegenhart, Food Product Design, Dec 1993
- the invention also provides methods of treatment and/or prevention of diseases or disorders (such as, for example, any one or more of the diseases or disorders disclosed herein) by administration to a subject of an effective amount of an albumin fusion protein of the invention or a polynucleotide encoding an albumin fusion protein ofthe invention ("albumin fusion polynucleotide") in a pharmaceutically acceptable earner [0446]
- the albumin fusion protein and/or polynucleotide will be formulated and dosed in a fashion consistent with good medical practice, taking into account the clinical condition of the individual patient (especially the side effects of treatment with the albumin fusion protein and/or polynucleotide alone), the site of delivery, the method of administration, the scheduling of administration, and other factors known to practitioners
- the "effective amount" for pu ⁇ oses herein is thus determined by such considerations
- the total pharmaceutically effective amount of the albumin fusion protein administered parenterally per dose will be in the range of about lug/kg/day to 10 mg/kg/day of patient body weight, although, as noted above, this will be subject to therapeutic discretion More preferably, this dose is at least 0 01 mg/kg/day, and most preferably for humans between about 0 01 and 1 mg/kg/day for the hormone
- the albumin fusion protein is typically administered at a dose rate of about 1 ug/kghour to about 50 ug/kg/hour, either by 1 -4 injections per day or by continuous subcutaneous infusions, for example, using a mini-pump
- An intravenous bag solution may also be employed The length of treatment needed to observe changes and the interval following treatment for responses to occur appears to vary depending on the desired effect
- the albumin fusion protein of the invention has a higher plasma stabhty compared to the Therapeutic protein portion (or fragment or vanant thereof) alone This increase in plasma stability should be taken into account when determining the effective amount of the albumin fusion protein to be administered per dose and the dosing administration schedule.
- higher plasma stability may allow the albumin fusion protein to be administered at a lower dose at the same frequency of administrations, or alternatively, may allow the albumin fusion protein to be administered in fewer dosings
- the higher stability allows the albumin fusion protein of the invention to be administered less often in fewer dosings
- the albumin fusion protein can be administered once every two weeks
- the albumin fusion protein can be administered once every three, four, five, or more weeks depending on the pharmacokinetics of the albumin fusion protein
- the pharmacokinetics of an IFN-alpha-HSA fusion protein supports a dosing regimen of once every 2-4 weeks
- Albumin fusion proteins and/or polynucleotides can be are administered orally, rectally, parenterally, intracisternally, intravaginally, intrape ⁇ toneally, topically (as by powders, ointments, gels, drops or transdermal patch), bucally, or as an oral or nasal spray
- “Pharmaceutically acceptable earner” refers to a non-toxic solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any
- parenteral refers to modes of administration which include intravenous, intramuscular, intraperitoneal, intrastemal, subcutaneous and intraarticular injection and infusion
- albumin fusion proteins and/or polynucleotides of the invention are also suitably administered by sustained-release systems
- sustained-release albumin fusion proteins and/or polynucleotides are administered orally, rectally, parenterally, intracisternally, intravaginally, intraperitoneally, topically (as by powders, ointments, gels, drops or transdermal patch), bucally, or as an oral or nasal spray
- “Pharmaceutically acceptable earner” refers to a non-toxic solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type
- parenteral refers to modes of administration which include intravenous, intramuscular, intraperitoneal, intrastemal, subcutaneous and intraarticular injection and infusion
- Additional examples of sustained-release albumin fusion proteins and/or polynucleotides include suitable polymeric materials tsuch as, for example, semi-permeable polymer matrices in the form
- Sustained-release mat ⁇ ces include polylactides (U S Pat No 3,773,919, EP 58,481), copolymers of L-glutamic acid and gamma-ethyl-L-glutamate (Sidman et al , Biopolymers 22 547-556 (1983)), poly (2- hydroxyethyl methacrylate) (Langer et al , J Biomed Mater Res 15 167-277 (1981), and Langer, Chem Tech 12 98-105 (1982)), ethylene vinyl acetate (Langer et al , Id ) or poly-D- (-)-3-hydroxybuty ⁇ c acid (EP 133,988)
- Sustained-release albumin fusion proteins and/or polynucleotides also include posomally entrapped albumin fusion proteins and/or polynucleotides of the invention (see generally, Langer, Science 249 1527-1533 (1990), Treat et al , in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds ), Liss, New York, pp 317 -327 and 353-365 (1989))
- Liposomes containing the albumin fusion protein and/or polynucleotide are prepared by methods known per se DE 3,218,121, Epstein et al , Proc Natl Acad Sci (USA) 82 3688-3692 (1985), Hwang et al , Proc Natl Acad Sci (USA) 77 4030-4034 (1980), EP 52,322, EP 36,676, EP 88,046, EP 143,949, EP 142,641, Japanese Pat Appl 83
- the albumin fusion proteins and/or polynucleotides of the invention are delivered by way of a pump (see Langer, supra, Sefton, CRC Cnt Ref Biomed Eng 14 201 (1987), Buchwald et al , Surgery 88 507 (1980), Saudek et al , N Engl J Med 321 574 (1989))
- the albumin fusion protein and/or polynucleotide is formulated generally by mixing it at the desired degree of purity, in a unit dosage injectable form (solution, suspension, or emulsion), with a pharmaceutically acceptable earner, l e , one that is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation
- the formulation preferably does not include oxidizing agents and other compounds that are known to be deleterious to the Therapeutic
- the formulations are prepared by contacting the albumin fusion protein and/or polynucleotide uniformly and intimately with liquid earners or finely divided solid earners or both Then, if necessary, the product is shaped into the desired formulation
- the earner is a parenteral earner, more preferably a solution that is isotonic with the blood of the recipient
- Examples of such earner vehicles include water, saline, Ringer's solution, and dextrose solution
- the earner suitably contains minor amounts of additives such as substances that enhance isotonicity and chemical stability
- Such materials are non-toxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, succinate, acetic acid, and other organic acids or their salts, antioxidants such as ascorbic acid, low molecular weight (less than about ten residues) polypeptides, e g , polyargimne or tnpeptides, proteins, such as serum albumin, gelatin, or immunoglobulins, hydrophilic polymers such as polyvmylpynolidone, amino acids, such as glycine, glutamic acid, aspartic acid, or arginine, monosaccha ⁇ des, disaccha ⁇ des, and other carbohydrates including cellulose or its derivatives, glucose, manose, or dext ⁇ ns, chelating agents such as EDTA, sugar alcohols such as mannitol or sorbitol, counte ⁇ ons such as
- the albumin fusion protein is typically formulated in such vehicles at a concentration of about 0 1 mg/ml to 100 mg/ml, preferably 1-10 mg/ml, at a pH of about 3 to 8 It will be understood that the use of certain of the foregoing excipients, earners, or stabilizers will result in the formation of polypeptide salts
- any pharmaceutical used for therapeutic administration can be sterile Stenhty is readily accomplished by filtration through stenle filtration membranes (e g , 0 2 micron membranes)
- Albumin fusion proteins and/or polynucleotides generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle
- Albumin fusion proteins and/or polynucleotides ordinarily will be stored in unit or multi-dose containers, for example, sealed ampoules or vials, as an aqueous solution or as a lyophihzed formulation for reconstitution
- 10-ml vials are filled with 5 ml of sterile-filtered 1% (w/v) aqueous albumm fusion protein and/or polynucleotide solution, and the resulting mixture is lyophihzed
- the infusion solution is
- the invention also provides a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the albumin fusion proteins and/or polynucleotides of the invention Associated with such conta ⁇ ner(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration
- the albumin fusion proteins and/or polynucleotides may be employed in con j unction with other therapeutic compounds
- albumin fusion proteins and/or polynucleotides of the invention may be administered alone or in combination with adjuvants
- Ad j uvants that may be administered with the albumin fusion proteins and/or polynucleotides of the invention include, but are not limited to, alum, alum plus deoxycholate (ImmunoAg), MTP-PE (Biocine Co ⁇ ), QS21 (Genentech, Inc ), BCG (e g , THERACYS®), MPL and nonviable preparations of Corynebacterium parvum
- albumin fusion proteins and/or polynucleotides of the invention are administered in combination with alum
- albumin fusion proteins and/or polynucleotides of the invention are administered in combination with QS-21
- Further adjuvants that may be administered with the albumin fusion proteins and/or polynucleotides of the invention include, but are not limited to, Monophosphoryl lipid immunomodul
- albumin fusion proteins and/or polynucleotides of the invention may be administered alone or in combination with other therapeutic agents
- Albumin fusion protein and/or polynucleotide agents that may be administered in combination with the albumin fusion proteins and/or polynucleotides of the invention include but not limited to, chemotherapeutic agents, antibiotics, steroidal and non-steroidal anti-inflammato ⁇ es, conventional lmmunotherapeutic agents, and/or therapeutic treatments described below
- Combinations may be administered either concomitantly, e g , as an admixture, separately but simultaneously or concunently, or sequentially
- This includes presentations in which the combined agents are administered together as a therapeutic mixture, and also procedures in which the combined agents are administered separately but simultaneously, e g , as through separate intravenous lines into the same individual Administration "in combination” further includes the separate administration of one ofthe compounds or agents given first, followed by the second
- the albumin fusion proteins and/or polynucleotides of the invention are administered in combination with an anticoagulant
- Anticoagulants that may be administered with the compositions of the invention include, but are not limited to, hepa ⁇ n, low molecular weight hepa ⁇ n, warfarin sodium (e g , COUMADIN®), dicumarol, 4-hydroxycouma ⁇ n, anisindione (e g , M1RADONTM), acenocoumarol (e g , nicoumalone, SINTHROMETM), ⁇ ndan-l,3-d ⁇ one, phenprocoumon (e g , MARCUMARTM), ethyl biscoumacetate (e g , TROMEXANTM), and aspirin
- compositions of the invention are administered in combination with hepa ⁇ n and/or warfarin
- compositions of the invention are administered in combination with warfa ⁇ n
- warfa ⁇ n In another anticoagulant
- the albumin fusion proteins and/or polynucleotides of the invention are administered in combination with thrombolytic drugs
- thrombolytic drugs that may be administered with the compositions of the invention include, but are not limited to, plasminogen, lys-plasminogen, alpha2-ant ⁇ plasm ⁇ n, streptokinae (e g , KABIKINASETM), antiresplace (e g , EMINASETM), tissue plasminogen activator (t-PA, altevase, ACTIVASETM), urokinase (e g , ABBOK1NASETM), sauruplase, (Prourokinase, single chain urokinase), and aminocaproic acid (e g , AMICARTM)
- compositions of the invention are administered in combination with tissue plasminogen activator and aspirin
- albumin fusion proteins and/or polynucleotides of the invention are administered in combination with antiplatelet drugs
- Antiplatelet drugs that may be administered with the compositions of the invention include, but are not limited to, aspirin, dipy ⁇ damole (e g , PERSANTINETM), and ticlopidine (e g , TICLIDTM)
- the use of anti-coagulants, thrombolytic and/or antiplatelet drugs in combination with albumin fusion proteins and/or polynucleotides of the invention is contemplated for the prevention, diagnosis, and/or treatment of thrombosis, arterial thrombosis, venous thrombosis, thromboembohsm, pulmonary embolism, atherosclerosis, myocardial infarction, transient ischemic attack unstable angina
- the use of anticoagulants, thrombolytic drugs and/or antiplatelet drugs in combination with albumin fusion proteins and/or polynucleotides ot the invention is contemplated for the prevention of occulsion of saphenous grafts, for reducing the ⁇ sk of pe ⁇ procedural thrombosis as might accompany angioplasty procedures, for reducing the risk of stroke in patients with at ⁇ al fib ⁇ llation including nonrheumatic atnal fibnllation, for
- albumin fusion proteins and/or polynucleotides of the invention are administered in combination with antiretroviral agents, nucleoside/nucleotide reverse transcriptase inhibitors (NRTIs), non- ⁇ ucleoside reverse transcnptase inhibitors (NNRTls), and/or protease inhibitors (Pis) NRTIs that may be administered in combination with the albumin fusion proteins and or polynucleotides of the invention, include, but are not limited to, RETROVIRTM (zidovudine/AZT), VIDEXTM (didanosine/ddl), HIVIDTM (zalcitabine/ddC), ZERITTM (stavud ⁇ ne/d4T), EPrVIRTM (lam ⁇ vud ⁇ ne/3TC), and COMBIVIRTM (zidovudme/lamivudine) NNRTls that may be administered in combination with the albumin fusion proteins and/or
- Additional NRTIs include LODENOSINETM (F-ddA, an acid-stable adenosine NRTI, T ⁇ angle/Abbott, COVIRACILTM (emtricitabine/FTC, structurally related to lamivudine (3TC) but with 3- to 10-fold greater activity in vitro, Triangle/Abbott), dOTC (BCH-10652, also structurally related to lamivudine but retains activity against a substantial proportion of lamivudine-resistant isolates, Biochem Pharma), Adefovir (refused approval for anti-HIV therapy by FDA, Gilead Sciences), PREVEON® (Adefovir Dipivoxil, the active prodrug of adefovir, its active form is PMEA-pp), TENOFOVIRTM (bis-POC PMPA, a PMPA prodrug, Gilead), DAPD/DXG (active metabolite of DAPD, T ⁇ angle
- Additional NNRTls include COACTINONTM (Emivirine/MKC-442, potent NNRTI of the HEPT class, T ⁇ angle/Abbott), CAPRAVIRINETM (AG-1549/S-1 153, a next generation NNRTI with activity against viruses containing the K103N mutation; Agouron), PNU- 142721 (has 20- to 50-fold greater activity than its predecessor delavirdine and is active against K103N mutants; Pharmacia & Upjohn), DPC-961 and DPC-963 (second-generation derivatives of efavirenz, designed to be active against viruses with the K103N mutation, DuPont), GW-420867X (has 25-fold greater activity than HBY097 and is active against K103N mutants, Glaxo Wellcome), CALANOLIDE A (naturally occumng agent from the latex tree, active against viruses containing either or both the Y181C and K103N mutations), and Propolis (WO 99/49830) [0472
- Additional antiretroviral agents include fusion mhibitors/chemokine receptor antagonists
- Fusion inhibitors/chemokine receptor antagonists include CXCR4 antagonists such as AMD 3100 (a bicyclam), SDF-1 and its analogs, and ALX40-4C (a cationic peptide), T22 (an 18 am o acid peptide, T ⁇ me ⁇ s) and the T22 analogs T134 and T140, CCR5 antagonists such as RANTES (9-68), AOP-RANTES, NNY-RANTES, and TAK-779, and CCR5/CXCR4 antagonists such as NSC 651016 (a distamycin analog) Also included are CCR2B, CCR3, and CCR6 antagonists Chemokine recpetor agonists such as RANTES, SDF-1, MlP-l ⁇ , MlP-l ⁇ , etc , may also inhibit fusion
- Additional antiretroviral agents include integrase inhibitors
- Integrase inhibitors include dicaffeoylquimc (DFQA) acids, L-chico ⁇ c acid (a dicaffeoyltarta ⁇ c (DCTA) acid), quinahza ⁇ n (QLC) and related anthraquinones, ZINTEVIRTM (AR 177, an oligonucleotide that probably acts at cell surface rather than being a true integrase inhibitor, Arondex), and naphthols such as those disclosed in WO 98/50347
- Additional antiretroviral agents include hydroxyurea-like compunds such as BCX-34 (a pu ⁇ ne nucleoside phosphorylase inhibitor, Biocryst), ⁇ bonucleotide reductase inhibitors such as D1DOXTM (Molecules for Health), inosine monophosphate dehydrogenase (IMPDH) inhibitors sucha as VX-497 (Vertex), and mycopholic acids such as CellCept (mycophenolate mofetil, Roche) 10477]
- Additional antiretroviral agents include inhibitors of viral integrase, inhibitors of viral genome nuclear translocation such as arylene b ⁇ s(methylketone) compounds, inhibitors of HIV entry such as AOP-RANTES, NNY-RANTES, RANTES-IgG fusion protein, soluble complexes of RANTES and glycosaminoglycans (GAG), and AMD-3100, nucleocapsid zinc finger inhibitors such as dithiane compounds,
- cytokines and lymphokines such as MlP-l ⁇ , MlP-l ⁇ , SDF-l ⁇ , IL-2, PROLEUKINTM (aldesleukm/L2-7001 , Chiron), IL IL-10, IL-12, and IL-13, interferons such as IFN-alpha2a, IFN-alpha2b, or IFN-beta, antagonists of TNFs, NF B, GM-CSF, M-CSF, and IL-10, agents that modulate immune activation such as cyclosporin and predmsone, vaccines such as RemuneTM (HIV Immunogen), APL 400-003 (Apollon), recombinant gpl20 and fragments, bivalent (B/E) recombinant envelope glycoprotein, rgpl20CM235, MN rgpl20, SF-2 rgpl20, gpl20/soluble CD4 complex
- interferon albumin fusion protein is administered in combination with ⁇ bavi ⁇ n
- interferon alpha albumin fusion protein is administered in combination with ⁇ bavi ⁇ n
- interferon alpha 2a albumin fusion protein is administered in combination with nbavi ⁇ n
- interferon alpha 2b albumin fusion protein is administered in combination with ⁇ bavi ⁇ n
- interferon beta albumin fusion protein is administered in combination with ⁇ bavi ⁇ n
- hybrid interferon albumin fusion protein is administered in combination with ⁇ bavi ⁇ n
- albumin fusion proteins and/or polynucleotides of the invention may be administered in combination with anti- opportunistic infection agents
- Anti-opportunistic agents that may be administered in combination with the albumin fusion proteins and/or polynucleotides of the invention include, but are not limited to, TR1METHOPRIM-SULFAMETHOXAZOLETM, DAPSONETM, PENTAMIDINETM, ATOVAQUONETM, ISONIAZIDTM, RIFAMPINTM, PYRAZINAMIDETM, ETHAMBUTOLTM, RIFABUTINTM, CLARITHROMYCINTM, AZITHROMYCINTM, GANCICLOVIRTM, TOSCARNETTM, CIDOFOVIRTM, FLUCONAZOLETM, ITRACONAZOLETM, KETOCONAZOLETM, ACYCLOVIRTM, FAMCICOLVIRTM, PYRIMETHAMINETM, LEUCOVORINTM, NEU
- albumin fusion proteins and/or polynucleotides of the invention are administered in combination with an antibiotic agent
- Antibiotic agents that may be administered with the albumin fusion proteins and or polynucleotides of the invention include, but are not limited to, amoxicillin, beta-lactamases, aminoglycosides, beta-lactam (glycopeptide), beta-lactamases, Clindamycin, chloramphenieol, cephalospo ⁇ ns, ciprofloxacin, erythromycin, fluoroqumolones, macrohdes, metronidazole, penicillins, qumolones, rapamycin, ⁇ fampin, streptomycin, sulfonamide, tetracychnes, t ⁇ methop ⁇ m, t ⁇ methop ⁇ m-sulfamethoxazole, and vancomycin
- the albumin fusion proteins and or polynucleotides of the invention are administered in combination with immunestimulants
- Immunostimulants that may be administered in combination with the albumin fusion proteins and or polynucleotides of the invention include, but are not limited to, levamisole (e g , ERGAMISOLTM), isop ⁇ nosine (e g INOSIPLEXTM), interferons (e g interferon alpha), and interleukins (e g , IL-2)
- albumin fusion proteins and/or polynucleotides of the invention are administered in combination with immunosuppressive agents
- Immunosuppressive agents that may be administered in combination with the albumin fusion proteins and/or polynucleotides of the invention include, but are not limited to, steroids, cyclospo ⁇ ne, cyclospo ⁇ ne analogs, cyclophosphamide methylprednisone, prednisone, azathiop ⁇ ne, FK-506, 15-deoxyspergual ⁇ n, and other immunosuppressive agents that act by suppressing the function of responding T cells
- Other immunosuppressive agents that may be administered in combination with the albumin fusion proteins and/or polynucleotides of the invention include, but are not limited to, predmsolone, methotrexate, thahdomide, methoxsalen, rapamycin, leflunomide, mizo ⁇ bine (BREDININTM), brequinar,
- the albumin fusion proteins and/or polynucleotides of the invention are administered alone or as part of a combination therapy, either in vivo to patients or in vitro to cells, for the treament of cancer
- the albumin fusion proteins, particularly IL-2 -albumin fusions are administered repeatedly during passive immunotherapy for cancer, such as adoptive cell transfer therapy for metastatic melanoma as described in Dudley et al (Science Express, 19 September 2002 , at www scienceexpress org, hereby inco ⁇ orated by reference in its entirety)
- the albumin fusion proteins and/or polynucleotides of the invention are administered alone or in combination with an anti-inflammatory agent
- Anti-inflammatory agents that may be administered with the albumin fusion proteins and/or polynucleotides of the invention include, but are not limited to, corticosteroids (e g betamethasone, budesomde, cortisone, dexamethasone, hydrocortisone, methylprednisolone, predmsolone, prednisone, and t ⁇ amcinolone), nonsteroidal anti-inflammatory drugs (e g , diclofenac, diflu sal, etodolac, fenoprofen, floctafenine, flurbiprofen, ibuprofen, lndomethacin, ketoprofen, meclofenamate, mefenamic acid, meloxicam, nabumetone, naproxen, oxaprozin,
- compositions of the invention are administered alone or in combination with an anti-angiogenic agent
- Anti-angiogenic agents that may be administered with the compositions of the invention include, but are not limited to, Angiostatin (Entremed, Rockville, MD), Troponin- 1 (Boston Life Sciences, Boston, MA), anti-Invasive Factor, retinoic acid and derivatives thereof, paclitaxel (Taxol), Suramin, Tissue Inhibitor of Metalloprote ⁇ nase-1, Tissue Inhibitor of Metalloprote ⁇ nase-2, VEGI, Plasminogen Activator Inh ⁇ b ⁇ tor-1, Plasminogen Activator lnh ⁇ b ⁇ tor-2, and various forms ofthe lighter "d group" transition metals
- Lighter "d group” transition metals include, for example, vanadium, molybdenum, tungsten, titanium, niobium, and tantalum species Such transition metal species may form transition metal complexes Suitable complexes of the above-mentioned transition metal species include oxo transition metal complexes
- vanadium complexes include oxo vanadium complexes such as vanadate and vanadyl complexes
- Suitable vanadate complexes include metava ⁇ adate and orthovanadate complexes such as, for example, ammonium metavanadate, sodium metavanadate, and sodium orthovanadate
- Suitable vanadyl complexes include, for example, vanadyl acetylacetonate and vanadyl sulfate including vanadyl sulfate hydrates such as vanadyl sulfate mono- and t ⁇ hydrates
- tungsten and molybdenum complexes also include oxo complexes Suitable oxo tungsten complexes include tungstate and tungsten oxide complexes Suitable tungstate complexes include ammonium tungstate, calcium tungstate, sodium tungstate dihydrate, and tungstic acid Suitable tungsten oxides include tungsten (IV) oxide and tungsten (VI) oxide Suitable oxo molybdenum complexes include molybdate, molybdenum oxide, and molybdenyl complexes Suitable molybdate complexes include ammonium molybdate and its hydrates, sodium molybdate and its hydrates, and potassium molybdate and its hydrates Suitable molybdenum oxides include molybdenum (VI) oxide, molybdenum (VI) oxide, and molybdic acid Suitable molybdenyl complexes include, for example, molybdenyl acetylaceton
- a wide variety of other anti-angiogenic factors may also be utilized within the context ofthe present invention
- Representative examples include, but are not limited to, platelet factor 4, protamine sulphate, sulphated chitin de ⁇ vatives (prepared from queen crab shells), (Murata et al , Cancer Res 51 22-26, (1991)), Sulphated Polysaccha ⁇ de Peptidoglycan Complex (SP- PG) (the function of this compound may be enhanced by the presence of steroids such as estrogen, and tamoxifen citrate), Staurospo ⁇ ne, modulators of matrix metabolism, including for example, proline analogs, cishydroxyprohne, d,L-3,4-dehydroprol ⁇ ne, Thiaprohne, alpha,alpha-d ⁇ pyndyl, aminopropionit ⁇ le fumarate, 4-propyl-5-(4-pyr ⁇ dmyl)- 2(3H)-oxazolone, Methotrexate, Mitoxantron
- Additional anti-angiogenic factors include Thahdomide, (Celgene, Wanen, NJ), Angiostatic steroid, AGM-1470 (H Brem and J Folkman J Pediatr Surg 28 445-51 (1993)), an integnn alpha v beta 3 antagonist (C Storgard et al , J Clin Invest 103 47-54 (1999)), carboxynaminolmidazole, Carboxyamidot ⁇ azole (CAI) (National Cancer Institute, Bethesda, MD), Conbretastatin A-4 (CA4P) (OXiGENE, Boston, MA), Squalamine (Magaimn Pharmaceuticals, Plymouth Meeting, PA), TNP ⁇ 70, (Tap Pharmaceuticals, Deerfield, IL), ZD-0101 AstraZeneca (London, UK), APRA (CT2584), Benefin, Byrostat ⁇ n-1 (SC339555), CGP-4125
- Anti-angiogenic agents that may be admimsted in combination with the compounds of the invention may work through a variety of mechanisms including, but not limited to, inhibiting proteolysis of the extracellular mat ⁇ x, blocking the function of endothelial cell-extracellular matrix adhesion molecules, by antagonizing the function of angiogenesis inducers such as growth factors, and inhibiting integnn receptors expressed on proliferating endothelial cells
- Examples of anti-angiogenic inhibitors that interfere with extracellular mat ⁇ x proteolysis and which may be administered in combination with the compositons of the invention include, but are not limited to, AG-3340 (Agouron, La Jolla, CA), BAY-12-9566 (Bayer, West Haven, CT), BMS-275291 (Bristol Myers Squibb, Princeton, NJ), CGS-27032A (Novartis, East Hanover, NJ), Ma ⁇ mastat (British Biotech, Oxford, UK), and Metastat (Aetema, St
- compositions of the invention are administered in combination with a chemotherapeutic agent
- compositions of the invention are administered in combination with one or more of the following drugs lnfliximab (also known as RemicadeTM Centocor, Inc ), Trocade (Roche, RO-32-3555), Leflunomide (also known as AravaTM from Hoechst Ma ⁇ on Roussel), KineretTM (an IL-1 Receptor antagonist also known as Anakmra from Amgen, Inc )
- lnfliximab also known as RemicadeTM Centocor, Inc
- Trocade also known as RemicadeTM Centocor, Inc
- Leflunomide also known as AravaTM from Hoechst Ma ⁇ on Roussel
- KineretTM an IL-1 Receptor antagonist also known as Anakmra from Amgen, Inc
- compositions of the invention are administered in combination with CHOP (cyclophosphamide, doxorubicin, vincnstine, and prednisone) or combination of one or more of the components of CHOP
- CHOP cyclophosphamide, doxorubicin, vincnstine, and prednisone
- the compositions of the invention are administered in combination with ant ⁇ -CD20 antibodies, human monoclonal ant ⁇ -CD20 antibodies
- the compositions ofthe invention are administered in combination with ant ⁇ -CD20 antibodies and CHOP, or ant ⁇ -CD20 antibodies and any combination of one or more of the components of CHOP, particularly cyclophosphamide and/or prednisone
- compositions of the invention are administered in combination with Rituximab
- compositions of the invention are administered with Rituximab and CHOP, or Rituximab and any combination of one or more of the components of CHOP, particularly cyclophosphamide and/or prednisone
- compositions of the invention are administered in combination ZevahnTM
- compositions of the invention are administered with ZevahnTM and CHOP, or ZevahnTM and any combination of one or more of the components of CHOP, particularly cyclophosphamide and or prednisone ZevahnTM may be associated with one or more radisotopes Particularly prefened isotopes are " ⁇ and '"in
- albumin fusion proteins and/or polynucleotides of the invention are administered in combination with cytokines
- Cytokines that may be administered with the albumin fusion proteins and/or polynucleotides of the invention include, but are not limited to, IL2, IL3, IL4, IL5, IL6, IL7, IL10, IL12, IL13, IL15, ant ⁇ -CD40, CD40L, IFN-gamma and TNF-alpha
- albumin fusion proteins and or polynucleotides of the invention may be administered with any interleukin, including, but not limited to, IL-1 alpha, lL-lbeta, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, 1L-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19
- the albumin fusion proteins and or polynucleotides of the invention are administered in combination with members of the TNF family TNF, TNF-related or TNF-hke molecules that may be administered with the albumin fusion proteins and/or polynucleotides of the invention include, but are not limited to, soluble forms of TNF-alpha, lymphotoxin-alpha (LT-alpha, also known as TNF-beta), LT-beta (found in complex heterot ⁇ mer LT-alpha2-beta), OPGL, FasL, CD27L, CD30L, CD40L, 4-1 BBL, DcR3, OX40L, TNF-gamma (International Publication No WO 96/14328), AIM-I (International Publication No WO 97/33899), endokine-alpha (International Publication No WO 98/07880), OPG, and neutrokine-alpha (International Publication No WO 98/18921, O
- the albumin fusion proteins and/or polynucleotides of the invention are administered in combination with angiogenic proteins
- Angiogenic proteins that may be administered with the albumin fusion proteins and/or polynucleotides of the invention include, but are not limited to, Ghoma De ⁇ ved Growth Factor (GDGF), as disclosed in European Patent Number EP-399816, Platelet De ⁇ ved Growth Factor-A (PDGF-A), as disclosed in European Patent Number EP-682110, Platelet Derived Growth Factor-B (PDGF-B), as disclosed in European Patent Number EP-282317, Placental Growth Factor (PlGF), as disclosed in International Publication Number WO 92/06194, Placental Growth Factor-2 (P1GF-2), as disclosed in Hauser et al , Growth Factors, 4 259-268 (1993), Vascular Endothelial Growth Factor (VEGF), as disclosed in International Publication Number WO 90/13649, Vascular Endothelial fibroal VEGF
- the albumin fusion proteins and/or polynucleotides of the invention are administered in combination with Fibroblast Growth Factors
- Fibroblast Growth Factors include, but are not limited to, FGF-1, FGF-2, FGF-3, FGF-4, FGF-5, FGF-6, FGF-7, FGF-8, FGF-9, FGF-10, FGF-11, FGF-12, FGF-13, FGF-14, and FGF-15
- the albumin fusion proteins and/or polynucleotides of the invention are administered in combination with hematopoietic growth factors
- Hematopoietic growth factors that may be administered with the albumin fusion proteins and/or polynucleotides of the invention include, but are not limited to, granulocyte macrophage colony stimulating factor (GM-CSF) (sargramostim, LEUKINETM, PROKINETM), granulocyte colony stimulating factor (G-CSF) (filgrastim, NEUPOGENTM), macrophage colony stimulating factor (M-CSF, CSF-1) erythropoietin (epoetin alfa, EPOGENTM, PROCRITTM), stem cell factor (SCF, c-kit ligand, steel factor), megakaryocyte colony stimulating factor, PD Y321 (a GMCSF/IL-3 fusion protein), interleukins, especially any one or more of IL-1 through IL-12, inter
- the albumin fusion proteins and or polynucleotides of the invention are administered in combination with an antianhythmic drug (e g , adenosine, amidoarone, bretylium, digitalis, digoxin, digitoxin, diliazem, disopyramide, esmolol, flecainide, hdocaine, mexiletine, mo ⁇ cizine, phenytoin, procainamide, N-acetyl procainamide, propafenone, propranolol, quinidine, sotalol, tocaimde, and verapamil
- the albumin fusion proteins and/or polynucleotides of the invention are administered in combination with diuretic agents, such as carbonic anhydrase-inhibiting agents (e g , acetazolamide, dichlo ⁇ henamide, and methazolamide), osmotic di
- the albumin fusion proteins and/or polynucleotides of the invention are administered in combination with treatments for endocrine and/or hormone imbalance disorders
- Treatments for endocrine and/or hormone imbalance disorders include, but are not limited to, l27 I, radioactive isotopes of iodine such as ,31 I and l23 I, recombinant growth hormone, such as HUMATROPETM (recombinant somatropin), growth hormone analogs such as PROTROPINTM (somatrem), dopamine agonists such as PARLODELTM (bromoc ⁇ ptine), somatostatin analogs such as SANDOSTATINTM (octreotide), gonadotropm preparations such as PREGNYLTM, A P L TM and PROFASITM (cho ⁇ omc gonadotropm (CG)), PERGONALTM (menotropins), and METRODINTM (urofol tropin (uFSH)), synthetic human
- Additional treatments for endocrine and/or hormone imbalance disorders include, but are not limited to, estrogens or congugated estrogens such as ESTRACETM (estradiol), ESTINYLTM (ethinyl estradiol), PREMARINTM, ESTRATABTM, ORTHO-ESTTM, OGENTM and estropipate (estrone), ESTROVISTM (quinestrol), ESTRADERMTM (estradiol), DELESTROGENTM and VALERGENTM (estradiol valerate), DEPO- ESTRADIOL CYPIONATETM and ESTROJECT LATM (estradiol cypionate), antiestrogens such as NOLVADEXTM (tamoxifen), SEROPHENETM and CLOMIDTM (clomiphene), progestins such as DURALUTINTM (hydroxyprogesterone caproate), MPATM and DEPO-PROVERATM (medroxyprogesterone acetate), PROVERATM and
- Additional treatments for endoc ⁇ ne and/or hormone imbalance disorders include, but are not limited to, testosterone esters such as methenolone acetate and testosterone undecanoate, parenteral and oral androgens such as TESTOJECT-50TM (testosterone), TESTEXTM (testosterone propionate), DELATESTRYLTM (testosterone enanthate), DEPO-TESTOSTERONETM (testosterone cypionate), DANOCRINETM (danazol), HALOTESTINTM (fluoxymesterone), ORETON METHYLTM, TESTREDTM and VIRILONTM (methyltestosterone), and OXANDRINTM (oxandrolone), testosterone transdermal systems such as TESTODERMTM, androgen receptor antagonist and 5-aIpha-reductase inhibitors such as ANDROCURTM (cyproterone acetate), EULEXINTM (flutamide), and PROSCARTM (finaste ⁇ de
- the albumin fusion proteins and/or polynucleotides of the invention are administered in combination with treatments for ute ⁇ ne motihty disorders
- Treatments for uterine motihty disorders include, but are not limited to, estrogen drugs such as conjugated estrogens (e g , PREMARIN ® and ESTRATAB ® ), estradiols (e g , CLIMARA ® and ALORA ® ), estropipate, and chlorot ⁇ anisene, progestin drugs (e g , AMEN ® (medroxyprogesterone), MICRONOR ® (norethidrone acetate), PROMETRRJM ® progesterone, and megestrol acetate), and estrogen/progesterone combination therapies such as, for example, conjugated estrogens/medroxyprogesterone (e g , PREMPROTM and PREMPHASE ® ) and norethmdrone acetate/ethin
- the albumin fusion proteins and/or polynucleotides of the invention are administered in combination with drugs effective in treating iron deficiency and hypochromic anemias, including but not limited to, fenous sulfate (iron sulfate, FEOSOLTM), fenous fumarate (e g , FEOSTATTM), fenous gluconate (e g , FERGONTM), polysaccha ⁇ de-iron complex (e g , NIFEREXTM), iron dextran injection (e g , INFEDTM), cup ⁇ c sulfate, pyroxidine, ⁇ boflavin, Vitamin B, 2 , cyancobalamin injection (e g , REDISOLTM, RUBRAMIN PCTM), hydroxocobalamin, folic acid (e g , FOLVITETM), leucovonn (folinic acid, 5-CHOH4PteGlu, citrovorum factor) or
- the albumin fusion proteins and/or polynucleotides of the invention are administered m combination with agents used to treat psychiat ⁇ c disorders
- Psychiat ⁇ c drugs that may be administered with the albumin fusion proteins and/or polynucleotides of the invention include, but are not limited to, antipsychotic agents (e g , chlo ⁇ romazme, chlo ⁇ rothixene, clozapine, fluphenazine, halope ⁇ dol, loxapine, mesondazine, molmdone, olanzapine, pe ⁇ henazine, pimozide, quetiapine, ⁇ spe ⁇ done, thio ⁇ daz e, thiothixene, t ⁇ fluoperazine, and t ⁇ flupromazine), antimanic agents (e g , carbamazepine, divalproex sodium, lithium carbonate, and lithium citrate),
- antipsychotic agents
- the albumin fusion proteins and/or polynucleotides of the invention are administered in combination with agents used to treat neurological disorders
- Neurological agents that may be administered with the albumin fusion proteins and/or polynucleotides of the invention include, but are not limited to, antiepileptic agents (e g , carbamazepine, clonazepam, ethosuximide, phenobarbital, phenytoin, p ⁇ midone, valproic acid, divalproex sodium, felbamate, gabapentin, lamot ⁇ gine, levetiracetam, oxcarbazepine, tiagabine, topiramate, zomsamide, diazepam, lorazepam, and clonazepam), antiparkinsonian agents (e g , levodopa/carbidopa, selegihne, amantidine, bromoc ⁇ ptine, pergo de,
- the albumin fusion proteins and/or polynucleotides of the invention are administered in combination with treatments for gastrointestinal disorders
- Treatments for gastrointestinal disorders that may be administered with the albumin fusion protein and/or polynucleotide of the invention include, but are not limited to, H 2 histamine receptor antagonists (e g , TAGAMETTM (cimetidine), ZANTACTM (ranitidine), PEPCIDTM (famotidi ⁇ e), and AXIDTM (mzatidine)), inhibitors of H + , K + ATPase (e g , PREVACIDTM (lansoprazole) and PRILOSECTM (omeprazole)), Bismuth compounds (e g , PEPTO-BISMOLTM (bismuth subsahcylate) and DE-NOLTM (bismuth subcitrate)), various antacids, sucralfate, prostaglandin analogs (e g CYTOTECTM
- the invention also provides a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions comprising albumin fusion proteins of the invention
- Optionally associated with such conta ⁇ ner(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration
- Gene Therapy [0521] Constructs encoding albumin fusion proteins of the invention can be used as a part of a gene therapy protocol to deliver therapeutically effective doses of the albumin fusion protein
- a prefened approach for in vivo introduction of nucleic acid into a cell is by use of a viral vector containing nucleic acid, encoding an albumm fusion protein of the invention
- Infection of cells with a viral vector has the advantage that a large proportion of the targeted cells can receive the nucleic acid
- Retrovirus vectors and adeno-associated virus vectors can be used as a recombinant gene delivery system for the transfer of exogenous nucleic acid molecules encoding albumin fusion proteins in vivo These vectors provide efficient delivery of nucleic acids into cells, and the transfened nucleic acids are stably integrated into the chromosomal DNA of the host.
- the development of specialized cell lines (termed "packaging cells") which produce only replication-defective retroviruses has increased the utility of retroviruses for gene therapy, and defective retroviruses are characterized for use in gene transfer for gene therapy pu ⁇ oses (for a review see Miller, A D (1990) Blood 76 27 1)
- a replication defective retrovirus can be packaged into vi ⁇ ons which can be used to infect a target cell through the use of a helper virus by standard techniques Protocols for producing recombinant retroviruses and for infecting cells in vitro or in vivo with such viruses can be found m Cunent Protocols in Molecular
- non-viral gene delivery systems of the present invention rely on endocytic pathways for the uptake of the subject nucleotide molecule by the targeted cell
- Exemplary gene delivery systems of this type include liposomal de ⁇ ved systems, poly-lysme conjugates, and artificial viral envelopes
- a nucleic acid molecule encoding an albumin fusion protein of the invention can be entrapped in liposomes bearing positive charges on their surface (e , pofectins) and (optionally) which are tagged with antibodies against cell surface antigens of the target tissue (Mizuno et al (1992) No Shinkei Geka 20 547-5 5 1, PCT publication W091/06309, Japanese patent application 1047381, and European patent publication EP-A-43075)
- Gene delivery systems for a gene encoding an albumin fusion protein of the invention can be introduced into a patient by any of a number of methods
- a pharmaceutical preparation of the gene delivery system can be introduced systemically, e g by intravenous injection, and specific transduction of the protein in the target cells occurs predominantly from specificity of transfection provided by the gene delivery vehicle, cell-type or tissue-type expression due to the transcriptional regulatory sequences controlling expression of the receptor gene, or a combination thereof
- initial delivery of the recombinant gene is more limited with introduction into the animal being quite localized
- the gene delivery vehicle can be introduced by catheter (see U S Patent 5,328,470) or by Stereotactic injection (e g Chen et al (1994) PNAS 91 3 054-3 05 7)
- the pharmaceutical preparation of the gene therapy construct can consist essentially ofthe gene delivery system in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded Where the albumin fusion protein can be produced
- cells from a patient may be engineered with a polynucleotide (DNA or RNA) comprising a promoter operably linked to a polynucleotide encoding an albumin fusion protein of the present invention ex vivo, with the engineered cells then being provided to a patient to be treated with the fusion protein of the present invention
- a polynucleotide DNA or RNA
- Such methods are well-known in the art For example, see Belldegrun, A , et al , J
- the cells which are engineered are artenal cells
- the arterial cells may be reintroduced into the patient through direct injection to the artery, the tissues sunounding the artery, or through catheter injection
- the polynucleotide constructs can be delivered by any method that delivers injectable materials to the cells of an animal, such as, injection into the interstitial space of tissues (heart, muscle, skin, lung, liver, and the like)
- the polynucleotide constructs may be delivered in a pharmaceutically acceptable liquid or aqueous earner
- polynucleotides encoding the albumin fusion proteins of the present invention is delivered as a naked polynucleotide
- naked polynucleotide, DNA or RNA refers to sequences that are free from any delivery vehicle that acts to assist, promote or facilitate entry into the cell, including viral sequences, viral particles, hposome formulations, lipofectin or precipitating agents and the like
- polynucleotides encoding the albumin fusion proteins of the present invention can also be delivered in hposome formulations and lipofectin formulations and the like can be prepared by methods well known to those skilled in the art Such methods are described, for example, in
- the polynucleotide vector constructs used in the gene therapy method are preferably constructs that will not integrate into the host genome nor will they contain sequences that allow for replication
- Appropnate vectors include pWLNEO, pSV2CAT, pOG44, pXTl and pSG available from Stratagene, pSVK3, pBPV, pMSG and pSVL available from Pharmacia, and pEFl/V5, pcDNA3 1, and pRc/CMV2 available from
- Suitable promoters include adenoviral promoters, such as the adenoviral major late promoter, or heterologous promoters, such as the cytomegalovirus (CMV) promoter, the respiratory syncytial virus (RSV) promoter, inducible promoters, such as the MMT promoter, the metallothionein promoter, heat shock promoters, the albumin promoter, the ApoAI promoter, human globin promoters, viral thymidine kinase promoters, such as the He ⁇ es
- CMV cytomegalovirus
- RSV respiratory syncytial virus
- inducible promoters such as the MMT promoter, the metallothionein promoter, heat shock promoters, the albumin promoter, the ApoAI promoter, human globin promoters, viral thymidine kinase promoters, such as the He ⁇ es
- the promoter also may be the native promoter for the gene conesponding to the Therapeutic protein portion ofthe albumm fusion proteins ofthe invention
- the polynucleotide construct can be delivered to the interstitial space of tissues within the an animal, including of muscle, skin, brain, lung, liver, spleen, bone manow, thymus, heart, lymph, blood, bone, cartilage, pancreas, kidney, gall bladder, stomach, intestine, testis, ovary, uterus, rectum, nervous system, eye, gland, and connective tissue Interstitial space of the tissues comp ⁇ ses the intercellular, fluid, mucopolysaccha ⁇ de matrix among the reticular fibers of organ tissues, elastic fibers in the walls of vessels or chambers, collagen fibers of fibrous tissues, or that same matrix within connective tissue ensheathing muscle cells or in the lacunae of bone It is similarly the space occupied by the plasma of the circulation and the lymph fluid of the lymphatic channels Delivery to the interstitial space of muscle tissue is prefened for the reasons discussed below They may be conveniently delivered by injection into the tissues comprising these cells They are preferably delivered to and expressed in persistent
- an effective dosage amount of DNA or RNA will be in the range of from about 0 05 mg/kg body weight to about 50 mg/kg body weight
- the dosage will be from about 0 005 mg/kg to about 20 mg/kg and more preferably from about 0 05 mg/kg to about 5 mg/kg
- this dosage will vary according to the tissue site of injection
- the appropriate and effective dosage of nucleic acid sequence can readily be determined by those of ordinary skill in the art and may depend on the condition being treated and the route of administration
- the prefened route of administration is by the parenteral route of injection into the interstitial space of tissues
- parenteral routes may also be used, such as, inhalation of an aerosol formulation particularly for delivery to lungs or bronchial tissues, throat or mucous membranes of the nose
- naked DNA constructs can be delivered to arteries du ⁇ ng angioplasty by the catheter used in the procedure
- the naked polynucleotides are delivered by any method known in the art, including, but not limited to, direct needle injection at the delivery site, intravenous injection, topical administration, catheter infusion, and so-called "gene guns" These delivery methods are known in the art
- constructs may also be delivered with delivery vehicles such as viral sequences, viral particles, hposome formulations, lipofectin, precipitating agents, etc.
