US20170253670A1 - Common light chains and methods of use - Google Patents
Common light chains and methods of use Download PDFInfo
- Publication number
- US20170253670A1 US20170253670A1 US15/600,015 US201715600015A US2017253670A1 US 20170253670 A1 US20170253670 A1 US 20170253670A1 US 201715600015 A US201715600015 A US 201715600015A US 2017253670 A1 US2017253670 A1 US 2017253670A1
- Authority
- US
- United States
- Prior art keywords
- antigen binding
- light chain
- cell
- domain
- activating bispecific
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 0 C****C(C)(C)N Chemical compound C****C(C)(C)N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/461—Igs containing Ig-regions, -domains or -residues form different species
- C07K16/464—Igs containing CDR-residues from one specie grafted between FR-residues from another
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001169—Tumor associated carbohydrates
- A61K39/00117—Mucins, e.g. MUC-1
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- A61K47/48369—
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
- C12N15/73—Expression systems using phage (lambda) regulatory sequences
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5158—Antigen-pulsed cells, e.g. T-cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the present invention generally relates to bispecific antigen binding molecules for activating T cells.
- the present invention relates to polynucleotides encoding such bispecific antigen binding molecules, and vectors and host cells comprising such polynucleotides.
- the invention further relates to methods for producing the bispecific antigen binding molecules of the invention, and to methods of using these bispecific antigen binding molecules in the treatment of disease.
- the selective destruction of an individual cell or a specific cell type is often desirable in a variety of clinical settings. For example, it is a primary goal of cancer therapy to specifically destroy tumor cells, while leaving healthy cells and tissues intact and undamaged.
- CTLs constitute the most potent effector cells of the immune system, however they cannot be activated by the effector mechanism mediated by the Fc domain of conventional therapeutic antibodies.
- bispecific antibodies designed to bind with one “arm” to a surface antigen on target cells, and with the second “arm” to an activating, invariant component of the T cell receptor (TCR) complex, have become of interest in recent years.
- TCR T cell receptor
- the simultaneous binding of such an antibody to both of its targets forces a temporary interaction between target cell and T cell, causing activation of any cytotoxic T cell and subsequent lysis of the target cell.
- the immune response is re-directed to the target cells and is independent of peptide antigen presentation by the target cell or the specificity of the T cell as would be relevant for normal MHC-restricted activation of CTLs.
- CTLs are only activated when the bispecific antibody binds to a target cell and the CTL, i.e. the immunological synapse is mimicked.
- Particularly desirable are bispecific antibodies that do not require lymphocyte preconditioning or co-stimulation in order to elicit efficient lysis of target cells.
- BiTE bispecific T cell engager
- DART dual affinity retargeting
- triomabs which are whole hybrid mouse/rat IgG molecules and also currently being evaluated in clinical trials, represent a larger sized format (reviewed in Seimetz et al., Cancer Treat Rev 36, 458-467 (2010)).
- bispecific antibodies a major challenge in the general development of bispecific antibodies has been the production of bispecific antibody constructs at a clinically sufficient quantity and purity, due to the mispairing of antibody heavy and light chains of different specificities upon co-expression, which decreases the yield of the correctly assembled construct and results in a number of non-functional side products from which the desired bispecific antibody may be difficult to separate.
- the present invention provides a T cell activating bispecific antigen binding molecule comprising a first and a second antigen binding moiety, wherein the first antigen binding moiety comprises a first light chain and wherein the first antigen binding moiety is capable of specific binding to an activating T cell antigen and the second antigen binding moiety comprises a second light chain and wherein the second antigen binding moiety is capable of specific binding to a target cell antigen, wherein the amino acid sequence of the first and the second light chain is identical.
- the first antigen binding moiety is a Fab.
- the second antigen binding moiety is a Fab.
- the first and the second antigen binding moiety is a Fab.
- said T cell activating bispecific antigen binding molecule further comprises an Fc domain composed of a first and a second subunit capable of stable association.
- said T cell activating bispecific antigen binding molecule comprises a light chain comprising the light chain CDRs of SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34.
- said T cell activating bispecific antigen binding molecule comprises a light chain comprising SEQ ID NO: 31.
- said Fab molecule capable of specific binding to an activating T cell antigen comprises a heavy chain comprising the heavy chain CDR of SEQ ID NO: 37, SEQ ID NO: 38 and SEQ ID NO: 39.
- not more than one antigen binding moiety capable of specific binding to an activating T cell antigen is present in the T cell activating bispecific antigen binding molecule (i.e. the T cell activating bispecific antigen binding molecule provides monovalent binding to the activating T cell antigen).
- the first and the second antigen binding moiety of the T cell activating bispecific antigen binding molecule are fused to each other, optionally via a peptide linker.
- the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding moiety.
- the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the second antigen binding moiety.
- the second antigen binding moiety is fused at the C-terminus of the Fab light chain to the N-terminus of the Fab light chain of the first antigen binding moiety.
- the first antigen binding moiety is fused at the C-terminus of the Fab light chain to the N-terminus of the Fab light chain of the second antigen binding moiety.
- the first antigen binding moiety of the T cell activating bispecific antigen binding molecule is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first or the second subunit of the Fc domain.
- the second antigen binding moiety of the T cell activating bispecific antigen binding molecule is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first or the second subunit of the Fc domain.
- the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first or second subunit of the Fc domain.
- the first and the second antigen binding moiety of the T cell activating bispecific antigen binding molecule are each fused at the C-terminus of the Fab heavy chain to the N-terminus of one of the subunits of the Fc domain.
- the T cell activating bispecific antigen binding molecule comprises a third antigen binding moiety which is a Fab molecule capable of specific binding to a target cell antigen.
- said third antigen binding moiety is a Fab molecule comprising an identical VLCL light chain as the first and the second antigen binding moiety.
- the first, second and third antigen binding moiety are each a Fab molecule comprising the light chain CDRs of SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34.
- the first, second and third antigen binding moiety are each a Fab molecule comprising a light chain comprising SEQ ID NO: 31.
- the third antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first or second subunit of the Fc domain.
- the second and the third antigen binding moiety of the T cell activating antigen binding molecule are each fused at the C-terminus of the Fab heavy chain to the N-terminus of one of the subunits of the Fc domain, and the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the second antigen binding moiety.