- delivery vehicles such as viral sequences, viral particles, hposome formulations, lipofectin, precipitating agents, etc.
- the polynucleotide constructs are complexed in a hposome preparation
- Liposomal preparations for use in the instant invention include cationic (positively charged), anionic (negatively charged) and neutral preparations
- cationic liposomes are particularly prefened because a tight charge complex can be formed between the cationic hposome and the polyanionic nucleic acid Cationic liposomes have been shown to mediate intracellular delivery of plasmid DNA (Feigner et al , Proc Natl Acad Sci USA (1987) 84 7413-7416, which is herein inco ⁇ orated by reference), mRNA (Malone et al , Proc Natl Acad Sci USA (1989) 86 6077-6081, which is herein inco ⁇ orated by reference), and purified transcription factors (Debs et al , J Biol Chem (1990) 265 10189-10192, which is herein inco ⁇ orated by
- Cationic liposomes are readily available for example, N[l-2,3-d ⁇ oleyloxy)pro ⁇ yl]-N,N,N-t ⁇ ethylammon ⁇ um (DOTMA) liposomes are particularly useful and are available under the trademark Lipofectin, from GIBCO BRL, Grand Island, N Y (See, also, Feigner et al , Proc Natl Acad Sci USA (1987) 84 7413-7416, which is herein inco ⁇ orated by reference)
- Other commercially available liposomes include transfectace (DDAB/DOPE) and DOTAP/DOPE (Boehringer)
- cationic liposomes can be prepared from readily available mate ⁇ als using techniques well known in the art See, e g PCT Publication No WO 90/11092 (which is herein inco ⁇ orated by reference) for a description of the synthesis of DOTAP (l,2-b ⁇ s(oleoyloxy)-3- (trimethylammomo)propane) liposomes Preparation of DOTMA liposomes is explained in the literature, see, e g , P Feigner et al , Proc Natl Acad Sci USA 84 7413-7417, which is herein inco ⁇ orated by reference Similar methods can be used to prepare liposomes from other cationic lipid materials
- anionic and neutral liposomes are readily available, such as from Avanti Polar Lipids (Birmingham, Ala ), or can be easily prepared using readily available matenals
- Such materials include phosphatidyl, chohne, cholesterol, phosphatidyl ethanolamine, dtoleoylphosphatidyl chohne (DOPC), dioleoylphosphatidyl glycerol (DOPG), dioleoylphoshatidyl ethanolamine (DOPE), among others
- DOPC dioleoylphosphatidyl glycerol
- DOPE dioleoylphoshatidyl ethanolamine
- DOPG/DOPC vesicles can be prepared by drying 50 mg each of DOPG and DOPC under a stream of nitrogen gas into a sonication vial The sample is placed under a vacuum pump overnight and is hydrated the following day with deiomzed water The sample is then sonicated for 2 hours m a capped vial, using a Heat Systems model 350 sonicator equipped with an inverted cup (bath type) probe at the maximum setting while the bath is circulated at 15 degrees celcius
- negatively charged vesicles can be prepared without sonication to produce multilamellar vesicles or by extrusion through nucle
- the liposomes can comprise multilamellar vesicles (MLVs), small umlamellar vesicles (SUVs), or large umlamellar vesicles (LUVs), with SUVs being prefened
- MLVs containing nucleic acid can be prepared by depositing a thin film of phospholipid on the walls of a glass tube and subsequently hydrating with a solution of the mate ⁇ al to be encapsulated SUVs are prepared by extended sonication of MLVs to produce a homogeneous population of umlamellar liposomes The mate ⁇ al to be entrapped is added to a suspension of preformed MLVs and then sonicated When using liposome
- the ratio of DNA to liposomes will be from about 10 1 to about 1 10
- the ration will be from about 5 1 to about 1 5 More preferably, the ration will be about 3 1 to about 1 3 Still more preferably, the ratio will be about 1 1
- U S Patent No 5,6/6,y54 (which is herein inco ⁇ orated by reference) reports on the injection of genetic material, complexed with cationic liposomes earners, into mice
- U S Patent Nos 4,897,355, 4,946,787, 5,049,386, 5,459,127, 5,589,466, 5,693,622, 5,580,859, 5,703,055, and international publication no WO 94/9469 (which are herein inco ⁇ orated by reference) provide cationic lipids for use in transfectmg DNA into cells and mammals
- cells are engineered, ex vivo or in vivo, using a retroviral particle containing RNA which comprises a sequence encoding an albumin fusion protein of the present invention
- Retroviruses from which the retroviral plasmid vectors may be derived include, but are not limited to, Moloney Munne Leukemia Virus, spleen necrosis virus, Rous sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, gibbon ape leukemia virus, human immunodeficiency virus, Myeloprohferative Sarcoma Virus, and mammary tumor virus
- the retroviral plasmid vector is employed to transduce packaging cell lines to form producer cell lines
- packaging cells which may be transfected include, but are not limited to, the PE501, PA317, R-2, R-AM, PA12, T19-14X, VT-19-17-H2, RCRE, RCR1P, GP+E-86, GP+envAml2, and DAN cell lines as descnbed in Miller, Human Gene Therapy 1 5-14 (1990), which is inco ⁇ orated herein by reference in its entirety
- the vector may transduce the packaging cells through any means known in the art Such means include, but are not limited to, electroporation, the use of liposomes, and CaP0 4 precipitation
- the retroviral plasmid vector may be encapsulated into a hposome, or coupled to a lipid, and then administered to a host
- the producer cell line generates infectious retroviral vector particles which include polynucleotide encoding an albumin fusion protein of the present invention
- retroviral vector particles then may be employed, to transduce eukaryotic cells, either in vitro or in vivo
- the transduced eukaryotic cells will express a fusion protin ofthe present invention
- cells are engineered, ex vivo or in vivo, with polynucleotide contained in an adenovirus vector
- Adenovirus can be manipulated such that it encodes and expresses fusion protein of the present invention, and at the same time is inactivated in terms of its ability to replicate in a normal lytic viral life cycle
- Adenovirus expression is achieved without integration ofthe viral DNA into the host cell chromosome, thereby alleviating concerns about insertional mutagenesis
- adenoviruses have been used as live ente ⁇ c vaccines for many years with an excellent safety profile (Schwartz et al Am Rev Respir Dis 109 233-238 (1974))
- adenovirus mediated gene transfer has been demonstrated in a number of instances including transfer of alpha- 1-ant ⁇ tryps ⁇ n and CFTR to the lungs of cotton rats (Rosenfeld, M A et al (1991) Science 252 431-434, Rosenfeld et al , (1992
- adenoviral vectors useful in the present invention are described, for example, in Kozarsky and Wilson, Cun Opin Genet Devel 3 499-503 (1993), Rosenfeld et al , Cell 68 143-155 (1992), Engelhardt et al , Human Genet Ther 4 759-769 (1993), Yang et al , Nature Genet 7 362-369 (1994), Wilson et al , Nature 365 691-692 (1993), and U S Patent No 5,652,224, which are herein inco ⁇ orated by reference
- the adenovirus vector Ad2 is useful and can be grown in human 293 cells These cells contain the El region of adenovirus and constitutively express Ela and Elb, which complement the defective adenoviruses by providing the products ofthe genes deleted from the vector
- Ad2 other va ⁇ eties of adenovirus (e g , Ad3, Ad5, and Ad7) are also useful in the present invention
- the adenoviruses used in the present invention are replication deficient Replication deficient adenoviruses require the aid of a helper virus and/or packaging cell line to form infectious particles
- the resulting virus is capable of infecting cells and can express a polynucleotide of interest which is operably linked to a promoter, but cannot replicate in most cells
- Replication deficient adenoviruses may be deleted in one or more of all or a portion of the following genes Ela, Elb, E3, E4, E2a, or Ll through L5
- the cells are engineered, ex vivo or in vivo, using an adeno-associated virus (AAV)
- AAVs are naturally occumng defective viruses that require helper viruses to produce infectious particles (Muzyczka, N , Curr Topics in Microbiol Immunol 158 97 (1992))
- helper viruses to produce infectious particles
- Vectors containing as little as 300 base pairs of AAV can be packaged and can integrate, but space for exogenous DNA is limited to about 4 5 kb
- Methods for producing and using such AAVs are known in the art See, for example, U S Patent Nos 5,139,941, 5,173,414, 5,354,678, 5,436,146, 5,474,935, 5,478,745, and 5,589,377
- an appropriate AAV vector for use in the present invention will include all the sequences necessary for DNA replication, encapsidation, and host-cell integration
- Another method of gene therapy involves operably associating heterologous control regions and endogenous polynucleotide sequences (e g encoding a polypeptide of the present invention) via homologous recombination (see, e g , U S Patent No 5,641,670, issued June 24, 1997, International Publication No WO 96/29411, published September 26, 1996, International Publication No WO 94/12650, published August 4, 1994,
- Polynucleotide constructs are made, using standard techniques known in the art, which contain the promoter with targeting sequences flanking the promoter Suitable promoters are descnbed herein
- the targeting sequence is sufficiently complementary to an endogenous sequence to permit homologous recombination of the promoter-targeting sequence with the endogenous sequence
- the targeting sequence will be sufficiently near the 5' end of the desired endogenous polynucleotide sequence so the promoter will be operably linked to the endogenous sequence upon homologous recombination
- the promoter and the targeting sequences can be amplified using PCR
- the amplified promoter contains distinct restriction enzyme sites on the 5' and 3' ends
- the 3' end of the first targeting sequence contains the same restriction enzyme site as the 5' end of the amplified promoter and the 5' end of the second targeting sequence contains the same restriction site as the 3' end of the amplified promoter
- the amplified promoter and targeting sequences are digested and ligated together
- the promoter-targeting sequence construct is delivered to the cells, either as naked polynucleotide, or in conjunction with transfection- facihtating agents, such as liposomes, viral sequences, viral particles, whole viruses, hpofection, precipitating agents, etc , described in more detail above
- transfection- facihtating agents such as liposomes, viral sequences, viral particles, whole viruses, hpofection, precipitating agents, etc , described in more detail above
- the P promoter-targeting sequence can be delivered by any method, included direct needle injection, intravenous injection, topical administration, catheter infusion, particle accelerators, etc The methods are described in more detail below
- the promoter-targeting sequence construct is taken up by cells Homologous recombination between the construct and the endogenous sequence takes place, such that an endogenous sequence is placed under the control ofthe promoter The promoter then drives the expression ofthe endogenous sequence
- the polynucleotide encoding an albumin fusion protein of the present invention may contain a secretory signal sequence that facilitates secretion of the protein Typically, the signal sequence is positioned in the coding region of the polynucleotide to be expressed towards or at the 5' end of the coding region
- the signal sequence may be homologous or heterologous to the polynucleotide of interest and may be homologous or heterologous to the cells to be transfected Additionally, the signal sequence may be chemically synthesized using methods known in the art
- any mode of administration of any of the above-described polynucleotides constructs can be used so long as the mode results in the expression of one or more molecules in an amount sufficient to provide a therapeutic effect
- direct injection of naked calcium phosphate-precipitated plasmid into rat liver and rat spleen or a protein-coated plasmid into the portal vein has resulted in gene expression of the foreign gene in the rat livers (Kaneda et al , Science 243 375
- a prefened method of local administration is by direct injection
- an albumin fusion protein of the present invention complexed with a delivery vehicle is administered by direct injection into or locally within the area of arte ⁇ es
- Administration of a composition locally within the area of arteries refers to injecting the composition centimeters and preferably, millimeters within arteries
- Another method of local administration is to contact a polynucleotide construct of the present invention in or around a surgical wound
- a patient can undergo surgery and the polynucleotide construct can be coated on the surface of tissue inside the wound or the construct can be injected into areas of tissue inside the wound
- compositions useful in systemic administration include fusion proteins of the present invention complexed to a targeted delivery vehicle of the present invention Suitable delivery vehicles for use with systemic administration comp ⁇ se liposomes comprising ligands for targeting the vehicle to a particular site In specific embodiments, suitable delivery vehicles for use with systemic administration comprise liposomes comprising albumin fusion proteins of the invention for targeting the vehicle to a particular site
- Prefened methods of systemic administration include intravenous injection, aerosol, oral and percutaneous (topical) delivery
- Intravenous injections can be performed using methods standard in the art Aerosol delivery can also be performed using methods standard in the art
- Oral delivery can be performed by complexing a polynucleotide construct of the present invention to a earner capable of withstanding degradation by digestive enzymes in the gut of an animal
- earners include plastic capsules or tablets, such as those known in the art
- Topical delivery can be performed by mixing a polynucleotide construct of the present invention with a lipophihc reagent (e g , DMSO) that is capable of passing into the
- Determining an effective amount of substance to be delivered can depend upon a number of factors including, for example, the chemical structure and biological activity of the substance, the age and weight of the animal, the precise condition requi ⁇ ng treatment and its severity, and the route of administration
- the frequency of treatments depends upon a number of factors, such as the amount of polynucleotide constructs a ⁇ ministere ⁇ per ⁇ ose, as wen as inc health and history of the subject.
- the precise amount, number of doses, and timing of doses will be determined by the attending physician or veterinarian
- Albumin fusion proteins of the present invention can be administered to any animal, preferably to mammals and birds Prefened mammals include humans, dogs, cats, mice, rats, rabbits sheep, cattle, horses and pigs, with humans being particularly prefened Biological A ctivities [0567) Albumin fusion proteins and/or polynucleotides encoding albumin fusion proteins of the present invention, can be used in assays to test for one or more biological activities If an albumin fusion protein and/or polynucleotide exhibits an activity in a particular assay, it is likely that the Therapeutic protein conesponding to the fusion portein may be involved in the diseases associated with the biological activity Thus, the fusion protein could be used to treat the associated disease
- the present invention encompasses a method of treating a disease or disorder listed in the "Prefened Indication Y" column of Table 1 compnsing administering to a patient in which such treatment, prevention or amelioration is desired an albumin fusion protein of the invention that comprises a Therapeutic protein portion conesponding to a Therapeutic protein disclosed m the "Therapeutic Protein X" column of Table 1 (in the same row as the disease or disorder to be treated is listed in the "Prefened Indication Y" column of Table 1) in an amount effective to treat, prevent or ameliorate the disease or disorder
- the present invention encompasses a method of treating a disease or disorder listed for a particular Therapeutic protein in the "Prefened Indication Y" column of Table 1 compnsing administering to a patient in which such treatment, prevention or amelioration is desired an albumin fusion protein of the invention that comp ⁇ ses a Therapeutic protein portion conesponding to the Therapeutic protein for which the indications in the Examples are related in an amount effective to treat, prevent or ameliorate the disease or disorder
- albumin fusion proteins produced by a cell when encoded by the polynucleotides that encode SEQ ID NO Y When these polynucleotides are used to express the encoded protein from a cell, the cell's natural secretion and processing steps produces a protein that lacks the signal sequence explicitly listed in columns 4 and/or 11 of Table 2
- the specific amino acid sequence of the listed signal sequence is shown in the specification or is well known in the art Thus, most prefened embodiments of the present
- fusion proteins of the present invention may be used in the diagnosis, prognosis, prevention and/or treatment of diseases and/or disorders relating to diseases and disorders of the endocrine system (see, for example, "Endocrine Disorders” section below), the nervous system (see, for example, “Neurological Disorders” section below), the immune system (see, for example, “Immune Activity” section below), respiratory system (see, for example, “Respiratory Disorders” section below), cardiovascular system (see, for example, “Cardiovascular Disorders” section below), reproductive system (see, for example, “Reproductive System Disorders” section below) digestive system (see, for example, "Gastrointestinal Disorders” section below), diseases and/or disorders relating to cell proliferation (see, for example, “Hype ⁇ ro ferative Disorders” section below), and/or diseases or disorders relating to the blood (see, for example, “Blood-Related Disorders” section below) (0572)
- the blood see, for example, “Blo
- fusion proteins of the invention and polynucleotides encoding albumin fusion proteins of the invention are useful in the diagnosis, detection and/or treatment of diseases and/or disorders associated with activities that include, but are not limited to, prohormone activation, neurotransmitter activity, cellular signaling, cellular proliferation, cellular differentiation, and cell migration
- fusion proteins of the invention and polynucleotides encoding albumin fusion proteins of the invention may be useful for the diagnosis, prognosis, prevention and/or treatment of diseases and/or disorders associated with the following systems Immune Activity (0575)
- Albumin fusion proteins of the invention and polynucleotides encoding albumin fusion proteins of the invention may be useful in treating, preventing, diagnosing and/or prognosing diseases, disorders, and/or conditions of the immune system, by, for example, activating or inhibiting the proliferation, differentiation, or mobilization (chemotaxis) of immune cells
- Immune cells develop through a process called hematopoiesis, producing myeloid (platelets, red blood cells, neutrophils, and macrophages) and lymphoid (B and T lymphocytes) cells from plu ⁇ potent stem cells
- the etiology of these immune diseases, disorders, and/or conditions may be genetic, somatic, such as cancer and some autoimmune diseases, acquired (e g , by chemotherapy or
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful m treating, preventing, diagnosing, and/or prognosing immunodeficiencies, including both congenital and acquired immunodeficiencies
- B cell immunodeficiencies in which immunoglobulin levels B cell function and/or B cell numbers are decreased include X-hnked agammaglobulinemia (Bruton's disease), X-hnked infantile agammaglobulinemia, X-lmked immunodeficiency with hyper IgM, non X-hnked immunodeficiency with hyper IgM, X-hnked lymphoproliferative syndrome (XLP), agammaglobulinemia including congenital and acquired agammaglobulinemia, adult onset agammaglobulinemia, late-onset agammaglobulinemia, dysgammaglobuhnemia, hypogammaglobuhn
- Ataxia-telangiectasia or conditions associated with ataxia-telangiectasia are treated, prevented, diagnosed, and/or prognosing using the, fusion proteins ofthe invention and/or polynucleotides encoding albumin fusion proteins ofthe invention
- congenital immunodeficiencies in which T cell and/or B cell function and/or number is decreased include, but are not limited to DiGeorge anomaly, severe combined immunodeficiencies (SCID) (including, but not limited to, X-linked SOD, autosomal recessive SCID, adenosine deaminase deficiency, pu ⁇ ne nucleoside phosphorylase (PNP) deficiency, Class II MHC deficiency (Bare lymphocyte syndrome), Wiskott-Ald ⁇ ch syndrome, and ataxia telangiectasia), thymic hypoplasia, third and fourth pharyngeal pouch syndrome, 22q
- SCID severe combined immunodeficiencies
- DiGeorge anomaly or conditions associated with DiGeorge anomaly are treated, prevented, diagnosed, and/or prognosed using fusion proteins ofthe invention and or polynucleotides encoding albumin fusion proteins ofthe invention
- immunodeficiencies that may be treated, prevented, diagnosed, and/or prognosed using fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of he invention, include, but are not limited to, chronic granulomatous disease, Chediak-Higashi syndrome, myeloperoxidase deficiency, leukocyte glucose-6-phosphate dehydrogenase deficiency, X-linked lymphoproliferative syndrome (XLP), leukocyte adhesion deficiency, complement component deficiencies (including CI, C2, C3, C4, C5, C6, C7, C8 and/or C9 deficiencies), reticular dysgenesis, thymic alymphoplasia-aplasia, immunodeficiency with thymoma, severe congenital leukopenia, dysplasia with immunodeficiency, neonatal neutropenia, short limbed dwarfism, and Nezelof syndrome-combined immunodefici
- the immunodeficiencies and/or conditions associated with the immunodeficiencies recited above are treated, prevented, diagnosed and or prognosed using fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention could be used as an agent to boost immunoresponsiveness among immunodeficient individuals
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention could be used as an agent to boost immunoresponsiveness among B cell and or T cell immunodeficient individuals
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in treating, preventing, diagnosing and or prognosing autoimmune disorders Many autoimmune disorders result from inappropriate recognition of self as foreign material by immune cells This inappropriate recognition results in an immune response leading to the destruction of the host tissue Therefore, the administration of fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention that can inhibit an immune response, particularly the proliferation, differentiation, or chemotaxis of T-cells, may be an effective therapy in preventing autoimmune disorders
- Autoimmune diseases or disorders that may be treated, prevented, diagnosed and/or prognosed by fusion proteins ofthe invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but are not limited to, one or more of the following systemic lupus erythematosus, rheumatoid arthritis, ankylosing spondy tis, multiple sclerosis, autoimmune thyroiditis, Hashimoto's thyroiditis, autoimmune hemolytic anemia, hemolytic anemia, thrombocytopema, autoimmune thrombocytopenia pu ⁇ ura, autoimmune neonatal thrombocytopenia, ldiopathic thrombocytopenia pu ⁇ ura, pu ⁇ ura (e g , Henloch-Scoenlein pu ⁇ ura), autoimmunocytopenia, Goodpasture's syndrome, Pemphigus vulga ⁇ s, myasthenia gravis, Grave's disease (hyperthyroidism), and insulin
- Additional disorders that are hkely to have an autoimmune component that may be treated, prevented, and/or diagnosed with the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but are not limited to, type II collagen-induced arth ⁇ tis, antiphospholipid syndrome, dermatitis, allergic encephalomye tis, myocarditis, relapsing polychond ⁇ tis, rheumatic heart disease, neu ⁇ tis, uveitis op naimia, p ⁇ lyendoc ⁇ nopathies, Reiter's Disease, Stiff-Man Syndrome, autoimmune pulmonary inflammation, autism, Guillain-Bane Syndrome, insulin dependent diabetes melhtus, and autoimmune inflammatory eye disorders
- Additional disorders that are likely to have an autoimmune component that may be treated, prevented, diagnosed and/or prognosed with the albumin fusion proteins ofthe invention and/or polynucleotides encoding albumin fusion proteins ofthe invention include, but are not limited to, scleroderma with anti-collagen antibodies (often charactenzed, e g , by nucleolar and other nuclear antibodies), mixed connective tissue disease (often charactenzed, e g , by antibodies to extractable nuclear antigens (e g , ribonucleoprotein)), polymyositis (often charactenzed, e g , by nonhistone ANA), pernicious anemia (often charactenzed, e g , by antipa ⁇ etal cell, microsomes, and intrinsic factor antibodies), ldiopathic Addison's disease (often characterized, e g , by humoral and cell-mediated adrenal cytotoxicity, infer
- Additional disorders that may have an autoimmune component that may be treated, prevented, diagnosed and/or prognosed with the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but are not limited to, chronic active hepatitis (often charactenzed, e g , by smooth muscle antibodies), p ⁇ mary biliary cinhosis (often charactenzed, e g , by mitochondria antibodies), other endoc ⁇ ne gland failure (often characterized, e g , by specific tissue antibodies in some cases), vitiligo (often characterized, e g , by melanocyte antibodies), vasculitis (often characterized, e g , by Ig and complement in vessel walls and/or low serum complement), post-MI (often charactenzed, e g , by myocardial antibodies), cardiotomy syndrome (often characterized, e g , by myocardial
- systemic lupus erythematosus is treated, prevented, and/or diagnosed using fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention
- ldiopathic thrombocytopenia pu ⁇ ura is treated, prevented, and/or diagnosed using fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention
- IgA nephropathy is treated, prevented, and/or diagnosed using fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention
- the autoimmune diseases and disorders and/or conditions associated with the diseases and disorders recited above are treated, prevented, diagnosed and/or prognosed using fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as a immunosuppressive agent(s)
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in treating, preventing, prognosing, and/or diagnosing diseases, disorders, and/or conditions of hematopoietic cells
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention could be used to increase differentiation and proliferation of hematopoietic cells, including the pluripotent stem cells, in an effort to treat or prevent those diseases, disorders, and/or conditions associated with a decrease in certain (or many) types hematopoietic cells, including but not limited to, leukopenia, neutropema, anemia, and thrombocytopenia
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention could be used to increase differentiation and proliferation of hematopoietic cells, including the pluripotent stem cells, in an effort to treat or prevent those
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used to treat, prevent, diagnose and/or prognose IgE-mediated allergic reactions Such allergic reactions include, but are not limited to, asthma, rhinitis, and eczema
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used to modulate IgE concentrations in vitro or in vivo
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention have uses in the diagnosis, prognosis, prevention, and/or treatment of inflammatory conditions
- these molecules can be used to prevent and/or treat chronic and acute inflammatory conditions
- Such inflammatory conditions include, but are not limited to, for example, inflammation associated with infection (e g , septic shock, sepsis, or systemic inflammatory response syndrome), ischemia-reperfusion injury, endotoxin lethality, complement-mediated hyperacute rejection, neph ⁇ tis, cytokine or chemokine induced lung in j ury, inflammatory bowel disease, Crohn's disease, over production of cytokines (e g , TNF or IL-1 ), respiratory disorders
- cytokines e g , TNF or IL-1
- fusion proteins ofthe invention and/or polynucleotides encoding albumin fusion proteins ofthe invention have uses in the treatment of tissue-specific inflammatory disorders, including, but not limited to, adrenahtis, alveohtis, angiocholecystitis, appendicitis, balamtis, blepharitis, bronchitis, bursitis, carditis, cellulitis, cervicitis, cholecystitis, chorditis, cochlitis, colitis, conjunctivitis, cystitis, dermatitis, diveiticuhtis, encephalitis, endocarditis, esophagitis, eustachitis, fibrositis, folhculitis, gastritis, gastroenteritis, gingivitis, glossitis, hepatosplemtis, ker
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are useful to diagnose, prognose, prevent, and/or treat organ transplant rejections and graft-versus-host disease Organ rejection occurs by host immune cell destruction of the transplanted tissue through an immune response Similarly, an immune response is also involved in GVHD, but, in this case, the foreign transplanted immune cells destroy the host tissues
- Polypeptides, antibodies, or polynucleotides of the invention, and/or agonists or antagonists thereof, that inhibit an immune response, particularly the activation, proliferation, differentiation, or chemotaxis of T-cells may be an effective therapy in preventing organ rejection or GVHD
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention, that inhibit an immune response, particularly the activation, proliferation, differentiation, or chemotaxis of T-cells may be an effective therapy in preventing experimental allergic
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are useful to diagnose, prognose, prevent, and/or treat immune complex diseases, including, but not limited to, serum sickness, post streptococcal glomeruloneph ⁇ tis, polyarte ⁇ tis nodosa, and immune complex-induced vascuhtis
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention can be used to treat, detect, and/or prevent infectious agents
- infectious agents For example, by increasing the immune response, particularly increasing the proliferation activation and/or differentiation of B and/or T cells, infectious diseases may be treated, detected, and/or prevented
- the immune response may be increased by either enhancing an existing immune response, or by initiating a new immune response
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may also directly inhibit the infectious agent (refer to section of application listing infectious agents, etc), without necessarily eliciting an immune response
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as a vaccine adjuvant that enhances immune responsiveness to an antigen
- albumin fusion proteins of the invention and/or polynucleotides encoding albumm fusion proteins of the invention are used as an adjuvant to enhance tumor-specific immune responses
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as an adjuvant to enhance anti-viral immune responses
- Anti-viral immune responses that may be enhanced using the compositions of the invention as an adjuvant include virus and virus associated diseases or symptoms descnbed herein or otherwise known in the art
- the compositions of the invention are used as an adjuvant to enhance an immune response to a virus, disease, or symptom selected from the group consisting of AIDS, meningitis, Dengue, EBV, and hepatitis (e g , hepatitis B)
- the compositions of the invention are used as an adjuvant to enhance an immune response to a virus, disease, or symptom selected from the group consisting of HIV/AIDS, respiratory syncytial virus, Dengue, rotavirus, Japanese B encephalitis, influenza A and B, parainfluenza, measles, cytome
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as an adjuvant to enhance anti-bacterial or anti-fungal immune responses
- Anti-bacterial or anti-fungal immune responses that may be enhanced using the compositions of the invention as an adjuvant include bacte ⁇ a or fungus and bacteria or fungus associated diseases or symptoms described herein or otherwise known in the art
- the compositions of the invention are used as an adjuvant to enhance an immune response to a bacteria or fungus, disease, or symptom selected from the group consisting of tetanus, Diphtheria, botulism, and meningitis type B
- compositions of the invention are used as an adjuvant to enhance an immune response to a bacte ⁇ a or fungus, disease, or symptom selected from the group consisting of Vibrio cholerae, Mycobaclerium leprae.
- albumm fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as an adjuvant to enhance anti-parasitic immune responses
- Anti-parasitic immune responses that may be enhanced using the compositions of the invention as an adjuvant include parasite and parasite associated diseases or symptoms descnbed herein or otherwise known in the art
- the compositions ofthe invention are used as an adjuvant to enhance an immune response to a parasite
- the compositions of the invention are used as an adjuvant to enhance an immune response to Plasmodium (malaria) or Leishmania
- albumin fusion proteins of the invention and or polynucleotides encoding albumin fusion proteins of the invention may also be employed to treat infectious diseases including sihcosis, sarcoidosis, and ldiopathic pulmonary fibrosis, for example, by preventing the recruitment and activation of mononuclear phagocytes
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as an antigen for the generation of antibodies to inhibit or enhance immune mediated responses against polypeptides of the invention
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are administered to an animal (e g , mouse, rat, rabbit, hamster, guinea pig, pigs, micro-pig, chicken, camel, goat, horse, cow, sheep, dog, cat, non- human p ⁇ mate, and human, most preferably human) to boost the immune system to produce increased quantities of one or more antibodies (e g , IgG, IgA, IgM, and IgE), to induce higher affinity antibody production and immunoglobulin class switching (e g , IgG, IgA, IgM, and IgE), and/or to increase an immune response
- an animal e g , mouse, rat, rabbit, hamster, guinea pig, pigs, micro-pig, chicken, camel, goat, horse, cow, sheep, dog, cat, non- human p ⁇ mate, and human, most preferably human
- boost the immune system
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as a stimulator of B cell responsiveness to pathogens
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as an activator of T cells
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as an agent that elevates the immune status of an individual prior to their receipt of immunosuppressive therapies [0613] In another specific embodiment, albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as an agent to induce higher affinity antibodies
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as an agent to increase serum immunoglobulin concentrations
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as an agent to accelerate recovery of immunocompromised individuals
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as an agent to boost immunoresponsiveness among aged populations and/or neonates
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as an immune system enhancer prior to, during, or after bone manow transplant and/or other transplants (e g , allogeneic or xenogeneic organ transplantation) With respect to transplantation, compositions of the invention may be administered prior to, concomitant with, and/or after transplantation In a specific embodiment, compositions of the invention are administered after transplantation, p ⁇ or to the beginning of recovery of T-cell populations In another specific embodiment, compositions of the invention are first administered after transplantation after the beginning of recovery of T cell populations, but prior to full recovery of B cell populations
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as an agent to boost immunoresponsiveness among individuals having an acquired loss of B cell function
- Conditions resulting in an acquired loss of B cell function that may be ameliorated or treated by administering the albumin fusion proteins of the invention and/or polynucleotides encoding aiDumin fusion proteins of the invention include, but are not limited to, HIV Infection, AIDS, bone manow transplant, and B cell chronic lymphocytic leukemia (CLL)
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as an agent to boost immunoresponsiveness among individuals having a temporary immune deficiency
- Conditions resulting in a temporary immune deficiency that may be ameliorated or treated by administe ⁇ ng the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but are not limited to, recovery from viral infections (e g , influenza), conditions associated with malnutrition, recovery from infectious mononucleosis, or conditions associated with stress, recovery from measles, recovery from blood transfusion, and recovery from surgery
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention are used as a regulator of antigen presentation by monocytes, dend ⁇ tic cells, and/or B-cells
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention enhance antigen presentation or antagonize antigen presentation in vitro or in vivo
- this enhancement or antagonism of antigen presentation may be useful as an anti-tumor treatment or to modulate the immune system
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as an agent to direct an individual's immune system towards development of a humoral response (I e TH2) as opposed to a TH1 cellular response
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention are used as a means to induce tumor proliferation and thus make it more susceptible to anti-neoplastic agents
- multiple myeloma is a slowly dividing disease and is thus refractory to virtually all anti-neoplastic regimens If these cells were forced to proliferate more rapidly their susceptibility profile would likely change
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention are used as a stimulator of B cell production in pathologies such as AIDS, chronic lymphocyte disorder and/or Common Vanable Immunodificiency
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention are used as a therapy for generation and/or regeneration of lymphoid tissues following surgery, trauma or genetic defect
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used in the pretreatment of bone manow samples p ⁇ or to transplant
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention are used as a gene-based therapy for genetically inherited disorders resulting m lmmuno-incompetence/immunodeficiency such as observed among SCID patients
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention are used as a means of activating monocytes/macrophages to defend against parasitic diseases that effect monocytes such as Leishmania [0627]
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention are used as a means of regulating secreted cytokines that are elicited by polypeptides of the invention
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used in one or more of the applications dec ⁇ bed herein, as they may apply to veterinary medicine
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention are used as a means of blocking various aspects of immune responses to foreign agents or self Examples of diseases or conditions in which blocking of certain aspects of immune responses may be desired include autoimmune disorders such as lupus, and arthritis, as well as immunoresponsiveness to skin allergies, inflammation, bowel disease, injury and diseases/disorders associated with pathogens [0630]
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as a therapy for preventing the B cell proliferation and Ig secretion associated with autoimmune diseases such as ldiopathic thrombocytope c pu ⁇ ura, systemic lupus erythematosus and multiple sclerosis
- polypeptides, antibodies, polynucleotides and/or agonists or antagonists of the present fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention invention are used as a inhibitor of B and/or T cell migration in endothelial cells This activity disrupts tissue architecture or cognate responses and is useful, for example in disrupting immune responses, and blocking sepsis
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention are used as a therapy for chronic hypergammaglobuhnemia evident in such diseases as monoclonal gammopathy of undetermined significance (MGUS), Waldenstrom's disease, related ldiopathic monoclonal gammopathies, and plasmacytomas
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be employed tor instance to inhibit polypeptide chemotaxis and activation of macrophages and their precursors, and of neutrophils, basophils, B lymphocytes and some T-cell subsets, e g , activated and CD8 cytotoxic T cells and natural killer cells, in certain autoimmune and chronic inflammatory and infective diseases Examples of autoimmune diseases are described herein and include multiple sclerosis, and insulin-dependent diabetes
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may also be employed to treat ldiopathic hyper-eosinophihc syndrome by, for example, preventing eosinophil production and migration
- albumin fusion proteins of the invention and or polynucleotides encoding albumm fusion proteins of the invention are used to enhance or inhibit complement mediated cell lysis
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used to enhance or inhibit antibody dependent cellular cytotoxicity
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may also be employed for treating atherosclerosis, for example, by preventing monocyte infiltration in the artery wall
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be employed to treat adult respiratory distress syndrome (ARDS)
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful for stimulating wound and tissue repair, stimulating angiogenesis, and/or stimulating the repair of vascular or lymphatic diseases or disorders Additionally, fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used to stimulate the regeneration of mucosal surfaces
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used to diagnose, prognose, treat, and/or prevent a disorder charactenzed by pnmary or acquired immunodeficiency, deficient serum immunoglobulin production, recunent infections, and/or immune system dysfunction
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used to treat or prevent infections of the joints, bones, skin, and/or parotid glands, blood-borne infections (e g , sepsis, meningitis, septic arth ⁇ tis, and/or osteomyelitis), autoimmune diseases (e g , those disclosed herein), inflammatory disorders, and malignancies, and/or any disease or disorder or condition associated with these infections, diseases, disorders and/or malignancies) including, but not limited to, CVID, other pnmary immune
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used to treat, and/or diagnose an individual having common variable immunodeficiency disease ("CVID", also known as “acquired agammaglobulinemia” and “acquired hypogammaglobuhnemia”) or a subset of this disease
- CVID common variable immunodeficiency disease
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used to diagnose, prognose, prevent, and/or treat cancers or neoplasms including immune cell or immune tissue-related cancers or neoplasms
- cancers or neoplasms that may be prevented, diagnosed, or treated by fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but are not limited to, acute myelogenous leukemia, chronic myelogenous leukemia, Hodgkin's disease, non-Hodgkin's lymphoma, acute lymphocytic anemia (ALL) Chronic lymphocyte leukemia, plasmacytomas, multiple myeloma, Burkitt's lymphoma, EBV-transformed diseases, and/or diseases and disorders described in the section entitled
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as a therapy for decreasing cellular proliferation of Large B-cell Lymphomas
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used as a means of decreasing the involvement of B cells and Ig associated with Chronic Myelogenous Leukemia
- compositions of the invention are used as an agent to boost immunoresponsiveness among B cell immunodeficient individuals, such as, for example, an individual who has undergone a partial or complete splenectomy Blood-Related Disorders
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used to modulate hemostatic (the stopping of bleeding) or thrombolytic (clot dissolving) activity
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention could be used to treat or prevent blood coagulation diseases, disorders, and/or conditions (e g , afib ⁇ nogenemia, factor deficiencies, hemophilia), blood platelet diseases, disorders, and/or conditions (e g , thrombocytopenia), or wounds resulting from trauma, surgery, or other causes
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used to prevent, diagnose, prognose, and/or treat thrombosis, arte ⁇ al thrombosis, venous thrombosis, thromboembohsm, pulmonary embolism, atherosclerosis, myocardial infarction, transient lschemic attack, unstable angina
- the albumin fusion proteins of the invention and or polynucleotides encoding albumin fusion proteins of the invention may be used for the prevention of occulsion of saphenous grafts, for reducing the risk of pe ⁇ procedural thrombosis as might accompany angioplasty procedures, for reducing the risk of stroke in patients with at ⁇ al fib ⁇ llation including nonrheumatic at ⁇ al fibrillation, for reducing the risk of embolism associated with mechanical heart valves and or mitral valves disease
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used to prevent, diagnose, prognose, and/or treat diseases and disorders of the blood and/or blood forming organs associated with the t ⁇ ssue(s) in which the polypeptide ofthe invention is expressed
- the fusion proteins of the invention and or polynucleotides encoding albumin fusion proteins of the invention may be used to modulate hematopoietic activity (the formation of blood cells)
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used to increase the quantity of all or subsets of blood cells, such as, for example, erythrocytes, lymphocytes (B or T cells), myeloid cells (e g , basophils, eosinophils, neutrophils, mast cells, macrophages) and platelets
- the ability to decrease the quantity of blood cells or subsets of blood cells may be useful in the prevention, detection, diagnosis and/or treatment of anemias and leukopemas described below
- the albumin fusion proteins ofthe invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used to decrease the quantity of all or subsets of blood cells, such as
- Anemias are conditions in which the number of red blood cells or amount of hemoglobin (the protein that cames oxygen) in them is below nonnal Anemia may be caused by excessive bleeding, decreased red blood cell production, or increased red blood cell destruction (hemolysis)
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in treating, preventing, and/or diagnosing anemias
- Anemias that may be treated prevented or diagnosed by the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include iron deficiency anemia, hypochromic anemia, microcytic anemia, chlorosis, hereditary siderob.astic anemia, ldiopathic acquired sideroblastic anemia, red cell aplasia, megaloblastic anemia (e g , pernicious anemia, (vitamin B12 deficiency) and folic acid deficiency anemia), aplastic an
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in treating, preventing, and/or diagnosing hemoglobin abnormalities, (e g , those associated with sickle cell anemia, hemoglobin C disease, hemoglobin S-C disease, and hemoglobin E disease) Additionally, the albumin fusion proteins of the invention and or polynucleotides encoding albumin fusion proteins of the invention may be useful in diagnosing, prognosing, preventing, and/or treating thalassemias, including, but not limited to, major and minor forms of alpha-thalassemia and beta-thalassemia
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in diagnosing, prognosing, preventing, and/or treating bleeding disorders including, but not limited to, thrombocytopenia (e g , ldiopathic thrombocytopemc pu ⁇ ura, and thrombotic thrombocytopemc pu ⁇ ura), Von Willebrand's disease, hereditary platelet disorders (e g , storage pool disease such as Chediak-Higashi and Hermansky-Pudiak syndromes, thromboxane A2 dysfunction, thromboasthenia, and Bemard-Souher syndrome), hemolytic-uremic syndrome, hemophehas such as hemophelia A or Factor VII deficiency and Christmas disease or Factor IX deficiency, Hereditary Hemorhhagic Telangiectsia, also known as Rendu-Osler-Weber syndrome, allergic pu ⁇
- thrombocytopenia
- albumin fusion proteins of the invention and or polynucleotides encoding albumin fusion proteins of the invention on the clotting time of blood may be monitored using any of the clotting tests known in the art including, but not limited to, whole blood partial thromboplastin time (PTT), the activated partial thromboplastin time (aPTT), the activated clotting time (ACT), the recalcified activated clotting time, or the Lee-White Clotting time
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in diagnosing, prognosing, preventing, and/or treating acquired platelet dysfunction such as platelet dysfunction accompanying kidney failure, leukemia, multiple myeloma, cinhosis of the liver, and systemic lupus erythematosus as well as platelet dysfunction associated with drug treatments, including treatment with aspirin, ticlopidine, nonsteroidal anti-inflammatory drugs (used for arthritis, pain, and sprains), and penicillin in high doses
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in diagnosing, prognosing, preventing, and/or treating diseases and disorders charactenzed by or associated with increased or decreased numbers of white blood cells
- Leukopenia occurs when the number of white blood cells decreases below normal Leukopemas include, but are not limited to, neutropenia and lymphocytopenia
- An increase in the number of white blood cells compared to normal is known as leukocytosis
- leukocytosis may simply be a normal physiological parameter that reflects infection
- leukocytosis may be an indicator of injury or other disease such as cancer Leokocytoses, include but are not limited to, eosinophiha, and accumulations of macrophages
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in diagnosing, prognosing, preventing, and/
- Leukopenia may be a generalized decreased in all types of white blood cells, or may be a specific depletion of particular types of white blood cells
- the albumin fusion proteins ofthe invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in diagnosing, prognosing, preventing, and/or treating decreases in neutrophil numbers, known as neutropenia
- neutropenia Neutropenias that may be diagnosed, prognosed, prevented, and/or treated by the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but are not limited to, infantile genetic agranulocytosis, familial neutropenia, cyclic neutropenia, neutropenias resulting from or associated with dietary deficiencies (e g , vitamin B 12 deficiency or folic acid deficiency), neutropenias resulting from or associated with drug treatments (e g , antibiotic regimens such as
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in diagnosing, prognosing, preventing, and or treating lymphocytopenias (decreased numbers of B and/or T lymphocytes), including, but not limited to, lymphocytopenias resulting from or associated with stress, drug treatments (e g , drug treatment with corticosteroids, cancer chemotherapies, and/or radiation therapies), AIDS infection and/or other diseases such as, for example, cancer, rheumatoid arthritis, systemic lupus erythematosus, chronic infections, some viral infections and or hereditary disorders (e g , DiGeorge syndrome, Wiskott-Ald ⁇ ch Syndome, severe combined immunodeficiency, ataxia telangiectsia)
- lymphocytopenias decreased numbers of B and/or T lymphocytes
- drug treatments e g , drug treatment with cortico
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in diagnosing, prognosing, preventing, and/or treating diseases and disorders associated with macrophage numbers and/or macrophage function including, but not limited to, Gaucher's disease, Niemann-Pick disease, Letterer-Siwe disease and Hand-Schuller-Ch ⁇ stian disease (0660
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in diagnosing, prognosing, preventing, and/or treating diseases and disorders associated with eosinophil numbers and/or eosinophil function including, but not limited to, ldiopathic hypereosinophihc syndrome, eosinophilia-myalgia syndrome, and Hand-Schuller- Ch ⁇ stian disease
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in diagnosing, prognosing, preventing, and/or treating leukemias and lymphomas including, but not limited to, acute lymphocytic (lymphpblastic) leukemia (ALL), acute myeloid (myelocytic, myelogenous, myeloblastic, or myelomonocytic) leukemia, chronic lymphocytic leukemia (e g , B cell leukemias, T cell leukemias, Sezary syndrome, and Hairy cell leukema), chronic myelocytic (myeloid, myelogenous, or granulocytic) leukemia, Hodgkin's lymphoma, non-hodgkin's lymphoma, Burkitt's lymphoma, and mycosis fungoides [0662]
- ALL acute lymphocytic leukemia
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in treating, preventing, and/or diagnosing myeloproliferative disorders, including but not limited to, polycythemia vera, relative polycythemia, secondary polycythemia, myelofibrosis, acute myelofibrosis, agnogemc myelod metaplasia, thrombocythemia, (including both pnmary and seconday thrombocythemia) and chronic myelocytic leukemia
- myeloproliferative disorders including but not limited to, polycythemia vera, relative polycythemia, secondary polycythemia, myelofibrosis, acute myelofibrosis, agnogemc myelod metaplasia, thrombocythemia, (including both pnmary and seconday thrombocythemia) and chronic mye
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful as a treatment prior to surgery, to increase blood cell production
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful as an agent to enhance the migration, phagocytosis, superoxide production, antibody dependent cellular cytotoxicity of neutrophils, eosionophils and macrophages
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful as an agent to increase the number of stem cells in circulation prior to stem cells pheresis
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful as an agent to increase the number of stem cells in circulation prior to platelet pheresis
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful as an agent to increase cytokine production
- albumin fusion proteins of the invention and/or polynucleotides encoding albumm fusion proteins of the invention may be useful in preventing, diagnosing, and/or treating pnmary hematopoietic disorders Hyperproliferative Disorders
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention can be used to treat or detect hype ⁇ rohferative disorders, including neoplasms
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may inhibit the proliferation of the disorder through direct or indirect interactions
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may proliferate other cells which can inhibit the hype ⁇ roliferative disorder
- hype ⁇ ro ferative disorders can be treated
- This immune response may be increased by either enhancing an existing immune response, or by initiating a new immune response
- decreasing an immune response may also be a method of treating hype ⁇ rohferative disorders, such as a chemotherapeutic agent
- Examples of hype ⁇ roliferative disorders that can be treated or detected by fusion proteins of the invention and or polynucleotides encoding albumin fusion proteins of the invention include, but are not limited to neoplasms located in the colon, abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous (central and peripheral), lymphatic system, pelvis, skin, soft tissue, spleen, thorax, and urogenital tract
- neoplasms located in the colon, abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous (central and peripheral), lymphatic system, pelvis, skin, soft tissue, sple
- hype ⁇ rohferative disorders can also be treated or detected by fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention
- hype ⁇ rohferative disorders include, but are not limited to Acute Childhood Lymphoblastic Leukemia, Acute Lymphoblastic Leukemia, Acute Lymphocytic Leukemia, Acute Myeloid Leukemia, Adrenocortical Carcinoma, Adult (Pnmary) Hepatocellular Cancer, Adult (Primary) Liver Cancer, Adult Acute Lymphocytic Leukemia, Adult Acute Myeloid Leukemia, Adult Hodgkin's Disease, Adult Hodgkin's Lymphoma, Adult Lymphocytic Leukemia, Adult Non-Hodgkm's Lymphoma, Adult Primary Liver Cancer, Adult Soft Tissue Sarcoma, AIDS-Related Lymphoma, AIDS-Related Malignancies, Anal Cancer, Astrocytoma
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used to diagnose, prognose, prevent, and/or treat premalignant conditions and to prevent progression to a neoplastic or malignant state, including but not limited to those disorders descnbed above
- Such uses are indicated in conditions known or suspected of preceding progression to neoplasia or cancer, in particular, where non-neoplastic cell growth consisting of hype ⁇ lasia, metaplasia, or most particularly, dysplasia has occuned (for review of such abnormal growth conditions, see Robbins and Angell, 1976, Basic Pathology, 2d Ed , W B Saunders Co , Philadelphia, pp 68-79 )
- Hype ⁇ lasia is a form of controlled cell proliferation, involving an increase in cell number in a tissue or organ, without significant alteration in structure or function
- Hype ⁇ lastic disorders which can be diagnosed, prognosed, prevented, and/or treated with fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but are not limited to, angiofol cular mediastinal lymph node hype ⁇ lasia, angiolymphoid hype ⁇ lasia with eosinophiha, atypical melanocytic hype ⁇ lasia, basal cell hype ⁇ lasia, benign giant lymph node hype ⁇ lasia, cementum hype ⁇ lasia, congenital adrenal hype ⁇ lasia, congenital sebaceous hype ⁇ lasia, cystic hype ⁇ lasia, cystic hype ⁇ lasia of the breast, denture hype ⁇ lasia, ductal hype ⁇ lasia, endometrial hype ⁇ lasia, fibromuscular hype ⁇ lasia, focal epithelial hype ⁇ lasi
- Metaplasia is a form of controlled cell growth in which one type of adult or fully differentiated cell substitutes for another type of adult cell Metaplastic disorders which can be diagnosed, prognosed, prevented, and/or treated with fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but are not limited to, agnogemc myeloid metaplasia, apoc ⁇ ne metaplasia, atypical metaplasia, autoparenchymatous metaplasia, connective tissue metaplasia, epithelial metaplasia, intestinal metaplasia, metaplastic anemia, metaplastic ossification, metaplastic polyps, myeloid metaplasia, primary myeloid metaplasia, secondary myeloid metaplasia, squamous metaplasia, squamous metaplasia of ammon, and symptomatic myeloid metaplasia
- Dysplasia is frequently a forerunner of cancer, and is found mainly in the epitheha, it is the most disorderly form of non-neoplastic cell growth, involving a loss in individual cell uniformity and in the architectural orientation of cells
- Dysplastic cells often have abnormally large, deeply stained nuclei, and exhibit pleomo ⁇ hism Dysplasia characteristically occurs where there exists chronic imtation or inflammation
- Dysplastic disorders which can be diagnosed, prognosed, prevented, and/or treated with fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but are not limited to, anhidrotic ectodermal dysplasia, anterofacial dysplasia, asphyxiating thoracic dysplasia, at ⁇ odigital dysplasia, bronchopulmonary dysplasia, cerebral dysplasia, cervical dysplasia, chondroectodermal dysplasia, cleidocranial dysplasia, con
- Additional pre-neoplastic disorders which can be diagnosed, prognosed, prevented, and/or treated with fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but are not limited to, benign dysprohferative disorders (e g , benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps, colon polyps, and esophageal dysplasia), leukoplakia, keratoses, Bowen's disease, Farmer's Skin, solar cheihtis, and solar keratosis
- benign dysprohferative disorders e g , benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps, colon polyps, and esophageal dysplasia
- leukoplakia keratoses
- Bowen's disease Farmer's Skin
- solar cheihtis solar cheihtis
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used to diagnose and/or prognose disorders associated with the t ⁇ ssue(s) in which the polypeptide of the invention is expressed
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention conjugated to a toxin or a radioactive isotope, as described herein may be used to treat cancers and neoplasms, including, but not limited to, those described herein
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention conjugated to a toxin or a radioactive isotope, as described herein may be used to treat acute myelogenous leukemia (0680
- Additional diseases or conditions associated with increased cell survival that could be diagnosed, prognosed, prevented, and/or treated by fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention, include, but are not limited to, progression, and/or metastases of malignancies and related disorders such as leukemia (including acute leukemias (e g , acute lymphocytic leukemia, acute myelocytic leukemia (including myeloblastic, promyelocytic, myelomonocytic, monocytic, and erythroleukemia)) and chronic leukemias (e g , chronic myelocytic (granulocytic) leukemia and chronic lymphocytic leukemia)), polycythemia vera, lymphomas (e g , Hodgkin's disease and non-Hodgkin's disease), multiple myeloma, Waldenstrom's macroglobuhnemia, heavy chain disease,
- Diseases associated with increased apoptosis that could be diagnosed, prognosed, prevented, and/or treated by fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention, include AIDS, neurodegenerative disorders (such as Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, retinitis pigmentosa, cerebellar degeneration and brain tumor or prior associated disease), autoimmune disorders (such as, multiple sclerosis, Sjogren's syndrome, Hashimoto's thyroiditis, biliary cinhosis, Behcet's disease, Crohn's disease, polymyositis, systemic lupus erythematosus and immune-related glomeruloneph ⁇ tis and rheumatoid arthritis) myelodysplastic syndromes (such as aplastic anemia), graft v host disease, lschemic injury (such as that caused by myocardial infarction, stroke and
- Hype ⁇ roliferative diseases and/or disorders that could be diagnosed, prognosed, prevented, and/or treated by fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention, include, but are not limited to, neoplasms located in the liver, abdomen, bone, breast, digestive system, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous system (central and penpheral), lymphatic system, pelvis, skin, soft tissue, spleen, thorax, and urogemtal tract
- other hype ⁇ rohferative disorders can also be diagnosed, prognosed, prevented, and/or treated by fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention Examples of such hype ⁇ ro ferative disorders include, but are not
- Another prefened embodiment utilizes polynucleotides encoding albumin fusion proteins of the invention to inhibit abenant cellular division, by gene therapy using the present invention, and/or protein fusions or fragments thereof
- the present invention provides a method for treating cell proliferative disorders by inserting into an abnormally proliferating cell a polynucleotide encoding an albumin fusion protein ofthe present invention, wherein said polynucleotide represses said expression (0688)
- Another embodiment of the present invention provides a method of treating cell-proliferative disorders in individuals comprising administration of one or more active gene copies of the present invention to an abnormally proliferating cell or cells
- polynucleotides of the present invention is a DNA construct comprising a recombinant expression vector effective in expressing a DNA sequence encoding said polynucleotides
- the DNA construct encoding the fusion protein of the present invention is inserted into cells to be treated utilizing a retrovirus, or more preferably an adenoviral vector (See G J Nabel, et al , PNAS 1999 96 324-326, which is hereby
- Polynucleotides of the present invention may be useful in repressing expression of oncogenic genes or antigens
- repressing expression of the oncogenic genes is intended the suppression of the transcription of the gene, the degradation ofthe gene transc ⁇ pt (pre-message RNA), the inhibition of splicing, the destruction of the messenger RNA, the prevention of the post-translational modifications of the protein, the destruction ofthe protein, or the inhibition ofthe normal function ofthe protein
- polynucleotides of the present invention may be administered by any method known to those of skill in the art including, but not limited to transfection, electroporation, microinjection of cells, or in vehicles such as liposomes, lipofectin, or as naked polynucleotides, or any other method descnbed throughout the specification
- the polynucleotide of the present invention may be delivered by known gene delivery systems such as, but not limited to, retroviral vectors (Gilboa, J Virology 44 845 (1982), Hocke, Nature 320 275 (1986), Wilson, et al , Proc Natl Acad Sci U S A 85 3014), vaccinia virus system (Chakrabarty et al , Mol Cell Biol 5 3403 (1985) or other efficient DNA delivery systems (Yates et al , Nature 313 812 (1985)) known to those skilled in the art
- retroviral vectors Ga.boa, J Virology 44 845 (1982), Hocke,
- the polynucleotides of the present invention may be delivered directly to cell proliferative disorder/disease sites in internal organs, body cavities and the like by use of imaging devices used to guide an injecting needle directly to the disease site
- the polynucleotides of the present invention may also be administered to disease sites at the time of surgical intervention
- cell proliferative disease any human or animal disease or disorder, affecting any one or any combination of organs, cavities, or body parts, which is characterized by single or multiple local abnormal proliferations of cells, groups of cells, or tissues, whether benign or malignant
- any amount of the polynucleotides of the present invention may be administered as long as it has a biologically inhibiting effect on the proliferation of the treated cells Moreover, it is possible to administer more than one of the polynucleotide of the present invention simultaneously to the same site
- biologically inhibiting is meant partial or total growth inhibition as well as decreases in the rate of proliferation or growth of the cells
- the biologically inhibitory dose may be determined by assessing the effects of the polynucleotides of the present invention on target malignant or abnormally proliferating cell growth in tissue culture, tumor growth in animals and cell cultures, or any other method known to one of ordinary skill in the art
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention of the present invention are useful in inhibiting the angiogenesis of proliferative cells or tissues, either alone, as a protein fusion, or in combination with other polypeptides directly or indirectly, as described elsewhere herein
- said anti-angiogenesis effect may be achieved indirectly, for example, through the inhibition of hematopoietic, tumor-specific cells, such as tumor-associated macrophages (See Joseph IB, et al J Natl Cancer Inst, 90(21) 1648-53 (1998), which is hereby inco ⁇ orated by reference)
- Albumin fusion proteins ot the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful m inhibiting proliferative cells or tissues through the induction of apoptosis These fusion protiems and/or polynucleotides may act
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are useful in inhibiting the metastasis of proliferative cells or tissues Inhibition may occur as a direct result of administering these albumin fusion proteins and or polynucleotides, or indirectly, such as activating the expression of proteins known to inhibit metastasis, for example alpha 4 integrins, (See, e g , Cun Top Microbiol Immunol 1998,231 125-41, which is hereby inco ⁇ orated by reference) Such thereapeutic affects ofthe present invention may be achieved either alone, or in combination with small molecule drugs or adjuvants
- the invention provides a method of delivering compositions containing the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention to targeted cells expressing the a polypeptide bound by, that binds to, or associates with an albumin fuison protein of the invention
- Albumin fusion proteins of the invention may be associated with with heterologous polypeptides, heterologous nucleic acids, toxins, or prodrugs via hydrophobic, hydrophilic, ionic and/or covalent interactions
- Albumin fusion proteins of the invention are useful in enhancing the immunogenicity and/or antigenicity of proliferating cells or tissues, either directly, such as would occur if the albumin fusion proteins of the invention 'vaccinated' the immune response to respond to proliferative antigens and immunogens, or indirectly, such as in activating the expression of proteins known to enhance the immune response (e g chemokines), to said antigens and immunogens Renal
- Kidney diseases which can be diagnosed, prognosed, prevented, and/or treated with compositions of the invention include, but are not limited to, acute kidney failure, chronic kidney failure, atheroembohc renal failure, end-stage renal disease, inflammatory diseases of the kidney (e g , acute glomeruloneph ⁇ tis, postinfectious glomeruloneph ⁇ tis, rapidly progressive glomeruloneph ⁇ tis, nephrotic syndrome, membranous glomeruloneph ⁇ tis, familial nephrotic syndrome, membranoproliferative glomeruloneph ⁇ tis I and II, mesangial proliferative glomeruloneph ⁇ tis, chronic glomeruloneph ⁇ tis, acute tubulointerstitial nephritis, chronic tubulointerstitial nephritis, acute post-streptococcal glomeruloneph ⁇ tis (PSGN), pyelonephritis,
- PSGN
- compositions of the invention can be used to diagnose, prognose, prevent, and/or treat metabolic and congenital disorders of the kidney (e g , uremia, renal amyloidosis, renal osteodystrophy, renal tubular acidosis, renal glycosu ⁇ a, nephrogemc diabetes insipidus, cystinu ⁇ a, Fanconi's syndrome, renal fibrocystic osteosis (renal ⁇ ckets), Hartnup disease, Bartter's syndrome, Liddle's syndrome, polycystic kidney disease, medullary cystic disease, medullary sponge kidney, Alport's syndrome, nail-patella syndrome, congenital nephrotic syndrome, CRUSH syndrome, horseshoe kidney, diabetic nephropathy, nephrogemc diabetes insipidus, analgesic nephropathy, kidney stones, and membranous nephropathy), and autoimmune disorders of the kidney (e g ,
- compositions of the invention can also be used to diagnose, prognose, prevent, and/or treat sclerotic or necrotic disorders of the kidney (e g , glomerulosclerosis, diabetic nephropathy, focal segmental glomerulosclerosis (FSGS), necrotizing glomeruloneph ⁇ tis, and renal papillary necrosis), cancers of the kidney (e g , nephroma, hypernephroma, nephroblastoma, renal cell cancer, transitional cell cancer, renal adenocarcinoma, squamous cell cancer, and Wilm's tumor), and electrolyte imbalances (e g , nephrocalcinosis, pyu ⁇ a, edema, hydroneph ⁇ tis, proteinuria, hyponatremia, hypematremia, hypokalemia, hyperkalemia, hypocalcemia, hypercalcemia, hypophosphatemta, and hype ⁇ hosphatemia) 107
- Cardiovascular disorders also include, but are not limited to, heart disease, such as anhythmias, carcinoid heart disease, high cardiac output, low cardiac output, cardiac tamponade, endocarditis (including bacte ⁇ al), heart aneurysm, cardiac anest, congestive heart failure, congestive cardiomyopathy, paroxysmal dyspnea, cardiac edema, heart hypertrophy, congestive cardiomyopathy, left ventncular hypertrophy, nght ventncular hypertrophy, post-infarction heart rupture, ventncular septal rupture, heart valve diseases, myocardial diseases, myocardial ischemia, pe ⁇ cardial effusion, pericarditis (including const ⁇ ctive and tuberculous), pneumope ⁇ cardium, postpe ⁇ cardiotomy syndrome, pulmonary heart disease, rheumatic heart disease, ventncular dysfunction, hyperemia, cardiovascular pregnancy complications, Scimitar Syndrome, cardiovascular syphilis, and cardiovascular tuberculous
- Anhythmias include, but are not limited to, sinus anhythmia, at ⁇ al fibnllation, atnal flutter, bradycardia, extrasystole, Adams-Stokes Syndrome, bundle-branch block, sinoatnal block long QT syndrome, parasystole, Lown-Ganong-Levine Syndrome, Mahaim-type pre-excitation syndrome, Wolff-Parkinson-White syndrome, sick sinus syndrome, tachycardias, and ventricular fibnllation Tachycardias include paroxysmal tachycardia, supraventncular tachycardia, accelerated ldiovent ⁇ cular rhythm, at ⁇ ovent ⁇ cular nodal reentry tachycardia, ectopic at ⁇ al tachycardia, ectopic junctional tachycardia, sinoatnal nodal reentry tachycardia, sinus tachycardia, Tor
- Myocardial diseases include, but are not limited to, alcoholic cardiomyopathy, congestive cardiomyopathy, hypertrophic cardiomyopathy, aortic subvalvular stenosis, pulmonary subvalvular stenosis, restrictive cardiomyopathy, Chagas cardiomyopathy, endocardial fibroelastosis, endomyocardial fibrosis, Keams Syndrome, myocardial reperfusion injury, and myocarditis
- Myocardial ischemias include, but are not limited to, coronary disease, such as angina pectoris, coronary aneurysm, coronary arteriosclerosis, coronary thrombosis, coronary vasospasm, myocardial infarction and myocardial stunning
- coronary disease such as angina pectoris, coronary aneurysm, coronary arteriosclerosis, coronary thrombosis, coronary vasospasm, myocardial infarction and myocardial stunning
- Cardiovascular diseases also include vascular diseases such as aneurysms, angiodysplasia, angiomatosis, bacillary angiomatosis, Hippel- Lindau Disease, Khppel-Trenaunay-Weber Syndrome, Sturge-Weber Syndrome, angioneurotic edema, aortic diseases, Takayasu's Arte ⁇ tis, aortitis, Le ⁇ che's Syndrome, arterial occlusive diseases, arte ⁇ tis, enarte ⁇ tis, polyarte ⁇ tis nodosa, cerebrovascular disorders, diabetic angiopathies, diabetic retmopathy, embolisms, thrombosis, erythromelalgia, hemonhoids, hepatic veno-occlusive disease, hypertension, hypotension, ischemia, peripheral vascular diseases, phlebitis, pulmonary veno-occlusive disease, Raynaud's disease, CR
- Aneurysms include, but are not limited to, dissecting aneurysms, false aneurysms, infected aneurysms, ruptured aneurysms, aortic aneurysms, cerebral aneurysms, coronary aneurysms, heart aneurysms, and iliac aneurysms
- Arterial occlusive diseases include, but are not limited to, arteriosclerosis, intermittent claudication, carotid stenosis, fibromuscular dysplasias, mesente ⁇ c vascular occlusion, Moyamoya disease, renal artery obstruction, retinal artery occlusion, and thromboangntis obhterans
- 0714] Cerebrovascular disorders include, but are not limited to, carotid artery diseases, cerebral amyloid angiopathy, cerebral aneurysm, cerebral anoxia, cerebral arteriosclerosis, cerebral arte ⁇ ovenous malformation, cerebral artery diseases, cerebral embolism and thrombosis, carotid artery thrombosis, sinus thrombosis, Wallenberg's syndrome, cerebral hemonhage, epidural hematoma, subdural hematoma, subaraxhnoid hemonhage, cerebral infarction, cerebral ischemia (including transient), subclavian steal syndrome
- Embolisms include, but are not limited to, air embolisms, amniotic fluid embolisms, cholesterol embolisms, blue toe syndrome, fat embolisms, pulmonary embolisms, ana thromoboembolisms
- Thrombosis include, but are not limited to, coronary thrombosis, hepatic vein thrombosis, retinal vein occlusion, carotid artery thrombosis, sinus thrombosis, Wallenberg's syndrome, and thrombophlebitis
- Ischemic disorders include, but are not limited to, cerebral ischemia, ischemic colitis, compartment syndromes, anterior compartment syndrome, myocardial ischemia, reperfusion injuries, and pe ⁇ pheral limb ischemia
- Vascuhtis includes, but is not limited to, aortitis, arte ⁇ tis,
- Behcet's Syndrome Churg-Strauss Syndrome, mucocutaneous lymph node syndrome, thromboangntis obhterans, hypersensitivity vascuhtis,
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be administered using any method known in the art, including, but not limited to, direct needle injection at the delivery site, intravenous injection, topical administration, catheter infusion, biohstic injectors, particle accelerators, gelfoam sponge depots, other commercially available depot materials, osmotic pumps, oral or supposito ⁇ al solid pharmaceutical formulations, decanting or topical applications du ⁇ ng surgery, aerosol delivery Such methods are known in the art Methods of dehve ⁇ ng polynucleotides are described in more detail herein Respiratory Disorders [0718] Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used to treat, prevent, diagnose, and/or prognose diseases and/or disorders ofthe respiratory system
- Diseases and disorders of the respiratory system include, but are not limited to, nasal vestibuhtis, nonallergic rhinitis (e g , acute rhinitis, chronic rhinitis, atrophic rhinitis, vasomotor rhinitis), nasal polyps, and sinusitis, juvenile angiofibromas, cancer ofthe nose and juvenile papillomas, vocal cord polyps, nodules (singer's nodules), contact ulcers, vocal cord paralysis, laryngoceles, pharyngitis (e g , viral and bacterial), tonsillitis, tonsillar cellulitis, parapharyngeal abscess, laryngitis, laryngoceles, and throat cancers (e g , cancer of the nasopharynx, tonsil cancer, larynx cancer), lung cancer (e g , squamous cell carcinoma, small cell (oat cell) carcinoma, large cell carcinoma, and adeno
- Additional diseases and disorders of the respiratory system include, but are not limited to bronchio tis, polio (poliomyelitis), croup, respiratory syncytial viral infection, mumps, erythema infectiosum (fifth disease), roseola infantum, progressive rubella panencephahtis, german measles, and subacute sclerosing panencephahtis), fungal pneumonia (e g , Histoplasmosis, Coccidioidomycosis, Blastomycosis, fungal infections in people with severely suppressed immune systems (e g , cryptococcosis, caused by Cryptococcus neoformans, aspergillosis, caused by Aspergillus spp , candidiasis, caused by Candida, and mucormycosis)), Pneumocystis carimi (pneumocystis pneumonia), atypical pneumonias (e g , Mycoplasma and
- the present invention provides for treatment of diseases or disorders associated with neovascula ⁇ zation by administration of fusion proteins of the invention and or polynucleotides encoding albumin fusion proteins of the invention
- Malignant and metastatic conditions which can be treated with the polynucleotides and polypeptides, or agonists or antagonists of the invention include, but are not limited to, malignancies, solid tumors, and cancers described herein and otherwise known in the art (for a review of such disorders, see Fishman et al Medicine, 2d Ed , J B Lippincott Co , Philadelphia (1985))
- the present invention provides a method of treating an angiogenesis-related disease and/or disorder, comprising administering to an individual in need thereof a therapeutically effective amount of an albumin fusion protein of the invention and/or polynucleotides encoding an albumin fusion protein ofthe invention
- fusion proteins of the invention and or polynucleotides encoding albumin fusion proteins of the invention may
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be utilized to treat superficial forms of bladder cancer by, for example, lntravesical administration
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be delivered directly into the tumor, or near the tumor site, via injection or a catheter
- the appropriate mode of administration will vary according to the cancer to be treated Other modes of delivery are discussed herein
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be useful in treating other disorders, besides cancers, which involve angiogenesis
- These disorders include, but are not limited to benign tumors, for example hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas, artheroscle ⁇ c plaques, ocular angiogenic diseases, for example, diabetic retinopathy, retinopathy of prematurity, macular degeneration, corneal graft rejection, neovascular glaucoma, retrolental fibroplasia, rubeosis, retinoblastoma, uvietis and Pterygia (abnormal blood vessel growth) of the eye, rheumatoid arthritis, psoriasis, delayed wound healing, endomet ⁇ osis, vasculogenesis, granulations, hypertrophic scars
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are directly injected into a hypertrophic scar or keloid, in order to prevent the progression of these lesions
- This therapy is of particular value in the prophylactic treatment of conditions which are known to result in the development of hypertrophic scars and keloids (e g , burns), and is preferably initiated after the proliferative phase has had time to progress (approximately 14 days after the initial injury), but before hypertrophic scar or keloid development
- the present invention also provides methods for treating neovascular diseases of the eye, including for example, corneal neovascula ⁇ zation, neovascular glaucoma, proliferative diabetic retinopathy, retrolental fibroplasia and macular degeneration
- Ocular disorders associated with neovascula ⁇ zation which can be treated with the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but are not limited to neovascular glaucoma, diabetic retinopathy, retinoblastoma, retrolental fibroplasia, uveitis, retinopathy of prematu ⁇ ty macular degeneration, corneal graft neovascula ⁇ zation, as well as other eye inflammatory diseases, ocular tumors and diseases associated with choroidal or iris neovascula ⁇ zation See, e g , reviews by Waltman et al Am J Ophthal 85 704-710 (1978) and Gartner et al Surv Ophthal 22 291-312 (1978)
- neovascular diseases of the eye such as corneal neovascula ⁇ zation (including corneal graft neovascula ⁇ zation)
- a compound e g , fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention
- the cornea is a tissue which nonnally lacks blood vessels
- capillaries may extend into the cornea from the pe ⁇ corneal vascular plexus of the hmbus
- the cornea becomes vasculanzed, it also becomes clouded, resulting in a decline in the patient's visual acuity Visual loss may become complete if the cornea completely opacitates
- a wide vanety of disorders can result in corneal neovascula ⁇ zation, including
- prefened embodiments of the invention may be prepared for topical administration in saline (combined with any of the preservatives and antimicrobial agents commonly used in ocular preparations), and administered in eyedrop form
- the solution or suspension may be prepared in its pure form and administered several times daily
- anti-angiogenic compositions prepared as described above, may also be administered directly to the cornea
- the anti-angiogenic composition is prepared with a muco-adhesive polymer which binds to cornea
- the anti-angiogenic factors or anti-angiogenic compositions may be utilized as an ad j unct to conventional steroid therapy
- Topical therapy may also be useful prophylactically in corneal lesions which are known to have a high probability of inducing an angiogenic response (such as chemical burns) In these instances the treatment, likely in combination with steroids, may be instituted immediately to help prevent subsequent complications
- the compounds described above may be injected directly into the corneal stroma by an ophthalmologist under microscopic guidance
- the prefened site of injection may vary with the mo ⁇ hology of the individual lesion, but the goal of the administration would be to place the composition at the advancing front of the vasculature (l e , interspersed between the blood vessels and the normal cornea) In most cases this would involve pe ⁇ hmbic comeal injection to "protect" the comea from the advancing blood vessels
- This method may also be utilized shortly after a corneal insult in order to prophylactically prevent corneal neovascula ⁇ zation In this situation the material could be injected in the penlimbic cornea interspersed between the corneal lesion and its undesired potential hmbic blood supply
- Such methods may also be utilized in a similar fashion to prevent capillary invasion of transplanted corneas In a sustained-release form injections might only be required 2-3 times per year A steroid could also be added to the injection solution to reduce inflammation resulting from
- methods for treating neovascular glaucoma comprising the step of administering to a patient a therapeutically effective amount of an albumin fusion protein of the invention and/or polynucleotides encoding an albumin fusion protein of the invention to the eye, such that the formation of blood vessels is inhibited
- the compound may be administered topically to the eye in order to treat early forms of neovascular glaucoma
- the compound may be implanted by injection into the region of the anterior chamber angle
- the compound may also be placed in any location such that the compound is continuously released into the aqueous humor
- methods are provided for treating proliferative diabetic retinopathy, comprising the step of administering to a patient a therapeutically effective amount of an albumin fusion protein of the invention and/or polynucleotides encoding an albumin fusion protein of the invention to the eyes, such that the formation of
- proliferative diabetic retinopathy may be treated by injection into the aqueous humor or the vitreous, in order to increase the local concentration of the polynucleotide, polypeptide, antagonist and/or agonist in the retina Preferably, this treatment should be initiated prior to the acquisition of severe disease requiring photocoagulation
- methods for treating retrolental fibroplasia comprising the step of administering to a patient a therapeutically effective amount of an albumin fusion protein of the invention and/or polynucleotides encoding an albumin fusion protein of the invention to the eye, such that the formation of blood vessels is inhibited
- the compound may be administered topically, via intravitreous injection and/or via intraocular implants
- disorders which can be treated with fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but are not limited to, hemangioma, arthritis, psoriasis, angiofibroma, atherosclerotic plaques, delayed wound healing, granulations, hemopfulic joints, hypertrophic scars, nonunion fractures, Osier-Weber syndrome, pyogenic granuloma, scleroderma, trachoma, and vascular adhesions
- disorders and/or states which can be treated, prevented, diagnosed, and/or prognosed with the the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention ofthe invention include, but are not limited to, solid tumors, blood born tumors such as leukemias, tumor metastasis, Kaposi's sarcoma, benign tumors, for example hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas, rheumatoid arthritis, psoriasis, ocular angiogenic diseases, for example, diabetic retinopathy, retinopathy of prematurity, macular degeneration, corneal graft rejection, neovascular glaucoma, retrolental fibroplasia, rubeosis, retinoblastoma, and uvietis, delayed wound healing, endomet ⁇ osis,
- an amount of the compound sufficient to block embryo implantation is administered before or after intercourse and fertilization have occuned, thus providing an effective method of birth control, possibly a "morning after" method
- Albumin fusion proteins of the invention an ⁇ /or polynucleotides encoding albumin fusion proteins of the invention may also be used in controlling menstruation or administered as either a pe ⁇ toneal lavage fluid or for peritoneal implantation in the treatment of endomet ⁇ osis
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be inco ⁇ orated into surgical sutures in order to prevent stitch granulomas
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be utilized in a wide variety of surgical procedures
- a compositions m the form of, for example, a spray or film
- compositions may be delivered via endoscopic procedures in order to coat tumors, or inhibit angiogenesis in a desired locale
- surgical meshes which have been coated with anti- angiogenic compositions of the present invention may be utilized in any procedure wherein a surgical mesh might be utilized
- a surgical mesh laden with an anti- angiogenic composition may be utilized during abdominal cancer resection surgery (e g , subsequent to
- the anti-angiogenic compound is administered directly to the tumor excision site (e g , applied by swabbing, brushing or otherwise coating the resection margins of the tumor with the anti-angiogenic compound)
- the anti-angiogenic compounds may be inco ⁇ orated into known surgical pastes p ⁇ or to administration
- the anti-angiogenic compounds are applied after hepatic resections for malignancy, and after neurosurgical operations
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be administered to the resection margin of a wide variety of tumors, including for example, breast, colon, brain and hepatic tumors
- anti-angiogenic compounds may be administered to the site of a neurological tumor subsequent to excision, such that the formation of new blood vessels at the site are inhibited
- albumin fusion proteins of the invention and or polynucleotides encoding albumin fusion proteins of the invention may also be administered along with other anti-angiogenic factors
- anti-angiogenic factors include Anti-Invasive Factor, retinoic acid and derivatives thereof, paclitaxel, Suramin, Tissue Inhibitor of Metalloprote ⁇ nase-1, Tissue Inhibitor of Metalloprote ⁇ nase-2, Plasminogen Activator Inh ⁇ b ⁇ tor-1 , Plasminogen Activator Inh ⁇ b ⁇ tor-2, and various forms of the lighter “d group” transition metals
- Lighter "d group” transition metals include, for example, vanadium, molybdenum, tungsten, titanium, niobium, and tantalum species Such transition metal species may form transition metal complexes Suitable complexes of the above-mentioned transition metal species include oxo transition metal complexes
- vanadium complexes include oxo vanadium complexes such as vanadate and vanadyl complexes