- the first and the third antigen binding moiety of the T cell activating antigen binding molecule are each fused at the C-terminus of the Fab heavy chain to the N-terminus of one of the subunits of the Fc domain, and the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding moiety.
- the components of the T cell activating bispecific antigen binding molecule may be fused directly or through suitable peptide linkers.
- the second and the third antigen binding moiety and the Fc domain are part of an immunoglobulin molecule.
- the first and the third antigen binding moiety and the Fc domain are part of an immunoglobulin molecule.
- the immunoglobulin molecule is an IgG class immunoglobulin. In an even more particular embodiment the immunoglobulin is an IgG 1 subclass immunoglobulin. In another embodiment, the immunoglobulin is an IgG 4 subclass immunoglobulin.
- the Fc domain is an IgG Fc domain. In a specific embodiment, the Fc domain is an IgG 1 Fc domain. In another specific embodiment, the Fc domain is an IgG 4 Fc domain. In an even more specific embodiment, the Fc domain is an IgG 4 Fc domain comprising the amino acid substitution S228P. In an even more specific embodiment, the Fc domain is an IgG 4 Fc domain comprising the amino acid substitutions L235E and S228P (SPLE). In particular embodiments the Fc domain is a human Fc domain.
- the Fc domain comprises a modification promoting the association of the first and the second Fc domain subunit.
- an amino acid residue in the CH3 domain of the first subunit of the Fc domain is replaced with an amino acid residue having a larger side chain volume, thereby generating a protuberance within the CH3 domain of the first subunit which is positionable in a cavity within the CH3 domain of the second subunit, and an amino acid residue in the CH3 domain of the second subunit of the Fc domain is replaced with an amino acid residue having a smaller side chain volume, thereby generating a cavity within the CH3 domain of the second subunit within which the protuberance within the CH3 domain of the first subunit is positionable.
- the Fc domain exhibits reduced binding affinity to an Fc receptor and/or reduced effector function, as compared to a native IgG 1 Fc domain.
- the Fc domain is engineered to have reduced binding affinity to an Fc receptor and/or reduced effector function, as compared to a non-engineered Fc domain.
- the Fc domain comprises one or more amino acid substitution that reduces binding to an Fc receptor and/or effector function.
- the one or more amino acid substitution in the Fc domain that reduces binding to an Fc receptor and/or effector function is at one or more position selected from the group of L234, L235, and P329 (Kabat numbering).
- each subunit of the Fc domain comprises three amino acid substitutions that reduce binding to an Fc receptor and/or effector function wherein said amino acid substitutions are L234A, L235A and P329G.
- the Fc domain is an IgG 1 Fc domain, particularly a human IgG 1 Fc domain.
- each subunit of the Fc domain comprises two amino acid substitutions that reduce binding to an Fc receptor and/or effector function wherein said amino acid substitutions are L235E and P329G.
- the Fc domain is an IgG 4 Fc domain, particularly a human IgG 4 Fc domain.
- the Fc receptor is an Fc ⁇ receptor. In one embodiment the Fc receptor is a human Fc receptor. In one embodiment, the Fc receptor is an activating Fc receptor. In a specific embodiment, the Fc receptor is human Fc ⁇ RIIa, Fc ⁇ RI, and/or Fc ⁇ RIIIa. In one embodiment, the effector function is antibody-dependent cell-mediated cytotoxicity (ADCC).
- ADCC antibody-dependent cell-mediated cytotoxicity
- the activating T cell antigen that the bispecific antigen binding molecule is capable of binding is CD3.
- the target cell antigen that the bispecific antigen binding molecule is capable of binding is a tumor cell antigen.
- the target cell antigen is selected from the group consisting of: Folate Receptor 1 (FolR1), Mucin-1 (MUC1), and B Cell Maturation Antigen (BCMA). In one specific embodiment, the target cell antigen is not BCMA.
- the invention provides for a light chain comprising the amino acid sequence of SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34 for use in a T cell activating bispecific antigen binding molecule.
- the light chain comprises the amino acid sequence of SEQ ID NO: 31.
- the light chain comprises the amino acid sequence of SEQ ID NO: 35.
- the invention provides for a light chain comprising the amino acid sequence of SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34 for use in a library for production of T cell activating bispecific antigen binding molecule.
- the light chain comprises the amino acid sequence of SEQ ID NO: 31.
- the light chain comprises the amino acid sequence of SEQ ID NO: 35.
- the invention provides for an isolated polypeptide comprising the amino acid sequence of SEQ ID NO: 31.
- the invention provides for an isolated polypeptide comprising the amino acid sequence of SEQ ID NO: 35.
- an isolated polynucleotide encoding a T cell activating bispecific antigen binding molecule of the invention or a fragment thereof.
- the invention also encompasses polypeptides encoded by the polynucleotides of the invention.
- the invention further provides an expression vector comprising the isolated polynucleotide of the invention, and a host cell comprising the isolated polynucleotide or the expression vector of the invention.
- the host cell is a eukaryotic cell, particularly a mammalian cell.
- a method of producing the T cell activating bispecific antigen binding molecule of the invention comprising the steps of a) culturing the host cell of the invention under conditions suitable for the expression of the T cell activating bispecific antigen binding molecule and b) recovering the T cell activating bispecific antigen binding molecule.
- the invention also encompasses a T cell activating bispecific antigen binding molecule produced by the method of the invention.
- the invention further provides a pharmaceutical composition comprising the T cell activating bispecific antigen binding molecule of the invention and a pharmaceutically acceptable carrier. Also encompassed by the invention are methods of using the T cell activating bispecific antigen binding molecule and pharmaceutical composition of the invention.
- the invention provides a T cell activating bispecific antigen binding molecule or a pharmaceutical composition of the invention for use as a medicament.
- a T cell activating bispecific antigen binding molecule or a pharmaceutical composition according to the invention for use in the treatment of a disease in an individual in need thereof. In a specific embodiment the disease is cancer.
- a T cell activating bispecific antigen binding molecule of the invention for the manufacture of a medicament for the treatment of a disease in an individual in need thereof; as well as a method of treating a disease in an individual, comprising administering to said individual a therapeutically effective amount of a composition comprising the T cell activating bispecific antigen binding molecule according to the invention in a pharmaceutically acceptable form.
- the disease is cancer.
- the individual preferably is a mammal, particularly a human.
- the invention also provides a method for inducing lysis of a target cell, particularly a tumor cell, comprising contacting a target cell with a T cell activating bispecific antigen binding molecule of the invention in the presence of a T cell, particularly a cytotoxic T cell.
- the invention provides for a method for identifying a variable heavy chain for use in a bispecific antigen binding molecule specific for a T cell activation antigen and a target cell antigen, comprising the step of screening a combinatorial library comprising variable heavy chains with a light chain comprising the amino acid sequence of SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34.
- the light chain comprises the amino acid sequence of SEQ ID NO: 31.
- the light chain comprises the amino acid sequence of SEQ ID NO: 35.
- FIGS. 1A-I illustrate exemplary configurations of the T cell activating bispecific antigen binding molecules (TCBs) disclosed herein. All constructs except the kappa-lambda format in ( FIG. 1I ) have P329G LALA mutations and comprise knob-into-hole Fc fragments with knob-into-hole modifications.
- FIG. 1A Illustration of the “FolR1 TCB 2+1 inverted (common light chain)”. The FolR1 binder is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain comprising the knob modification. These constructs are not crossed and have three times the same VLCL light chain.
- FIG. 1A Illustration of the “FolR1 TCB 2+1 inverted (common light chain)”. The FolR1 binder is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain comprising the knob modification.
- FIG. 1B Illustration of the “FolR1 TCB 1+1 head-to-tail (common light chain)”. These constructs are not crossed and have two times the same VLCL light chain.
- FIG. 1C Illustration of the “FolR1 TCB 1+1 classical (common light chain)”. These constructs are not crossed and have two times the same VLCL light chain.
- FIG. 1D Illustration of the “FolR1 TCB 2+1 classical (common light chain)”. The CD3 binder is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain comprising the knob modification. These constructs are not crossed and have three times the same VLCL light chain.
- FIG. 1C Illustration of the “FolR1 TCB 1+1 classical (common light chain)”. These constructs are not crossed and have two times the same VLCL light chain.
- FIG. 1D Illustration of the “FolR1 TCB 2+1 classical (common light chain
- FIG. 1E Illustration of the “FolR1 TCB 2+1 crossfab classical”. These constructs comprise a Ck-VH chain for the CD3 binder instead of the conventional CH1-VH chain.
- the CD3 binder is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain comprising the knob modification.
- FIG. 1F Illustration of the “FolR1 TCB 2+1 crossfab inverted”.
- These constructs comprise a Ck-VH chain for the CD3 binder instead of the conventional CH1-VH chain.
- the FolR1 binder is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain comprising the knob modification.
- FIG. 1G Illustration of the “FolR1 TCB 1+1 crossfab head-to-tail”. These constructs comprise a Ck-VH chain for the CD3 binder instead of the conventional CH1-VH chain.
- FIG. 1H Illustration of the “FolR1 TCB 1+1 crossfab classical”. These constructs comprise a Ck-VH chain for the CD3 binder instead of the conventional CH1-VH chain.
- FIG. 11 illustrates the CD3/FolR1 kappa-lambda antibody format. These constructs comprise a crossed common light chain VLCH1 and one crossed VHCL chain specific for CD3 and one crossed VHCL chain specific for FolR1.
- FIGS. 2A-C depict graphs summarizing Binding of FoLR1 IgG binders to HeLa cells. Binding of newly generated FolR1 binders to FolR1 expressed on HeLa cells were determined by flow cytometry. Bound antibodies were detected with a fluorescently labeled anti-human secondary antibody.
- FIGS. 3A-B depict graphs summarizing specificity of FolR1 binders for FolR1. Binding of FolR1 IgGs to HEK cells transiently transfected with either FolR1 or FolR2 was analyzed by flow cytometry to identify clones which bind specifically to FolR1 and not to FolR2. The antibodies were detected with a fluorescently labeled anti-human secondary antibody.
- FIGS. 4A-B depict graphs summarizing cross-reactivity of FolR1 binders to cyFoLR1.
- Cross-reactivity of the FolR1 antibodies to cyno FolR1 was addressed on HEK cells transiently transfected with cyFolR1 by flow cytometry. The antibodies were detected with a fluorescently labeled anti-human secondary antibody.
- FIG. 5 depicts a graph illustrating internalization of FolR1 TCBs after binding. Internalization of the four FolR1 TCBs after binding to FolR1 was tested on HeLa cells. Remaining FolR1 TCBs on the surface were detected with a fluorescently labeled anti-human secondary antibody after indicated time points of incubation at 37° C. Percentage of internalization was calculated.
- FIGS. 6A-E depict graphs summarizing binding of FolR1 IgGs to cells with different FolR1 expression levels. Binding of 9D11, 16D5 and Mov19 IgG to tumor cells with different FolR1 expression levels was analyzed by flow cytometry. DP47 IgG was included as isotype control and MKN-45 were included as FolR1 negative cell line. The antibodies were detected with a fluorescently labeled anti-human secondary antibody.
- FIGS. 7A-L depict graphs summarizing T cell mediated killing of HT-29 and SKOV3 cells.
- FolR1 TCBs were used to test T cell mediated killing of HT-29 and SKOV3 tumor cells and upregulation of activation marker on T cells upon killing.
- FIGS. 7A-D T cell mediated killing of HT-29 and SKOV3 cells in the presence of 9D11 FolR1 TCB and 16D5 FolR1 TCB was measured by LDH release after 24 h and 48 h. DP47 TCB was included as negative control. After 48 h incubation upregulation of the activation marker CD25 and CD69 on CD8 T cells and CD4 T cells upon killing of SKOV3 ( FIGS. 7E-H ) or HT-29 ( FIG. 71 -L) tumor cells was assessed by flow cytometry.
- FIG. 8 depicts a graph showing absence of anti-FolR1 binding to erythrocytes.
- Erythrocytes were gated as CD235a positive population and binding of 9D11 IgG, 16D5 IgG, Mov19 IgG and DP47 IgG to this population was determined by flow cytometry.
- the antibodies were detected with a fluorescently labeled anti-human secondary antibody.