- Suitable vanadate complexes include metavanadate and orthovanadate complexes such as, for example, ammonium metavanadate, sodium metavanadate, and sodium orthovanadate
- Suitable vanadyl complexes include, for example, vanadyl acetylacetonate and vanadyl sulfate including vanadyl sulfate hydrates such as vanadyl sulfate mono- and t ⁇ hydrates
- tungsten and molybdenum complexes also include oxo complexes Suitable oxo tungsten complexes include tungstate and tungsten oxide complexes Suitable tungstate complexes include ammonium tungstate, calcium tungstate, sodium tungstate dihydrate, and tungstic acid Suitable tungsten oxides include tungsten (IV) oxide and tungsten (VI) oxide Suitable oxo molybdenum complexes include molybdate, molybdenum oxide, and molybdenyl complexes Suitable molybdate complexes include ammonium molybdate and its hydrates, sodium molybdate and its hydrates, and potassium molybdate and its hydrates Suitable molybdenum oxides include molybdenum (VI) oxide, molybdenum (VI) oxide, and molybdic acid Suitable molybdenyl complexes include, for example, molybdenyl acetylaceton
- a wide variety of other anti-angiogenic factors may also be utilized within the context of the present invention
- Representative examples include platelet factor 4, protamine sulphate, sulphated chitin derivatives (prepared from queen crab shells), (Murata et al , Cancer Res 51 22-26, 1991), Sulphated Polysaccha ⁇ de Peptidoglycan Complex (SP- PG) (the function of this compound may be enhanced by the presence of steroids such as estrogen, and tamoxifen citrate), Staurospo ⁇ ne, modulators of matrix metabolism, including for example, proline analogs, cishydroxyprohne, d,L-3,4-dehydroprohne, Thiaprohne, alpha.alpha-dipy ⁇ dyl, aminopropionit ⁇ le fumarate, 4-propyl-5-(4-py ⁇ d ⁇ nyl)-2(3H)- oxazolone, Methotrexate, Mitoxantrone, Hepa ⁇ n, Interferons,
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used to inhibit growth, progression, and/or metasis of cancers, in particular those listed above
- Additional diseases or conditions associated with increased cell survival that could be treated or detected by fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but are not limited to, progression, and/or metastases of malignancies and related disorders such as leukemia (including acute leukemias (e g , acute lymphocytic leukemia, acute myelocytic leukemia (including myeloblastic, promyelocytic, myelomonocytic, monocytic, and erythroleukemia)) and chronic leukemias (e g , chronic myelocytic (granulocytic) leukemia and chronic lymphocytic leukemia)), polycythemia vera, lymphomas (e g , Hodgkin's disease and non-Hodgkin's disease), multiple myeloma, Waldenstrom's macroglobuhnemia, heavy chain disease, and solid tumors including, but not limited to
- Diseases associated with increased apoptosis that could be treated, prevented, diagnosed, and/or prognesed using fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention, include, but are not limited to, AIDS, neurodegenerative disorders (such as Alzheimer's disease, Parkinson's disease, Amyotrophic lateral sclerosis, Retinitis pigmentosa, Cerebellar degeneration and brain tumor or prior associated disease), autoimmune disorders (such as, multiple sclerosis, Sjogren's syndrome, Hashimoto's thyroiditis, biliary cinhosis, Behcet's disease, Crohn's disease, polymyositis, systemic lupus erythematosus and immune-related glomeruloneph ⁇ tis and rheumatoid arthritis) myelodysplastic syndromes (such as aplastic anemia), graft v host disease, ischemic injury (such as that caused by myocardial), graf
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention could be used to increase the adherence of skin grafts to a wound bed and to stimulate re-epithelialization from the wound bed
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention will also produce changes in hepatocyte proliferation, and epithelial cell proliferation in the lung, breast, pancreas, stomach, small intestine, and large intestine
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention could promote proliferation of epithelial cells such as sebocytes, hair follicles, hepatocytes, type II pneumocytes, mucin-producing goblet cells, and other epithelial cells and their progenitors contained within the skm, lung, liver, and gastrointestinal tract
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may promote proliferation of endothelial cells, keratinocytes, and basal keratinocytes
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention could also be used to reduce the side effects of gut toxicity that result from radiation, chemotherapy treatments or viral infections
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention may have a cytoprotective effect on the small intestine mucosa
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may also stimulate healing of mucositis (mouth ulcers) that result from chemotherapy and viral infections
- Albumin fusion proteins ofthe invention and/or polynucleotides encoding albumin fusion proteins ofthe invention could further be used in full regeneration of skin in full and partial thickness skin defects, including burns, (I e , repopulation of hair follicles, sweat glands, and sebaceous glands), treatment of other skin defects such as pso ⁇ asis
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention could be used to treat epidermolysis bullosa, a defect in adherence ofthe epidermis to the underlying dermis which results in frequent, open and painful blisters by accelerating reepitheliahzation of these lesions
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention could also be used to treat gastric and doudenal ulcers and help heal by scar formation of the mucosal lining and regeneration of glandular
- fusion proteins of the invention and/or polynucleotides encoding albumm fusion proteins of the invention could be used to prevent and heal damage to the lungs due to various pathological states
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention which could stimulate proliferation and differentiation and promote the repair of alveoli and brochiolar epithelium to prevent or treat acute or chronic lung damage
- emphysema which results in the progressive loss of aveoh, and inhalation injuries, l e , resulting from smoke inhalation and burns, that cause necrosis of the bronchiolar epithelium and alveoli could be effectively treated using polynucleotides or polypeptides, agonists or antagonists of the present invention
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention could be used to stimulate the proliferation of and differentiation of type II pneumocytes
- albumin fusion proteins of the invention and or polynucleotides encoding albumin fusion proteins of the invention could stimulate the proliferation and differentiation of hepatocytes and, thus, could be used to alleviate or treat liver diseases and pathologies such as fulminant liver failure caused by cinhosis, liver damage caused by viral hepatitis and toxic substances (I e , acetaminophen, carbon tetraholo ⁇ de and other hepatotoxins known in the art)
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention could be used treat or prevent the onset of diabetes mellitus In patients with newly diagnosed Types I and II diabetes, where some islet cell function remains, fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention, could be used to maintain the islet function so as to alleviate, delay or prevent permanent manifestation of the disease Also, fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention, could be used as an auxiliary in islet cell transplantation to improve or promote islet cell function Neural Activity and Neurological Diseases 10758) The albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used for the diagnosis and/or treatment of diseases, disorders, damage or injury of the brain and/or nervous system Nervous system disorders that can be treated with the compositions of the invention (
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used to protect neural cells from the damaging effects of hypoxia
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used to protect neural cells from the damaging effects of cerebral hypoxia
- the compositions of the invention are used to treat or prevent neural cell injury associated with cerebral hypoxia
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used to treat or prevent neural cell injury associated with cerebral ischemia
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used to treat or prevent neural cell injury associated with cerebral infarction
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used to treat or prevent neural cell injury associated with a stroke
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used to treat or prevent cerebral neural cell injury associated with a stroke
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used to treat or prevent neural cell injury associated with a heart attack
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention are used to treat or prevent cerebral neural cell injury associated with a heart attack
- compositions of the invention which are useful for treating or preventing a nervous system disorder may be selected by testing for biological activity in promoting the survival or differentiation of neurons
- compositions of the invention which elicit any of the following effects may be useful according to the invention (1) increased survival time of neurons in culture either in the presence or absence of hypoxia or hypoxic conditions, (2) increased sprouting of neurons in culture or in vivo, (3) increased production of a neuron- associated molecule in culture or in vivo, e g , chohne acetyltransferase or acetylcho nesterase with respect to motor neurons, or (4) decreased symptoms of neuron dysfunction m vivo
- increased survival of neurons may routinely be measured using a method set forth herein or otherwise known in the art, such as, for example, in Zhang et al , Proc Natl Acad Sci USA 97 3637-42 (2000)
- motor neuron disorders that may be treated according to the invention include, but are not limited to, disorders such as infarction, infection, exposure to toxin, trauma, surgical damage, degenerative disease or malignancy that may affect motor neurons as well as other components ot the nervous system, as well as disorders that selectively affect neurons such as amyotrophic lateral sclerosis, and including, but not limited to, progressive spinal muscular atrophy, progressive bulbar palsy, primary lateral sclerosis, infantile and juvenile muscular atrophy, progressive bulbar paralysis of childhood (Fazio-Londe syndrome), poliomyelitis and the post polio syndrome, and Hereditary Motorsensory Neuropathy (Charcot-Ma ⁇ e-Tooth Disease)
- compositions of the invention may be used to diagnose and/or treat or prevent diseases or disorders associated with these roles, including, but not limited to, learning and/or cognition disorders
- the compositions of the invention may also be useful in the treatment or prevention of neurodegenerative disease states and/or behavioural disorders
- neurodegenerative disease states and/or behavioral disorders include, but are not limited to, Alzheimer's Disease, Parkinson's Disease, Huntmgton's Disease, Tourette Syndrome, schizophrenia, ma a, dementia, paranoia, obsessive compulsive disorder, panic disorder, learning disabilities, ALS, psychoses, autism, and altered behaviors, including disorders in feeding, sleep patterns, balance, and perception
- compositions of the invention include, but are not limited to, Alzheimer's Disease, Parkinson's Disease, Huntmgton's Disease, Tourette Syndrome, schizophrenia, ma a, dementia, paranoia, obsessive compulsive disorder, panic disorder, learning disabilities, ALS, psychoses, autism, and altered behaviors, including disorders in feeding, sleep patterns, balance, and perception
- Additional neurologic diseases which can be treated or detected with fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include cerebrovascular disorders (such as carotid artery diseases which include carotid artery thrombosis, carotid stenosis and Moyamoya Disease), cerebral amyloid angiopathy, cerebral aneurysm, cerebral anoxia, cerebral arteriosclerosis, cerebral arte ⁇ ovenous malformations, cerebral artery diseases, cerebral embolism and thrombosis such as carotid artery thrombosis, sinus thrombosis and Wallenberg's Syndrome, cerebral hemonhage such as epidural hematoma, subdural hematoma and subarachnoid hemonhage, cerebral infarction, cerebral ischemia such as transient cerebral ischemia, Subclavian Steal Syndrome and vertebrobasilar insufficiency, vascular dementia such as multi-infarct dementia, perivent
- Additional neurologic diseases which can be treated or detected with fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include dementia such as AIDS Dementia Complex, prese le dementia such as Alzheimer's Disease and Creutzfeldt-Jakob Syndrome, senile dementia such as Alzheimer's Disease and progressive supranuclear palsy, vascular dementia such as multi- mfarct dementia, encephalitis which include encephalitis pe ⁇ axialis, viral encephalitis such as epidemic encephalitis, Japanese Encephalitis, St Louis Encephalitis, tick-borne encephalitis and West Nile Fever, acute disseminated encephalomye tis, meningoencephahtis such as uveomeningoencephahtic syndrome, Postencephahtic Parkinson Disease and subacute sclerosmg panencephahtis, encephalomalacia such as pe ⁇ vent ⁇ cular leukomalacia, epilepsy such as
- Additional neurologic diseases which can be treated or detected with fusion proteins of the invention and or polynucleotides encoding albumin fusion proteins of the invention include hydrocephalus such as Dandy- Walker Syndrome and normal pressure hydrocephalus, hypothalamic diseases such as hypothalamic neoplasms, cerebral malaria, narcolepsy which includes cataplexy, bulbar poliomyelitis, cereb ⁇ pseudotumor, Rett Syndrome, Reye's Syndrome, thalamic diseases, cerebral toxoplasmosis, intracranial tuberculoma and Zellweger Syndrome, central nervous system infections such as AIDS Dementia Complex, Bram Abscess, subdural empyema, encephalomyelitis such as Equine Encephalomyelitis, Venezuelan Equine Encephalomyelitis, Necrotizing Hemonhagic Encephalomyelitis, Visna, and cerebral malaria
- hydrocephalus such as Dandy- Walker Syndrome and normal pressure hydroce
- Additional neurologic diseases which can be treated or detected with fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include meningitis such as arachnoiditis, aseptic meningtitis such as viral meningtitis which includes lymphocytic cho ⁇ omeningitis, Bacterial meningtitis which includes Haemophilus Meningtitis, Liste ⁇ a Meningtitis, Meningococcal Meningtitis such as Waterhouse-Fnderichsen Syndrome, Pneumococcal Meningtitis and meningeal tuberculosis, fungal meningitis such as Cryptococcal Meningtitis, subdural effusion, meningoencephahtis such as uvemeningoencephalitic syndrome, myelitis such as transverse myelitis, neurosyphihs such as tabes dorsa s, poliomyelitis which includes bulbar poliomyelitis and postpoliomy
- Additional neurologic diseases which can be treated or detected with fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include central nervous system neoplasms such as brain neoplasms that include cerebellar neoplasms such as lnfratento ⁇ al neoplasms, cerebral ventricle neoplasms such as choroid plexus neoplasms, hypothalamic neoplasms and supratento ⁇ al neoplasms, meningeal neoplasms, spinal cord neoplasms which include epidural neoplasms, demyelinatmg diseases such as Canavan Diseases, diffuse cerebral scelo ⁇ s which includes adrenoleukodystrophy, encephalitis pe ⁇ axialis, globoid cell leukodystrophy, diffuse cerebral sclerosis such as metachromatic leukodystrophy, allergic encephalomyelitis,
- Additional neurologic diseases which can be treated or detected with fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include hereditary motor and sensory neuropathies which include Charcot-Ma ⁇ e Disease, Hereditary optic atrophy, Refsum's Disease, hereditary spastic paraplegia, Werdmg-Hoffmann Disease, Hereditary Sensory and Autonomic Neuropathies such as Congenital Analgesia and Familial Dysautonomia, Neurologic manifestations (such as agnosia that include Gerstmann's Syndrome, Amnesia such as retrograde amnesia, apraxia, neurogemc bladder, cataplexy, communicative disorders such as hearing disorders that includes deafness, partial hearing loss, loudness recruitment and tinnitus, language disorders such as aphasia which include agraphia, anomia, broca aphasia, and Wernicke Aphasia, Dyslexia such
- Optic Nerve Diseases such as Optic Atrophy which includes Hereditary Optic Atrophy, Optic Disk Drusen, Optic Neuritis such as Neuromyehtis Optica, Papilledema, T ⁇ geminal Neuralgia, Vocal Cord Paralysis, Demyelinatmg Diseases such as Neuromyehtis Optica and Swayback, and Diabetic neuropathies such as diabetic foot
- Additional neurologic diseases which can be treated or detected with fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include nerve compression syndromes such as ca ⁇ al tunnel syndrome, tarsal tunnel syndrome, thoracic outlet syndrome such as cervical rib syndrome, ulnar nerve compression syndrome, neuralgia such as causalgia, cervico-brachial neuralgia, facial neuralgia and t ⁇ geminal neuralgia, neuritis such as expe ⁇ mental allergic neuritis, optic neuritis, polyneu ⁇ tis, polyradiculoneu ⁇ tis and radiculities such as polyradiculitis, hereditary motor and sensory neuropathies such as Charcot-Ma ⁇ e Disease, Hereditary Optic Atrophy, Refsum's Disease, Hereditary Spastic Paraplegia and Werdmg-Hoffmann Disease, Hereditary Sensory and Autonomic Neuropathies which include Congenital Analgesia and Familial Dysautonomia
- Endocrine system and/or hormone imbalance and/or diseases encompass disorders of utenne motihty including, but not limited to complications with pregnancy and labor (e g , pre-term labor, post-term pregnancy, spontaneous abortion, and slow or stopped labor), and disorders and/or diseases ofthe menstrual cycle (e g , dysmeno ⁇ hea and endomet ⁇ osis)
- Endocrine system and/or hormone imbalance disorders and/or diseases include disorders and/or diseases of the pancreas, such as, for example, diabetes mellitus, diabetes insipidus, congenital pancreatic agenesis, pheochromocytoma-islet cell tumor syndrome, disorders and/or diseases ofthe adrenal glands such as, for example, Addison's Disease, corticosteroid deficiency, vi ⁇ hzing disease, hirsutism, Cushing's Syndrome, hyperaldosteronism, pheochromocytoma, disorders and/or diseases of the pituitary gland, such as, for example, hype ⁇ ituita ⁇ sm, hypopituitansm, pituitary dwarfism, pituitary adenoma, panhypopituita ⁇ sm, acromegaly, gigantism, disorders and/or diseases of the thyroid, including but not limited to, hyperthyroidism, hypothyroidism, Plummer's
- endocrine system and/or hormone imbalance disorders and/or diseases may also include disorders and/or diseases of the testes or ova ⁇ es, including cancer Other disorders and/or diseases of the testes or ovaries further include, for example, ovarian cancer, polycystic ovary syndrome, Khnefelter's syndrome, vanishing testes syndrome (bilateral anorchia), congenital absence of Leydig's cells, cryptorchidism, Noonan's syndrome, myotonic dystrophy, capillary haemangioma ofthe testis (benign), neoplasias ofthe testis and neo-testis [0780] Moreover, endocrine system and/or hormone imbalance disorders and/or diseases may also include disorders and/or diseases such as, for example, polyglandular deficiency syndromes, pheochromocytoma, neuroblastoma, multiple Endoc ⁇ ne neoplasia, and disorders
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used to diagnose, prognose, prevent, and/or treat endocrine diseases and/or disorders associated with the t ⁇ ssue(s) in which the Therapeutic protein conesponding to the Therapeutic protein portion of the albumin protein ofthe invention is expressed, Reproductive System Disorders
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used for the diagnosis, treatment, or prevention of diseases and/or disorders ofthe reproductive system Reproductive system disorders that can be treated by the compositions of the invention, include, but are not limited to, reproductive system inju ⁇ es, infections, neoplastic disorders, congenital defects, and diseases or disorders which result in infertility, complications with pregnancy, labor, or parturition, and postpartum difficulties [0783] Reproductive system disorders and/or diseases include diseases and/or disorders of the
- Reproductive system disorders also include disorders of the prostate gland, such as acute non-bacte ⁇ al prostatitis, chronic non-bacterial prostatitis, acute bacterial prostatitis, chronic bacterial prostatitis, prostatodystoma, prostatosis, granulomatous prostatitis, malacoplakia, benign prostatic hypertrophy or hype ⁇ lasia, and prostate neoplastic disorders, including adenocarcinomas, transitional cell carcinomas, ductal carcinomas, and squamous cell carcinomas
- compositions of the invention may be useful in the diagnosis, treatment, and/or prevention of disorders or diseases of the penis and urethra, including inflammatory disorders, such as balanoposthitis, balanitis xerotica obhterans, phimosis, paraphimosis, syphilis, he ⁇ es simplex virus, gononhea, non-gonococcal urethntis, chlamydia, mycoplasma, tnchomonas, HIV, AIDS, Reiter's syndrome, condyloma acuminatum, condyloma latum, and pearly penile papules, urethral abnormalities, such as hypospadias, epispadias, and phimosis, premalignant lesions, including Erythroplasia of Queyrat, Bowen's disease, Bowenoid paplosis, giant condyloma of Buscke-Lowenstein
- diseases and/or disorders of the vas deferens include vascuhtitis and CBAVD (congenital bilateral absence of the vas deferens), additionally, the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used in the diagnosis, treatment, and or prevention of diseases and/or disorders of the seminal vesicles, including hydatid disease, congenital chloride dianhea, and polycystic kidney disease
- disorders and/or diseases of the male reproductive system include, for example, Khnefelter's syndrome, Young's syndrome, premature ejaculation, diabetes mellitus, cystic fibrosis, Kartagener's syndrome, high fever, multiple sclerosis, and gynecomastia
- the polynucleotides, fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used in the diagnosis, treatment, and/or prevention of diseases and/or disorders of the vagina and vulva, including bacterial vaginosis, Candida vaginitis, he ⁇ es simplex virus, chancroid, granuloma inguinale, lymphogranuloma venereum, scabies, human papillomavirus, vaginal trauma, vulvar trauma, ade ⁇ osis, chlamydia vaginitis, gononhea, tncho
- disorders and/or diseases of the uterus include dysmenonhea, retroverted uterus, endomet ⁇ osis, fibroids, adenomyosis, anovulatory bleeding, amenonhea, Cushing's syndrome, hydatidiform moles, Asherman's syndrome, premature menopause, precocious puberty, uterine polyps, dysfunctional ute ⁇ ne bleeding (e g , due to abenant hormonal signals), and neoplastic disorders, such as adenocarcinomas, keiomyosarcomas, and sarcomas
- the albumin fusion proteins of the invention and or polynucleotides encoding albumin fusion proteins of the invention may be useful as a marker or detector of, as well as in the diagnosis, treatment, and/or prevention of congenital uterine abnormalities, such as bicomuate uterus, septate uterus, simple u cornuate uterus,
- Ovarian diseases and/or disorders include anovulation, polycystic ovary syndrome (Stein-Leventhal syndrome), ovarian cysts, ovarian hypofunction, ovarian sensitivity to gonadotropins, ovarian ove ⁇ roduction of androgens, right ova ⁇ an vein syndrome, amenonhea, hirutism, and ovarian cancer (including, but not limited to, primary and secondary cancerous growth, Sertoh-Leydig tumors, endometnod carcinoma of the ovary, ovarian papillary serous adenocarcinoma, ovarian mucinous adenocarcinoma, and Ovarian Krukenberg tumors)
- Cervical diseases and/or disorders include cervicitis, chronic cervicitis, mucopurulent cervicitis, cervical dysplasia, cervical polyps, Nabothian cysts, cervical erosion, cervical incompetence, and cervical neoplasms (including, for example, cervical carcinoma, squamous metaplasia, squamous cell carcinoma, adenosquamous cell neoplasia, and columnar cell neoplasia)
- diseases and/or disorders of the reproductive system include disorders and/or diseases of pregnancy, including misca age and stillbirth, such as early abortion, late abortion, spontaneous abortion, induced abortion, therapeutic abortion, threatened abortion, missed abortion, incomplete abortion, complete abortion, habitual abortion, missed abortion, and septic abortion, ectopic pregnancy, anemia, Rh incompatibility, vaginal bleeding during pregnancy, gestational diabetes, lntraute ⁇ ne growth retardation, polyhydrammos, HELLP syndrome, abruptio placentae, placenta previa, hyperemesis, preeclampsia, eclampsia, he ⁇ es gestatio s, and urticaria of pregnancy
- the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may be used m the diagnosis, treatment, and/or prevention of diseases that can complicate pregnancy, including heart disease, heart failure, rheumatic heart disease, congenital heart disease,
- Complications associated with labor and parturition include premature rupture of the membranes, pre-term labor, post-term pregnancy, postmatu ⁇ ty, labor that progresses too slowly, fetal distress (e g , abnormal heart rate (fetal or maternal), breathing problems, and abnormal fetal position), shoulder dystocia, prolapsed umbilical cord, amniotic fluid embolism, and abenant uterine bleeding
- diseases and/or disorders of the postdehvery period including endomet ⁇ tis, myomet ⁇ tis, paramet ⁇ tis, pe ⁇ tonitis, pelvic thrombophlebitis, pulmonary embolism, endotoxemia, pyeloneph ⁇ tis, saphenous thrombophlebitis, mastitis, cystitis, postpartum hemonhage, and inverted uterus
- albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention can be used to treat or detect infectious agents
- infectious agents For example, by increasing the immune response, particularly increasing the proliferation and differentiation of B and/or T cells, infectious diseases may be treated The immune response may be increased by either enhancing an existing immune response, or by initiating a new immune response Alternatively, fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of
- viruses are one example of an infectious agent that can cause disease or symptoms that can be treated or detected by albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention
- viruses include, but are not limited to Examples of viruses, include, but are not limited to the following DNA and RNA viruses and viral families Arbovirus, Adenovi ⁇ dae, Arenavi ⁇ dae, Artenvirus, Birnavi ⁇ dae, Bunyavi ⁇ dae, Calicivi ⁇ dae, Circovi ⁇ dae, Coronavi ⁇ dae, Dengue, EBV, HIV, Flavivindae, Hepadnavi ⁇ dae (Hepatitis), He ⁇ esvi ⁇ dae (such as, Cytomegalovirus, He ⁇ es Simplex, He ⁇ es Zoster), Mononegavirus (e g , Paramyxovindae, Morbillivirus, Rhabdovi ⁇ dae), Orthomyxovindae
- bacterial and fungal agents that can cause disease or symptoms and that can be treated or detected by albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but not limited to, the following Gram-Negative and Gram-positive bacteria, bacterial families, and fungi Actinomyces (e g , Norcardia), Acinetobacter, Cryptococcus neoformans, Aspergillus, Bacillaceae (e g , Bacillus anthrasis), Bacteroides (e g , Bacteroides fragihs), Blastomycosis, Bordetella, Boneha (e g , Borreha burgdorferi), Brucella, Candidia, Campylobacter, Chlamydia, Clost ⁇ dium (e g , Clostridium botulinum, Clostridium perfringens, Clostridium t
- Salmonella typhi Senatia, Yersinia, Shigella), Erysipeloth ⁇ x, Haemophilus (e g , Haemophilus influenza type B), Hehcobacter, Legionella (e g , Legionella pneumophila), Leptospira, Liste ⁇ a (e g , Listeria monocytogenes), Mycoplasma, Mycobacte ⁇ um (e g , Mycobaclerium leprae and Mycobaclerium tuberculosis), Vibrio (e g , Vibrio cholerae), Neisse ⁇ aceae (e g , Neissena gonorrhea, Neissena memngitidis), Pasteurellacea, Proteus, Pseudomonas (e g , Pseudomonas aeruginosa), Rickettsiaceae, Spirochetes (e g , Treponema spp ,
- parasitic agents causing disease or symptoms that can be treated, prevented, and/or diagnosed by fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention include, but not limited to, the following families or class Amebiasis, Babesiosis, Coccidiosis, Cryptospo ⁇ diosis, Dientamoebiasis, Dou ⁇ ne, Ectoparasitic, Giardias, Helminthiasis, Leishmaniasis, Schistisoma, Theile ⁇ asis, Toxoplasmosis, Trypanosomiasis, and Tnchomonas and Sporozoans (e g , Plasmodium virax, Plasmodium falciparium, Plasmodium malariae and Plasmodium ovale) These parasites can cause a vanety of diseases or symptoms, including, but not limited to Scabies, Trombicu asis, eye infections, intestinal disease (e g , dysent
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention could either be by administenng an effective amount of an albumin fusion protein of the invention to the patient, or by removing cells from the patient, supplying the cells with a polynucleotide of the present invention, and returning the engineered cells to the patient (ex vivo therapy) Moreover, the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention can be used as an antigen in a vaccine to raise an immune response against infectious disease Regeneration [0801] Albumin fusion proteins of the invention and or polynucleotides encoding albumin fusion proteins of the invention can be used to differentiate, proliferate, and attract cells, leading to the regeneration of tissues (See, Science 276 59-87 (1997)) The regeneration of tissues could be used to repair, replace, or protect tissue damaged by congenital defects, trauma (wounds, burns, incisions
- Tissues that could be regenerated using the present invention include organs (e g , pancreas, liver, intestine, kidney, skin, endothe um), muscle (smooth, skeletal or cardiac), vasculature (including vascular and lymphatics), nervous, hematopoietic, and skeletal (bone, cartilage, tendon, and ligament) tissue
- organs e g , pancreas, liver, intestine, kidney, skin, endothe um
- muscle smooth, skeletal or cardiac
- vasculature including vascular and lymphatics
- nervous hematopoietic
- hematopoietic and skeletal (bone, cartilage, tendon, and ligament) tissue
- regeneration occurs without or decreased scamng Regeneration
- angiogenesis e.g vascular and lymphatics
- nerve and brain tissue could also be regenerated by using fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention, to proliferate and differentiate nerve cells Diseases that could be treated using this method include central and peripheral nervous system diseases, neuropathies, or mechanical and traumatic disorders (e g , spinal cord disorders, head trauma, cerebrovascular disease, and stoke) Specifically, diseases associated with peripheral nerve inju ⁇ es, peripheral neuropathy (e g , resulting from chemotherapy or other medical therapies), localized neuropathies, and central nervous system diseases (e g , Alzheimer's disease, Parkinson's disease, Huntmgton's disease, amyotrophic lateral sclerosis, and Shy-Drager syndrome), could all be treated using the albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention Gastrointestinal Disorders [0805] Albumin fusion proteins of the invention and/or polynucleot
- Gastrointestinal disorders include dysphagia, odynophagia, inflammation of the esophagus, peptic esophagitis, gastric reflux, submucosal fibrosis and st ⁇ cturing, Mallory-Weiss lesions, leiomyomas, hpomas, epidermal cancers, adeoncarcinomas, gast ⁇ c retention disorders, gastroenteritis, gastric atrophy, gastric/stomach cancers, polyps of the stomach, autoimmune disorders such as pernicious anemia, pylonc stenosis, gastritis (bacterial, viral, eosinophihc, stress-induced, chronic erosive, atrophic, plasma cell, and Menet ⁇ er's), and peritoneal diseases (e g , chylope ⁇ oneum, hemope ⁇ toneum, mesente ⁇ c cyst, mesente ⁇ c lymphadenitis, mesente ⁇ c vascular occlusion,
- Gastrointestinal disorders also include disorders associated with the small intestine, such as malabso ⁇ tion syndromes, distension, lnitable bowel syndrome, sugar intolerance, cehac disease, duodenal ulcers, duodenitis, tropical sprue, Whipple's disease, intestinal lymphangiectasia, Crohn's disease, appendicitis, obstructions of the lleum, Meckel's diverticulum, multiple diverticula, failure of complete rotation of the small and large intestine, lymphoma, and bactenal and parasitic diseases (such as Traveler's dianhea, typhoid and paratyphoid, cholera, infection by Roundworms (Ascariasis lumbricoides), Hookworms (Ancylostoma duodenale). Threadworms (Enterobius vermicularis), Tapeworms (Taema saginata, Echmococcus granulos
- Liver diseases and/or disorders include lntrahepatic cholestasis (alagille syndrome, biliary liver cinhosis), fatty liver (alcoholic fatty liver, reye syndrome), hepatic vein thrombosis, hepatolent ⁇ cular degeneration, hepatomegaly, hepatopulmonary syndrome, hepatorenal syndrome, portal hypertension (esophageal and gastric vances), liver abscess (amebic liver abscess), liver cinhosis (alcoholic, biliary and expe ⁇ mental), alcoholic liver diseases (fatty liver, hepatitis, cinhosis), parasitic (hepatic echinococcosis, fasciohasis, amebic liver abscess), jaundice (hemolytic, hepatocellular, and cholestatic), cholestasis, portal hypertension, liver enlargement, ascites, hepatitis (alcoholic hepatitis, animal he
- Pancreatic diseases and/or disorders include acute pancreatitis, chronic pancreatitis (acute necrotizing pancreatitis, alcoholic pancreatitis), neoplasms (adenocarcinoma of the pancreas, cystadenocarcmoma, lnsu noma, gast ⁇ noma, and glucagonoma, cystic neoplasms, islet- cell tumors, pancreoblastoma), and other pancreatic diseases (e g , cystic fibrosis, cyst (pancreatic pseudocyst, pancreatic fistula, insufficiency))
- Gallbladder diseases include gallstones (cholelithiasis and choledocho thiasis), postcholecystectomy syndrome, diverticulosis of the gallbladder, acute cholecystitis, chronic cholecystitis, bile duct tumors, and muco
- Diseases and/or disorders of the large intestine include antibiotic-associated colitis, diverticulitis, ulcerative colitis, acquired megacolon, abscesses, fungal and bacterial infections, anorectal disorders (e g , fissures, hemonhoids), colonic diseases (colitis, colonic neoplasms [colon cancer, adenomatous colon polyps (e g , villous adenoma), colon carcinoma, colorectal cancer], colonic diverticulitis, colonic diverticulosis, megacolon [Hirschsprung disease, toxic megacolon], sigmoid diseases [proctocohtis, sigmoin neoplasms]), constipation, Crohn's disease, dianhea (infantile dianhea, dysentery), duodenal diseases (duodenal neoplasms, duodenal obstruction, duodenal ulcer, duodenitis), enteritis (enterocohtis), HIV
- Albumin fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins of the invention may increase chemotaxic activity of particular cells
- chemotactic molecules can then be used to treat inflammation, infection, hype ⁇ roliferative disorders, or any immune system disorder by increasing the number of cells targeted to a particular location in the body
- chemotaxic molecules can be used to treat wounds and other trauma to tissues by attracting immune cells to the injured location
- Chemotactic molecules of the present invention can also attract fibroblasts, which can be used to treat wounds
- fusion proteins ofthe invention and/or polynucleotides encoding albumin fusion proteins of the invention may inhibit chemotactic activity These molecules could also be used to treat disorders
- fusion proteins of the invention and/or polynucleotides encoding albumin fusion proteins ofthe invention could be used as an inhibitor of chemotaxis Binding Activity
- Albumin fusion proteins of the invention may be used to screen for molecules that bind to the Therapeutic protein portion of the fusion protein or for molecules to which the Therapeutic protein portion of the fusion protein binds The binding of the fusion protein and the molecule may activate (agonist), increase, inhibit (antagonist), or decrease activity of the fusion protein or the molecule bound Examples of such molecules include antibodies, oligonucleotides, proteins (e g , receptors), or small molecules
- the molecule is closely related to the natural ligand of the Therapeutic protein portion of the fusion protein of the invention, e g , a fragment of the ligand, or a natural substrate, a ligand, a structural or functional mimetic (See, Cohgan et al , Cunent Protocols in Immunology 1(2) Chapter 5 (1991))
- the molecule can be closely related to the natural receptor to which the Therapeutic protein portion of an albumin fusion protein of the invention binds, or at least, a fragment of the receptor capable of being bound by the Therapeutic protein portion of an albumin fusion protein ofthe invention (e g , active site)
- the molecule can be rationally designed using known techniques ⁇ 0818]
- the screening for these molecules involves producing appropriate cells which express the albumin fusion proteins of the invention
- Prefened cells include cells from mammals, yeast, Drosophila, or E coli
- the assay may simply test binding of a candidate compound to an albumin fusion protein o the invention, wherein binding is detected by a label, or in an assay involving competition with a labeled competitor Further, the assay may test whether the candidate compound results in a signal generated by binding to the fusion protein
- the assay can be earned out using cell-free preparations, fusion protein/molecule affixed to a solid support, chemical libraries, or natural product mixtures
- the assay may also simply comprise the steps of mixing a candidate compound with a solution containing an albumin fusion protein, measuring fusion protem/molecule activity or binding, and comparing the fusion protein/molecule activity or binding to a standard
- an ELISA assay can measure fusion protein level or activity in a sample (e g , biological sample) using a monoclonal or polyclonal antibody
- the antibody can measure fusion protein level or activity by either binding, directly or indirectly, to the albumin fusion protein or by competing with the albumin fusion protein for a substrate lUSZZJ A ⁇ itionally, tne recepi ⁇ r to which a Therapeutic protein portion of an albumin fusion protein of the invention binds can be identified by numerous methods known to those of skill in the art, for example, ligand panning and FACS sorting (Cohgan, et al , Cunent Protocols in Immun , 1(2), Chapter 5, (1991))
- expression cloning may be employed wherein polyadenylated RNA is prepared from a cell responsive to the albumin fusion protein, for example, NIH3T3 cells which are known to
- a labeled albumin fusion protein can be photoaffimty linked with cell membrane or extract preparations that express the receptor molecule for the Therapeutoc protein component of an albumin fusion protein of the invention, the linked mate ⁇ al may be resolved by PAGE analysis and exposed to X-ray film
- the labeled complex containing the receptors of the fusion protein can be excised, resolved into peptide fragments, and subjected to protein microsequencing
- the amino acid sequence obtained from microsequencing would be used to design a set of degenerate oligonucleotide probes to screen a cDNA library to identify the genes encoding the putative receptors
- DNA shuffling may be employed to modulate the activities of the fusion protein, and/or Therapeutic protein portion or albumin component of an albumin fusion protein of the present invention, thereby effectively generating agonists and antagonists of an albumin fusion protein of the present invention.
- DNA shuffling may be employed to modulate the activities of the fusion protein, and/or Therapeutic protein portion or albumin component of an albumin fusion protein of the present invention, thereby effectively generating agonists and antagonists of an albumin fusion protein of the present invention.
- Other prefened fragments are biologically active fragments of the Therapeutic protein portion and/or albumin component of the albumin fusion proteins of the present invention
- Biologically active fragments are those exhibiting activity similar, but not necessa ⁇ ly identical, to an activity of a Therapeutic protein portion and/or albumin component of the albumin fusion proteins of the present invention
- the biological activity ofthe fragments may include an improved desired activity, or a decreased undesirable activity
- this invention provides a method of screening compounds to identify those which modulate the action of an albumin fusion protein of the present invention
- An example of such an assay comprises combining a mammalian fibroblast cell, an albumin fusion protein of the present invention, and the compound to be screened and [H] thymidine under cell culture conditions where the fibroblast cell would normally proliferate
- a control assay may be performed in the absence of the compound to be screened and compared to the amount of fibroblast proliferation in the presence of the compound to determine if the compound stimulates proliferation by determining the uptake of 3 [H] thymidine in each case
- the amount of fibroblast cell proliferation is measured by liquid scintillation chromatography which measures the inco ⁇ oration of [H] thymidine
- Both agonist and antagonist compounds may be identified by this procedure
- a mammalian cell or membrane preparation expressing a receptor for the Therapeutic protien component of a fusion protine of the invention is incubated with a labeled fusion protein of the present invention in the presence of the compound
- the ability of the compound to enhance or block this interaction could then be measured
- the response of a known second messenger system following interaction of a compound to be screened and the receptor is measured and the ability of the compound to bind to the receptor and elicit a second J ⁇ c messenger response is measured to determine if the compound is a potential fusion protein
- Such second messenger systems include but are not limited to, cAMP guanylate cyclase, ion channels or phosphoinositide hydrolysis
- the assays can discover agents which may inhibit or enhance the production ofthe albumm fusion proteins ofthe invention from suitably manipulated cells or tissues
- the invention includes a method of identifying compounds which bind to an albumin fusion protein of the invention comprising the steps of (a) incubating a candidate binding compound with an albumin fusion protein ofthe present invention, and (b) determining if binding has occuned Moreover, the invention includes a method of identifying agonists/antagonists comprising the steps of (a) incubating a candidate compound with an albumin fusion protein of the present invention, (b) assaying a biological activity, and (b) determining if a biological activity ofthe fusion protein has been altered Targeted Delivery [08311 In another embodiment, the invention provides a method of delivering compositions to targeted cells expressing a receptor for a component of an albumin fusion protein ofthe invention
- fusion proteins of the invention may be associated with heterologous polypeptides, heterologous nucleic acids, toxins, or prodrugs via hydrophobic, hydrophilic, ionic and/or covalent interactions
- the invention provides a method for the specific delivery of compositions of the invention to cells by administering fusion proteins ofthe invention (including antibodies) that are associated with heterologous polypeptides or nucleic acids
- the invention provides a method for delivering a Therapeutic protein into the targeted cell
- the invention provides a method for dehve ⁇ ng a single stranded nucleic acid (e g , antisense or ⁇ bozymes) or double stranded nucleic acid (e g , DNA that can integrate into the cell's genome or replicate episomally and that can be transcribed) into the targeted cell
- the invention provides a method for the specific destruction of cells (e g , the destruction of tumor cells) by administe ⁇ ng an albumin fusion protein of the invention (e g , polypeptides of the invention or antibodies of the invention) in association with toxins or cytotoxic prodrugs
- toxin compounds that bind and activate endogenous cytotoxic effector systems, radioisotopes, holotoxins, modified toxins, catalytic subunits of toxins, or any molecules or enzymes not normally present in or on the surface of a cell that under defined conditions cause the cell's death
- Toxins that may be used according to the methods of the invention include, but are not limited to, radioisotopes known in the art, compounds such as, for example, antibodies (or complement fixing containing portions thereof) that bind an inherent or induced endogenous cytotoxic effector system, thymidine kinase, endonuclease, RNAse, alpha toxin, ricin, ab ⁇ n, Pseudomonas exotoxin A, diphtheria toxin, sapo ⁇ n, momordin, gelonin, pokeweed antiviral protein, alpha-sarcin and cholera toxin
- cytotoxic prodrug is
- This invention is particularly useful for screening therapeutic compounds by using the albumin fusion proteins of the present invention, or binding fragments thereof, in any of a variety of drug screening techniques
- the albumin fusion protein employed in such a test may be affixed to a solid support, expressed on a cell surface, free in solution, or located intracellulariy
- One method of drug screening utilizes eukaryotic or prokaryotic host cells which are stably transformed with recombinant nucleic acids expressing the albumin fusion protein Drugs are screened against such transformed cells or supematants obtained from cultu ⁇ ng such cells, in competitive binding assays
- One may measure, for example, the formulation of complexes between the agent being tested and an albumin fusion protein ofthe present invention
- the present invention provides methods of screening for drugs or any other agents which affect activities mediated by the albumin fusion proteins of the present invention
- methods comprise contacting such an agent with an albumin fusion protein of the present invention or a fragment thereof and assaying for the presence of a complex between the agent and the albumin fusion protein or a fragment thereof, by methods well known in the art
- the agents to screen are typically labeled Following incubation, free agent is separated from that present in bound form, and the amount of free or uncomplexed label is a measure of the ability of a particular agent to bind to the albumin fusion protein ofthe present invention
- Another technique for drug screening provides high throughput screening for compounds having suitable binding affinity to an albumin fusion protein of the present invention, and is described in great detail in European Patent Application 84/03564, published on September 13, 1984, which is incorporated herein by reference herein B ⁇ efly stated, large numbers of different small peptide test compounds are synthesized on a solid substrate, such as plastic pins or some other surface The peptide test compounds are reacted with an albumin fusion protein ofthe present invention and washed Bound peptides are then detected by methods well known in the art Purified albumin fusion protein may be coated directly onto plates for use in the aforementioned drug screening techniques In addition, non-neutralizing antibodies may be used to capture the peptide and immobilize it on the solid support
- This invention also contemplates the use of competitive drug screening assays in which neutralizing antibodies capable of binding an albumin fusion protein of the present invention specifically compete with a test compound for binding to the albumin fusion protein or fragments thereof In this manner, the antibodies are used to detect the presence of any peptide which shares one or more antigenic epitopes with an albumin fusion protein ofthe invention Binding Peptides and Other Molecules
- the invention also encompasses screening methods for identifying polypeptides and nonpolypeptides that bind albumin fusion proteins of the invention, and the binding molecules identified thereby These binding molecules are useful, for example, as agonists and antagonists of the albumin fusion proteins of the invention Such agonists and antagonists can be used, in accordance with the invention, in the therapeutic embodiments described in detail, below
- This method compnses the steps of contacting an albumin fusion protein of the invention with a plurality of molecules, and identifying a molecule that binds the albumin fusion protein
- the step of contacting the albumin fusion protein of the invention with the plurality of molecules may be effected in a number of ways
- Such a procedure would be akin to an affinity chromatographic process, with the affinity matrix being comprised of the immobilized albumin fusion protein of the invention
- the molecules having a selective affinity for the albumin fusion protein can then be purified by affinity selection
- affinity selection The nature of the solid support, process for attachment of the albumin fusion protein to the solid support, solvent, and conditions ofthe affinity isolation or selection are largely conventional and well known to those of ordinary skill in the art
- one may also separate a plurality of polypeptides into substantially separate fractions compnsing a subset of or individual polypeptides For instance, one can separate the plurality of polypeptides by gel electrophoresis, column chromat
- Peptoid hbranes can be adapted for use Peptoid hbranes (Simon et al , Proc Natl Acad Sci USA 89 9367-9371 (1992)) can also be used Another example of a library that can be used, in which the amide functionalities in peptides have been permethylated to generate a chemically transformed combinatorial library, is described by Ostresh et al (Proc Natl Acad Sci USA 91 11 138-11142 (1994))
- Non-peptide libraries can be classified broadly into two types decorated monomers and oligomers Decorated monomer libraries employ a relatively simple scaffold structure upon which a variety functional groups is added Often the scaffold will be a molecule with a known useful pharmacological activity For example, the scaffold might be the benzodiazepme structure
- Non-peptide oligomer libraries utilize a large number of monomers that are assembled together in ways that create new shapes that depend on the order of the monomers Among the monomer units that have been used are carbamates, pynohnones, and mo ⁇ ho nos Peptoids, peptide-like oligomers in which the side chain is attached to the alpha amino group rather than the alpha carbon, form the basis of another version of non-peptide oligomer libra ⁇ es
- the first non-peptide oligomer libraries utilized a single type of monomer and thus contained a repeating backbone
- Screening the libra ⁇ es can be accomplished by any of a vanety of commonly known methods See, e g , the following references, which disclose screening of peptide libraries Parmley et al , Adv Exp Med Biol 251 215-218 (1989), Scott et al, Science 249 386-390 (1990), Fowlkes et al , BioTechmques 13 422-427 (1992), Oldenburg et al , Proc Natl Acad Sci USA 89 5393-5397 (1992), Yu et al , Cell 76 933-945 (1994),
- screening to identify a molecule that binds an albumin fusion protein of the invention can be earned out by contacting the library members with an albumin fusion protein of the invention immobilized on a solid phase and harvesting those library members that bind to the albumin fusion protein Examples of such screening methods, termed "panning" techniques are described by way of example in
- the binding molecule is a polypeptide
- the polypeptide can be conveniently selected from any peptide library, including random peptide libraries, combinatorial peptide libraries, or biased peptide libraries
- bias is used herein to mean that the method of generating the library is manipulated so as to restrict one or more parameters that govern the diversity of the resulting collection of molecules, in this case peptides
- a truly random peptide library would generate a collection of peptides in which the probability of finding a particular ammo acid at a given position of the peptide is the same for all 20 ammo acids
- a bias can be introduced into the library, however, by specifying, for example, that a lysine occur every fifth amino acid or that positions 4, 8, and 9 of a decapeptide library be fixed to include only arginine
- biases can be contemplated, and the present invention is not restricted to any particular bias
- the present invention contemplates specific types of peptide libraries, such as phage displayed peptide libraries and those that utilize a DNA construct comprising a lambda phage vector with a DNA insert
- the polypeptide may have about 6 to less than about 60 amino acid residues, preferably about 6 to about 10 amino acid residues, and most preferably, about 6 to about 22 amino acids In another embodiment, a binding polypeptide has in the range of 15-100 amino acids, or 20-50 ammo acids
- the selected binding polypeptide can be obtained by chemical synthesis or recombinant expression Other Activities 10859]
- An albumin fusion protein ofthe invention and/or polynucleotide encoding an albumin fusion protein ofthe invention may be employed in treatment for stimulating re-vascula ⁇ zation of ischemic tissues due to va ⁇ ous disease conditions such as thrombosis, arteriosclerosis, and other cardiovascular conditions
- the albumin fusion proteins of the invention and or polynucleotides encoding albumin fusion proteins of the invention may also be employed to stimulate angiogenesis and limb regeneration, as discussed above
- An albumin fusion protein oi the invention and/or polynucleotide encoding an albumin fusion protein of the invention may also be employed for treating wounds due to injuries, bums, post-operative tissue repair, and ulcers since they are mitogenic to various cells of different o ⁇ gins, such as fibroblast cells and skeletal muscle cells, and therefore, facilitate the repair or replacement of damaged or diseased
- An albumin fusion protein of the invention and/or polynucleotide encoding an albumin fusion protein of the invention may also be employed stimulate neuronal growth and to treat and prevent neuronal damage which occurs in certain neuronal disorders or neuro-degenerative conditions such as Alzheimer's disease, Parkinson's disease, and AIDS-related complex
- An albumin fusion protein of the invention and/or polynucleotide encoding an albumin fusion protein of the invention may have the ability to stimulate chondrocyte growth, therefore, they may be employed to enhance bone and pe ⁇ odontal regeneration and aid in tissue transplants or bone grafts
- An albumin fusion protein of the invention and/or polynucleotide encoding an albumin fusion protein of the invention may be also be employed to prevent skin aging due to sunburn by stimulating keratinocyte growth
- An albumin fusion protein of the invention and/or polynucleotide encoding an albumin fusion protein of the invention may also be employed for preventing hair loss
- an albumin fusion protein of the invention and/or polynucleotide encoding an albumin fusion protein of the invention may be employed to stimulate growth and differentiation of hematopoietic cells and bone manow cells when used in combination with other cytokines
- An albumin fusion protein of the invention and/or polynucleotide encoding an albumin fusion protein of the invention may also be employed to maintain organs before transplantation or for supporting cell culture of primary tissues
- An albumin fusion protein of the invention and/or polynucleotide encoding an albumin fusion protein of the invention may also be employed for inducing tissue of mesodermal origin to differentiate in early embryos
- An albumin fusion protein of the invention and/or polynucleotide encoding an albumin fusion protein of the invention may also increase or decrease the differentiation or proliferation of embryonic stem cells, besides, as discussed above, hematopoietic lineage
- An albumin fusion protein of the invention and/or polynucleotide encoding an albumin fusion protein of the invention may also be used to modulate mammalian characte ⁇ stics, such as body height, weight, hair color, eye color, skin, percentage of adipose tissue, pigmentation, size, and shape (e g , cosmetic surgery)
- an albumin fusion protein of the invention and/or polynucleotide encoding an albumin fusion protein of the invention may be used to modulate mammalian metabolism affecting catabohsm, anabohsm, processing, utilization, and storage of energy
- An albumin fusion protein of the invention and/or polynucleotide encoding an albumin fusion protein of the invention may be used to change a mammal's mental state or physical state by influencing biorhythms, ca ⁇ cadic rhythms, depression (including depressive disorders), tendency for violence, tolerance for pain, reproductive capabilities (preferably by Activin or Inhibm-hke activity), hormonal or endocrine levels, appetite, libido, memory, stress, or other cognitive qualities
- An albumin fusion protein of the invention and/or polynucleotide encoding an albumin fusion protein of the invention may also be used as a food additive or preservative, such as to increase or decrease storage capabilities, fat content, lipid, protein, carbohydrate, vitamins, minerals, cofactors or other nutntional components
- hosts include, but are not limited to, human, murine, rabbit, goat, guinea pig, camel, horse, mouse, rat, hamster, pig, micro-pig, chicken, goat, cow, sheep, dog, cat, non-human primate, and human
- the host is a mouse, rabbit, goat, guinea pig, chicken, rat, hamster, pig, sheep, dog or cat
- the host is a mammal
- the host is a human
- EXAMPLE 1 Generation of pScNHSA and pScCHSA.