- FIGS. 9A-D depict graphs summarizing activation marker upregulation in whole blood.
- FIG. 10 Binding of 9D11 TCB a-glyco variants to HeLa cells. Binding of 9D11 FolR1 TCB a-glyco variants to Hela cells was compared to binding of the original 9D11 TCB on HeLa cells. The antibodies were detected with a fluorescently labeled anti-human secondary antibody and binding was determined by flow cytometry.
- FIGS. 11A-F depict graphs summarizing T cell mediated killing with 9D11 FolR1 TCB a-glyco variants of tumor cells.
- 9D11 FolR1 TCB a-glyco variants were used to test T cell mediated killing of ( FIG. 11A-D ) SKOV3, MKN-45 (as FolR1 negative control) and ( FIG. 11E-F ) HT-29 tumor cells in comparison to killing with the original 9D11 FolR1 TCB.
- FIGS. 12A-X depict graphs summarizing T cell mediated killing of primary epithelial cells.
- Primary epithelial cells with very low levels of FolR1 were used to test T cell mediated killing with 16D5 FolR1 TCB and 9D11 FolR1 TCB, DP47 TCB was included as a negative control and HT29 cells were included as positive control.
- FIGS. 12A-H LDH release of human retinal pigment (HRP), human renal cortical (HRC), human bronchial (HB) and of HT29 cells was determined after 24 h and 48 h.
- CD25 and CD69 activation marker upregulation on CD4 T cells and CD8 T cells upon killing of FIGS. 12I-L ) HRP, ( FIGS. 12M-P ) HRC, ( FIGS. 12Q-T ) HB and ( FIGS. 12 U-X) HT29 was determined after 48 h by flow cytometry.
- FIGS. 13A-C show a comparison of different TCB formats with 16D5.
- Four different TCB formats containing the FolR1 binder 16D5 were compared in FIG. 13A binding to HeLa cells, in FIG. 14 B T cell mediated killing of SKOV3 cells after 24 h and 48 h and in FIG. 14C CD25 and CD69 activation marker upregulation on CD4 T cells and CD8 T cells 48 h after killing.
- FIGS. 14A-C depict a comparison of different TCB formats with 9D11.
- Three different TCB formats containing the FolR1 binder 9D11 were compared in A) binding to HeLa cells, in B) T cell mediated killing of SKOV3 cells after 24 h and 48 h and in C) CD25 and CD69 activation marker upregulation on CD4 T cells and CD8 T cells 48 h after killing.
- FIG. 15 depicts a PK-profile of FOLR1 TCB in NOG mice for three different doses.
- FIG. 16 illustrates an experimental protocol for efficacy study with FOLR1 TCB.
- FIGS. 17A-B depict tumor growth curves.
- FIG. 17A Mean values and SEM of tumor volumes in the different treatment groups.
- FIG. 17B Tumor growth of single mice in all treatment groups. TGI (tumor growth inhibition) give the percentage of the Mean tumor volume compared to vehicle group.
- FIG. 18 shows tumor weights at study termination.
- FIGS. 19A-B show FACS analysis of tumor infiltrating T-cells at study day 32.
- FIG. 19A Tumor single cells suspensions were stained with anti-human CD3/CD4/CD8 and analyzed by flow cytometry.
- FIG. 19B Mean values and SEM of T-cell counts per mg tumor tissue in different treatment groups.
- FIGS. 20A-B show FACS analysis for T-cell activation/degranulation and cytokine secretion at study day 32.
- FIGS. 21A-B show percent tumor lysis.
- SKOV3 cells were incubated with PBMCs in the presence of either kappa lambda FoLR1 TCB or DP47 TCB. After 24 h ( FIG. 21A ) and 48 h ( FIG. 21B ) killing of tumor cells was determined by measuring LDH release
- FIGS. 22A-D show CD25 and CD69 upregulation on CD4 T cells.
- SKOV3 cells were incubated with PBMCs in the presence of either kappa lambda FoLR1 TCB or DP47 TCB. After 48 h CD25 and CD69 upregulation on CD4 T cells ( FIG. 22A-B ) and CD8 T cells ( FIG. 22C-D ) was measured by flow cytometry.
- DP47 TCB was included as non-binding control.
- FIG. 27 depicts a table summarizing quantification of FolR1 binding sites on various normal and cancer cells lines.
- FIGS. 28A-B show binding of 16D5 TCB and its corresponding CD3 deamidation variants 16D5 TCB N100A and 16D5 TCB S100aA and 9D11 TCB and its demidation variants 9D11 TCB N100A and 9D11 TCB S100aA to human CD3 expressed on Jurkat cells.
- DP47 TCB was included as non-binding control.
- DP47 TCB was included as non-binding control.
- FIG. 31 shows a sequence alignment of the VH domains of the 3 identified MUC1-specific binders. All three clones are derivatives of the IGHV3-23 germline (SEQ ID NO: 136). Clone 58D6 (SEQ ID NO: 60) and 110A5 (SEQ ID NO: 64) originate from a library that was only randomized in CDR3, while clone 106D2 (SEQ ID NO: 62) was identified from a library randomized in all 3 CDRs. Positions in CDR1 and 2 that deviate from the germline sequence are printed italic.
- FIGS. 32A-B shows results of characterization of CLC binders.
- FIG. 32A SPR analysis. SPR-based kinetic analyses of 3 clones specifically binding to MUC1. Smooth lines represent a global fit of the data to a 1:1 interaction model.
- FIG. 32B Summary of kinetic and thermodynamic parameters.
- FIG. 33 depicts a schematic diagram of the generated TCB construct.
- the CLC TCB construct consists of 3 different immunoglobulin chains: 1) an IgG heavy chain harbouring the “hole mutations” in the Fc part and containing the target-specific VH domain; 2) an Ig chain consisting of the target-specific VH and a CH1 domain, followed by the CD3-specific VH domain and a CH1 domain, followed by the Fc part containing the “knob” mutations; and 3) the common light chain that anneals to both the MUC1-specific and the CD3-specific sequences.
- FIGS. 34A-B depicts purification and analytical characterization of the produced MUC1-specific TCBs ( FIG. 34A and FIG. 34B ).
- the purification method involved an affinity step (protein A) followed by size exclusion chromatography (Superdex 200, GE Healthcare). The final product was analyzed and characterized by analytical size exclusion chromatography (Superdex 200 column) and by capillary electrophoresis.
- FIG. 35 depicts SPR analysis of the MUC1-specific binders in the TCB format. Shown is the binding of 2 MUC1-specific TCBs at different concentrations (see text) to either MUC1 or an unrelated antigen. Smooth lines represent a global fit of the data to a 1:1 interaction model
- FIGS. 36A-G depict bispecific bivalent and trivalent antibodies comprising only the Fab fragments (specific to CD3 and BCMA) with or without an Fc part as specified:
- A Fab BCMA-Fc-Fab CD3;
- B Fab BCMA-Fc-Fab CD3-Fab BCMA;
- C Fab BCMA-Fc-Fab BCMA-Fab CD3;
- D Fc-Fab CD3-Fab BCMA;
- E Fc-Fab BCMA-Fab CD3;
- F Fab CD3-Fab BCMA-Fab BCMA;
- G Fab CD3-Fab BCMA.
- the LC of Fab CD3 and Fab BCMA are identical (common LC) to avoid LC mispairing and reduce side-products.
- Fab CD3 and Fab BCMA are linked to each other with flexible linkers.
- FIG. 37 depicts lack of binding of BCMA IgG antibody to TACI receptor as detected by surface plasmon resonance (SPR).
- Curve 1 corresponds to the signal on reference channel
- curve 2 to the channel where the binding occurs (binding channel)
- the curve 2 ⁇ 1 is the subtracted signal (binding channel—reference channel), meaning that this is the signal due to the binding event.
- SPR binding assay clearly demonstrated that pSCHLI372 IgG did not bind to human TACI receptor.
- FIGS. 38A-C show production and purification of BCMA-TCB CLC.
- CE-SDS graphs non-reduced (top) and reduced (bottom)) of the final protein preparations after Protein A (PA) affinity chromatography and size exclusion chromatographic (SEC) purification steps applied to (A) pSCHLI333-TCB CLC, (B) pSCHLI372-TCB CLC, (C) pSCHLI373-TCB CLC. All three molecules are of molecular format as described in FIG. 36B .
- FIGS. 39A-B show binding of BCMA-TCB CLC antibodies on BCMA hi -positive H929 cells by flow cytometry.
- the median fluorescence intensity of BCMA-TCB CLC antibodies were plotted in function of antibody concentrations (0.12 to 500 nM);
- (A) pSCHLI372-TCB CLC and pSCHLI373-TCB CLC on H929 cells (A) and MKN45 cells (B).
- DP47-TCB is a negative control TCB which did not bind to BCMA at concentrations below 100 nM (see Example 7).
- FIGS. 40A-B show binding of BCMA-TCB CLC antibodies on CD3-positive Jurkat T cells as measured by flow cytometry.
- FIG. 41 shows T-cell activation mediated by BCMA-TCB CLC antibodies in presence of H929 cells as detected by flow cytometry.
- pSCHLI372-TCB CLC and pSCHLI373-TCB CLC antibodies induced an up-regulation of CD69 and CD25 activation markers in a concentration-dependent and specific manner in the presence of BCMA-positive target cells.
- DP47-TCB which is a negative control TCB did not induce T-cell activation. Representative results are from two independent experiments.
- FIGS. 42A-B show BCMA-TCB CLC antibodies induce T-cell redirected killing of BCMA hi -positive H929 myeloma cells as detected by colorimetric LDH release assay.
- BCMA-TCB CLC antibodies pSCHLI372-TCB CLC (A, B) and pSCHLI373-TCB CLC (A) induced a concentration-dependent killing of BCMA hi -positive H929 myeloma cells as measured by LDH release.
- DP47-TCB which is a negative control TCB that does not bind to BCMA but only to CD3 did not induce H929 cell killing.
- FIGS. 43 shows BCMA-TCB CLC antibodies induce T-cell redirected killing of BCMA med/lo -positive U266 myeloma cells as detected by colorimetric LDH release assay.
- BCMA-TCB CLC antibodies pSCHLI372-TCB CLC and pSCHLI373-TCB CLC induced a concentration-dependent killing of BCMA med/lo -positive U266 myeloma cells as measured by LDH release.
- DP47-TCB which is a negative control TCB that does not bind to BCMA but only to CD3 did not induce H929 cell killing.
- antigen binding molecule refers in its broadest sense to a molecule that specifically binds an antigenic determinant.
- antigen binding molecules are immunoglobulins and derivatives, e.g. fragments, thereof.
- bispecific means that the antigen binding molecule is able to specifically bind to at least two distinct antigenic determinants.
- a bispecific antigen binding molecule comprises two antigen binding sites, each of which is specific for a different antigenic determinant.
- the bispecific antigen binding molecule is capable of simultaneously binding two antigenic determinants, particularly two antigenic determinants expressed on two distinct cells.
- valent denotes the presence of a specified number of antigen binding sites in an antigen binding molecule.
- monovalent binding to an antigen denotes the presence of one (and not more than one) antigen binding site specific for the antigen in the antigen binding molecule.
- an “antigen binding site” refers to the site, i.e. one or more amino acid residues, of an antigen binding molecule which provides interaction with the antigen.
- the antigen binding site of an antibody comprises amino acid residues from the complementarity determining regions (CDRs).
- CDRs complementarity determining regions
- a native immunoglobulin molecule typically has two antigen binding sites, a Fab molecule typically has a single antigen binding site.
- an antigen binding moiety refers to a polypeptide molecule that specifically binds to an antigenic determinant.
- an antigen binding moiety is able to direct the entity to which it is attached (e.g. a second antigen binding moiety) to a target site, for example to a specific type of tumor cell or tumor stroma bearing the antigenic determinant.
- an antigen binding moiety is able to activate signaling through its target antigen, for example a T cell receptor complex antigen.
- Antigen binding moieties include antibodies and fragments thereof as further defined herein. Particular antigen binding moieties include an antigen binding domain of an antibody, comprising an antibody heavy chain variable region and an antibody light chain variable region.
- the antigen binding moieties may comprise antibody constant regions as further defined herein and known in the art.
- Useful heavy chain constant regions include any of the five isotypes: ⁇ , ⁇ , ⁇ , ⁇ , or ⁇ .