- the vectors pScNHSA (ATCC Deposit No PTA-3279) and pScCHSA (ATCC Deposit No PTA-3276) are derivatives of pPPC0005 (ATCC Deposit No PTA-3278) and are used as cloning vectors into which polynucleotides encoding a therapeutic protein or fragment or va ⁇ ant thereof is inserted adjacent to and in translation frame with polynucleotides encoding human serum albumin "HSA" pScCHSA may be used for generating Therapeutic protein-HSA fusions, while pScNHSA may be used to generate HSA-Therapeutic protein fusions Generation ofpScCHSA albumin fusion with the albumin moiety C-terminal to the therapeutic portion ]0873]
- a vector to facilitate cloning DNA encoding a Therapeutic protein N-terminal to DNA encoding the mature albumin protein was made by altering the nucleic acid sequence that encodes the chimeric HSA signal peptide in pPPC000
- the Xho I and Cla I restriction sites were engineered into the nucleic acid sequence that encodes the signal peptide of HSA (a chimera of the HSA leader and a kex2 site from mating factor alpha, "MAF") in pPPCOOO ⁇ using two rounds of PCR
- amplification with p ⁇ mers shown as SEQ ID NO 36 and SEQ ID NO 37 was performed
- the p ⁇ mer whose sequence is shown as SEQ ID NO 36 comprises a nucleic acid sequence that encodes part of the signal peptide sequence of HSA, a kex2 site from the mating factor alpha leader sequence, and part of the amino-terminus of the mature form of HSA
- Four point mutations were introduced in the sequence, creating the ⁇ 7 ⁇ o I and
- the vectors pScNHSA and pScCHSA may be used as cloning vectors into which polynucleotides encoding a therapeutic protein or fragment or variant thereof is inserted adjacent to polynucleotides encoding mature human serum albumin "HSA" pScCHSA is used for generating Therapeutic protem-HSA fusions, while pScNHSA may be used to generate HSA-Therapeutic protein fusions Generation of albumin fusion constructs comprising HSA-Therapeuttc protein fusion products [0878] DNA encoding a Therapeutic protein (e g , sequences shown in SEQ ID NO X or known in the art) may be PCR amplified using the primers which facilitate the generation of a fusion construct (e g , by adding restriction sites, encoding seamless fusions, encoding linker sequences, etc ) For example, one skilled in the art could design a 5' primer that adds polynucleotides encoding
- DNA encoding a Therapeutic protein may be PCR amplified using the following primers A 5' p ⁇ mer that adds polynucleotides containing a Sal] site and encoding the last three amino acids of the HSA leader sequence, DKR, onto the 5' end of
- DNA encoding a Therapeutic protein and a 3' p ⁇ mer that adds polynucleotides encoding the first few amino acids of the mature HSA containing a Cla I site onto the 3' end of DNA encoding a Therapeutic protein
- the forward p ⁇ mer used to amplify the DNA encoding a Therapeutic protein might have the sequence, 5'-aggagcgtcGACAAAAGA(N), 5 -3' (SEQ ID NO 46) where the underlined sequence is a Sal I site, the upper case nucleotides encode the last three amino acids of the HSA leader sequence (DKR), and (N), 5 is identical to the first 15 nucleotides encoding the Therapetic protein of interest
- the reverse primer used to amplify the DNA encoding a Therapeutic protein might have the sequence, S'-CTTTAA ⁇ rCG ⁇ 7GAGCAACCTCACTCTTGTGTGCATCfN1»-3'(SEO ID NO 47) where the italicized sequence is
- An expression vector compatible with yeast expression can be transformed into yeast S cerevisiae by lithium acetate transformation, electroporation, or other methods known in the art and or as described in part in Sambrook, F ⁇ tsch, and Mamatis 1989 "Molecular Cloning A Laboratory Manual, 2 nd edition", volumes 1-3, and in Ausubel et al 2000 Massachusetts General Hospital and Harvard Medical School “Cunent Protocols in Molecular Biology", volumes 1-4
- the expression vectors are introduced into S cerevisiae strains DXY1, D88, or BXP10 by transformation, individual transformants can be grown, for example, for 3 days at 30°C in 10 mL YEPD (1% w/v yeast extract, 2 % w/v, peptone, 2 % w/v, dextrose), and cells can be collected at stationary phase after 60 hours of growth Supematants are collected by clanfying cells at 3000g for 10 minutes
- pSAC35 (Sleep et al , 1990, Biotechnology 8 42 and see Figure 3) comprises, in addition to the LEU2 selectable marker, the entire yeast 2 ⁇ m plasmid to provide replication functions, the PRB1 promoter, and the ADH1 termination signal
- EXAMPLE 4 General Purification of an Albumin Fusion Protein Expressed from an Albumin Fusion in Yeast S. cerevisiae.
- albumin fusion proteins of the invention comprise the mature form of HSA fused to either the N- or C- terminus of the mature form of a therapeutic protein or portions thereof (e g , the mature form of a therapeutic protein listed in Table 1, or the mature form of a therapeutic protein shown in Table 2 as SEQ ID NO Z)
- albumin fusion proteins of the invention further comprise a signal sequence which directs the nascent fusion polypeptide in the secretory pathways of the host used for expression
- the signal peptide encoded by the signal sequence is removed, and the mature albumin fusion protein is secreted directly into the culture medium
- Albumin fusion proteins of the invention preferably comprise heterologous signal sequences (e g , the non-native signal sequence of a particular therapeutic protein) including, but not limited to, MAF, INV, Ig, Fibuhn B, Clustenn, Insulin-Like Growth Factor Binding Protein 4, variant HSA leader
- Albumin fusion proteins expressed in yeast as descnbed above can be purified on a small-scale over a Dyax peptide affinity column as follows Supematants from yeast expressing an albumin fusion protein is diafiltrated against 3 mM phosphate buffer pH 6 2, 20 mM NaCI and 0 01% Tween 20 to reduce the volume and to remove the pigments The solution is then filtered through a 0 22 ⁇ m device The filtrate is loaded onto a Dyax peptide affinity column The column is eluted with 100 mM T ⁇ s/HCl, pH 8 2 buffer The peak fractions containing protein are collected and analyzed on SDS-PAGE after concentrating 5-fold
- Albumin fusion constructs can be generated in expression vectors for use in mammalian cell culture systems
- DNA encoding a therapeutic protein can be cloned N-terminus or C-terminus to HSA in a mammalian expression vector by standard methods known in the art (e g , PCR amplification, restriction digestion, and hgation)
- transfection into a mammalian expression system can proceed Suitable vectors are known in the art including, but not limited to, for example, the pC4 vector, and/or vectors available from Lonza Biologies, Inc (Portsmouth, NH)
- DHFR DiHydroFolate Reductase
- the pC4 HSA vector is suitable for expression of albumin fusion proteins in CHO cells
- a fragment comprising, or alternatively consisting, of DNA which encodes for a mature albumm fusion protein may be subcloned into another expression vector including, but not limited to, any of the mammalian expression vectors described herein
- DNA encoding an albumin fusion construct is subcloned into vectors provided by Lonza Biologies, Inc (Portsmouth, NH) by procedures known in the art for expression in NS0 cells
- Generation of albumin fusion constructs comprising HSA-Therapeutw Protein fusion products [0891] Using pC4 HSA (ATCC Deposit # PTA-3277), albumin fusion constructs can be generated in which the Therapeutic protein portion is C terminal to the mature albumin sequence
- pC4 HSA ATCC Deposit # PTA-3277
- albumin fusion constructs can be generated in which the Therapeutic protein portion is C terminal to the mature albumin sequence
- one can clone DNA encoding a Therapeutic protein of fragment or variant thereof between the Bsu 361 and Asc I restriction sites of the vector When cloning into the Bsu 361 and Asc I, the same primer design used to clone into the yeast vector system (SEQ ID NO 42 and 43) may be employed (see Example 2)
- the native albumin leader sequence can be replaced with the chimeric albumin leader, I e , the HSA-kex2 signal peptide, or an alternative leader by standard methods known in the art (For example, one skilled in the art could routinely PCR amplify an alternate leader and subclone the PCR product into an albumin fusion construct in place of the albumin leader while maintaining the reading frame)
- EXAMPLE 6 General Expression in Mammalian Cell-Lines.
- An albumin fusion construct generated in an expression vector compatible with expression in mammalian cell-lines can be transfected into appropriate cell-lines by calcium phosphate precipitation, hpofectamine, electroporation, or other transfection methods known in the art and/or as described in Sambrook, Fntsch, and Ma atis 1989 "Molecular Cloning A Laboratory Manual, 2 nd edition” and in Ausubel et al 2000 Massachusetts General Hospital and Harvard Medical School “Cunent Protocols in Molecular Biology", volumes 1-4
- the transfected cells are then seiecte ⁇ tor Dy tne presence oi a seie ung agent determined by the selectable marker in the expression vector
- the pC4 expression vector (ATCC Accession No 209646) is a derivative of the plasmid pSV2-DHFR (ATCC Accession No 37146) pC4 contains the strong promoter Long Terminal Repeats "LTR" of the Rous Sarcoma Virus (Cullen et al , March 1985, Molecular and Cellular Biology, 438-447) and a fragment of the CytoMegaloVirus "CMV"-enhancer (Boshart et al , 1985, Cell 41 521-530) The vector also contains the 3' intron, the polyadenylation and termination signal of the rat preproinsuhn gene, and the mouse DHFR gene under control of the SV40 early promoter Chinese hamster ovary "CHO" cells or other cell-lines lacking an active DHFR gene are used for transfection Transfection of an albumin fusion construct in pC4 into CHO cells by methods known in the art will allow for the expression of the albumin fusion protein in CHO cells
- the pEE12 1 expression vector is provided by Lonza Biologies, Inc (Portsmouth, NH) and is a derivative of pEE6 (Stephens and Cockett, 1989, Nucl Acids Res 17 7110)
- This vector comprises a promoter, enhancer and complete 5 '-untranslated region of the Major Immediate Early gene of the human CytoMegaloVirus, "hCMV-MIE" (International Publication # WO89/01036), upstream of a sequence of interest, and a Glutamine Synthetase gene (Mu ⁇ hy et al , 1991, Biochem J 227 277-279, Bebbington et al , 1992, Bio/Technology 10 169-175, US patent US 5,122,464) for pu ⁇ oses of selection of transfected cells in selective methionine sulphoximine containing medium Transfection of albumin fusion constructs made in pEE12 1 into NS0 cells (International Publication # WO86/
- albumin fusion protein may be analyzed, for example, by SDS-PAGE and Western blot, reversed phase HPLC analysis, or other methods known in the art
- Stable CHO and NS0 cell-lines transfected with albumin fusion constructs are generated by methods known in the art (e g , hpofectami ⁇ e transfection) and selected, for example, with 100 nM methotrexate for vectors having the DiHydroFolate Reductase 'DHFR' gene as a selectable marker or through growth in the absence of glutamine Expression levels can be examined for example, by immunoblotting, p ⁇ ma ⁇ ly, with an anti-HSA serum as the primary antibody, or, secondarily, with serum containing antibodies directed to the Therapeutic protein portion of a given albumin fusion protein as the primary antibody
- Expression levels are examined by immunoblot detection with anti-HSA serum as the primary antibody
- the specific productivity rates are determined via ELISA in which the capture antibody can be a monoclonal antibody towards the therapeutic protein portion ofthe albumin fusion and the detecting antibody can be the monoclonal anti-HSA-biotinylated antibody (or vice versa), followed by horseradish peroxidase/streptavidin binding and analysis according to the manufacturer's protocol
- EXAMPLE 7 Expression of an Albumin Fusion Protein in Mammalian Cells.
- the albumin fusion proteins of the present invention can be expressed in a mammalian cell
- a typical mammalian expression vector contains a promoter element, which mediates the initiation of transcription of mRNA, a protein coding sequence, and signals required for the termination of transcription and polyadenylation of the transcript
- Additional elements include enhancers, Kozak sequences and intervening sequences flanked by donor and acceptor sites for RNA splicing
- Highly efficient transcription is achieved with the early and late promoters from SV40, the long terminal repeats (LTRs) from Retroviruses, e g , RSV, HTLVI, HIVI and the early promoter of the cytomegalovirus (CMV)
- cellular elements can also be used (e g , the human actin promoter)
- Suitable expression vectors for use in practicing the present invention include, for example, vectors such as, pSVL and pMSG (Pharmacia, Uppsala, Sweden), pRSVcat (ATCC 37152), pSV2dhfr (ATCC 37146), pBC12MI (ATCC 67109), pCMVSport 2 0, and pCMVSport 3 0
- Mammalian host cells that could be used include, but are not limited to, human Hela, 293, H9 and Jurkat cells, mouse NIH3T3 and C127 cells, Cos 1, Cos 7 and CVI, quail QC1-3 cells, mouse L cells and Chinese hamster ovary (CHO) cells
- the albumin fusion protein can be expressed in stable cell lines containing the polynucleotide encoding the albumin fusion protein integrated into a chromosome
- a selectable marker such as DHFR, gpt, neomycin, or hygromycin allows the identification and isolation of the transfected cells
- the transfected polynucleotide encoding the fusion protein can also be amplified to express large amounts of the encoded fusion protein
- the DHFR (dihydrofolate reductase) marker is useful in developing cell lines that cany several hundred or even several thousand copies of the gene of interest (See, e g , Alt et al , J Biol Chem 253 1357-1370 (1978), Hamhn et al , Biochem et Biophys Acta, 1097 107-143 (1990), Page et al , Biotechnology 9 64-68 (1991))
- Another useful selection marker is the enzyme glutamine synthase (GS) (Mu ⁇ hy et al , Biochem J 227 277-279 (1991), Bebbington et al , Bio Technology 10 169-175 (1992) Using these markers, the mammalian cells are grown in selective medium and the cells with the highest resistance are selected These cell lines contain the amplified gene(s) integrated into
- Derivatives of the plasmid pSV2-dhfr (ATCC Accession No 37146), the expression vectors pC4 (ATCC Accession No 209646) and pC6 (ATCC Accession No 209647) contain the strong promoter (LTR) of the Rous Sarcoma Virus (Cullen et al , Molecular and Cellular Biology, 438 ⁇ 147 (March, 1985)) plus a fragment of the CMV-enhancer (Boshart et al , Cell 41 521-530 (1985)) Multiple cloning sites, e g , with the restriction enzyme cleavage sites BamHI, Xbal and Asp718, facilitate the cloning of the gene of interest
- the vectors also contain the 3' intron, the polyadenylation and termination signal ofthe rat preproinsuhn gene, and the mouse DHFR gene under control ofthe SV40 early promoter
- the plasmid pC6, for example, is digested with appropriate rest ⁇ ction enzymes and then dephosphorylated using calf intestinal phosphates by procedures known in the art The vector is then isolated from a 1% agarose gel
- a polynucleotide encoding an albumin fusion protein of the present invention is generated using techniques known in the art and this polynucleotide is amplified using PCR technology known in the art If a naturally occumng signal sequence is used to produce the fusion protein of the present invention, the vector does not need a second signal peptide Alternatively, if a naturally occumng signal sequence is not used, the vector can be modified to include a heterologous signal sequence (See, e g , International Publication No WO 96/34891 )
- the amplified fragment encoding the fusion protein of the invention is isolated from a 1% agarose gel using a commercially available kit
- the amplified fragment encoding the albumin fusion protein of the invention is then digested with the same restriction enzyme and purified on a 1% agarose gel
- the isolated fragment and the dephosphorylated vector are then ligated with T4 DNA hgase E coli HB101 or XL-1
- Blue cells are then transformed and bacteria are identified that contain the fragment inserted into plasmid pC6 using, for instance, restriction enzyme analysis
- albumin fusion proteins of the invention comprise the mature form of HSA fused to either the N- or C- terminus of the mature form of a therapeutic protein or portions thereof (e g , the mature form of a therapeutic protein listed in Table 1 , or the mature form of a therapeutic protein shown in Table 2 as SEQ ID NO Z)
- albumin fusion proteins of the invention further comp ⁇ se a signal sequence which directs the nascent fusion polypeptide in the secretory pathways ofthe host used for expression
- the signal peptide encoded by the signal sequence is removed, and the mature albumin fusion protein is secreted directly into the culture medium
- Albumin fusion proteins of the invention preferably comp ⁇ se heterologous signal sequences (e g , the non-native signal sequence of a particular therapeutic protein) including, but not limited to, MAF, INV, Ig, Fibuhn B, Clustenn, Insulin-Like Growth Factor Bind
- Albumin fusion proteins from mammalian cell-line supematants are purified according to different protocols depending on the expression system used Purification from CHO and 293T cell-lines
- Purification of an albumin fusion protein from CHO cell supernatant or from transiently transfected 293T cell supernatant may involve initial capture with an anionic HQ resin using a sodium phosphate buffer and a phosphate gradient elution, followed by affinity chromatography on a Blue Sepharose FF column using a salt gradient elution Blue Sepharose FF removes the main BSA/fetuin contaminants Further purification over the Poros PI 50 resin with a phosphate gradient may remove and lower endotoxin contamination as well as concentrate the albumin fusion protein Purification from NSO cell-line [0914
- Purification of an albumin-fusion protein from NSO cell supernatant may involve Q-Sepharose amon exchange chromatography, followed by SP-sepharose punfication with
- a polynucleotide encoding an albumin fusion protein of the present invention comprising a bacterial signal sequence is amplified using PCR oligonucleotide primers conesponding to the 5' and 3' ends of the DNA sequence, to synthesize insertion fragments
- the primers used to amplify the polynucleotide encoding insert should preferably contain restriction sites, such as BamHI and Xbal, at the 5' end ofthe p ⁇ mers in order to clone the amplified product into the expression vector
- restriction sites such as BamHI and Xbal
- BamHI and Xbal conespond to the restriction enzyme sites on the bacterial expression vector pQE-9 (Qiagen, Inc , Chatsworth, CA)
- This plasmid vector encodes antibiotic resistance (Amp r ), a bacterial origin of replication (on), an IPTG-regulatable promoter/operator (P/O), a ⁇ bosome binding site (RBS
- Clones containing the desired constructs are grown overnight (O/N) in liquid culture in LB media supplemented with both Amp (100 ug/ml) and Kan (25 ug/ml)
- the O/N culture is used to inoculate a large culture at a ratio of 1 100 to 1 250
- the cells are grown to an optical density 600 (O D 60 °) of between 04 and 0 6 IPTG (Isopropyl-B-D-thiogalacto pyranoside) is then added to a final concentration of 1 mM IPTG induces by inactivating the lad repressor, clearing the P/O leading to increased gene expression
- Cells are grown for an extra 3 to 4 hours Cells are then harvested by centrifugation (20 mins at 6000Xg) The cell pellet is solubihzed in the chaotropic agent 6 Molar Guamdine HC1 or preferably in 8 M urea and concentrations greater than 0 14 M 2-mercaptoethanol by stir ⁇ ng for
- Proteins with a 6 x His tag bind to the Ni-NTA resin with high affinity and can be purified m a simple one-step procedure (for details see The
- the purified protein is then renatured by dialyzing it against phosphate-buffered saline (PBS) or 50 mM Na-acetate, pH 6 buffer plus
- PBS phosphate-buffered saline
- the protein can be successfully refolded while immobilized on the Ni-NTA column
- Exemplary conditions are as follows renature using a linear 6M-1M urea gradient in 500 mM NaCI, 20% glycerol, 20 mM T ⁇ s/HCl pH 7 4, containing protease inhibitors
- the renaturation should be performed over a period of 1 5 hours or more
- the proteins are eluted by the addition of 250 mM immidazole Immidazole is removed by a final dialyzing step against PBS or 50 mM sodium acetate pH 6 buffer plus 200 mM NaCI
- the purified protein is stored at 4°C or frozen at -80° C
- the present invention further includes an expression vector, called pHE4a (ATCC Accession
- This vector contains 1) a neomycinphosphotransferase gene as a selection marker, 2) an E coli origin of replication, 3) a T5 phage promoter sequence, 4) two lac operator sequences, 5) a Shine-Delgamo sequence, and 6) the lactose operon repressor gene (laclq)
- laclq lactose operon repressor gene
- [0923J DNA can be inserted into the pHE4a by restricting the vector with Ndel and Xbal, BamHI, Xhol, or Asp718, running the restricted product on a gel, and isolating the larger fragment (the stuffer fragment should be about 310 base pairs)
- the DNA insert is generated according to
- PCR insert is gel purified and restricted with compatible enzymes
- the insert and vector are ligated according to standard protocols
- the engineered vector may be substituted in the above protocol to express protein in a bacterial system
- EXAMPLE 10 Isolation of a Selected cDNA Clone From the Deposited Sample.
- Many of the albumin fusion constructs of the invention have been deposited with the ATCC as shown in Table 3
- the albumin fusion constructs may comprise any one of the following expression vectors the yeast S cerevisiae expression vector pSAC35, the mammalian expression vector pC4, or the mammalian expression vector pEE12 1
- vectors comprise an ampicillin resistance gene for growth in bacterial cells
- E coli strain such as Stratagene XL-1 Blue
- ATCC Deposit Number contain at least an albumin fusion construct identified in the conesponding row of Table 3
- an albumm fusion construct may be directly isolated by screening the sample of deposited plasmid DNAs using a polynucleotide probe conesponding to SEQ ID NO X for an individual construct ID number in Table 1, using methods known m the art
- a specific polynucleotide with 30-40 nucleotides may be synthesized using an Applied Biosystems DNA synthesizer according to the sequence reported
- the oligonucleotide can be labeled, for instance, with 32 P- ⁇ -ATP using T4 polynucleotide kinase and punfied according to routine methods (E g , Mamatis et al , Molecular Cloning A Laboratory Manual, Cold Spring Harbor Press, Cold Spring, NY (1982))
- RNA oligonucleotide is ligated to the 5' ends of a population of RNA presumably containing full-length gene RNA transcnpts
- a primer set containing a primer specific to the ligated RNA oligonucleotide and a primer specific to a known sequence of the gene of interest is used to PCR amplify the 5' portion of the desired full-length gene
- This amplified product may then be sequenced and used to generate the full length gene
- RNA preparation can then be treated with phosphatase if necessary to eliminate 5' phosphate groups on degraded or damaged RNA which may interfere with the later RNA hgase step
- the phosphatase should then be inactivated and the RNA treated with tobacco acid pyrophosphatase in order to remove the cap structure present at the 5' ends of messenger RNAs This reaction leaves a 5' phosphate group at the 5' end of the cap cleaved RNA which can then be ligated to an RNA oligonucleotide using T4 RNA hgase
- This modified RNA preparation is used as a template for first strand cDNA synthesis using a gene specific oligonucleotide
- the first strand synthesis reaction is used as a template for PCR amplification of the desired 5' end using a primer specific to the ligated RNA oligonucleotide and a primer specific to the known sequence of the gene of interest
- the resultant product is then sequenced and analyzed to confirm that the 5' end sequence belongs to the desired gene EXAMPLE II: Multifusion Fusions.
- the albumin fusion proteins may additionally be fused to other proteins to generate "multifusion proteins" These multifusion proteins can be used for a vanety of applications
- fusion of the albumin fusion proteins of the invention to His-tag, HA-tag, protein A, IgG domains, and maltose binding protein facilitates purification See e g, EP A 394,827, Traunecker et al , Nature 331 84-86 (1988)
- Nuclear localization signals fused to the polypeptides of the present invention can target the protein to a specific subcellular localization, while covalent heterodimer or homodimers can increase or decrease the activity of an albumin fusion protein
- the fusion of additional protein sequences to the albumin fusion proteins of the invention may further increase the solubility and/or stability of the fusion protein
- the fusion proteins described above can be made using or routinely
- the human Fc portion of the IgG molecule can be PCR amplified, using primers that span the 5' and 3' ends of the sequence descnbed below These primers also should have convenient restriction enzyme sites that will facilitate cloning into an expression vector, preferably a mammalian or yeast expression vector
- the human Fc portion can be ligated into the BamHI cloning site Note that the 3' BamHI site should be destroyed Next, the vector containing the human Fc portion is re-rest ⁇ cted with BamHI, hneanzing the vector, and a polynucleotide encoding an albumin fusion protein of the present invention (generateed and isolated using techniques known in the art), is ligated into this BamHI site Note that the polynucleotide encoding the fusion protein of the invention is cloned without a stop codon, otherwise a Fc containing fusion protein will not be produced
- the vector can be modified to include a heterologous signal sequence (See, e g , International Publication No WO 96/34891 )
- EXAMPLE 12 Production of an Antibody from an Albumin Fusion Protein.
- Hybridoma Technology Antibodies that bind the albumm fusion proteins of the present invention and portions of the albumin fusion proteins of the present invention (e g , the Therapeutic protein portion or albumin portion of the fusion protein) can be prepared by a variety of methods (See, Cunent Protocols, Chapter 2 ) As one example of such methods, a preparation of an albumin fusion protein of the invention or a portion of an albumin fusion protein of the invention is prepared and punfied to render it substantially free of natural contaminants Such a preparation is then introduced into an animal in order to produce polyclonal antisera of greater specific activity
- Monoclonal antibodies specific for an albumin fusion protein of the invention, or a portion of an albumin fusion protein ofthe invention are prepared using hybridoma technology (Kohler et al , Nature 256495 (1975), Kohler et al , Eur J Immunol 6 511 (1976), Kohler et al , Eur J Immunol 6 292 (1976), Hammerhng et al , in Monoclonal Antibodies and T-Cell Hybridomas, Elsevier, N Y , pp 563-681 (1981))
- an animal preferably a mouse
- the splenocytes of such mice are extracted and fused with a suitable myeloma cell line Any suitable myeloma cell line may be employed in accordance with the present invention, however, it is preferable to employ the parent myeloma cell
- Adipose, skeletal muscle, and liver are insulin-sensitive tissues Insulin can stimulate glucose uptake/transport into these tissues In the case of adipose and skeletal muscle, insulin initiates the signal transduction that eventually leads to the translocation of the glucose transporter 4 molecule, GLUT4, from a specialized intracellular compartment to the cell surface Once on the cell surface, GLUT4 allows for glucose uptake/transport fHl-2-Deoxyglucose Uptake
- a number of adipose and muscle related cell-lines can be used to test for glucose uptake transport activity in the absence or presence of a combination of any one or more of the therapeutic drugs listed for the treatment of diabetes mellitus
- the 3T3-L1 murine fibroblast cells and the L6 murine skeletal muscle cells can be differentiated into 3T3-L1 adipocytes and into myotubes, respectively, to serve as appropriate in vitro models for the [ 3 H]-2-deoxyglucose uptake assay (Ur
- GLP-1 induces differentiation of the rat pancreatic ductal epithelial cell-line ARIP in a time- and dose- dependent manner which is associated with an increase in Islet Duodenal Homeobox-1 (IDX-1) and insulin mRNA levels (Hui et al , 2001, Diabetes, 50(4) 785-96)
- IDX-1 increases mRNA levels ofthe GLP-1 receptor Cells Types Tested (0953) RIN-M cells
- RIN-M cells These cells are available from the Amencan Type Tissue Culture Collection (ATCC Cell Line Number CRL-2057 )
- the RIN-M cell line was de ⁇ ved from a radiation induced transplantable rat islet cell tumor The line was established from a nude mouse xenograft of the tumor
- the cells produce and secrete islet polypeptide hormones, and produce L-dopa decarboxylase (a marker for cells having amine precursor uptake and decarboxylation, or APUD, activity)
- ARIP cells These are pancreatic exocnne cells of epithelial mo ⁇ hology available from the American Type Tissue Culture Collection (ATCC Cell Line Number CRL-1674) See also, references Jessop, N W and Hay, R J , "Characteristics of two rat pancreatic exocnne cell lines derived from transplantable tumors," In Vitro 16 212, (1980), Cockell, M et al , "Identification of a cell-specific DNA-binding activity that interacts with a transcriptional activator of genes expressed in the acinar pancreas," Mol Cell Biol 9 2464-2476, (1989), Roux, E , et al "The cell-specific transcription factor PTF1 contains two different subunits that interact with the DNA” Genes Dev 3 1613-1624, (1989), and, Hui, H , et al , "Glucagon-hke peptide 1 induces differentiation of islet duodenal homeobox-1 -
- the ARIP (ATCC #CRL-1674) cell-line is grown in Ham's F12K medium (ATCC, #30-2004) with 2 mM L-glutamine adjusted to contain 1 5 g/L sodium bicarbonate and 10% fetal bovine serum
- the ARIP cell-line is subcultured at a ratio of 1 3 to 1 6 twice per week The medium is changed every 3 to 4 days Assav Protocol
- the cells are seeded at 4000 cells/well in 96-well plates and cultured for 48 to 72 hours to 50% confluence
- the cells are switched to serum-free media at 100 ⁇ L well After incubation for 48-72 hours, serum and/or the therapeutics of the subject invention (e g , albumin fusion proteins of the invention and fragments and variants thereof) are added to the well Incubation persists for an additional 36 hours [ 3 H]-Thym ⁇ d ⁇ ne (5-20 Ci/mmol) (Amersham Pharmacia, #TRK120) is diluted to 1 m
- Glycosu ⁇ a (I e , excess sugar in the urine), can be readily assayed to provide an index of the disease state of diabetes mellitus Excess unne in a patient sample as compared with a normal patient sample is symptomatic of IDDM and NIDDM Efficacy of treatment of such a patient having IDDM and NIDDM is indicated by a resulting decrease in the amount of excess glucose in the urine
- IDDM and NIDDM monitonng urine samples from patients are assayed for the presence of glucose using techniques known in the art
- Glycosu ⁇ a in humans is defined by a urinary glucose concentration exceeding 100 mg per 100 ml
- Excess sugar levels in those patients exhibiting glycosu ⁇ a can be measured even more precisely by obtaining blood samples and assaying serum glucose
- EXAMPLE 16 Assays Detecting Stimulation or Inhibition ofB cell Proliferation and Differentiation.
- a CD3- ⁇ nduced proliferation assay is performed on PBMCs and is measured by the uptake of 3 H-thym ⁇ d ⁇ ne
- the assay is performed as follows
- Ninety-six well plates are coated with 100 ⁇ l/well of mAb to CD3 (HIT3a, Pharmingen) or isotype-matched control mAb (B33 1) overnight at 4 degrees C (1 ⁇ g/ml in 05M bicarbonate buffer, pH 9 5), then washed three times with PBS PBMC are isolated by F/H gradient cent ⁇ fugation from human peripheral blood and added to quadruplicate wells (5 x 10 4 /well) of mAb coated plates in RPMI containing 10% FCS and P/S in the presence of varying concentrations of an albumin fusion protein of the invention (including fusion proteins containing fragments or variants of Therapeutic proteins and/or albumin or fragments or va ⁇ ants of albumin) (total volume 200 ul) Relevant protein buffer and medium alone are controls After 48
- Dendritic cells are generated by the expansion of proliferating precursors found in the peripheral blood adherent PBMC or elut ⁇ ated monocytic fractions are cultured for 7-10 days with GM-CSF (50 ng/ml) and IL-4 (20 ng/ml) These dendntic cells have the characteristic phenotype of immature cells (expression of CD 1 , CD80, CD86, CD40 and MHC class II antigens) Treatment with activating factors, such as TNF- ⁇ , causes a rapid change in surface phenotype (increased expression of MHC class I and II, costimulatory and adhesion molecules, downregulation of FC ⁇ RII, upregulation of CD83) These changes conelate with increased antigen-presenting capacity and with functional maturation of the dendntic cells
- FACS analysis of surface antigens is performed as follows Cells are treated 1 -3 days with increasing concentrations of an albumin fusion protein of the invention or LPS (positive control), washed with PBS containing 1% BSA and 0 02 mM sodium azide, and then incubated with
- IL-12 Cytokines generated by dendntic cells, in particular IL-12, are important in the initiation of T-cell dependent immune responses IL-12 strongly influences the development of Thl helper T-cell immune response, and induces cytotoxic T and NK cell function
- An ELISA is used to measure the IL-12 release as follows Dendntic cells (lOVml) are treated with increasing concentrations of an albumin fusion protein of the invention for 24 hours LPS (100 ng/ml) is added to the cell culture as positive control Supematants from the cell cultures are then collected and analyzed for IL-12 content using commercial ELISA kit (e g , R & D Systems (Minneapolis, MN)) The standard protocols provided with the kits are used
- MHC Class II. costimulatorv and adhesion molecules Three major families of cell surface antigens can be identified on monocytes adhesion molecules, molecules involved in antigen presentation, and Fc receptor Modulation of the expression of MHC class II antigens and other costimulatory molecules, such as B7 and ICAM-1, may result in changes in the antigen presenting capacity of monocytes and ability to induce T cell activation Increased expression of Fc receptors may conelate with improved monocyte cytotoxic activity, cytokine release and phagocytosis
- FACS analysis is used to examine the surface antigens as follows Monocytes are treated 1-5 days with increasing concentrations of an albumin fusion protein of the invention or LPS (positive control), washed with PBS containing 1% BSA and 002 mM sodium azide, and then incubated with 1 20 dilution of appropriate FITC- or PE-labeled monoclonal antibodies for 30 minutes at 4 degrees C After an additional wash, the labeled cells are analyzed by flow cytometry on a FACScan (Becton Dickinson)
- Monocyte activation and/or increased survival Assays for molecules that activate (or alternatively, inactivate) monocytes and/or increase monocyte survival (or alternatively, decrease monocyte survival) are known in the art and may routinely be applied to determine whether a molecule of the invention functions as an inhibitor or activator of monocytes
- Albumin fusion proteins of the invention can be screened using the three assays described below For each of these assays, Peripheral blood mononuclear cells (PBMC) are purified from single donor leukopacks (American Red
- Monocytes are cultured for 48 hours in polypropylene tubes in serum-free medium (positive control), in the presence of 100 ng/ml TNF-alpha
- Oxidative burst Purified monocytes are plated m 96-w plate at 2-lxlO 5 cell/well Increasing concentrations of an albumin fusion protein of the invention are added to the wells in a total volume of 0 2 ml culture medium (RPMI 1640 + 10% FCS, glutamine and antibiotics) After 3 days incubation, the plates are centrifuged and the medium is removed from the wells To the macrophage monolayers, 0 2 ml per well of phenol red solution (140 mM NaCI, 10 mM potassium phosphate buffer pH 7 0, 5 5 mM dextrose, 0 56 mM phenol red and 19 U/ml of HRPO) is added, together with the stimulant (200 nM PMA) The plates are incubated at 37°C for 2 hours and the reaction is stopped by adding 20 ⁇ l IN NaOH per well The absorbance is read at 610 nm To calculate the amount of H 2 0 2 produced by the macrophages,
- human umbilical vein endothelial cells are seeded at 2-5xl0 4 cells/35 mm dish density in M199 medium containing 4% fetal bovine serum (FBS), 16 units/ml heparin, and 50 units/ml endothelial cell growth supplements (ECGS, Biotechnique, Inc )
- FBS fetal bovine serum
- ECGS fetal bovine serum
- bFGF basic FGF
- Diabetic db+/db+ Mouse Model [0979] To demonstrate that an albumin fusion protein of the invention accelerates the healing process, the genetically diabetic mouse model of wound healing is used
- the full thickness wound healing model in the db+/db+ mouse is a well charactenzed, clinically relevant and reproducible model of impaired wound healing Healing ofthe diabetic wound is dependent on formation of granulation tissue and re-epithehahzation rather than contraction (Gartner, M H el al , J Surg Res 52 389 (1992), Greenhalgh, D G et al , Am J Pathol 736 1235 (1990))
- mice have many of the characteristic features observed in Type II diabetes mellitus Homozygous (db+/db+) mice are obese in comparison to their normal heterozygous (db+/+m) littermates
- Mutant diabetic (db+/db+) mice have a single autosomal recessive mutation on chromosome 4 (db+) (Coleman et al Proc Natl Acad Sci USA 77 283-293 (1982)) Animals show polyphagia, polydipsia and polyu ⁇ a
- Mutant diabetic mice (db+/db+) have elevated blood glucose, increased or normal insulin levels, and suppressed cell-mediated immunity (Mandel et al , J Immunol 120 1375 (1978), Debray-Sachs, M et al, Clin Exp Immunol 51(1) 1-7 (1983), Leiter el al , Am J ofPathol 114 46- 55 (1985)) Peripheral neuropathy, myocardial complications,
- Wounding protocol is performed according to previously reported methods (Tsuboi, R and Rifkin, D B , J Exp Med 172 245-251
- Wounds are visually examined and photographed at a fixed distance at the day of surgery and at two day intervals thereafter Wound closure is determined by daily measurement on days 1-5 and on day 8 Wounds are measured horizontally and vertically using a calibrated Jameson cahper Wounds are considered healed if granulation tissue is no longer visible and the wound is covered by a continuous epithelium
- An albumin fusion protein of the invention is administered using at a range different doses, from 4mg to 500mg per wound per day for
- Tissue sections are also stained immunohistochemically with a polyclonal rabbit anti-human keratin antibody using ABC Elite detection system Human skin is used as a positive tissue control while non-immune IgG is used as a negative control Keratinocyte growth is determined by evaluating the extent of reepitheha zation of the wound using a calibrated lens micrometer
- PCNA Proliferating cell nuclear antigen/cychn
- PCNA antibody (1 50) with an ABC Elite detection system Human colon cancer served as a positive tissue control and human brain tissue is used as a negative tissue control
- Each specimen included a section with omission of the primary antibody and substitution with non-immune mouse IgG Ranking of these sections is based on the extent of proliferation on a scale of 0-8, the lower side of the scale reflecting slight proliferation to the higher side reflecting intense proliferation
- Experimental data are analyzed using an unpaired t test A p value of ⁇ 0 05 is considered significant Steroid Impaired Rat Model
- the inhibition of wound healing by steroids has been well documented in various in vitro and in vivo systems (Wahl, Glucocorticoids and Wound healing In Anti-Inflammatory Steroid Action Basic and Clinical Aspects 280-302 (1989), Wahler ⁇ / , J Immunol 115 476-481 (1975), Werb et al , J
- Wounds are visually examined and photographed at a fixed distance at the day of wounding and at the end of treatment Wound closure is determined by daily measurement on days 1-5 and on day 8 Wounds are measured honzontally and vertically using a calibrated Jameson cahper
- Wounds are considered healed if granulation tissue is no longer visible and the wound is covered by a continuous epithelium
- the fusion protein of the invention is administered using at a range different doses, from 4mg to 500mg per wound per day for 8 days in vehicle Vehicle control groups received 50mL of vehicle solution
- Wound closure is analyzed by measuring the area in the vertical and honzontal axis and obtaining the total area of the wound Closure is then estimated by establishing the differences between the initial wound area (day 0) and that of post treatment (day 8) The wound area on day 1 is
- the conesponding size ofthe dermal punch Calculations are made using the following formula b [Open area on day 8] - [Open area on day 1 ] / [Open area on day 1 ] [1002] Specimens are fixed in 10% buffered formalin and paraffin embedded blocks are sectioned pe ⁇ endicular to the wound surface (5mm) and cut using an Olympus microtome Routine hematoxyhn-eosin (H&E) staining is performed on cross-sections of bisected wounds Histologic examination of the wounds allows assessment of whether the healing process and the mo ⁇ hologic appearance of the repaired skin is improved by treatment with an albumin fusion protein of the invention A calibrated lens micrometer is used by a blinded observer to determine the distance of the wound gap (1003) Expe ⁇ mental data are analyzed using an unpaired t test A p value of ⁇ 0 05 is considered significant EXAMPLE 22: Lymphedema Animal Model (1004
- CAMs cell surface adhesion molecules
- vascular endothehum The adhesion process, in both normal and pathological settings, follows a multi-step cascade that involves intercellular adhesion molecule-1 (ICAM-1), vascular cell adhesion molecule-1 (VCAM-1), and endothelial leukocyte adhesion molecule-1 (E-selectin) expression on endothelial cells (EC)
- ICM-1 intercellular adhesion molecule-1
- VCAM-1 vascular cell adhesion molecule-1
- E-selectin endothelial leukocyte adhesion molecule-1
- EC endothelial leukocyte adhesion molecule-1
- the expression of these molecules and others on the vascular endothehum determines the efficiency with which leukocytes may adhere to the local vasculature and extravasate into the local tissue during the development of an inflammatory response
- the local concentration of cytokines and growth factor participate in the modulation of the expression of these CAMs
- Tumor necrosis factor alpha (TNF-a), a potent proinflammatory cytokine, is a stimulator of all three CAMs on endothelial cells and may be involved in a wide vanety of inflammatory responses, often resulting in a pathological outcome
- human umbilical vein endothelial cell (HUVEC) cultures are obtained from pooled cord harvests and maintained in growth medium (EGM-2, Clonetics, San Diego, CA) supplemented with 10% FCS and 1% penicillin/streptomycin in a 37 degree C humidified incubator containing 5% C0 HUVECs are seeded in 96-well plates at concentrations of 1 x 10 cells/well in EGM medium at 37 degree C for 18-24 hrs or until confluent The monolayers are subsequently washed 3 times with a serum-free solution of RPMI-1640 supplemented with 100 U/ml penicillin and 100 mg ml streptomycin, and treated with a given cytokine and/or growth factor(s) for 24 h at 37 degree C Following incubation, the cells are then evaluated for CAM expression
- HAVECs Human Umbilical Vein Endothelial cells
- 199 Medium 10% FBS
- Samples for testing and positive or negative controls are added to the plate in triplicate (in 10 ul volumes) Plates are incubated at 37 degree C for either 5 h (selectin and integnn expression) or 24 h (integnn expression only) Plates are aspirated to remove medium and 100 ⁇ l of 0 1% paraformaldehyde-PBS(w ⁇ th Ca** and Mg**) is added to each well Plates are held at 4°C
- Fixative is then removed from the wells and wells are washed IX with PBS(+Ca,Mg)+0 5% BSA and drained Do not allow the wells to dry
- Add 10 ⁇ l of diluted primary antibody to the test and control wells Ant ⁇ -ICAM-1-B ⁇ ot ⁇ n, Ant ⁇ -VCAM-1-B ⁇ ot ⁇ n and Anti-E-selectin-Biotm are used at a concentration of 10 ⁇ g/ml (1 10 dilution of 0 1 mg/ml stock antibody) Cells are incubated at 37"C for 30 mm in a humidified environment
- Wells are washed X3 with PBS(+Ca,Mg)+0 5% BSA
- GAS and ISRE elements are recognized by a class of transcnption factors called Signal Transducers and Activators of Transcnption, or "STATs".