- Useful light chain constant regions include any of the two isotypes: ⁇ and ⁇ .
- antigenic determinant is synonymous with “antigen” and “epitope,” and refers to a site (e.g. a contiguous stretch of amino acids or a conformational configuration made up of different regions of non-contiguous amino acids) on a polypeptide macromolecule to which an antigen binding moiety binds, forming an antigen binding moiety-antigen complex.
- Useful antigenic determinants can be found, for example, on the surfaces of tumor cells, on the surfaces of virus-infected cells, on the surfaces of other diseased cells, on the surface of immune cells, free in blood serum, and/or in the extracellular matrix (ECM).
- ECM extracellular matrix
- MCSP, FAP, CEA, EGFR, CD33, CD3 can be any native form the proteins from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g. mice and rats), unless otherwise indicated.
- the antigen is a human protein.
- the term encompasses the “full-length”, unprocessed protein as well as any form of the protein that results from processing in the cell.
- the term also encompasses naturally occurring variants of the protein, e.g. splice variants or allelic variants.
- Exemplary human proteins useful as antigens include, but are not limited to Folate Receptor 1 (FolR1, Folate receptor alpha (FRA); Folate binding protein (FBP); human FolR1 UniProt no.: P15328; murine FolR1 UniProt no.: P35846; cynomolgus FolR1 UniProt no.: G7PR14), Mucin-1 (MUC1), and B Cell Maturation Antigen (BCMA), and CD3, particularly the epsilon subunit of CD3 (see UniProt no. P07766 (version 130), NCBI RefSeq no. NP_000724.1 for the human sequence; or UniProt no. Q95LI5 (version 49), NCBI GenBank no. BAB71849.1 for the cynomolgus [ Macaca fascicularis ] sequence).
- Folate Receptor 1 Folate Receptor 1
- FBP Folate binding protein
- the T cell activating bispecific antigen binding molecule of the invention binds to an epitope of an activating T cell antigen or a target cell antigen that is conserved among the activating T cell antigen or target antigen from different species.
- ELISA enzyme-linked immunosorbent assay
- SPR surface plasmon resonance
- an antigen binding moiety that binds to the antigen, or an antigen binding molecule comprising that antigen binding moiety has a dissociation constant (K D ) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 10 ⁇ 8 M or less, e.g. from 10 ⁇ 8 M to 10 ⁇ 13 M, e.g., from 10 ⁇ 9 M to 10 ⁇ 13 M).
- K D dissociation constant
- Binding affinity refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., an antigen binding moiety and an antigen, or a receptor and its ligand).
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K D ), which is the ratio of dissociation and association rate constants (k off and k on , respectively).
- affinities may comprise different rate constants, as long as the ratio of the rate constants remains the same.
- Affinity can be measured by well established methods known in the art, including those described herein.
- a particular method for measuring affinity is Surface Plasmon Resonance (SPR).
- Reduced binding for example reduced binding to an Fc receptor, refers to a decrease in affinity for the respective interaction, as measured for example by SPR.
- the term includes also reduction of the affinity to zero (or below the detection limit of the analytic method), i.e. complete abolishment of the interaction.
- increased binding refers to an increase in binding affinity for the respective interaction.
- an “activating T cell antigen” as used herein refers to an antigenic determinant expressed on the surface of a T lymphocyte, particularly a cytotoxic T lymphocyte, which is capable of inducing T cell activation upon interaction with an antigen binding molecule. Specifically, interaction of an antigen binding molecule with an activating T cell antigen may induce T cell activation by triggering the signaling cascade of the T cell receptor complex. In a particular embodiment the activating T cell antigen is CD3.
- T cell activation refers to one or more cellular response of a T lymphocyte, particularly a cytotoxic T lymphocyte, selected from: proliferation, differentiation, cytokine secretion, cytotoxic effector molecule release, cytotoxic activity, and expression of activation markers.
- the T cell activating bispecific antigen binding molecules of the invention are capable of inducing T cell activation. Suitable assays to measure T cell activation are known in the art described herein.
- a “target cell antigen” as used herein refers to an antigenic determinant presented on the surface of a target cell, for example a cell in a tumor such as a cancer cell or a cell of the tumor stroma.
- first and second with respect to antigen binding moieties etc., are used for convenience of distinguishing when there is more than one of each type of moiety. Use of these terms is not intended to confer a specific order or orientation of the T cell activating bispecific antigen binding molecule unless explicitly so stated.
- BCMA human B cell maturation target
- TR17_HUMAN TNFRSF17 (UniProt Q02223)
- TNFRSF17 UniProt Q02223
- the extracellular domain of BCMA consists according to UniProt of amino acids 1-54 (or 5-51).
- antibody against BCMA, anti BCMA antibody as used herein relates to an antibody specifically binding to BCMA.
- CD3 ⁇ or CD3 as used herein relates to human CD3 ⁇ described under UniProt P07766 (CD3E_HUMAN).
- antibody against CD3, anti CD3 antibody relates to an antibody binding to CD3 ⁇ .
- a “Fab molecule” refers to a protein consisting of the VH and CH1 domain of the heavy chain (the “Fab heavy chain”) and the VL and CL domain of the light chain (the “Fab light chain”) of an immunoglobulin.
- the term “Fab molecules having identical VLCL light chains” as used therein refers to binders that share one light chain but still have separate specificities.
- T-cell activating bispecific molecules of the invention comprise at least two Fab molecules having identical VLCL light chains. The corresponding heavy chains are remodeled and confer specific binding to a T cell activating bispecific antigen and a target cell antigen, respectively.
- fused is meant that the components (e.g. a Fab molecule and an Fc domain subunit) are linked by peptide bonds, either directly or via one or more peptide linkers.
- common light chain refers to a light chain that within a bispecific or multispecific molecule pairs with more than one heavy chain or fragment thereof to form at least a first and a second antigen binding site, e.g., a Fab, each specific for a different antigen.
- first and a second antigen binding site e.g., a Fab
- another copy of the common light chain pairs with a second heavy chain or fragment thereof within an antigen binding molecule to form a second binding site specific for a T cell activating antigen, e.g., CD3.
- immunoglobulin molecule refers to a protein having the structure of a naturally occurring antibody.
- immunoglobulins of the IgG class are heterotetrameric glycoproteins of about 150,000 daltons, composed of two light chains and two heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CH1, CH2, and CH3), also called a heavy chain constant region.
- VH variable region
- CH1, CH2, and CH3 constant domains
- each light chain has a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a constant light (CL) domain, also called a light chain constant region.
- VL variable region
- the heavy chain of an immunoglobulin may be assigned to one of five types, called ⁇ (IgA), ⁇ (IgD), ⁇ (IgE), ⁇ (IgG), or ⁇ (IgM), some of which may be further divided into subtypes, e.g. ⁇ 1 (IgG 1 ), ⁇ 2 (IgG 2 ), ⁇ 3 (IgG 3 ), ⁇ 4 (IgG 4 ), ⁇ 1 (IgA 1 ) and ⁇ 2 (IgA 2 ).
- the light chain of an immunoglobulin may be assigned to one of two types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequence of its constant domain.
- An immunoglobulin essentially consists of two Fab molecules and an Fc domain, linked via the immunoglobulin hinge region.
- antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, and antibody fragments so long as they exhibit the desired antigen-binding activity.
- antibody fragment refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds.
- antibody fragments include but are not limited to Fv, Fab, Fab′, Fab′-SH, F(ab′) 2 , diabodies, linear antibodies, single-chain antibody molecules (e.g. scFv), and single-domain antibodies.
- scFv single-chain antibody molecules
- Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific.
- Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody.
- a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham, Mass.; see e.g. U.S. Pat. No. 6,248,516 B1).
- Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g. E. coli or phage), as described herein.
- an antigen binding domain refers to the part of an antibody that comprises the area which specifically binds to and is complementary to part or all of an antigen.
- An antigen binding domain may be provided by, for example, one or more antibody variable domains (also called antibody variable regions).
- an antigen binding domain comprises an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH).
- variable region refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen.
- the variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HVRs). See, e.g., Kindt et al., Kuby Immunology, 6 th ed., W.H. Freeman and Co., page 91 (2007).
- a single VH or VL domain may be sufficient to confer antigen-binding specificity.
- hypervariable region refers to each of the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops (“hypervariable loops”).
- native four-chain antibodies comprise six HVRs; three in the VH (H1, H2, H3), and three in the VL (L1, L2, L3).
- HVRs generally comprise amino acid residues from the hypervariable loops and/or from the complementarity determining regions (CDRs), the latter being of highest sequence variability and/or involved in antigen recognition. With the exception of CDR1 in VH, CDRs generally comprise the amino acid residues that form the hypervariable loops.
- Hypervariable regions are also referred to as “complementarity determining regions” (CDRs), and these terms are used herein interchangeably in reference to portions of the variable region that form the antigen binding regions.
- CDRs complementarity determining regions
- This particular region has been described by Kabat et al., U.S. Dept. of Health and Human Services, Sequences of Proteins of Immunological Interest (1983) and by Chothia et al., J Mol Biol 196:901-917 (1987), where the definitions include overlapping or subsets of amino acid residues when compared against each other. Nevertheless, application of either definition to refer to a CDR of an antibody or variants thereof is intended to be within the scope of the term as defined and used herein.
- Kabat et al. also defined a numbering system for variable region sequences that is applicable to any antibody.
- One of ordinary skill in the art can unambiguously assign this system of “Kabat numbering” to any variable region sequence, without reliance on any experimental data beyond the sequence itself.
- “Kabat numbering” refers to the numbering system set forth by Kabat et al., U.S. Dept. of Health and Human Services, “Sequence of Proteins of Immunological Interest” (1983). Unless otherwise specified, references to the numbering of specific amino acid residue positions in an antibody variable region are according to the Kabat numbering system.
- polypeptide sequences of the sequence listing are not numbered according to the Kabat numbering system. However, it is well within the ordinary skill of one in the art to convert the numbering of the sequences of the Sequence Listing to Kabat numbering.
- “Framework” or “FR” refers to variable domain residues other than hypervariable region (HVR) residues.
- the FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
- the “class” of an antibody or immunoglobulin refers to the type of constant domain or constant region possessed by its heavy chain.
- the heavy chain constant domains that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
- Fc domain or “Fc region” herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region.
- the term includes native sequence Fc regions and variant Fc regions.
- the boundaries of the Fc region of an IgG heavy chain might vary slightly, the human IgG heavy chain Fc region is usually defined to extend from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain.
- the C-terminal lysine (Lys447) of the Fc region may or may not be present.
- a “subunit” of an Fc domain as used herein refers to one of the two polypeptides forming the dimeric Fc domain, i.e. a polypeptide comprising C-terminal constant regions of an immunoglobulin heavy chain, capable of stable self-association.
- a subunit of an IgG Fc domain comprises an IgG CH2 and an IgG CH3 constant domain.
- a “modification promoting the association of the first and the second subunit of the Fc domain” is a manipulation of the peptide backbone or the post-translational modifications of an Fc domain subunit that reduces or prevents the association of a polypeptide comprising the Fc domain subunit with an identical polypeptide to form a homodimer.
- a modification promoting association as used herein particularly includes separate modifications made to each of the two Fc domain subunits desired to associate (i.e. the first and the second subunit of the Fc domain), wherein the modifications are complementary to each other so as to promote association of the two Fc domain subunits.
- a modification promoting association may alter the structure or charge of one or both of the Fc domain subunits so as to make their association sterically or electrostatically favorable, respectively.
- (hetero)dimerization occurs between a polypeptide comprising the first Fc domain subunit and a polypeptide comprising the second Fc domain subunit, which might be non-identical in the sense that further components fused to each of the subunits (e.g. antigen binding moieties) are not the same.
- the modification promoting association comprises an amino acid mutation in the Fc domain, specifically an amino acid substitution.
- the modification promoting association comprises a separate amino acid mutation, specifically an amino acid substitution, in each of the two subunits of the Fc domain.
- effector functions refers to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype.
- antibody effector functions include: C1q binding and complement dependent cytotoxicity (CDC), Fc receptor binding, antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), cytokine secretion, immune complex-mediated antigen uptake by antigen presenting cells, down regulation of cell surface receptors (e.g. B cell receptor), and B cell activation.