- STATs Signal Transducers and Activators of Transcnption
- Stat4 is more restricted and is not in many cell types though it has been found in T helper class I, cells after treatment with IL-12 Stat5 was ongmally called mammary growth factor, but has been found at higher concentrations in other cells including myeloid cells It can be activated in tissue culture cells by many cytokines
- the STATs are activated to translocate from the cytoplasm to the nucleus upon tyrosine phosphorylation by a set of kinases known as the Janus Kinase ("Jaks") family Jaks represent a distinct family of soluble tyrosine kinases and include Tyk2, Jakl, Jak2, and Jak3 These kinases display significant sequence simila ⁇ ty and are generally catalytically inactive in resting cells
- the Jaks are activated by a wide range of receptors summa ⁇ zed in the Table below (Adapted from review by Schidler and Darnell, Ann Rev Biochem 64 621-51 (1995))
- a cytokine receptor family capable of activating Jaks, is divided into two groups (a) Class 1 includes receptors for IL-2, IL-3, IL-4, 1L-6, IL-7, IL-9, IL-11, IL-12, IL-15, Epo, PRL, GH, G-CSF, GM-CSF, LIT, CNTF, and thrombopoietin, and (b) Class 2 includes IFN-a, IFN-g, and IL-10
- the Class 1 receptors share a conserved cysteine motif (a set of four conserved cysteines and one tryptophan) and a WSXWS motif (a membrane proximal region encoding T ⁇ -Ser-Xaa-T ⁇ -Ser (SEQ ID NO 53))
- Jaks are activated, which in turn activate STATs, which then translocate and bind to GAS elements
- This entire process is encompassed in the Jaks-STATs signal transduction pathway Therefore, activation of the Jaks-STATs pathway, reflected by the binding of the GAS or the ISRE element, can be used to indicate proteins involved in the proliferation and differentiation of cells
- growth factors and cytokines are known to activate the Jaks-STATs pathway (See Table 5, below)
- activators ofthe Jaks-STATs pathway can be identified
- IL-2 lymphocytes + - + 1,3,5 GAS
- IL-7 lymphocytes + - + 5 GAS
- IL-9 lymphocytes + - + 5 GAS
- IL-13 (lymphocyte) . + 6 GAS
- the 5' primer also contains 18bp of sequence complementary to the SV40 early promoter sequence and is flanked with an Xhol site The sequence ofthe 5' pnmer is
- downstream p ⁇ mer is complementary to the SV40 promoter and is flanked with a Hind III site
- PCR amplification is performed using the SV40 promoter template present in the B-gal promoter plasmid obtained from Clontech The resulting PCR fragment is digested with Xhol/Hind III and subcloned mto BLSK2- (Stratagene ) Sequencing with forward and reverse primers confirms that the insert contains the following sequence
- reporter molecule is a secreted alkaline phosphatase, or "SEAP"
- SEAP secreted alkaline phosphatase
- any reporter molecule can be instead of SEAP, in this or in any of the other Examples
- Well known reporter molecules that can be used instead of SEAP include chloramphenieol acetyltransferase (CAT), luciferase, alkaline phosphatase, B-galactosidase, green fluorescent protein (GFP), or any protein detectable by an antibody
- this vector does not contain a neomycin resistance gene, and therefore, is not prefened for mammalian expression systems
- GAS-SEAP vector using Sail and Notl, and inserted into a backbone vector containing the neomycin resistance gene, such as pGFP-1 (Clontech), using these restriction sites in the multiple cloning site, to create the GAS-SEAP/Neo vector
- pGFP-1 pGFP-1
- Cardiomyocyte EXAMPLE 25 Assav for SEAP Activity.
- SEAP activity is assayed using the Tropix Phospho-hght Kit (Cat BP-400) according to the following general procedure
- the Tropix Phospho-hght Kit supplies the Dilution, Assay, and Reaction Buffers used below
- EXAMPLE 26 Assav Identifying Neuronal Activity.
- EGR1 early growth response gene 1
- the promoter of EGR1 is responsible for such induction Using the EGR1 promoter linked to reporter molecules, the ability of fusion proteins of the invention to activate cells can be assessed
- PC12 cells rat phenochromocytoma cells
- TPA tetradecanoyl phorbol acetate
- NGF nerve growth factor
- EGF epidermal growth factor
- the EGR/SEAP reporter construct can be assembled by the following protocol
- the EGR-1 promoter sequence (-633 to +l)(Sakamoto K et al , Oncogene 6 867-871 (1991)) can be PCR amplified from human genomic DNA using the following primers First primer 5' GCGCTCGAGGGATGACAGCGATAGAACCCCGG-3' (SEQ ID NO 57) Second primer 5' GCGAAGCTTCGCGACTCCCCGGATCCGCCTC-3' (SEQ ID NO 58)
- EGR1 amplified product can then be inserted into this vector Linearize the GAS SEAP/Neo vector using restriction enzymes Xhol/Hmdlll, removing the GAS/SV40 stuffer Restrict the EGR1 amplified product with these same enzymes Ligate the vector and the EGR1 promoter
- EGR-SEAP/PC12 stable cells are obtained by growing the cells in 300 ug/ml G418 The G418-free medium is used for routine growth but every one to two months, the cells should be re-grown in 300 ug/ml G418 for couple of passages
- T-cell activity is assessed using the GAS/SEAP/Neo construct produced in Example 24
- factors that increase SEAP activity indicate the ability to activate the Jaks-STATS signal transduction pathway
- the T-cell used in this assay is Jurkat T-cells (ATCC Accession No TIB-152), although Molt-3 cells (ATCC Accession No CRL-1552) and Mol cells (ATCC Accession No CRL-1582) cells can also be used
- Jurkat T-cells are lymphoblastic CD4+ Thl helper cells
- DMRIE-C (Life Technolog ⁇ es)(transfect ⁇ on procedure descnbed below)
- the transfected cells are seeded to a density of approximately 20,000 cells per well and transfectants resistant to 1 mg/ml gentian selected Resistant colonies are expanded and then tested for their response to increasing concentrations of interferon gamma
- the dose response of a selected clone is demonstrated
- the following protocol will yield sufficient cells for 75 wells containing 200 ul of cells Thus, it is either scaled up, or performed in multiple to generate sufficient cells for multiple 96 well plates
- Jurkat cells are maintained in RPMI + 10% serum with l%Pen-Strep Combine 2 5 mis of OPTI-MEM (Life Technologies) with 10 ug of plasmid DNA in a T25 flask Add
- the Jurkat GAS-SEAP stable reporter lines are maintained in RPMI + 10% serum, 1 mg/ml Genticin, and 1% Pen-Strep These cells are treated with varying concentrations of one or more fusion proteins ofthe present invention
- the cells On the day of treatment with the fusion protein, the cells should be washed and resuspended in fresh RPMI + 10% serum to a density of 500,000 cells per ml The exact number of cells required will depend on the number of fusion proteins and the number of different concentrations of fusion proteins being screened For one 96 well plate, approximately 10 million cells (for 10 plates, 100 million cells) are required [1054
- NF-KB Nuclear Factor KB
- NF-KB is a transcription factor activated by a wide variety of agents including the inflammatory cytokines IL-1 and TNF, CD30 and CD40, lymphotoxin-alpha and lymphotoxin-beta, by exposure to LPS or thrombin, and by expression of certain viral gene products
- NF-KB regulates the expression of genes involved in immune cell activation, control of apoptosis (NF- KB appears to shield cells from apoptosis), B and T-cell development, anti-viral and antimicrobial responses, and multiple stress responses
- NF- KB is retained in the cytoplasm with I-KB (Inhibitor KB)
- I-KB Inhibitor KB
- I- KB is phosphorylated and degraded, causing NF- KB to shuttle to the nucleus, thereby activating transcription of target genes
- Target genes activated by NF- KB include IL-2, IL-6, GM-CSF, ICAM-1 and class 1 MHC
- reporter constructs utilizing the NF-KB promoter element are used to screen the fusion protein Activators or inhibitors of NF-KB would be useful in treating, preventing, and/or diagnosing diseases
- inhibitors of NF-KB could be used to treat those diseases related to the acute or chronic activation of NF-KB, such as rheumatoid arthritis
- To construct a vector containing the NF-KB promoter element a PCR based strategy is employed The upstream primer contains four tandem copies of the NF-KB binding site (GGGGACTTTCCC) (SEQ ID NO 59), 18 bp of sequence complementary to the 5 ' end of the S V40 early promoter sequence, and is flanked with an Xhol site
- the downstream primer is complementary to the 3' end ofthe SV40 promoter and is flanked with a Hind III site
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Veterinary Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Biophysics (AREA)
- Biomedical Technology (AREA)
- Immunology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Microbiology (AREA)
- Oncology (AREA)
- Diabetes (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Communicable Diseases (AREA)
- Endocrinology (AREA)
- Hematology (AREA)
- Pulmonology (AREA)
- Obesity (AREA)
- Virology (AREA)
- Transplantation (AREA)
Priority Applications (25)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| HK07101008.1A HK1095087B (en) | 2004-02-09 | 2005-02-09 | Albumin fusion proteins |
| CN200580012252.5A CN1980687B (zh) | 2004-02-09 | 2005-02-09 | 清蛋白融合蛋白 |
| KR1020067018484A KR101184391B1 (ko) | 2004-02-09 | 2005-02-09 | 알부민 융합 단백질 |
| CA2554089A CA2554089C (en) | 2004-02-09 | 2005-02-09 | Albumin fusion proteins |
| KR1020127015659A KR101271635B1 (ko) | 2001-12-21 | 2005-02-09 | 알부민 융합 단백질 |
| EP05722848.8A EP1729795B1 (en) | 2004-02-09 | 2005-02-09 | Albumin fusion proteins |
| NZ548612A NZ548612A (en) | 2004-02-09 | 2005-02-09 | Albumin fusion proteins comprising tandem GLP-1 |
| BRPI0507026-0A BRPI0507026A (pt) | 2004-02-09 | 2005-02-09 | proteìnas de fusão de albumina |
| JP2006553197A JP5010923B2 (ja) | 2004-02-09 | 2005-02-09 | アルブミン融合蛋白質 |
| AU2005211725A AU2005211725B2 (en) | 2004-02-09 | 2005-02-09 | Albumin fusion proteins |
| MXPA06009072A MXPA06009072A (es) | 2004-02-09 | 2005-02-09 | Proteinas de fusion de albumina. |
| PL05722848T PL1729795T3 (pl) | 2004-02-09 | 2005-02-09 | Białka fuzyjne albuminy |
| SI200532048T SI1729795T1 (sl) | 2004-02-09 | 2005-02-09 | Albuminski fuzijski proteini |
| DK05722848.8T DK1729795T3 (en) | 2004-02-09 | 2005-02-09 | Albumin fusion proteins |
| ES05722848.8T ES2567634T3 (es) | 2004-02-09 | 2005-02-09 | Proteínas de fusión de albúmina |
| IL176894A IL176894A (en) | 2004-02-09 | 2006-07-17 | Albumin fusion proteins comprising two or more tandemly oriented glp-1 polypeptides |
| US11/495,624 US20080004206A1 (en) | 2001-12-21 | 2006-07-31 | Albumin fusion proteins |
| US11/500,314 US20070048282A1 (en) | 2004-02-09 | 2006-08-08 | Albumin fusion proteins |
| US11/500,508 US7569384B2 (en) | 2004-02-09 | 2006-08-08 | Albumin fusion proteins |
| NO20064059A NO20064059L (no) | 2004-02-09 | 2006-09-08 | Albumin fusjonsproteiner |
| US11/932,823 US20080194481A1 (en) | 2001-12-21 | 2007-10-31 | Albumin Fusion Proteins |
| US12/534,585 US8143026B2 (en) | 2004-02-09 | 2009-08-03 | Albumin fusion proteins |
| US12/793,652 US20100291033A1 (en) | 2001-12-21 | 2010-06-03 | Albumin Fusion Proteins |
| US12/793,658 US8287859B2 (en) | 2001-12-21 | 2010-06-03 | Methods of reducing toxicity and effects of cocaine by administering a butyrylcholinesterase (BChE)-albumin fusion protein |
| AU2010227035A AU2010227035A1 (en) | 2004-02-09 | 2010-10-07 | Albumin fusion proteins |
Applications Claiming Priority (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US54227404P | 2004-02-09 | 2004-02-09 | |
| US60/542,274 | 2004-02-09 | ||
| US54990104P | 2004-03-05 | 2004-03-05 | |
| US60/549,901 | 2004-03-05 | ||
| US55690604P | 2004-03-29 | 2004-03-29 | |
| US60/556,906 | 2004-03-29 | ||
| US63660304P | 2004-12-17 | 2004-12-17 | |
| US60/636,603 | 2004-12-17 |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US12/426,882 Continuation-In-Part US20100048472A1 (en) | 2001-12-21 | 2009-04-20 | Albumin Fusion Proteins |
Related Child Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US11/495,624 Continuation-In-Part US20080004206A1 (en) | 2001-12-21 | 2006-07-31 | Albumin fusion proteins |
| US11/500,314 Continuation-In-Part US20070048282A1 (en) | 2004-02-09 | 2006-08-08 | Albumin fusion proteins |
| US11/500,508 Continuation-In-Part US7569384B2 (en) | 2001-12-21 | 2006-08-08 | Albumin fusion proteins |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2005077042A2 true WO2005077042A2 (en) | 2005-08-25 |
| WO2005077042A3 WO2005077042A3 (en) | 2006-11-30 |
Family
ID=34865403
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2005/004041 Ceased WO2005077042A2 (en) | 2001-12-21 | 2005-02-09 | Albumin fusion proteins |
Country Status (20)
| Country | Link |
|---|---|
| US (3) | US7569384B2 (https=) |
| EP (1) | EP1729795B1 (https=) |
| JP (2) | JP5010923B2 (https=) |
| KR (1) | KR101184391B1 (https=) |
| CN (1) | CN102816241B (https=) |
| AU (2) | AU2005211725B2 (https=) |
| BR (1) | BRPI0507026A (https=) |
| CA (1) | CA2554089C (https=) |
| CY (1) | CY1117401T1 (https=) |
| DK (1) | DK1729795T3 (https=) |
| ES (1) | ES2567634T3 (https=) |
| HU (1) | HUE027902T2 (https=) |
| IL (1) | IL176894A (https=) |
| MA (1) | MA28565B1 (https=) |
| MX (1) | MXPA06009072A (https=) |
| NO (1) | NO20064059L (https=) |
| NZ (1) | NZ548612A (https=) |
| PL (1) | PL1729795T3 (https=) |
| SI (1) | SI1729795T1 (https=) |
| WO (1) | WO2005077042A2 (https=) |
Cited By (67)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006038027A2 (en) | 2004-10-08 | 2006-04-13 | Domantis Limited | SINGLE DOMAIN ANTIBODIES AGAINST TNFRl AND METHODS OF USE THEREFOR |
| US7141547B2 (en) | 2001-12-21 | 2006-11-28 | Human Genome Sciences, Inc. | Albumin fusion proteins comprising GLP-1 polypeptides |
| US7189690B2 (en) | 2001-12-21 | 2007-03-13 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| WO2007056681A2 (en) | 2005-11-04 | 2007-05-18 | Smithkline Beecham Corporation | Methods for administering hypoglycemic agents |
| WO2008052043A3 (en) * | 2006-10-24 | 2009-01-08 | Cogenesys Inc | Opioid receptor agonist fusion proteins |
| WO2009030373A1 (en) * | 2007-09-05 | 2009-03-12 | Sanofi-Aventis | Use of urate oxidase for the treatment or prophylaxis of disorders or indirect sequelae of the heart caused by ischemic or reperfusion events |
| RU2361607C2 (ru) * | 2007-06-09 | 2009-07-20 | Государственное образовательное учреждение высшего профессионального образования "Челябинская государственная медицинская академия Федерального агентства по здравоохранению и социальному развитию Российской Федерации" | Способ локальной иммунотерапии гнойно-воспалительных заболеваний мягких тканей челюстно-лицевой области |
| EP1924596A4 (en) * | 2005-08-12 | 2009-07-29 | Human Genome Sciences Inc | ALBUM INFUSION PROTEINS |
| US7569384B2 (en) | 2004-02-09 | 2009-08-04 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| EP2046367A4 (en) * | 2006-06-07 | 2009-11-11 | Human Genome Sciences Inc | ALBUM INFUSION PROTEINS |
| EP2068905A4 (en) * | 2006-09-14 | 2009-12-30 | Human Genome Sciences Inc | ALBUM INFUSION PROTEINS |
| JP2010503697A (ja) * | 2006-09-13 | 2010-02-04 | スミスクライン・ビーチャム・コーポレイション | 持続性血糖降下剤の投与方法 |
| WO2010094720A2 (en) | 2009-02-19 | 2010-08-26 | Glaxo Group Limited | Improved anti-tnfr1 polypeptides, antibody variable domains & antagonists |
| US7785599B2 (en) | 2000-04-12 | 2010-08-31 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| WO2010116248A1 (en) | 2009-04-10 | 2010-10-14 | Novartis Ag | Organic compounds and their uses |
| WO2010115981A1 (en) | 2009-04-10 | 2010-10-14 | Novartis Ag | 7-azadispiro [3.0.4.1] decane-8-carboxamides as hepatitis c virus inhibitors |
| WO2011006914A2 (en) | 2009-07-16 | 2011-01-20 | Glaxo Group Limited | Antagonists, uses & methods for partially inhibiting tnfr1 |
| WO2011012609A2 (en) | 2009-07-29 | 2011-02-03 | Glaxo Group Limited | Ligands that bind tgf-beta receptor rii |
| WO2011053617A1 (en) | 2009-10-30 | 2011-05-05 | Boehringer Ingelheim International Gmbh | Dosage regimens for hcv combination therapy comprising bi201335, interferon alpha and ribavirin |
| WO2011051217A1 (en) | 2009-10-27 | 2011-05-05 | Glaxo Group Limited | Stable anti-tnfr1 polypeptides, antibody variable domains & antagonists |
| WO2011098644A2 (es) | 2010-02-09 | 2011-08-18 | Proyecto De Biomedicina Cima, S.L. | Composiciones para el tratamiento de enfermedades infecciosas y tumorales |
| EP2371390A2 (en) | 2004-10-08 | 2011-10-05 | Domantis Limited | Antagonists and methods of use therefor |
| US20110300127A1 (en) * | 2008-05-27 | 2011-12-08 | Fujifilm Corporation | Drug-containing composition |
| WO2011161644A1 (en) | 2010-06-24 | 2011-12-29 | Panmed Ltd. | Treatment of hepatitis c virus related diseases using hydroxychloroquine or a combination of hydroxychloroquine and an anti-viral agent |
| WO2012013597A1 (de) * | 2010-07-28 | 2012-02-02 | Justus-Liebig-Universität Giessen | Stoffe und deren verwendung zur beeinflussung natriuretischer peptidrezeptoren |
| WO2012048235A1 (en) | 2010-10-08 | 2012-04-12 | Novartis Ag | Vitamin e formulations of sulfamide ns3 inhibitors |
| WO2012093125A1 (en) | 2011-01-06 | 2012-07-12 | Glaxo Group Limited | Ligands that bind tgf-beta receptor ii |
| US8287859B2 (en) | 2001-12-21 | 2012-10-16 | Human Genome Sciences, Inc. | Methods of reducing toxicity and effects of cocaine by administering a butyrylcholinesterase (BChE)-albumin fusion protein |
| EP2518079A2 (en) | 2006-04-11 | 2012-10-31 | Novartis AG | HCV/HIV inhibitors and their uses |
| WO2013138064A1 (en) | 2012-03-14 | 2013-09-19 | Boehringer Ingelheim International Gmbh | Combination therapy for treating hcv infection in an hcv-hiv coinfected patient population |
| WO2013143581A1 (en) | 2012-03-28 | 2013-10-03 | Boehringer Ingelheim International Gmbh | Combination therapy for treating hcv infection in specific patient subgenotype sub-population |
| US8642542B2 (en) | 1995-12-30 | 2014-02-04 | Novozymes Biopharma Dk A/S | Recombinant fusion proteins to growth hormone and serum albumin |
| WO2014029752A1 (en) | 2012-08-22 | 2014-02-27 | Glaxo Group Limited | Anti lrp6 antibodies |
| WO2014082935A1 (en) | 2012-11-30 | 2014-06-05 | Novartis Ag | Cyclic nucleoside derivatives and uses thereof |
| JPWO2012093704A1 (ja) * | 2011-01-07 | 2014-06-09 | 中外製薬株式会社 | 抗体の物性を改善させる方法 |
| US8748380B2 (en) | 2009-10-30 | 2014-06-10 | Novozymes Biopharma Dk A/S | Albumin variants |
| EP2746291A2 (en) | 2007-06-06 | 2014-06-25 | Domantis Limited | Pulmonary formulation comprising an immunoglobulin single variable domain which binds to TNFR1 |
| US8765915B2 (en) | 2006-02-06 | 2014-07-01 | Csl Behring Gmbh | Modified coagulation factor VIIa with extended half-life |
| US8822417B2 (en) | 2011-05-05 | 2014-09-02 | Novozymes Biopharma DIC A/S | Albumin variants |
| WO2014140180A1 (en) | 2013-03-15 | 2014-09-18 | Glaxosmithkline Intellectual Property Development Limited | Anti-lag-3 binding proteins |
| EP2423222B1 (en) | 2007-01-30 | 2015-04-29 | Epivax, Inc. | Regulatory t cell epitopes, compositions and uses thereof |
| WO2015198199A1 (en) | 2014-06-23 | 2015-12-30 | Novartis Ag | Hsa-gdf-15 fusion polypeptide and use thereof. |
| WO2016100803A2 (en) | 2014-12-19 | 2016-06-23 | Alexion Pharmaceuticals, Inc. | Methods of treating tissue calcification |
| WO2017109706A1 (en) | 2015-12-22 | 2017-06-29 | Novartis Ag | Methods of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15) |
| WO2017112889A1 (en) * | 2015-12-23 | 2017-06-29 | The Johns Hopkins University | Long-acting glp-1r agonist as a therapy of neurological and neurodegenerative conditions |
| US9732162B2 (en) | 2007-10-15 | 2017-08-15 | Sanofi | Antibodies that bind IL-4 and/or IL-13 and their uses |
| WO2017218786A1 (en) | 2016-06-16 | 2017-12-21 | Alexion Pharmaceuticals, Inc. | Methods of treating myointimal proliferation |
| US9944691B2 (en) | 2012-03-16 | 2018-04-17 | Albumedix A/S | Albumin variants |
| CN107949638A (zh) * | 2015-09-08 | 2018-04-20 | Jcr制药股份有限公司 | 新型人血清白蛋白突变体 |
| US10233228B2 (en) | 2010-04-09 | 2019-03-19 | Albumedix Ltd | Albumin derivatives and variants |
| WO2019067502A1 (en) | 2017-09-27 | 2019-04-04 | Alexion Pharmaceuticals, Inc. | METHODS FOR IMPROVING CARDIOVASCULAR FUNCTION AND TREATING CARDIOVASCULAR DISEASE USING RECOMBINANT ECTO-NUCLEOTIDE PYROPHOSPHATASE / PHOSPHODIESTERASE |
| WO2019152827A1 (en) * | 2018-02-02 | 2019-08-08 | AskGene Pharma, Inc. | Novel antibody-drug conjugates (adc), methods of making, and methods of use thereof |
| US10501524B2 (en) | 2012-11-08 | 2019-12-10 | Albumedix Ltd | Albumin variants |
| US10633428B2 (en) | 2015-08-20 | 2020-04-28 | Albumedix Ltd | Albumin variants and conjugates |
| US10711050B2 (en) | 2011-11-18 | 2020-07-14 | Albumedix Ltd | Variant serum albumin with improved half-life and other properties |
| WO2020152367A1 (en) | 2019-01-25 | 2020-07-30 | Ospedale San Raffaele S.R.L. | Inhibitor of dux4 and uses thereof |
| WO2021242663A1 (en) | 2020-05-26 | 2021-12-02 | Boehringer Ingelheim International Gmbh | Anti-pd-1 antibodies |
| US20220288226A1 (en) * | 2020-08-27 | 2022-09-15 | Enosi Life Sciences Corp. | Methods and compositions to treat autoimmune diseases and cancer |
| WO2022254379A1 (en) | 2021-06-04 | 2022-12-08 | Boehringer Ingelheim International Gmbh | Anti-sirp-alpha antibodies |
| US11555061B2 (en) | 2009-02-11 | 2023-01-17 | Albumedix, Ltd | Albumin variants and conjugates |
| US11680104B2 (en) | 2015-09-02 | 2023-06-20 | Immutep S.A.S. | Anti-LAG-3 antibodies |
| EP4389762A1 (en) | 2022-12-23 | 2024-06-26 | Ospedale San Raffaele S.r.l. | Inhibitors of dux4 activity and their use in therapy. |
| EP4245776A4 (en) * | 2020-11-16 | 2025-01-01 | Huatong Forturn (China) Co., Ltd | HUMAN SERUM ALBUMIN-INTERLEUKIN-2 FUSION PROTEIN AND USE THEREOF |
| WO2025074337A1 (en) | 2023-10-06 | 2025-04-10 | Boehringer Ingelheim International Gmbh | Use of anti-sirp-alpha antibodies to treat a liver disease or disorder |
| WO2025074328A1 (en) | 2023-10-06 | 2025-04-10 | Boehringer Ingelheim International Gmbh | Use of anti-sirp-alpha antibodies to treat cancer |
| WO2025181215A1 (en) | 2024-03-01 | 2025-09-04 | Boehringer Ingelheim International Gmbh | Antibodies to connective tissue growth factor (ctgf) and uses thereof |
| WO2026042013A1 (en) | 2024-08-19 | 2026-02-26 | Institute Of Molecular And Clinical Ophthalmology Basel (Iob) | Mitochondrial therapy |
Families Citing this family (141)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050100991A1 (en) * | 2001-04-12 | 2005-05-12 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| WO2005003296A2 (en) | 2003-01-22 | 2005-01-13 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| WO2004096113A2 (en) * | 2003-04-28 | 2004-11-11 | Medical Instill Technologies, Inc. | Container with valve assembly for filling and dispensing substances, and apparatus and method for filling |
| US7846445B2 (en) * | 2005-09-27 | 2010-12-07 | Amunix Operating, Inc. | Methods for production of unstructured recombinant polymers and uses thereof |
| US7855279B2 (en) | 2005-09-27 | 2010-12-21 | Amunix Operating, Inc. | Unstructured recombinant polymers and uses thereof |
| JP2009509535A (ja) * | 2005-09-27 | 2009-03-12 | アムニクス, インコーポレイテッド | タンパク様薬剤およびその使用 |
| US20090099031A1 (en) * | 2005-09-27 | 2009-04-16 | Stemmer Willem P | Genetic package and uses thereof |
| US20080280328A1 (en) * | 2005-11-18 | 2008-11-13 | Novozymes A/S | Glucoamylase Variants |
| WO2007127286A2 (en) | 2006-04-24 | 2007-11-08 | Medical Instill Technologies, Inc. | Needle penetrable and laser resealable lyophilization device and related method |
| MX2009005466A (es) | 2006-11-22 | 2009-08-17 | Adnexus A Bristol Myers Sqibb | Terapeuticos dirigidos a base de proteinas manipuladas para receptores de tirosina cinasas, incluyendo receptor de factor de crecimiento tipo insulina-i. |
| EP2111228B1 (en) | 2007-02-02 | 2011-07-20 | Bristol-Myers Squibb Company | 10Fn3 domain for use in treating diseases associated with inappropriate angiogenesis |
| US20100268055A1 (en) * | 2007-07-19 | 2010-10-21 | Arizona Board of Regents, a body corporate acting for and on behalf of Arizona State University | Self-Anchoring MEMS Intrafascicular Neural Electrode |
| JP2010536341A (ja) * | 2007-08-15 | 2010-12-02 | アムニクス, インコーポレイテッド | 生物学的に活性なポリペプチドの特性を改変するための組成物および方法 |
| GB0723712D0 (en) * | 2007-12-04 | 2008-01-16 | Apitope Technology Bristol Ltd | Peptides |
| EP2072527A1 (en) | 2007-12-21 | 2009-06-24 | Altonabiotec AG | Fusion polypeptides comprising a SHBG dimerization component and uses thereof |
| US20110009497A1 (en) * | 2008-03-21 | 2011-01-13 | Fujifilm Corporation | Drug-containing composition |
| WO2009142773A2 (en) | 2008-05-22 | 2009-11-26 | Bristol-Myers Squibb Company | Multivalent fibronectin based scaffold domain proteins |
| PT2373681T (pt) | 2008-12-10 | 2017-04-11 | Glaxosmithkline Llc | Composições farmacêuticas de albiglutida |
| US8680050B2 (en) * | 2009-02-03 | 2014-03-25 | Amunix Operating Inc. | Growth hormone polypeptides fused to extended recombinant polypeptides and methods of making and using same |
| ES2610356T3 (es) | 2009-02-03 | 2017-04-27 | Amunix Operating Inc. | Polipéptidos recombinantes extendidos y composiciones que comprenden los mismos |
| US8703717B2 (en) * | 2009-02-03 | 2014-04-22 | Amunix Operating Inc. | Growth hormone polypeptides and methods of making and using same |
| EP2419120A4 (en) * | 2009-04-08 | 2016-01-06 | Univ California | HUMAN PROTEIN CONCERNS WITH CONTROLLED SERUM PHARMACOKINETICS |
| KR101286721B1 (ko) * | 2009-06-05 | 2013-07-16 | 한국과학기술연구원 | 폴리-시스테인 펩티드 융합 재조합 알부민 및 이의 제조방법 |
| US9849188B2 (en) | 2009-06-08 | 2017-12-26 | Amunix Operating Inc. | Growth hormone polypeptides and methods of making and using same |
| WO2010144508A1 (en) * | 2009-06-08 | 2010-12-16 | Amunix Operating Inc. | Glucose-regulating polypeptides and methods of making and using same |
| CA2771999A1 (en) | 2009-08-24 | 2011-03-10 | Amunix Operating Inc. | Coagulation factor vii compositions and methods of making and using same |
| JP2013520426A (ja) | 2010-02-18 | 2013-06-06 | ブリストル−マイヤーズ スクイブ カンパニー | Il−23に結合する、フィブロネクチンをベースとする足場ドメインタンパク質 |
| US8557961B2 (en) | 2010-04-02 | 2013-10-15 | Amunix Operating Inc. | Alpha 1-antitrypsin compositions and methods of making and using same |
| EP2558491B1 (en) | 2010-04-13 | 2018-07-04 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind pcsk9 |
| US8691763B2 (en) | 2010-05-04 | 2014-04-08 | Glaxosmithkline Llc | Methods for treating or preventing cardiovascular disorders and providing cardiovascular protection |
| EP2571992B1 (en) * | 2010-05-21 | 2018-04-25 | Merrimack Pharmaceuticals, Inc. | Bi-specific fusion proteins |
| JP6023703B2 (ja) | 2010-05-26 | 2016-11-09 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | 改善された安定性を有するフィブロネクチンをベースとする足場タンパク質 |
| CN103380143B (zh) | 2010-12-22 | 2016-01-06 | 百时美施贵宝公司 | 结合il-23的基于纤连蛋白的支架结构域蛋白质 |
| US20120277155A1 (en) | 2011-02-25 | 2012-11-01 | Medtronic, Inc. | Therapy for kidney disease and/or heart failure |
| AU2012222833B2 (en) | 2011-03-03 | 2017-03-16 | Zymeworks Inc. | Multivalent heteromultimer scaffold design and constructs |
| EP2750697A4 (en) | 2011-09-02 | 2015-03-25 | Medtronic Inc | CHIMERIC NATRIURETIC PEPTIDE COMPOSITIONS AND METHOD FOR THE PRODUCTION THEREOF |
| JP2015504038A (ja) | 2011-10-31 | 2015-02-05 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | 低減した免疫原性を有するフィブロネクチン結合ドメイン |
| EP2822577B1 (en) | 2012-02-15 | 2019-02-06 | Bioverativ Therapeutics Inc. | Recombinant factor viii proteins |
| JP6256882B2 (ja) | 2012-02-15 | 2018-01-10 | アムニクス オペレーティング インコーポレイテッド | 第viii因子組成物、ならびに組成物の作製方法および用途 |
| JP6355563B2 (ja) | 2012-02-27 | 2018-07-11 | アムニクス オペレーティング インコーポレイテッド | Xten共役組成物およびそれを製造する方法 |
| US9603897B2 (en) | 2012-03-12 | 2017-03-28 | Massachusetts Institute Of Technology | Methods for treating tissue damage associated with ischemia with apolipoprotein D |
| US9844582B2 (en) | 2012-05-22 | 2017-12-19 | Massachusetts Institute Of Technology | Synergistic tumor treatment with extended-PK IL-2 and therapeutic agents |
| WO2014012082A2 (en) | 2012-07-13 | 2014-01-16 | Zymeworks Inc. | Multivalent heteromultimer scaffold design an constructs |
| ES2984405T3 (es) | 2012-09-13 | 2024-10-29 | Bristol Myers Squibb Co | Proteínas de dominio de andamio basadas en fibronectina que se unen a la miostatina |
| EP2951206A2 (en) | 2013-02-01 | 2015-12-09 | Bristol-Myers Squibb Company | Fibronectin based scaffold proteins |
| USRE48805E1 (en) * | 2013-03-06 | 2021-11-02 | Vision Global Holdings Ltd. | Method for cancer targeting treatment and detection of arginine using albumin-binding arginine deiminase fusion protein |
| US9255262B2 (en) * | 2013-03-06 | 2016-02-09 | Vision Global Holdings Ltd. | Albumin-binding arginine deminase and the use thereof |
| EP2964666B1 (en) | 2013-03-06 | 2020-11-18 | GlaxoSmithKline LLC | Host cells and methods of use |
| EP2968587A2 (en) | 2013-03-13 | 2016-01-20 | Bristol-Myers Squibb Company | Fibronectin based scaffold domains linked to serum albumin or a moiety binding thereto |
| EP2992021B1 (en) | 2013-04-30 | 2020-07-22 | Intas Pharmaceuticals Limited | Novel cloning, expression & purification method for the preparation of ranibizumab |
| WO2015001049A1 (en) | 2013-07-04 | 2015-01-08 | Novartis Ag | O-mannosyltransferase deficient filamentous fungal cells and methods of use thereof |
| WO2015023890A1 (en) * | 2013-08-14 | 2015-02-19 | The Arizona Board Of Regents On Behalf Of The University Of Arizona | Glycosylated pacap/vip analogues with enhanced cns penetration for treatment of neurodegenerative diseases |
| TW202003554A (zh) | 2013-08-14 | 2020-01-16 | 美商百歐維拉提夫治療公司 | 因子viii-xten融合物及其用途 |
| CN105377882B (zh) * | 2014-03-06 | 2020-05-05 | 葛兰素史密斯克莱有限责任公司 | 宿主细胞和使用方法 |
| SG11201700446XA (en) | 2014-07-21 | 2017-02-27 | Glykos Finland Oy | Production of glycoproteins with mammalian-like n-glycans in filamentous fungi |
| CA2957717C (en) | 2014-08-12 | 2021-10-19 | Massachusetts Institute Of Technology | Synergistic tumor treatment with il-2 and integrin-binding-fc-fusion protein |
| WO2016025647A1 (en) | 2014-08-12 | 2016-02-18 | Massachusetts Institute Of Technology | Synergistic tumor treatment with il-2, a therapeutic antibody, and a cancer vaccine |
| US9616114B1 (en) | 2014-09-18 | 2017-04-11 | David Gordon Bermudes | Modified bacteria having improved pharmacokinetics and tumor colonization enhancing antitumor activity |
| CN107207379B (zh) | 2014-11-25 | 2021-08-10 | 百时美施贵宝公司 | 用于生物制品的18f-放射性标记的方法和组合物 |
| CA2969067A1 (en) | 2014-11-25 | 2016-06-02 | Bristol-Myers Squibb Company | Novel pd-l1 binding polypeptides for imaging |
| EA035332B1 (ru) | 2015-04-24 | 2020-05-28 | ВАЙВ ХЕЛТКЕР ЮКей (№5) ЛИМИТЕД | Полипептиды, нацеленные на слияние вич |
| US10676723B2 (en) | 2015-05-11 | 2020-06-09 | David Gordon Bermudes | Chimeric protein toxins for expression by therapeutic bacteria |
| EA201890423A1 (ru) | 2015-08-03 | 2018-07-31 | Биовератив Терапьютикс Инк. | Слитые белки фактора ix, способы их получения и применения |
| IL319047A (en) | 2015-08-28 | 2025-04-01 | Amunix Operating Inc | Chimeric polypeptide composition and methods for its preparation and use |
| NZ740534A (en) * | 2015-09-18 | 2019-07-26 | Univ Miyazaki | Long-acting adrenomedullin derivative |
| CN108884147B (zh) | 2015-09-23 | 2024-02-27 | 百时美施贵宝公司 | 结合磷脂酰肌醇蛋白聚糖3的基于纤连蛋白的支架分子 |
| CN110498851B (zh) * | 2015-11-10 | 2022-10-11 | 孙嘉琳 | 一种抗肿瘤蛋白内皮抑素的衍生物及应用 |
| JP2017165713A (ja) * | 2016-03-14 | 2017-09-21 | Jcrファーマ株式会社 | 血清アルブミン−20k成長ホルモン融合タンパク質 |
| US10994033B2 (en) | 2016-06-01 | 2021-05-04 | Bristol-Myers Squibb Company | Imaging methods using 18F-radiolabeled biologics |
| MX2019006444A (es) | 2016-12-02 | 2019-10-30 | Bioverativ Therapeutics Inc | Métodos de tratamiento de artropatía hemofílica utilizando factores de coagulación quiméricos. |
| US11180535B1 (en) | 2016-12-07 | 2021-11-23 | David Gordon Bermudes | Saccharide binding, tumor penetration, and cytotoxic antitumor chimeric peptides from therapeutic bacteria |
| US11129906B1 (en) | 2016-12-07 | 2021-09-28 | David Gordon Bermudes | Chimeric protein toxins for expression by therapeutic bacteria |
| US10350266B2 (en) | 2017-01-10 | 2019-07-16 | Nodus Therapeutics, Inc. | Method of treating cancer with a multiple integrin binding Fc fusion protein |
| AU2018207303A1 (en) | 2017-01-10 | 2019-07-25 | xCella Biosciences, Inc. | Combination tumor treatment with an integrin-binding-Fc fusion protein and immune modulator |
| US10767164B2 (en) | 2017-03-30 | 2020-09-08 | The Research Foundation For The State University Of New York | Microenvironments for self-assembly of islet organoids from stem cells differentiation |
| CN110090295B (zh) * | 2018-01-29 | 2022-12-23 | 武汉康理通科技有限公司 | Ephrin-B1在制备治疗炎症性肠病的药物中的用途 |
| US20210113606A1 (en) | 2018-02-12 | 2021-04-22 | Biontech Rna Pharmaceuticals Gmbh | Treatment using cytokine encoding rna |
| AU2019271148B9 (en) | 2018-05-14 | 2025-05-29 | Werewolf Therapeutics, Inc. | Activatable interleukin-2 polypeptides and methods of use thereof |
| WO2019222296A1 (en) | 2018-05-14 | 2019-11-21 | Werewolf Therapeutics, Inc. | Activatable interleukin 12 polypeptides and methods of use thereof |
| PL3793588T3 (pl) | 2018-05-18 | 2025-09-01 | Bioverativ Therapeutics Inc. | Sposoby leczenia hemofilii a |
| EP3806889A4 (en) | 2018-06-18 | 2022-07-13 | Anwita Biosciences, Inc. | CYTOKI FUSION PROTEINS AND USES THEREOF |
| MX2021000801A (es) | 2018-07-24 | 2021-04-12 | BioNTech SE | Agonistas de il2. |
| US20220002370A1 (en) | 2018-09-27 | 2022-01-06 | Xilio Development, Inc. | Masked cytokine polypeptides |
| AU2019346335B2 (en) | 2018-09-28 | 2024-07-25 | Massachusetts Institute Of Technology | Collagen-localized immunomodulatory molecules and methods thereof |
| EP3914289A1 (en) | 2019-01-23 | 2021-12-01 | Massachusetts Institute of Technology | Combination immunotherapy dosing regimen for immune checkpoint blockade |
| EP4414033A3 (en) | 2019-02-08 | 2024-10-30 | Biontech Cell & Gene Therapies Gmbh | Treatment involving car-engineered t cells and cytokines |
| WO2020187848A1 (en) | 2019-03-18 | 2020-09-24 | Biontech Cell & Gene Therapies Gmbh | Lnterleukin-2 receptor (il2r) and interleukin-2 (il2) variants for specific activation of immune effector cells |
| WO2020200481A1 (en) | 2019-04-05 | 2020-10-08 | Biontech Rna Pharmaceuticals Gmbh | Treatment involving interleukin-2 (il2) and interferon (ifn) |
| EP3955957A1 (en) | 2019-04-15 | 2022-02-23 | Qwixel Therapeutics LLC | Fusion protein composition(s) comprising targeted masked type i interferons (ifna and ifnb) and an antibody against tumor antigen, for use in the treatment of cancer |
| CN111944036B (zh) * | 2019-05-14 | 2024-09-06 | 上海盖浦生物科技有限公司 | 一种增殖免疫细胞的突变体蛋白 |
| EP3969035A4 (en) | 2019-05-14 | 2023-06-21 | Werewolf Therapeutics, Inc. | SEPARATION UNITS AND METHODS AND THEIR USE |
| TW202115105A (zh) | 2019-06-24 | 2021-04-16 | 德商拜恩迪克Rna製藥有限公司 | Il2激動劑 |
| WO2020263399A1 (en) | 2019-06-26 | 2020-12-30 | Massachusetts Institute Of Technology | Immunomodulatory fusion protein-metal hydroxide complexes and methods thereof |
| RU2714392C1 (ru) * | 2019-07-09 | 2020-02-14 | Екатерина Олеговна Кудасова | Способ модификации поверхности метилметакрилата стоматологического протеза низкотемпературной газоразрядной плазмой кислорода низкого давления за счет изменения контактного угла смачивания по воде и свободной поверхностной энергии |
| KR20220044534A (ko) | 2019-08-13 | 2022-04-08 | 엘피스 바이오파마슈티컬즈 | 조작된 인터류킨-2 수용체 베타 효능제 |
| WO2021058091A1 (en) | 2019-09-24 | 2021-04-01 | Biontech Rna Pharmaceuticals Gmbh | Treatment involving therapeutic antibody and interleukin-2 (il2) |
| MX2022005666A (es) | 2019-11-14 | 2022-10-07 | Werewolf Therapeutics Inc | Polipeptidos de citocina activables y metodos de uso de los mismos. |
| WO2021129927A1 (en) | 2019-12-23 | 2021-07-01 | Biontech Cell & Gene Therapies Gmbh | Treatment with immune effector cells engineered to express an antigen receptor |
| WO2021129945A1 (en) | 2019-12-27 | 2021-07-01 | Biontech Cell & Gene Therapies Gmbh | In vitro and in vivo gene delivery to immune effector cells using nanoparticles functionalized with designed ankyrin repeat proteins (darpins) |
| WO2021174045A1 (en) | 2020-02-28 | 2021-09-02 | Bristol-Myers Squibb Company | Radiolabeled fibronectin based scaffolds and antibodies and theranostic uses thereof |
| US20230405046A1 (en) | 2020-03-16 | 2023-12-21 | Biontech Cell & Gene Therapies Gmbh | Antigen-specific t cell receptors and t cell epitopes |
| WO2021197589A1 (en) | 2020-03-31 | 2021-10-07 | BioNTech SE | Treatment involving non-immunogenic rna for antigen vaccination |
| JPWO2022030580A1 (https=) * | 2020-08-06 | 2022-02-10 | ||
| KR102467827B1 (ko) * | 2020-08-31 | 2022-11-16 | 연세대학교 산학협력단 | 미생물 에어로졸화 과정 중 발생하는 손상 방지 방법 |
| WO2022115865A2 (en) | 2020-11-25 | 2022-06-02 | Xilio Development, Inc. | Tumor-specific cleavable linkers |
| WO2022135666A1 (en) | 2020-12-21 | 2022-06-30 | BioNTech SE | Treatment schedule for cytokine proteins |
| TW202245808A (zh) | 2020-12-21 | 2022-12-01 | 德商拜恩迪克公司 | 用於治療癌症之治療性rna |
| WO2022135667A1 (en) | 2020-12-21 | 2022-06-30 | BioNTech SE | Therapeutic rna for treating cancer |
| CN112753846B (zh) * | 2021-01-27 | 2023-08-29 | 吉林农业大学 | 一种超持水大豆分离蛋白凝胶及其制备方法 |
| AU2022256732A1 (en) | 2021-04-12 | 2023-10-19 | Biontech Delivery Technologies Gmbh | Rna compositions comprising a buffer substance and methods for preparing, storing and using the same |
| BR112023021654A2 (pt) | 2021-04-20 | 2023-12-26 | BioNTech SE | Vacina contra vírus |
| CA3218973A1 (en) * | 2021-05-14 | 2022-11-17 | Antlia Bioscience, Inc. | Modified b-type natriuretic peptide |
| CN113391067B (zh) * | 2021-06-16 | 2023-07-25 | 军事科学院军事医学研究院军事兽医研究所 | 抗尼帕病毒g蛋白抗体的间接elisa检测方法 |
| WO2023051926A1 (en) | 2021-09-30 | 2023-04-06 | BioNTech SE | Treatment involving non-immunogenic rna for antigen vaccination and pd-1 axis binding antagonists |
| EP4419136A1 (en) | 2021-10-21 | 2024-08-28 | BioNTech SE | Coronavirus vaccine |
| WO2023067193A2 (en) | 2021-10-22 | 2023-04-27 | BioNTech SE | Compositions for administration of different doses of rna |
| WO2023083434A1 (en) | 2021-11-09 | 2023-05-19 | BioNTech SE | Rna encoding peptidoglycan hydrolase and use thereof for treating bacterial infection |
| WO2023126053A1 (en) | 2021-12-28 | 2023-07-06 | BioNTech SE | Lipid-based formulations for administration of rna |
| WO2023141638A1 (en) * | 2022-01-21 | 2023-07-27 | The Methodist Hospital System | Methods for vascular regeneration and wound treatment |
| WO2023165681A1 (en) | 2022-03-01 | 2023-09-07 | BioNTech SE | Rna lipid nanoparticles (lnps) comprising a polyoxazoline and/or polyoxazine polymer |
| WO2023193892A1 (en) | 2022-04-05 | 2023-10-12 | BioNTech SE | Nucleic acid compositions comprising an inorganic polyphosphate and methods for preparing, storing and using the same |
| CN119731199A (zh) | 2022-05-10 | 2025-03-28 | 艾佩斯瑞生物制药公司 | 工程化的白细胞介素-2受体β降低结合的激动剂 |
| WO2024002985A1 (en) | 2022-06-26 | 2024-01-04 | BioNTech SE | Coronavirus vaccine |
| WO2024017479A1 (en) | 2022-07-21 | 2024-01-25 | BioNTech SE | Multifunctional cells transiently expressing an immune receptor and one or more cytokines, their use and methods for their production |
| AU2023317702A1 (en) | 2022-08-01 | 2025-01-09 | BioNTech SE | Nucleic acid compositions comprising amphiphilic oligo ethylene glycol (oeg)-conjugated compounds and methods of using such compounds and compositions |
| WO2024027910A1 (en) | 2022-08-03 | 2024-02-08 | BioNTech SE | Rna for preventing or treating tuberculosis |
| IL318534A (en) | 2022-08-03 | 2025-03-01 | BioNTech SE | RNA for preventing or treating tuberculosis |
| CN115960175A (zh) * | 2022-08-08 | 2023-04-14 | 江南大学 | 一种强化乳铁蛋白表达的毕赤酵母及其构建方法与应用 |
| WO2024080304A1 (ja) * | 2022-10-11 | 2024-04-18 | Jcrファーマ株式会社 | 血清アルブミンと生理活性を有する蛋白質との融合蛋白質 |
| WO2024080306A1 (ja) * | 2022-10-11 | 2024-04-18 | Jcrファーマ株式会社 | 血清アルブミンと生理活性を有する蛋白質との融合蛋白質 |
| WO2024153324A1 (en) | 2023-01-18 | 2024-07-25 | BioNTech SE | Rna formulations for pharmaceutical use |
| WO2024216212A1 (en) | 2023-04-14 | 2024-10-17 | BioNTech SE | Rna for preventing or treating tuberculosis |
| CN121398842A (zh) | 2023-04-14 | 2026-01-23 | 百欧恩泰欧洲股份公司 | 用于预防或治疗结核病的rna |
| WO2024213776A1 (en) | 2023-04-14 | 2024-10-17 | BioNTech SE | Rna for preventing or treating tuberculosis |
| AU2024308069A1 (en) | 2023-06-27 | 2026-02-05 | Firecyte Therapeutics, Inc. | Insulin-like growth factor binding protein like 1 (igfbpl1) compositions and methods of use thereof |
| WO2025021277A1 (en) | 2023-07-21 | 2025-01-30 | BioNTech SE | Agents and methods for targeted delivery of cytokines to immune cells |
| WO2025026866A1 (en) | 2023-07-28 | 2025-02-06 | BioNTech SE | Rna therapeutics with reduced toxicity |
| CN117511986B (zh) * | 2023-10-17 | 2026-04-10 | 广州立白企业集团有限公司 | 一种构建多基因改造酵母菌的方法及其应用 |
| WO2025106754A1 (en) | 2023-11-15 | 2025-05-22 | BioNTech SE | Coronavirus vaccine |
| WO2026082899A2 (en) | 2024-10-16 | 2026-04-23 | BioNTech SE | Rna for preventing or treating tuberculosis |
| CN120591344B (zh) * | 2025-06-13 | 2026-04-03 | 广州景旸生物科技有限公司 | Col3a1蛋白的制备方法及其应用 |
Citations (100)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4002531A (en) | 1976-01-22 | 1977-01-11 | Pierce Chemical Company | Modifying enzymes with polyethylene glycol and product produced thereby |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4444887A (en) | 1979-12-10 | 1984-04-24 | Sloan-Kettering Institute | Process for making human antibody producing B-lymphocytes |
| WO1984003564A1 (en) | 1983-03-08 | 1984-09-13 | Commw Serum Lab Commission | Method of determining antigenically active amino acid sequences |
| US4474893A (en) | 1981-07-01 | 1984-10-02 | The University of Texas System Cancer Center | Recombinant monoclonal antibodies |
| WO1986005807A1 (en) | 1985-04-01 | 1986-10-09 | Celltech Limited | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| EP0239400A2 (en) | 1986-03-27 | 1987-09-30 | Medical Research Council | Recombinant antibodies and methods for their production |
| US4714681A (en) | 1981-07-01 | 1987-12-22 | The Board Of Reagents, The University Of Texas System Cancer Center | Quadroma cells and trioma cells and methods for the production of same |
| US4716111A (en) | 1982-08-11 | 1987-12-29 | Trustees Of Boston University | Process for producing human antibodies |
| US4741900A (en) | 1982-11-16 | 1988-05-03 | Cytogen Corporation | Antibody-metal ion complexes |
| WO1989001036A1 (en) | 1987-07-23 | 1989-02-09 | Celltech Limited | Recombinant dna expression vectors |
| US4816397A (en) | 1983-03-25 | 1989-03-28 | Celltech, Limited | Multichain polypeptides or proteins and processes for their production |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0322094A1 (en) | 1987-10-30 | 1989-06-28 | Delta Biotechnology Limited | N-terminal fragments of human serum albumin |
| EP0330451A2 (en) | 1988-02-22 | 1989-08-30 | Toa Nenryo Kogyo Kabushiki Kaisha | A cDNA coding for human normal serum albumin a, and a process for production of the albumin |
| WO1989010404A1 (en) | 1988-04-18 | 1989-11-02 | Celltech Limited | Recombinant dna methods, vectors and host cells |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| EP0361991A2 (en) | 1988-08-05 | 1990-04-04 | Rhone-Poulenc Sante | Method for the microbiological preparation of human serum albumin and other heterologous proteins from a yeast |
| US4925648A (en) | 1988-07-29 | 1990-05-15 | Immunomedics, Inc. | Detection and treatment of infectious and inflammatory lesions |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| US4980286A (en) | 1985-07-05 | 1990-12-25 | Whitehead Institute For Biomedical Research | In vivo introduction and expression of foreign genetic material in epithelial cells |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| US4994560A (en) | 1987-06-24 | 1991-02-19 | The Dow Chemical Company | Functionalized polyamine chelants and radioactive rhodium complexes thereof for conjugation to antibodies |
| WO1991006657A1 (en) | 1989-10-25 | 1991-05-16 | Celltech Limited | Recombinant dna method and vectors for use therein |
| WO1991009967A1 (en) | 1989-12-21 | 1991-07-11 | Celltech Limited | Humanised antibodies |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| US5073627A (en) | 1989-08-22 | 1991-12-17 | Immunex Corporation | Fusion proteins comprising GM-CSF and IL-3 |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992005793A1 (en) | 1990-10-05 | 1992-04-16 | Medarex, Inc. | Targeted immunostimulation with bispecific reagents |
| WO1992008802A1 (en) | 1990-10-29 | 1992-05-29 | Cetus Oncology Corporation | Bispecific antibodies, method of production, and uses thereof |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1992022324A1 (en) | 1991-06-14 | 1992-12-23 | Xoma Corporation | Microbially-produced antibody fragments and their conjugates |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1993017715A1 (en) | 1992-03-05 | 1993-09-16 | Board Of Regents, The University Of Texas System | Diagnostic and/or therapeutic agents, targeted to neovascular endothelial cells |
| WO1993020242A1 (en) | 1992-03-30 | 1993-10-14 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US5274119A (en) | 1988-07-01 | 1993-12-28 | The Dow Chemical Company | Vicinal diols |
| US5283184A (en) | 1989-03-30 | 1994-02-01 | Dna Plant Technology Corporation | Genetic engineering of novel plant phenotypes |
| EP0592106A1 (en) | 1992-09-09 | 1994-04-13 | Immunogen Inc | Resurfacing of rodent antibodies |
| EP0598877A1 (en) | 1992-06-09 | 1994-06-01 | Hoppe Ag | Latch and lockset system |
| WO1994018318A1 (en) | 1993-02-01 | 1994-08-18 | The University Of North Carolina At Chapel Hill | Totally synthetic affinity reagents |
| US5342604A (en) | 1988-10-31 | 1994-08-30 | The Dow Chemical Company | Complexes possessing ortho ligating functionality |
| US5349052A (en) | 1988-10-20 | 1994-09-20 | Royal Free Hospital School Of Medicine | Process for fractionating polyethylene glycol (PEG)-protein adducts and an adduct for PEG and granulocyte-macrophage colony stimulating factor |
| WO1995006058A1 (en) | 1993-08-24 | 1995-03-02 | Polymasc Pharmaceuticals Plc | Polymer modification |
| US5413923A (en) | 1989-07-25 | 1995-05-09 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| US5428139A (en) | 1991-12-10 | 1995-06-27 | The Dow Chemical Company | Bicyclopolyazamacrocyclophosphonic acid complexes for use as radiopharmaceuticals |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5435990A (en) | 1988-06-24 | 1995-07-25 | The Dow Chemical Company | Macrocyclic congugates and their use as diagnostic and therapeutic agents |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US5441050A (en) | 1992-12-18 | 1995-08-15 | Neoprobe Corporation | Radiation responsive surgical instrument |
| US5482852A (en) | 1990-07-19 | 1996-01-09 | Regents Of The University Of California | Biologically safe plant transformation system |
| EP0693554A1 (en) | 1994-06-23 | 1996-01-24 | Massachusetts General Hospital | Crucifer aft proteins and uses thereof |
| US5489425A (en) | 1987-06-24 | 1996-02-06 | The Dow Chemical Company | Functionalized polyamine chelants |
| US5505931A (en) | 1993-03-04 | 1996-04-09 | The Dow Chemical Company | Acid cleavable compounds, their preparation and use as bifunctional acid-labile crosslinking agents |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5573920A (en) | 1991-04-26 | 1996-11-12 | Surface Active Limited | Antibodies, and methods for their use |
| WO1996040281A2 (en) | 1995-06-07 | 1996-12-19 | Alliance Pharmaceutical Corp. | Gas emulsions stabilized with fluorinated ethers having low ostwald coefficients |
| US5601819A (en) | 1988-08-11 | 1997-02-11 | The General Hospital Corporation | Bispecific antibodies for selective immune regulation and for selective immune cell binding |
| US5612460A (en) | 1989-04-19 | 1997-03-18 | Enzon, Inc. | Active carbonates of polyalkylene oxides for modification of polypeptides |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5643575A (en) | 1993-10-27 | 1997-07-01 | Enzon, Inc. | Non-antigenic branched polymer conjugates |
| US5652361A (en) | 1988-06-24 | 1997-07-29 | The Dow Chemical Company | Macrocyclic ligands and complexes |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1997033899A1 (en) | 1996-03-14 | 1997-09-18 | Human Genome Sciences, Inc. | Apoptosis inducing molecule i |
| WO1997034911A1 (en) | 1996-03-22 | 1997-09-25 | Human Genome Sciences, Inc. | Apoptosis inducing molecule ii |
| US5696239A (en) | 1988-10-31 | 1997-12-09 | The Dow Chemical Company | Conjugates possessing ortho ligating functionality and complexes thereof |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1998016654A1 (en) | 1996-10-11 | 1998-04-23 | Japan Tobacco, Inc. | Production of a multimeric protein by cell fusion method |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| US5756065A (en) | 1988-06-24 | 1998-05-26 | The Dow Chemical Company | Macrocyclic tetraazacyclododecane conjugates and their use as diagnostic and therapeutic agents |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| WO1998032466A1 (en) | 1997-01-29 | 1998-07-30 | Polymasc Pharmaceuticals Plc | Pegylation process |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| US5808003A (en) | 1989-05-26 | 1998-09-15 | Perimmune Holdings, Inc. | Polyaminocarboxylate chelators |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| WO1998046645A2 (en) | 1997-04-14 | 1998-10-22 | Micromet Gesellschaft Für Biomedizinische Forschung Mbh | Method for the production of antihuman antigen receptors and uses thereof |
| WO1998050433A2 (en) | 1997-05-05 | 1998-11-12 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| WO1999000504A1 (en) | 1997-06-26 | 1999-01-07 | Delta Biotechnology Limited | Improved protein expression strains |
| WO1999023105A1 (en) | 1997-11-03 | 1999-05-14 | Human Genome Sciences, Inc. | Vegi, an inhibitor of angiogenesis and tumor growth |
| US5985660A (en) | 1994-06-15 | 1999-11-16 | Systemix, Inc. | Method of identifying biological response modifiers involved in dendritic and/or lymphoid progenitor cell proliferation and/or differentiation |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
Family Cites Families (86)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2873012B2 (ja) * | 1987-04-09 | 1999-03-24 | デルタ バイオテクノロジー リミテッド | 酵母ベクター |
| PT88641B (pt) | 1987-10-02 | 1993-04-30 | Genentech Inc | Metodo para a preparacao de uma variante de adesao |
| AU4216689A (en) | 1988-08-11 | 1990-03-05 | California Biotechnology, Inc. | Method for stabilizing heterologous protein expression and vectors for use therein |
| US5705363A (en) * | 1989-03-02 | 1998-01-06 | The Women's Research Institute | Recombinant production of human interferon τ polypeptides and nucleic acids |
| US5766883A (en) * | 1989-04-29 | 1998-06-16 | Delta Biotechnology Limited | Polypeptides |
| FR2650598B1 (fr) * | 1989-08-03 | 1994-06-03 | Rhone Poulenc Sante | Derives de l'albumine a fonction therapeutique |
| KR100221066B1 (ko) | 1989-10-13 | 1999-10-01 | 스튜어트 엘.왓트 | 에리트로포이에틴 유사체와 그를 포함하는 제약학적 조성물 |
| US5667986A (en) * | 1989-10-18 | 1997-09-16 | Delta Biotechnology Limited | Yeast promoter for expressing heterologous polypeptides |
| US5545618A (en) * | 1990-01-24 | 1996-08-13 | Buckley; Douglas I. | GLP-1 analogs useful for diabetes treatment |
| GB9013017D0 (en) * | 1990-06-11 | 1990-08-01 | Mars Uk Ltd | Compounds |
| US5202239A (en) * | 1990-08-07 | 1993-04-13 | Scios Nova Inc. | Expression of recombinant polypeptides with improved purification |
| JPH07108232B2 (ja) | 1990-10-09 | 1995-11-22 | エム・ディ・リサーチ株式会社 | ペプチド又は蛋白質の製造方法 |
| US5646012A (en) * | 1991-04-30 | 1997-07-08 | Rhone-Poulenc Rorer S.A. | Yeast promoter and use thereof |
| FR2686620B1 (fr) * | 1992-01-27 | 1995-06-23 | Rhone Poulenc Rorer Sa | Serum-albumine humaine, preparation et utilisation. |
| FR2686899B1 (fr) * | 1992-01-31 | 1995-09-01 | Rhone Poulenc Rorer Sa | Nouveaux polypeptides biologiquement actifs, leur preparation et compositions pharmaceutiques les contenant. |
| FR2686900B1 (fr) * | 1992-01-31 | 1995-07-21 | Rhone Poulenc Rorer Sa | Nouveaux polypeptides ayant une activite de stimulation des colonies de granulocytes, leur preparation et compositions pharmaceutiques les contenant. |
| DK0955062T3 (da) | 1992-07-31 | 2007-09-17 | Genentech Inc | Vandig formulering indeholdende humant væksthormon |
| DK82893D0 (da) * | 1993-07-08 | 1993-07-08 | Novo Nordisk As | Peptid |
| US5512459A (en) | 1993-07-20 | 1996-04-30 | Bionebraska, Inc. | Enzymatic method for modification or recombinant polypeptides |
| US5705483A (en) * | 1993-12-09 | 1998-01-06 | Eli Lilly And Company | Glucagon-like insulinotropic peptides, compositions and methods |
| DK144093D0 (https=) * | 1993-12-23 | 1993-12-23 | Novo Nordisk As | |
| US5639642A (en) * | 1994-06-16 | 1997-06-17 | Novo Nordisk A/S | Synthetic leader peptide sequences |
| US5574008A (en) * | 1994-08-30 | 1996-11-12 | Eli Lilly And Company | Biologically active fragments of glucagon-like insulinotropic peptide |
| US5512549A (en) * | 1994-10-18 | 1996-04-30 | Eli Lilly And Company | Glucagon-like insulinotropic peptide analogs, compositions, and methods of use |
| GB9526733D0 (en) * | 1995-12-30 | 1996-02-28 | Delta Biotechnology Ltd | Fusion proteins |
| US6110707A (en) * | 1996-01-19 | 2000-08-29 | Board Of Regents, The University Of Texas System | Recombinant expression of proteins from secretory cell lines |
| WO1997026321A2 (en) | 1996-01-19 | 1997-07-24 | Board Of Regents, The University Of Texas System | Recombinant expression of proteins from secretory cell lines |
| US6087129A (en) * | 1996-01-19 | 2000-07-11 | Betagene, Inc. | Recombinant expression of proteins from secretory cell lines |
| DE69740176D1 (de) | 1996-03-01 | 2011-05-26 | Novo Nordisk As | Appetithemmendes Peptid, Zusammensetzung und Verwendung |
| US5912229A (en) * | 1996-03-01 | 1999-06-15 | Novo Nordisk Als | Use of a pharmaceutical composition comprising an appetite-suppressing peptide |
| US6300065B1 (en) * | 1996-05-31 | 2001-10-09 | Board Of Trustees Of The University Of Illinois | Yeast cell surface display of proteins and uses thereof |
| US6110703A (en) * | 1996-07-05 | 2000-08-29 | Novo Nordisk A/S | Method for the production of polypeptides |
| WO1998005782A1 (en) * | 1996-08-02 | 1998-02-12 | Zymogenetics, Inc. | Testis-specific insulin homolog polypeptides |
| US6458924B2 (en) * | 1996-08-30 | 2002-10-01 | Novo Nordisk A/S | Derivatives of GLP-1 analogs |
| US6277819B1 (en) | 1996-08-30 | 2001-08-21 | Eli Lilly And Company | Use of GLP-1 or analogs in treatment of myocardial infarction |
| US6006753A (en) * | 1996-08-30 | 1999-12-28 | Eli Lilly And Company | Use of GLP-1 or analogs to abolish catabolic changes after surgery |
| AU4199597A (en) | 1996-09-09 | 1998-04-02 | Novo Nordisk A/S | A cdna and peptide with relation to cancer and weight loss |
| AU7364696A (en) | 1996-09-18 | 1998-04-14 | Human Genome Sciences, Inc. | Human tumor necrosis factor receptor-like genes |
| EP1306092A3 (en) | 1996-11-05 | 2003-05-07 | Eli Lilly & Company | Use of GLP-1 and analogs administered peripherally, in regulation of obesity |
| UA65549C2 (uk) * | 1996-11-05 | 2004-04-15 | Елі Ліллі Енд Компані | Спосіб регулювання ожиріння шляхом периферійного введення аналогів та похідних glp-1 (варіанти) та фармацевтична композиція |
| DE69732572T2 (de) | 1996-11-12 | 2005-12-29 | Novo Nordisk A/S | Verwendung von glp-1 peptiden |
| EP0954589A1 (en) | 1997-01-24 | 1999-11-10 | Novo Nordisk A/S | Synthetic leader peptide sequences |
| US20030049618A1 (en) * | 1997-03-07 | 2003-03-13 | Ruben Steven M. | 186 human secreted proteins |
| US6420526B1 (en) * | 1997-03-07 | 2002-07-16 | Human Genome Sciences, Inc. | 186 human secreted proteins |
| US20060084082A1 (en) * | 1997-03-07 | 2006-04-20 | Human Genome Sciences, Inc. | 186 human secreted proteins |
| US20030175858A1 (en) * | 1997-03-07 | 2003-09-18 | Ruben Steven M. | 186 human secreted proteins |
| US20030065139A1 (en) * | 1998-03-19 | 2003-04-03 | Craig A. Rosen | Secreted protein hmmbd35 |
| US5981488A (en) * | 1997-03-31 | 1999-11-09 | Eli Lillly And Company | Glucagon-like peptide-1 analogs |
| NZ503343A (en) | 1997-09-17 | 2002-09-27 | Genentech Inc | Secreted and transmembrane polypeptides and use to induce apoptosis of tumour cells |
| WO1999043706A1 (en) | 1998-02-27 | 1999-09-02 | Novo Nordisk A/S | Derivatives of glp-1 analogs |
| US7205280B2 (en) * | 1998-03-11 | 2007-04-17 | Cognosci, Inc. | Methods of suppressing microglial activation |
| DE69933216T2 (de) * | 1998-06-15 | 2007-09-20 | GTC Biotherapeutics, Inc., Framingham | Erythropoietin-analog-menschliches serum-albumin fusionsprotein |
| MY155270A (en) | 1998-09-24 | 2015-09-30 | Lilly Co Eli | Use of glp-1 or analogs in treatment of stroke |
| US7259136B2 (en) | 1999-04-30 | 2007-08-21 | Amylin Pharmaceuticals, Inc. | Compositions and methods for treating peripheral vascular disease |
| US6514500B1 (en) * | 1999-10-15 | 2003-02-04 | Conjuchem, Inc. | Long lasting synthetic glucagon like peptide {GLP-!} |
| BR0010750A (pt) | 1999-05-17 | 2002-02-26 | Conjuchem Inc | Peptìdeos insulinotrópicos de longa duração |
| CA2376641A1 (en) | 1999-07-19 | 2001-01-25 | Aaron Morris | Chimeric polypeptides of serum albumin and uses related thereto |
| US20020048571A1 (en) | 1999-07-19 | 2002-04-25 | Jeno Gyuris | Chimeric polypeptides of serum albumin and uses related thereto |
| EP2213743A1 (en) | 2000-04-12 | 2010-08-04 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| CN103356996A (zh) | 2000-05-19 | 2013-10-23 | 埃米林药品公司 | Glp-1用于制备治疗急性冠脉综合征的药物的用途 |
| NZ519752A (en) | 2000-10-20 | 2005-04-29 | Amylin Pharmaceuticals Inc | Treatment of hibernating myocardium and diabetic cardiomyopathy with a GLP-1 peptide |
| US7101561B2 (en) * | 2000-12-01 | 2006-09-05 | Innogenetics N.V. | Purified hepatitis C virus envelope proteins for diagnostic and therapeutic use |
| IL155812A0 (en) * | 2000-12-07 | 2003-12-23 | Lilly Co Eli | Glp-1 fusion proteins |
| WO2002097038A2 (en) | 2001-05-25 | 2002-12-05 | Human Genome Sciences, Inc. | Chemokine beta-1 fusion proteins |
| AU2002322403A1 (en) | 2001-08-23 | 2003-03-10 | Eli Lilly And Company | Glucagon-like peptide-1 analogs |
| WO2003042354A2 (en) * | 2001-09-04 | 2003-05-22 | Aventis Pharmaceuticals Inc. | Abrogen polypeptides, nucleic acids encoding them and methods for using them to inhibit angiogenesis |
| AU2002332041A1 (en) * | 2001-10-05 | 2003-04-22 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| ES2411007T3 (es) * | 2001-10-10 | 2013-07-04 | Novo Nordisk A/S | Remodelación y glicoconjugación de péptidos |
| AU2002364586A1 (en) * | 2001-12-21 | 2003-07-30 | Delta Biotechnology Limited | Albumin fusion proteins |
| WO2003059934A2 (en) * | 2001-12-21 | 2003-07-24 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| WO2003054182A2 (en) * | 2001-12-21 | 2003-07-03 | Nexia Biotechnologies, Inc. | Production of butyrylcholinesterases in transgenic mammals |
| KR101271635B1 (ko) * | 2001-12-21 | 2013-06-12 | 휴먼 게놈 사이언시즈, 인코포레이티드 | 알부민 융합 단백질 |
| WO2005003296A2 (en) * | 2003-01-22 | 2005-01-13 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US20080167238A1 (en) * | 2001-12-21 | 2008-07-10 | Human Genome Sciences, Inc. | Albumin Fusion Proteins |
| WO2003084563A1 (en) | 2002-04-04 | 2003-10-16 | Novo Nordisk A/S | Glp-1 agonist and cardiovascular complications |
| CN1241946C (zh) * | 2002-07-01 | 2006-02-15 | 美国福源集团 | 对多种细胞具刺激增生作用的人血清白蛋白重组融合蛋白 |
| DK1641823T3 (da) | 2003-06-12 | 2011-12-12 | Lilly Co Eli | GLP-1-analog fusionsproteiner |
| HUE027902T2 (en) | 2004-02-09 | 2016-11-28 | Human Genome Sciences Inc Corp Service Company | Albumin fusion proteins |
| US20070270339A1 (en) * | 2004-04-23 | 2007-11-22 | Serono, Inc. | Use of GPCR54 Ligands for the Treatment of Infertility |
| CA2599594A1 (en) | 2004-12-24 | 2006-07-13 | Amylin Pharmaceuticals, Inc. | Use of glp-1 and agonists thereof to prevent cardiac myocyte apoptosis |
| DK1888103T3 (da) | 2005-04-11 | 2012-04-23 | Amylin Pharmaceuticals Inc | Anvendelse af glp-1, exendin og agonister deraf til forsinkelse eller forhindring af kardial remodellering |
| WO2007021494A2 (en) | 2005-08-12 | 2007-02-22 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| WO2007139941A2 (en) | 2006-05-26 | 2007-12-06 | Amylin Pharmaceuticals, Inc. | Composition and methods for treatment of congestive heart failure |
| WO2007146038A2 (en) | 2006-06-07 | 2007-12-21 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| WO2008019143A2 (en) | 2006-08-04 | 2008-02-14 | Amylin Pharmaceuticals, Inc | Use of exendins and glp-i receptor agonists for altering lipoprotein particle size and subclass composition |
| JP5005450B2 (ja) * | 2007-07-13 | 2012-08-22 | 本田技研工業株式会社 | 燃料給油管の口元内部構造 |
-
2005
- 2005-02-09 HU HUE05722848A patent/HUE027902T2/en unknown
- 2005-02-09 AU AU2005211725A patent/AU2005211725B2/en not_active Ceased
- 2005-02-09 MX MXPA06009072A patent/MXPA06009072A/es active IP Right Grant
- 2005-02-09 SI SI200532048T patent/SI1729795T1/sl unknown
- 2005-02-09 CA CA2554089A patent/CA2554089C/en not_active Expired - Fee Related
- 2005-02-09 WO PCT/US2005/004041 patent/WO2005077042A2/en not_active Ceased
- 2005-02-09 PL PL05722848T patent/PL1729795T3/pl unknown
- 2005-02-09 ES ES05722848.8T patent/ES2567634T3/es not_active Expired - Lifetime
- 2005-02-09 KR KR1020067018484A patent/KR101184391B1/ko not_active Expired - Fee Related
- 2005-02-09 CN CN201210139189.3A patent/CN102816241B/zh not_active Expired - Fee Related
- 2005-02-09 DK DK05722848.8T patent/DK1729795T3/en active
- 2005-02-09 EP EP05722848.8A patent/EP1729795B1/en not_active Expired - Lifetime
- 2005-02-09 BR BRPI0507026-0A patent/BRPI0507026A/pt not_active Application Discontinuation
- 2005-02-09 NZ NZ548612A patent/NZ548612A/en not_active IP Right Cessation
- 2005-02-09 JP JP2006553197A patent/JP5010923B2/ja not_active Expired - Fee Related
-
2006
- 2006-07-17 IL IL176894A patent/IL176894A/en active IP Right Grant
- 2006-08-08 US US11/500,508 patent/US7569384B2/en not_active Expired - Fee Related
- 2006-08-08 US US11/500,314 patent/US20070048282A1/en not_active Abandoned
- 2006-09-08 NO NO20064059A patent/NO20064059L/no not_active Application Discontinuation
- 2006-09-08 MA MA29305A patent/MA28565B1/fr unknown
-
2009
- 2009-08-03 US US12/534,585 patent/US8143026B2/en not_active Expired - Fee Related
-
2010
- 2010-10-07 AU AU2010227035A patent/AU2010227035A1/en not_active Abandoned
-
2012
- 2012-02-28 JP JP2012041914A patent/JP5568582B2/ja not_active Expired - Fee Related
-
2016
- 2016-04-18 CY CY20161100318T patent/CY1117401T1/el unknown
Patent Citations (112)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4002531A (en) | 1976-01-22 | 1977-01-11 | Pierce Chemical Company | Modifying enzymes with polyethylene glycol and product produced thereby |
| US4444887A (en) | 1979-12-10 | 1984-04-24 | Sloan-Kettering Institute | Process for making human antibody producing B-lymphocytes |
| US4474893A (en) | 1981-07-01 | 1984-10-02 | The University of Texas System Cancer Center | Recombinant monoclonal antibodies |
| US4714681A (en) | 1981-07-01 | 1987-12-22 | The Board Of Reagents, The University Of Texas System Cancer Center | Quadroma cells and trioma cells and methods for the production of same |
| US4716111A (en) | 1982-08-11 | 1987-12-29 | Trustees Of Boston University | Process for producing human antibodies |
| US4741900A (en) | 1982-11-16 | 1988-05-03 | Cytogen Corporation | Antibody-metal ion complexes |
| WO1984003564A1 (en) | 1983-03-08 | 1984-09-13 | Commw Serum Lab Commission | Method of determining antigenically active amino acid sequences |
| US4816397A (en) | 1983-03-25 | 1989-03-28 | Celltech, Limited | Multichain polypeptides or proteins and processes for their production |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| WO1986005807A1 (en) | 1985-04-01 | 1986-10-09 | Celltech Limited | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same |
| US4980286A (en) | 1985-07-05 | 1990-12-25 | Whitehead Institute For Biomedical Research | In vivo introduction and expression of foreign genetic material in epithelial cells |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US5122464A (en) | 1986-01-23 | 1992-06-16 | Celltech Limited, A British Company | Method for dominant selection in eucaryotic cells |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| EP0239400A2 (en) | 1986-03-27 | 1987-09-30 | Medical Research Council | Recombinant antibodies and methods for their production |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US4994560A (en) | 1987-06-24 | 1991-02-19 | The Dow Chemical Company | Functionalized polyamine chelants and radioactive rhodium complexes thereof for conjugation to antibodies |
| US5489425A (en) | 1987-06-24 | 1996-02-06 | The Dow Chemical Company | Functionalized polyamine chelants |
| WO1989001036A1 (en) | 1987-07-23 | 1989-02-09 | Celltech Limited | Recombinant dna expression vectors |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| EP0322094A1 (en) | 1987-10-30 | 1989-06-28 | Delta Biotechnology Limited | N-terminal fragments of human serum albumin |
| EP0330451A2 (en) | 1988-02-22 | 1989-08-30 | Toa Nenryo Kogyo Kabushiki Kaisha | A cDNA coding for human normal serum albumin a, and a process for production of the albumin |
| WO1989010404A1 (en) | 1988-04-18 | 1989-11-02 | Celltech Limited | Recombinant dna methods, vectors and host cells |
| US5435990A (en) | 1988-06-24 | 1995-07-25 | The Dow Chemical Company | Macrocyclic congugates and their use as diagnostic and therapeutic agents |
| US5652361A (en) | 1988-06-24 | 1997-07-29 | The Dow Chemical Company | Macrocyclic ligands and complexes |
| US5756065A (en) | 1988-06-24 | 1998-05-26 | The Dow Chemical Company | Macrocyclic tetraazacyclododecane conjugates and their use as diagnostic and therapeutic agents |
| US5274119A (en) | 1988-07-01 | 1993-12-28 | The Dow Chemical Company | Vicinal diols |
| US4925648A (en) | 1988-07-29 | 1990-05-15 | Immunomedics, Inc. | Detection and treatment of infectious and inflammatory lesions |
| EP0361991A2 (en) | 1988-08-05 | 1990-04-04 | Rhone-Poulenc Sante | Method for the microbiological preparation of human serum albumin and other heterologous proteins from a yeast |
| US5601819A (en) | 1988-08-11 | 1997-02-11 | The General Hospital Corporation | Bispecific antibodies for selective immune regulation and for selective immune cell binding |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5349052A (en) | 1988-10-20 | 1994-09-20 | Royal Free Hospital School Of Medicine | Process for fractionating polyethylene glycol (PEG)-protein adducts and an adduct for PEG and granulocyte-macrophage colony stimulating factor |
| US5714631A (en) | 1988-10-31 | 1998-02-03 | The Dow Chemical Company | Conjugates possessing ortho ligating functionality |
| US5696239A (en) | 1988-10-31 | 1997-12-09 | The Dow Chemical Company | Conjugates possessing ortho ligating functionality and complexes thereof |
| US5342604A (en) | 1988-10-31 | 1994-08-30 | The Dow Chemical Company | Complexes possessing ortho ligating functionality |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5283184A (en) | 1989-03-30 | 1994-02-01 | Dna Plant Technology Corporation | Genetic engineering of novel plant phenotypes |
| US5612460A (en) | 1989-04-19 | 1997-03-18 | Enzon, Inc. | Active carbonates of polyalkylene oxides for modification of polypeptides |
| US5808003A (en) | 1989-05-26 | 1998-09-15 | Perimmune Holdings, Inc. | Polyaminocarboxylate chelators |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| US5413923A (en) | 1989-07-25 | 1995-05-09 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| US5073627A (en) | 1989-08-22 | 1991-12-17 | Immunex Corporation | Fusion proteins comprising GM-CSF and IL-3 |
| WO1991006657A1 (en) | 1989-10-25 | 1991-05-16 | Celltech Limited | Recombinant dna method and vectors for use therein |
| WO1991009967A1 (en) | 1989-12-21 | 1991-07-11 | Celltech Limited | Humanised antibodies |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| US6114598A (en) | 1990-01-12 | 2000-09-05 | Abgenix, Inc. | Generation of xenogeneic antibodies |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5482852A (en) | 1990-07-19 | 1996-01-09 | Regents Of The University Of California | Biologically safe plant transformation system |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| WO1992005793A1 (en) | 1990-10-05 | 1992-04-16 | Medarex, Inc. | Targeted immunostimulation with bispecific reagents |
| WO1992008802A1 (en) | 1990-10-29 | 1992-05-29 | Cetus Oncology Corporation | Bispecific antibodies, method of production, and uses thereof |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| US5658727A (en) | 1991-04-10 | 1997-08-19 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| US5573920A (en) | 1991-04-26 | 1996-11-12 | Surface Active Limited | Antibodies, and methods for their use |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| WO1992022324A1 (en) | 1991-06-14 | 1992-12-23 | Xoma Corporation | Microbially-produced antibody fragments and their conjugates |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5428139A (en) | 1991-12-10 | 1995-06-27 | The Dow Chemical Company | Bicyclopolyazamacrocyclophosphonic acid complexes for use as radiopharmaceuticals |
| WO1993017715A1 (en) | 1992-03-05 | 1993-09-16 | Board Of Regents, The University Of Texas System | Diagnostic and/or therapeutic agents, targeted to neovascular endothelial cells |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1993020242A1 (en) | 1992-03-30 | 1993-10-14 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
| EP0598877A1 (en) | 1992-06-09 | 1994-06-01 | Hoppe Ag | Latch and lockset system |
| EP0592106A1 (en) | 1992-09-09 | 1994-04-13 | Immunogen Inc | Resurfacing of rodent antibodies |
| US5441050A (en) | 1992-12-18 | 1995-08-15 | Neoprobe Corporation | Radiation responsive surgical instrument |
| WO1994018318A1 (en) | 1993-02-01 | 1994-08-18 | The University Of North Carolina At Chapel Hill | Totally synthetic affinity reagents |
| US5505931A (en) | 1993-03-04 | 1996-04-09 | The Dow Chemical Company | Acid cleavable compounds, their preparation and use as bifunctional acid-labile crosslinking agents |
| WO1995006058A1 (en) | 1993-08-24 | 1995-03-02 | Polymasc Pharmaceuticals Plc | Polymer modification |
| US5643575A (en) | 1993-10-27 | 1997-07-01 | Enzon, Inc. | Non-antigenic branched polymer conjugates |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| US5985660A (en) | 1994-06-15 | 1999-11-16 | Systemix, Inc. | Method of identifying biological response modifiers involved in dendritic and/or lymphoid progenitor cell proliferation and/or differentiation |
| EP0693554A1 (en) | 1994-06-23 | 1996-01-24 | Massachusetts General Hospital | Crucifer aft proteins and uses thereof |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996040281A2 (en) | 1995-06-07 | 1996-12-19 | Alliance Pharmaceutical Corp. | Gas emulsions stabilized with fluorinated ethers having low ostwald coefficients |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| WO1997033899A1 (en) | 1996-03-14 | 1997-09-18 | Human Genome Sciences, Inc. | Apoptosis inducing molecule i |
| WO1997034911A1 (en) | 1996-03-22 | 1997-09-25 | Human Genome Sciences, Inc. | Apoptosis inducing molecule ii |
| US5916771A (en) | 1996-10-11 | 1999-06-29 | Abgenix, Inc. | Production of a multimeric protein by cell fusion method |
| WO1998016654A1 (en) | 1996-10-11 | 1998-04-23 | Japan Tobacco, Inc. | Production of a multimeric protein by cell fusion method |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| WO1998032466A1 (en) | 1997-01-29 | 1998-07-30 | Polymasc Pharmaceuticals Plc | Pegylation process |
| WO1998046645A2 (en) | 1997-04-14 | 1998-10-22 | Micromet Gesellschaft Für Biomedizinische Forschung Mbh | Method for the production of antihuman antigen receptors and uses thereof |
| WO1998050433A2 (en) | 1997-05-05 | 1998-11-12 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| WO1999000504A1 (en) | 1997-06-26 | 1999-01-07 | Delta Biotechnology Limited | Improved protein expression strains |
| WO1999023105A1 (en) | 1997-11-03 | 1999-05-14 | Human Genome Sciences, Inc. | Vegi, an inhibitor of angiogenesis and tumor growth |
Non-Patent Citations (152)
| Title |
|---|
| "Currentprotocol in Molecular Biology", 1989, GREEN PUBLISHING ASSOCIATES, INC., AND JOHN WILEY & SONS INC., pages: 6.3.1 - 6.3.6,2. |
| "DNA cloning", vol. 3, 1987, ACADEMIC PRESS |
| "LISOPOSOMES IN THE THERAPY OF INFECTIOUS DISEASE AND CANCER", pages: 317 - 327 |
| "Methods in Enzymology", vol. 153, 1987, ACADEMIC PRESS, article "Recombinant DNA Part D" |
| "Monoclonal Antibodies For Cancer Detection And Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, And Future Prospective Of The Therapeutic Use OfRadiolabeled Antibody In Cancer Therapy", pages: 303 - 16 |
| AMES ET AL., 1. IMMUNOL. METHODS, vol. 184, 1995, pages 177 - 186 |
| AMOAH, J. ANIMAL SCIENCE, vol. 75, no. 2, 1997, pages 578 - 585 |
| AMON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy", pages: 243 - 56 |
| AUSUBEL ET AL,: "Current Protocols in Molecular Biology", vol. I, 1994, JOHN WILEY & SONS, INC. |
| AUSUBEL ET AL,: "Current Protocols in Molecular Biology", vol. I, 1994, JOHN WILEY & SONS, INC., pages: 10.16.1 |
| AUSUBEL ET AL,: "Current Protocols in Molecular Biology", vol. I, 1994, JOHN WILEY & SONS, INC., pages: 10.8.1 |
| AUSUBEL ET AL,: "Current Protocols in Molecular Biology", vol. I, 1994, JOHN WILEY & SONS, INC., pages: 11.2.1 |
| AUSUBEL ET AL.,: "Current Protocols in Molecular Biology", 1998, JOHN WILEY & SONS |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1993, JOHN WILEY & SONS |
| BARTUNEK ET AL., CYTOKINE, vol. 8, no. 1, 1996, pages 14 - 20 |
| BEBBINGTON ET AL., BIOLTECHNOLOGY, vol. 10, 1992, pages 169 |
| BETTER ET AL., SCIENCE, vol. 240, 1988, pages 1041 - 1043 |
| BIBLIA; ROBINSON, BIOTECHNOL. PROG., vol. 11, 1995, pages 1 |
| BIRD, SCIENCE, vol. 242, 1988, pages 423 - 42 |
| BRENNER; LERNER, PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 5381 - 5383 |
| BRINKMA ET AL., J. IMMUNOL. METHODS, vol. 182, 1995, pages 41 - 50 |
| BUCHWALD ET AL., SURGERY, vol. 88, 1980, pages 507 |
| BURTON ET AL., ADVANCES IN IMMUNOLOGY, vol. 57, 1994, pages 191 - 280 |
| CALICETI ET AL., BIOCONJUG. CHERN., vol. 10, 1999, pages 638 - 646 |
| CARLSON ET AL., J. BIOI. CHERN., vol. 272, no. 17, 1997, pages 11295 - 11301 |
| CHEN ET AL., CANCER RES., vol. 58, no. 16, 1998, pages 3668 - 3678 |
| CHOTHIA ET AL., J. MOL. BIOI., vol. 278, 1998, pages 457 - 479 |
| CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883 |
| CHOTHIA; LESK, J MOL. BIOI., vol. 196, 1987, pages 901 - 917 |
| CHRISTIAN ET AL., J. MOL. BIOI., vol. 227, 1992, pages 711 - 718 |
| CLARK ET AL., BIOTECHNOLOGY, vol. 7, 1989, pages 487 - 492 |
| COLBERRE-GARAPIN ET AL., J. MOL. BIOI., vol. 150, 1981, pages 1 |
| COLIGAN ET AL.,: "Current Protocols in Immunology", 1994, JOHN WILEY & SONS |
| CROUSE ET AL., MOL. CELL. BIOL., vol. 3, 1983, pages 257 |
| CULL ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 1865 - 1869 |
| CWIRLA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 6378 - 6382 |
| DELGADO ET AL., CRIT. REV. THERA. DRUG CARRIER SYS., vol. 9, 1992, pages 249 - 304 |
| DELGADO, CRIT. REV. THERA. DRUG CARRIER SYS., vol. 9, 1992, pages 249 - 304 |
| DENG ET AL., BLOOD, vol. 92, no. 6, 1998, pages 1981 - 1988 |
| DEVLIN ET AL., SCIENCE, vol. 249, 1990, pages 404 - 406 |
| DEVLIN, SCIENCE, vol. 249, 1990, pages 404 - 406 |
| DITULLIO, BIOTECHNOLOGY, vol. 10, 1992, pages 74 - 77 |
| DRACOPOLI ET AL.: "Current Protocols in Human Genetics", 1994, JOHN WILEY & SONS |
| DURING ET AL., ANN. NEUROL, vol. 25, 1989, pages 351 |
| ERB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 11422 - 11426 |
| FELICI, J. MOL. BIOI., vol. 222, 1991, pages 301 - 310 |
| FODOR ET AL., SCIENCE, vol. 251, 1991, pages 767 - 773 |
| FODOR, NATURE, vol. 364, 1993, pages 555 - 556 |
| FRANCIS ET AL., INTERN. J. OF HEMATOL., vol. 68, 1998, pages 1 - 18 |
| GALLOP ET AL., J. MEDICINAL CHEMISTRY, vol. 37, no. 9, 1994, pages 1233 - 1251 |
| GANDERTON; JONES: "Drug Delivery to the Respiratory Tract", 1987, ELLIS HORWOOD |
| GENTZ ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 821 - 824 |
| GILLIES ET AL., J. IMMUNOL. METHODS, vol. 125, 1989, pages 191 - 202 |
| GONDA, CRITICAL REVIEWS IN THERAPEUTIC DRUG CARRIER SYSTEMS, vol. 6, 1990, pages 273 - 313 |
| GOODSON, MEDICAL APPLICATIONS OF CONTROLLED RELEASE, vol. 2, 1984, pages 115 - 138 |
| GORTON ET AL., BIOTECHNOLOGY, vol. 5, 1987, pages 1183 - 1187 |
| GRESSER ET AL., NATURE, vol. 251, 1974, pages 543 - 545 |
| HAMMERLING ET AL.: "Monoclonal Antibodies and T-Cell Hybridomas", 1981, ELSEVIER, pages: 563 - 681 |
| HARLOW ET AL.: "Antibodies: A Laboratory Manual, 2nd ed.", 1988, COLD SPRING HARBOR LABORATORY PRESS |
| HARROP ET, J. LMMUNOL., vol. 161, no. 4, 1998, pages 1786 - 1794 |
| HELLSTROM ET AL.: "Controlled Drug Delivery", 1987, MARCEL DEKKER, INC., article "Antibodies For Drug Delivery", pages: 623 - 53 |
| HOLLIGER ET AL.: "Diabodies': small bivalent and bispecific antibody fragments", PNAS USA, vol. 90, 1993, pages 6444 - 6448 |
| HOUDEBME, KEPROD. NUTR. DEV., vol. 35, no. 6, 1995, pages 609 - 617 |
| HOUGHTEN ET AL., BIOTECHNIQUES, vol. 13, 1992, pages 412 |
| HOUGHTEN ET AL., NATURE, vol. 354, 1991, pages 84 - 86 |
| HOUGHTEN, BIOFFECHNIQUES, vol. 13, 1992, pages 412 - 421 |
| HOWARD ET AL., J.NEUROSURG., vol. 71, 1989, pages 105 |
| HSU ET AL., J. HISTOCHEM. CYTOCHEM., vol. 29, 1981, pages 577 - 580 |
| HUSTON ET AL., METHODS IN ENZYMOLOGY, vol. 203, 1991, pages 46 - 88 |
| HUSTON ET AL., PROC. NAT. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| JALKANEN ET AL., J. CELL. BIOI., vol. 101, 1985, pages 976 - 985 |
| JALKANEN ET AL., J. CELL. BIOI., vol. 105, 1987, pages 3087 - 3096 |
| JAYAWICKREME ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 1614 - 1618 |
| JESPERS ET AL., BIO/TECHNOLOGY, vol. 12, 1988, pages 899 - 903 |
| JOHNSON, TEXAS REPORTS BIOI MED, vol. 35, 1977, pages 357 - 369 |
| JOLIOT ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 1864 - 1868 |
| KABAT: "Sequences of Proteins of Immunological interest", 1987, NATIONAL INSTITUTES OF HEALTH |
| KAY ET AL., GENE, vol. 128, 1993, pages 59 - 65 |
| KETTLEBOROUGH ET AL., EUR. J. IMMUNOL., vol. 24, 1994, pages 952 - 958 |
| KOHLER, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 2197 |
| KOSTELNY ET AL., J JMMUNOL., vol. 148, 1992, pages 1547 - 1553 |
| KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553 |
| KRIEGLER: "Gene Transfer and Expression, A Laboratory Manual", 1990, STOCKTON PRESS |
| KUTMEIER ET AL., BIOTECHNIQUES, vol. 17, 1994, pages 242 |
| LAM ET AL., NATURE, vol. 354, 1991, pages 82 - 84 |
| LAM, NATURE, vol. 354, 1991, pages 82 - 84 |
| LANGER AND WISE: "Medical Applications of Controlled Release", 1974, CRC PRES |
| LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533 |
| LEBLEU ET AL., PNAS USA, vol. 73, 1976, pages 3107 - 3111 |
| LENSTRA, J. IMMUNOL. METH, vol. 152, 1992, pages 149 - 157 |
| LEVY ET AL., SCIENCE, vol. 228, 1985, pages 190 |
| LIAUTARD ET AL., CYTOKINE, vol. 9, no. 4, 1997, pages 233 - 241 |
| LONBERG; HUSZAR, INT. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93 |
| MALIK ET AL., EXP. HEMATOL., vol. 20, 1992, pages 1028 - 1035 |
| MEDYNSKI, BIO/TECHNOLOGY, vol. 12, 1994, pages 709 - 710 |
| MORPURGO ET AL., APPL. BIOCHEM. BIOTECHNOL., vol. 56, 1996, pages 59 - 72 |
| MORRISON ET AL., CELL, vol. 96, 1999, pages 737 - 49 |
| MORRISON ET AL., PROC. NATL. ACAD. SCI., vol. 81, 1984, pages 851 - 855 |
| MORRISON, SCIENCE, vol. 229, 1985, pages 1202 |
| MULLER ET AL., STRUCTURE, vol. 6, no. 9, 1998, pages 1153 - 1167 |
| MULLINAX ET AL., BIOTECHNIQUES, vol. 12, no. 6, 1992, pages 864 - 869 |
| NEUBERGER ET AL., NATURE, vol. 312, 1984, pages 604 - 608 |
| O ET AL., BIOTECHNIQUES, vol. 4, 1986, pages 214 |
| OHHNEYER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 10922 - 10926 |
| PADLAN, MOLECULAR IMMUNOLOGY, vol. 28, no. 4-5, 1991, pages 489 - 498 |
| PERSIC ET AL., GENE, vol. 187, 1997, pages 9 - 18 |
| PETTERS, REPROD. FERTIL. DEV., vol. 6, no. 5, 1994, pages 643 - 645 |
| PHIZICKY ET AL., MICROBIAL. REV., vol. 59, 1995, pages 94 - 123 |
| PITARD ET AL., J. IMMUNOL. METHODS, vol. 205, no. 2, 1997, pages 177 - 190 |
| POZNANSKY ET AL., FEBS LETT., vol. 239, 1988, pages 18 |
| PRAT ET AL., J. CELL. SCI., vol. LLL, 1998, pages 237 - 247 |
| PROUDFOOT, NATURE, vol. 322, 1986, pages 52 |
| RAEBURN ET AL., PHARMACAL. TOXICOL. METHODS, vol. 27, 1992, pages 143 - 159 |
| RANGER; PEPPAS, J., MACROMOL. SCI. REV. MACROMOL. CHERN., vol. 23, 1983, pages 61 |
| RATTAN ET AL., ANN. N.Y. ACAD. SCI., vol. 663, 1992, pages 48 - 62 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 |
| ROGUSKA ET AL., PNAS, vol. 91, 1994, pages 969 - 973 |
| S.W. BURCHI ET AL.: "Tumor Imaging: The Radiochemical Detection of Cancer", 1982, MASSON PUBLISHING INC., article "Immunopharmacokinetics of Radiolabeled Antibodies and Their Fragments" |
| S.W. BURCHIEL ET AL.: "Tumor Imaging: The Radiochemical Detection of Cancer", 1982, MASSON PUBLISHING INC., article "lmmunopharmacokinetics of Radiolabeled Antibodies and Their Fragments" |
| SAHNON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 11708 - 11712 |
| SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual, 2d Ed.,", 1990, COLD SPRING HARBOR LABORATORY, COLD SPRING HARBOR |
| SAUDEK ET AL., N. ENGL. J. MED., vol. 321, 1989, pages 574 |
| SAWAI ET AL., AJRI, vol. 34, 1995, pages 26 - 34 |
| SCHNIEKE, SCIENCE, vol. 278, no. 5346, 1997, pages 2130 - 2133 |
| SCOTT ET AL., SCIENCE, vol. 249, 1990, pages 386 - 390 |
| SCOTT; SMITH, SCIENCE, vol. 249, 1990, pages 386 - 390 |
| See also references of EP1729795A4 |
| SEFTON, CRC CRIT. REF. BIOMED. ENG., vol. 14, 1987, pages 201 |
| SHU ET AL., PNAS, vol. 90, 1993, pages 7995 - 7999 |
| SKERRA ET AL., SCIENCE, vol. 240, 1988, pages 1038 - 1040 |
| SKERRA ET AL., SCIENCE, vol. 242, 1988, pages 1038 - 1041 |
| SLEEP ET AL., BIOTECHNOLOGY, vol. 8, 1990, pages 42 - 46 |
| SMOLEN AND BALL: "Controlled Drug Bioavailability, Drug Product Design and Performance", 1984, WILEY |
| SONGSIVILAI; LACHMANN, CLIN. EXP. LMMUNOL., vol. 79, 1990, pages 315 - 321 |
| SOULIER, FEBS LETTS., vol. 297, 1992, pages 13 |
| STUDNICKA ET AL., PROTEIN ENGINEERING, vol. 7, no. 6, 1994, pages 805 - 814 |
| TAKAHASHI ET AL., INT. IMMUNOL., vol. 6, 1994, pages 1567 - 1574 |
| TAKAHASHI ET AL., INT. IMMUNOL.., vol. 6, 1994, pages 1567 - 1574 |
| TAKEDA ET AL., NATURE, vol. 314, 1985, pages 452 - 454 |
| TARYMAN ET AL., NEURON, vol. 14, no. 4, 1995, pages 755 - 762 |
| THORPE ET AL.: "Monoclonal Antibodies '84: Biological And Clinical Applications", 1985, article "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", pages: 475 - 506 |
| THORPE ET AL.: "The Preparation And Cytotoxic Properties Of Antibody-Toxin Conjugates", IMMUNOL. REV., vol. 62, 1982, pages 119 - 58 |
| TRAUNECKER ET AL.: "Bispecific single chain molecules (Janusins) target cytotoxic lymphocytes on HIV infected cells", EMBO J, vol. 10, 1991, pages 3655 - 3659 |
| TRAUNECKER ET AL.: "Janusin: new molecular design for bispecific reagents", JNT J CANCER, vol. 7, 1992, pages 51 - 52 |
| TREAT ET AL.: "Liposomes in the Therapy of Infectious Disease and Cancer", 1989, LISS, pages: 353 - 365 |
| TUTT ET AL., J.IMMUNOL., vol. 147, 1991, pages 60 - 69 |
| VOROBJEV ET AL., NUCLEOSIDES NUCLEOTIDES, vol. 18, 1999, pages 2745 - 2750 |
| WARD ET AL., NATURE, vol. 334, 1989, pages 544 - 54 |
| WILSON ET AL., CELL, vol. 37, 1984, pages 767 |
| WU; WU, J. BIOI. CHERN., vol. 262, 1987, pages 4429 - 4432 |
| YOON ET AL., J. IMMUNOL., vol. 160, no. 7, 1998, pages 3170 - 3179 |
| ZHU ET AL., CANCER RES., vol. 58, no. 15, 1998, pages 3209 - 3214 |
Cited By (118)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8642542B2 (en) | 1995-12-30 | 2014-02-04 | Novozymes Biopharma Dk A/S | Recombinant fusion proteins to growth hormone and serum albumin |
| US9849162B2 (en) | 2000-04-12 | 2017-12-26 | Albumedix A/S | Treatment with factor VII-albumin fusion protein |
| US9821039B2 (en) | 2000-04-12 | 2017-11-21 | Albumedix A/S | Albumin fusion proteins |
| US7785599B2 (en) | 2000-04-12 | 2010-08-31 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US9775888B2 (en) | 2000-04-12 | 2017-10-03 | Albumedix A/S | Treatment with factor ix-albumin fusion protein |
| US10080785B2 (en) | 2000-04-12 | 2018-09-25 | Novozymes Biopharma Dk A/S | Albumin fusion proteins |
| US8946156B2 (en) | 2000-04-12 | 2015-02-03 | Human Genome Sciences, Inc. | Albumin Fusion Proteins |
| US8287859B2 (en) | 2001-12-21 | 2012-10-16 | Human Genome Sciences, Inc. | Methods of reducing toxicity and effects of cocaine by administering a butyrylcholinesterase (BChE)-albumin fusion protein |
| US7189690B2 (en) | 2001-12-21 | 2007-03-13 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US7141547B2 (en) | 2001-12-21 | 2006-11-28 | Human Genome Sciences, Inc. | Albumin fusion proteins comprising GLP-1 polypeptides |
| US7238660B2 (en) | 2001-12-21 | 2007-07-03 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US8012464B2 (en) | 2001-12-21 | 2011-09-06 | Human Genome Sciences, Inc. | G-CSF-albumin fusion proteins |
| US7799759B2 (en) | 2001-12-21 | 2010-09-21 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US7977306B2 (en) | 2001-12-21 | 2011-07-12 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US7569384B2 (en) | 2004-02-09 | 2009-08-04 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| WO2006038027A2 (en) | 2004-10-08 | 2006-04-13 | Domantis Limited | SINGLE DOMAIN ANTIBODIES AGAINST TNFRl AND METHODS OF USE THEREFOR |
| EP2371390A2 (en) | 2004-10-08 | 2011-10-05 | Domantis Limited | Antagonists and methods of use therefor |
| EP2420251A2 (en) | 2004-11-10 | 2012-02-22 | Domantis Limited | Ligands that enhance endogenous compounds |
| EP1924596A4 (en) * | 2005-08-12 | 2009-07-29 | Human Genome Sciences Inc | ALBUM INFUSION PROTEINS |
| EP1965823B1 (en) * | 2005-11-04 | 2016-05-18 | Glaxosmithkline LLC | Methods for administering hypoglycemic agents |
| EP3095456A1 (en) | 2005-11-04 | 2016-11-23 | Glaxosmithkline LLC | Methods for administering hypoglycemic agents |
| JP2014159431A (ja) * | 2005-11-04 | 2014-09-04 | Glaxosmithkline Llc | 血糖降下剤の投与方法 |
| JP2009514900A (ja) * | 2005-11-04 | 2009-04-09 | スミスクライン・ビーチャム・コーポレイション | 血糖降下剤の投与方法 |
| WO2007056681A2 (en) | 2005-11-04 | 2007-05-18 | Smithkline Beecham Corporation | Methods for administering hypoglycemic agents |
| US8765915B2 (en) | 2006-02-06 | 2014-07-01 | Csl Behring Gmbh | Modified coagulation factor VIIa with extended half-life |
| EP2518079A2 (en) | 2006-04-11 | 2012-10-31 | Novartis AG | HCV/HIV inhibitors and their uses |
| US8969538B2 (en) | 2006-06-07 | 2015-03-03 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| AU2007258609B2 (en) * | 2006-06-07 | 2013-01-24 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| EP2046367A4 (en) * | 2006-06-07 | 2009-11-11 | Human Genome Sciences Inc | ALBUM INFUSION PROTEINS |
| US8334365B2 (en) | 2006-06-07 | 2012-12-18 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| JP2010503697A (ja) * | 2006-09-13 | 2010-02-04 | スミスクライン・ビーチャム・コーポレイション | 持続性血糖降下剤の投与方法 |
| EP2068905A4 (en) * | 2006-09-14 | 2009-12-30 | Human Genome Sciences Inc | ALBUM INFUSION PROTEINS |
| WO2008052043A3 (en) * | 2006-10-24 | 2009-01-08 | Cogenesys Inc | Opioid receptor agonist fusion proteins |
| EP2423222B1 (en) | 2007-01-30 | 2015-04-29 | Epivax, Inc. | Regulatory t cell epitopes, compositions and uses thereof |
| EP2423222B2 (en) † | 2007-01-30 | 2020-07-29 | Epivax, Inc. | Regulatory t cell epitopes, compositions and uses thereof |
| EP2746290A2 (en) | 2007-06-06 | 2014-06-25 | Domantis Limited | Polypeptides, antibody variable domains and antagonists |
| EP2746291A2 (en) | 2007-06-06 | 2014-06-25 | Domantis Limited | Pulmonary formulation comprising an immunoglobulin single variable domain which binds to TNFR1 |
| RU2361607C2 (ru) * | 2007-06-09 | 2009-07-20 | Государственное образовательное учреждение высшего профессионального образования "Челябинская государственная медицинская академия Федерального агентства по здравоохранению и социальному развитию Российской Федерации" | Способ локальной иммунотерапии гнойно-воспалительных заболеваний мягких тканей челюстно-лицевой области |
| CN101801460A (zh) * | 2007-09-05 | 2010-08-11 | 塞诺菲-安万特股份有限公司 | 尿酸氧化酶用于治疗或预防由局部缺血或再灌注事件引起的心脏疾病或间接后遗症的用途 |
| WO2009030373A1 (en) * | 2007-09-05 | 2009-03-12 | Sanofi-Aventis | Use of urate oxidase for the treatment or prophylaxis of disorders or indirect sequelae of the heart caused by ischemic or reperfusion events |
| AU2008295145B2 (en) * | 2007-09-05 | 2013-12-05 | Sanofi | Use of urate oxidase for the treatment or prophylaxis of disorders or indirect sequelae of the heart caused by ischemic or reperfusion events |
| US11453727B2 (en) | 2007-10-15 | 2022-09-27 | Sanofi | Antibodies that bind IL-4 and/or IL-13 and their uses |
| US10759871B2 (en) | 2007-10-15 | 2020-09-01 | Sanofi | Antibodies that bind IL-4 and/or IL-13 and their uses |
| US9738728B2 (en) | 2007-10-15 | 2017-08-22 | Sanofi | Antibodies that bind IL-4 and/or IL-13 and their uses |
| US9732162B2 (en) | 2007-10-15 | 2017-08-15 | Sanofi | Antibodies that bind IL-4 and/or IL-13 and their uses |
| US20110300127A1 (en) * | 2008-05-27 | 2011-12-08 | Fujifilm Corporation | Drug-containing composition |
| US11555061B2 (en) | 2009-02-11 | 2023-01-17 | Albumedix, Ltd | Albumin variants and conjugates |
| WO2010094720A2 (en) | 2009-02-19 | 2010-08-26 | Glaxo Group Limited | Improved anti-tnfr1 polypeptides, antibody variable domains & antagonists |
| WO2010115981A1 (en) | 2009-04-10 | 2010-10-14 | Novartis Ag | 7-azadispiro [3.0.4.1] decane-8-carboxamides as hepatitis c virus inhibitors |
| WO2010116248A1 (en) | 2009-04-10 | 2010-10-14 | Novartis Ag | Organic compounds and their uses |
| WO2011006914A2 (en) | 2009-07-16 | 2011-01-20 | Glaxo Group Limited | Antagonists, uses & methods for partially inhibiting tnfr1 |
| WO2011012609A2 (en) | 2009-07-29 | 2011-02-03 | Glaxo Group Limited | Ligands that bind tgf-beta receptor rii |
| WO2011051217A1 (en) | 2009-10-27 | 2011-05-05 | Glaxo Group Limited | Stable anti-tnfr1 polypeptides, antibody variable domains & antagonists |
| WO2011053617A1 (en) | 2009-10-30 | 2011-05-05 | Boehringer Ingelheim International Gmbh | Dosage regimens for hcv combination therapy comprising bi201335, interferon alpha and ribavirin |
| US8748380B2 (en) | 2009-10-30 | 2014-06-10 | Novozymes Biopharma Dk A/S | Albumin variants |
| US10696732B2 (en) | 2009-10-30 | 2020-06-30 | Albumedix, Ltd | Albumin variants |
| WO2011098644A2 (es) | 2010-02-09 | 2011-08-18 | Proyecto De Biomedicina Cima, S.L. | Composiciones para el tratamiento de enfermedades infecciosas y tumorales |
| US10233228B2 (en) | 2010-04-09 | 2019-03-19 | Albumedix Ltd | Albumin derivatives and variants |
| WO2011161644A1 (en) | 2010-06-24 | 2011-12-29 | Panmed Ltd. | Treatment of hepatitis c virus related diseases using hydroxychloroquine or a combination of hydroxychloroquine and an anti-viral agent |
| WO2012013597A1 (de) * | 2010-07-28 | 2012-02-02 | Justus-Liebig-Universität Giessen | Stoffe und deren verwendung zur beeinflussung natriuretischer peptidrezeptoren |
| WO2012048235A1 (en) | 2010-10-08 | 2012-04-12 | Novartis Ag | Vitamin e formulations of sulfamide ns3 inhibitors |
| WO2012093125A1 (en) | 2011-01-06 | 2012-07-12 | Glaxo Group Limited | Ligands that bind tgf-beta receptor ii |
| JPWO2012093704A1 (ja) * | 2011-01-07 | 2014-06-09 | 中外製薬株式会社 | 抗体の物性を改善させる方法 |
| US8822417B2 (en) | 2011-05-05 | 2014-09-02 | Novozymes Biopharma DIC A/S | Albumin variants |
| US10711050B2 (en) | 2011-11-18 | 2020-07-14 | Albumedix Ltd | Variant serum albumin with improved half-life and other properties |
| WO2013137869A1 (en) | 2012-03-14 | 2013-09-19 | Boehringer Ingelheim International Gmbh | Combination therapy for treating hcv infection in an hcv-hiv coinfected patient population |
| WO2013138064A1 (en) | 2012-03-14 | 2013-09-19 | Boehringer Ingelheim International Gmbh | Combination therapy for treating hcv infection in an hcv-hiv coinfected patient population |
| US10329340B2 (en) | 2012-03-16 | 2019-06-25 | Albumedix Ltd | Albumin variants |
| US9944691B2 (en) | 2012-03-16 | 2018-04-17 | Albumedix A/S | Albumin variants |
| WO2013144193A1 (en) | 2012-03-28 | 2013-10-03 | Boehringer Ingelheim International Gmbh | Combination therapy for treating hcv infection in specific patient subgenotype sub-population |
| WO2013143581A1 (en) | 2012-03-28 | 2013-10-03 | Boehringer Ingelheim International Gmbh | Combination therapy for treating hcv infection in specific patient subgenotype sub-population |
| WO2014029752A1 (en) | 2012-08-22 | 2014-02-27 | Glaxo Group Limited | Anti lrp6 antibodies |
| US10934341B2 (en) | 2012-11-08 | 2021-03-02 | Albumedix, Ltd. | Albumin variants |
| US10501524B2 (en) | 2012-11-08 | 2019-12-10 | Albumedix Ltd | Albumin variants |
| WO2014082935A1 (en) | 2012-11-30 | 2014-06-05 | Novartis Ag | Cyclic nucleoside derivatives and uses thereof |
| EP3712177A1 (en) | 2013-03-15 | 2020-09-23 | GlaxoSmithKline Intellectual Property Development Limited | Anti-lag-3 binding proteins |
| US10344088B2 (en) | 2013-03-15 | 2019-07-09 | Glaxosmithkline Intellectual Property Development Limited | Antigen binding proteins |
| US10280221B2 (en) | 2013-03-15 | 2019-05-07 | Glaxosmithkline Intellectual Property Development Limited | Anti-LAG-3 binding proteins |
| WO2014140180A1 (en) | 2013-03-15 | 2014-09-18 | Glaxosmithkline Intellectual Property Development Limited | Anti-lag-3 binding proteins |
| WO2015198199A1 (en) | 2014-06-23 | 2015-12-30 | Novartis Ag | Hsa-gdf-15 fusion polypeptide and use thereof. |
| EP4438118A2 (en) | 2014-12-19 | 2024-10-02 | Inozyme Pharma, Inc. | Methods of treating tissue calcification |
| WO2016100803A2 (en) | 2014-12-19 | 2016-06-23 | Alexion Pharmaceuticals, Inc. | Methods of treating tissue calcification |
| EP3967755A1 (en) | 2014-12-19 | 2022-03-16 | Alexion Pharmaceuticals, Inc. | Methods of treating tissue calcification |
| US12116400B2 (en) | 2015-08-20 | 2024-10-15 | Sartorius Albumedix Limited | Albumin variants and conjugates |
| US10633428B2 (en) | 2015-08-20 | 2020-04-28 | Albumedix Ltd | Albumin variants and conjugates |
| US11680104B2 (en) | 2015-09-02 | 2023-06-20 | Immutep S.A.S. | Anti-LAG-3 antibodies |
| CN107949638A (zh) * | 2015-09-08 | 2018-04-20 | Jcr制药股份有限公司 | 新型人血清白蛋白突变体 |
| US11634474B2 (en) | 2015-09-08 | 2023-04-25 | Jcr Pharmaceuticals Co., Ltd. | Human serum albumin mutant |
| US10654912B2 (en) | 2015-09-08 | 2020-05-19 | Jcr Pharmaceuticals Co., Ltd. | Human serum albumin mutant |
| CN107949638B (zh) * | 2015-09-08 | 2022-05-13 | Jcr制药股份有限公司 | 新型人血清白蛋白突变体 |
| US11046751B2 (en) | 2015-09-08 | 2021-06-29 | Jcr Pharmaceuticals Co., Ltd. | Human serum albumin mutant |
| WO2017109706A1 (en) | 2015-12-22 | 2017-06-29 | Novartis Ag | Methods of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15) |
| CN108697768B (zh) * | 2015-12-23 | 2022-07-22 | 约翰霍普金斯大学 | 长效glp-1r激动剂作为神经系统病状和神经退行性病状的治疗方法 |
| US12233109B2 (en) | 2015-12-23 | 2025-02-25 | The Johns Hopkins University | Long-acting GLP-1r agonist as a therapy of neurological and neurodegenerative conditions |
| US11123405B2 (en) | 2015-12-23 | 2021-09-21 | The Johns Hopkins University | Long-acting GLP-1R agonist as a therapy of neurological and neurodegenerative conditions |
| AU2016379403B2 (en) * | 2015-12-23 | 2020-03-12 | The Johns Hopkins University | Long-acting GLP-1r agonist as a therapy of neurological and neurodegenerative conditions |
| WO2017112889A1 (en) * | 2015-12-23 | 2017-06-29 | The Johns Hopkins University | Long-acting glp-1r agonist as a therapy of neurological and neurodegenerative conditions |
| CN108697768A (zh) * | 2015-12-23 | 2018-10-23 | 约翰霍普金斯大学 | 长效glp-1r激动剂作为神经系统病状和神经退行性病状的治疗方法 |
| WO2017218786A1 (en) | 2016-06-16 | 2017-12-21 | Alexion Pharmaceuticals, Inc. | Methods of treating myointimal proliferation |
| EP3827835A1 (en) | 2016-06-16 | 2021-06-02 | Inozyme Pharma, Inc. | Methods of treating myointimal proliferation |
| WO2019067502A1 (en) | 2017-09-27 | 2019-04-04 | Alexion Pharmaceuticals, Inc. | METHODS FOR IMPROVING CARDIOVASCULAR FUNCTION AND TREATING CARDIOVASCULAR DISEASE USING RECOMBINANT ECTO-NUCLEOTIDE PYROPHOSPHATASE / PHOSPHODIESTERASE |
| WO2019152827A1 (en) * | 2018-02-02 | 2019-08-08 | AskGene Pharma, Inc. | Novel antibody-drug conjugates (adc), methods of making, and methods of use thereof |
| WO2020152367A1 (en) | 2019-01-25 | 2020-07-30 | Ospedale San Raffaele S.R.L. | Inhibitor of dux4 and uses thereof |
| EP4464383A2 (en) | 2020-05-26 | 2024-11-20 | Boehringer Ingelheim International GmbH | Anti-pd-1 antibodies |
| US12312405B2 (en) | 2020-05-26 | 2025-05-27 | Boehringer Ingelheim International Gmbh | Anti-PD-1 antibodies |
| WO2021242663A1 (en) | 2020-05-26 | 2021-12-02 | Boehringer Ingelheim International Gmbh | Anti-pd-1 antibodies |
| US20220288226A1 (en) * | 2020-08-27 | 2022-09-15 | Enosi Life Sciences Corp. | Methods and compositions to treat autoimmune diseases and cancer |
| EP4245776A4 (en) * | 2020-11-16 | 2025-01-01 | Huatong Forturn (China) Co., Ltd | HUMAN SERUM ALBUMIN-INTERLEUKIN-2 FUSION PROTEIN AND USE THEREOF |
| US12516127B2 (en) | 2021-06-04 | 2026-01-06 | Boehringer Ingelheim International Gmbh | Anti-SIRP-alpha antibodies |
| US11572412B2 (en) | 2021-06-04 | 2023-02-07 | Boehringer Ingelheim International Gmbh | Anti-SIRP-alpha antibodies |
| WO2022254379A1 (en) | 2021-06-04 | 2022-12-08 | Boehringer Ingelheim International Gmbh | Anti-sirp-alpha antibodies |
| WO2024133934A1 (en) | 2022-12-23 | 2024-06-27 | Ospedale San Raffaele S.R.L. | Inhibitors of dux4 activity and their use in therapy |
| EP4389762A1 (en) | 2022-12-23 | 2024-06-26 | Ospedale San Raffaele S.r.l. | Inhibitors of dux4 activity and their use in therapy. |
| WO2025074328A1 (en) | 2023-10-06 | 2025-04-10 | Boehringer Ingelheim International Gmbh | Use of anti-sirp-alpha antibodies to treat cancer |
| WO2025074337A1 (en) | 2023-10-06 | 2025-04-10 | Boehringer Ingelheim International Gmbh | Use of anti-sirp-alpha antibodies to treat a liver disease or disorder |
| WO2025181215A1 (en) | 2024-03-01 | 2025-09-04 | Boehringer Ingelheim International Gmbh | Antibodies to connective tissue growth factor (ctgf) and uses thereof |
| US12600770B2 (en) | 2024-03-01 | 2026-04-14 | Boehringer Ingelheim International Gmbh | Antibodies to connective tissue growth factor (CTGF) and uses thereof |
| WO2026042013A1 (en) | 2024-08-19 | 2026-02-26 | Institute Of Molecular And Clinical Ophthalmology Basel (Iob) | Mitochondrial therapy |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2005211725B2 (en) | Albumin fusion proteins | |
| US8969538B2 (en) | Albumin fusion proteins | |
| US7521424B2 (en) | Albumin fusion proteins | |
| US20100254944A1 (en) | Albumin Fusion Proteins | |
| EP2277889A2 (en) | Fusion proteins of albumin and interferon beta | |
| EP1924596A2 (en) | Albumin fusion proteins | |
| WO2009058322A1 (en) | Albumin fusion proteins | |
| WO2001079480A9 (en) | Albumin fusion proteins | |
| EP1463752A2 (en) | Albumin fusion proteins | |
| ZA200605871B (en) | Albumin fusion proteins | |
| HK1095087B (en) | Albumin fusion proteins | |
| HK1126502A (en) | Albumin fusion proteins |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006/05871 Country of ref document: ZA Ref document number: 176894 Country of ref document: IL Ref document number: 200605871 Country of ref document: ZA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2005211725 Country of ref document: AU Ref document number: 2554089 Country of ref document: CA Ref document number: 548612 Country of ref document: NZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12006501460 Country of ref document: PH Ref document number: 4362/DELNP/2006 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11495624 Country of ref document: US |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11500508 Country of ref document: US Ref document number: 11500314 Country of ref document: US |
|
| WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2006/009072 Country of ref document: MX Ref document number: 2006553197 Country of ref document: JP |
|
| ENP | Entry into the national phase |
Ref document number: 2005211725 Country of ref document: AU Date of ref document: 20050209 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWP | Wipo information: published in national office |
Ref document number: 2005211725 Country of ref document: AU |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2005722848 Country of ref document: EP Ref document number: DZP2006000447 Country of ref document: DZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 06089815 Country of ref document: CO |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020067018484 Country of ref document: KR Ref document number: 1200601476 Country of ref document: VN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006132384 Country of ref document: RU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 200580012252.5 Country of ref document: CN |
|
| WWP | Wipo information: published in national office |
Ref document number: 2005722848 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 11500508 Country of ref document: US |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020067018484 Country of ref document: KR |
|
| WWP | Wipo information: published in national office |
Ref document number: 11500314 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: PI0507026 Country of ref document: BR |
|
| WWP | Wipo information: published in national office |
Ref document number: 11495624 Country of ref document: US |