- engine engineered, engineering
- engineering includes modifications of the amino acid sequence, of the glycosylation pattern, or of the side chain group of individual amino acids, as well as combinations of these approaches.
- amino acid mutation as used herein is meant to encompass amino acid substitutions, deletions, insertions, and modifications. Any combination of substitution, deletion, insertion, and modification can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., reduced binding to an Fc receptor, or increased association with another peptide.
- Amino acid sequence deletions and insertions include amino- and/or carboxy-terminal deletions and insertions of amino acids.
- Particular amino acid mutations are amino acid substitutions.
- non-conservative amino acid substitutions i.e. replacing one amino acid with another amino acid having different structural and/or chemical properties, are particularly preferred.
- Amino acid substitutions include replacement by non-naturally occurring amino acids or by naturally occurring amino acid derivatives of the twenty standard amino acids (e.g. 4-hydroxyproline, 3-methylhistidine, ornithine, homoserine, 5-hydroxylysine).
- Amino acid mutations can be generated using genetic or chemical methods well known in the art. Genetic methods may include site-directed mutagenesis, PCR, gene synthesis and the like. It is contemplated that methods of altering the side chain group of an amino acid by methods other than genetic engineering, such as chemical modification, may also be useful. Various designations may be used herein to indicate the same amino acid mutation. For example, a substitution from proline at position 329 of the Fc domain to glycine can be indicated as 329G, G329, G 329 , P329G, or Pro329Gly.
- polypeptide refers to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds).
- polypeptide refers to any chain of two or more amino acids, and does not refer to a specific length of the product.
- peptides, dipeptides, tripeptides, oligopeptides, “protein,” “amino acid chain,” or any other term used to refer to a chain of two or more amino acids are included within the definition of “polypeptide,” and the term “polypeptide” may be used instead of, or interchangeably with any of these terms.
- polypeptide is also intended to refer to the products of post-expression modifications of the polypeptide, including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids.
- a polypeptide may be derived from a natural biological source or produced by recombinant technology, but is not necessarily translated from a designated nucleic acid sequence. It may be generated in any manner, including by chemical synthesis.
- a polypeptide of the invention may be of a size of about 3 or more, 5 or more, 10 or more, 20 or more, 25 or more, 50 or more, 75 or more, 100 or more, 200 or more, 500 or more, 1,000 or more, or 2,000 or more amino acids.
- Polypeptides may have a defined three-dimensional structure, although they do not necessarily have such structure. Polypeptides with a defined three-dimensional structure are referred to as folded, and polypeptides which do not possess a defined three-dimensional structure, but rather can adopt a large number of different conformations, and are referred to as unfolded.
- an “isolated” polypeptide or a variant, or derivative thereof is intended a polypeptide that is not in its natural milieu. No particular level of purification is required.
- an isolated polypeptide can be removed from its native or natural environment.
- Recombinantly produced polypeptides and proteins expressed in host cells are considered isolated for the purpose of the invention, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique.
- Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2.
- the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087.
- the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif., or may be compiled from the source code.
- the ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows:
- polynucleotide refers to an isolated nucleic acid molecule or construct, e.g. messenger RNA (mRNA), virally-derived RNA, or plasmid DNA (pDNA).
- mRNA messenger RNA
- pDNA virally-derived RNA
- a polynucleotide may comprise a conventional phosphodiester bond or a non-conventional bond (e.g. an amide bond, such as found in peptide nucleic acids (PNA).
- PNA peptide nucleic acids
- nucleic acid molecule refers to any one or more nucleic acid segments, e.g. DNA or RNA fragments, present in a polynucleotide.
- isolated nucleic acid molecule or polynucleotide is intended a nucleic acid molecule, DNA or RNA, which has been removed from its native environment.
- a recombinant polynucleotide encoding a polypeptide contained in a vector is considered isolated for the purposes of the present invention.
- Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) polynucleotides in solution.
- An isolated polynucleotide includes a polynucleotide molecule contained in cells that ordinarily contain the polynucleotide molecule, but the polynucleotide molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
- Isolated RNA molecules include in vivo or in vitro RNA transcripts of the present invention, as well as positive and negative strand forms, and double-stranded forms. Isolated polynucleotides or nucleic acids according to the present invention further include such molecules produced synthetically.
- a polynucleotide or a nucleic acid may be or may include a regulatory element such as a promoter, ribosome binding site, or a transcription terminator.
- nucleic acid or polynucleotide having a nucleotide sequence at least, for example, 95% “identical” to a reference nucleotide sequence of the present invention it is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence.
- a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence.
- These alterations of the reference sequence may occur at the 5′ or 3′ terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence.
- any particular polynucleotide sequence is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a nucleotide sequence of the present invention can be determined conventionally using known computer programs, such as the ones discussed above for polypeptides (e.g. ALIGN-2).
- expression cassette refers to a polynucleotide generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a target cell.
- the recombinant expression cassette can be incorporated into a plasmid, chromosome, mitochondrial DNA, plastid DNA, virus, or nucleic acid fragment.
- the recombinant expression cassette portion of an expression vector includes, among other sequences, a nucleic acid sequence to be transcribed and a promoter.
- the expression cassette of the invention comprises polynucleotide sequences that encode bispecific antigen binding molecules of the invention or fragments thereof.
- vector or “expression vector” is synonymous with “expression construct” and refers to a DNA molecule that is used to introduce and direct the expression of a specific gene to which it is operably associated in a target cell.
- the term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
- the expression vector of the present invention comprises an expression cassette. Expression vectors allow transcription of large amounts of stable mRNA. Once the expression vector is inside the target cell, the ribonucleic acid molecule or protein that is encoded by the gene is produced by the cellular transcription and/or translation machinery.
- the expression vector of the invention comprises an expression cassette that comprises polynucleotide sequences that encode bispecific antigen binding molecules of the invention or fragments thereof.
- host cell refers to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells.
- Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
- a host cell is any type of cellular system that can be used to generate the bispecific antigen binding molecules of the present invention.
- Host cells include cultured cells, e.g.
- mammalian cultured cells such as CHO cells, BHK cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, yeast cells, insect cells, and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue.
- an “activating Fc receptor” is an Fc receptor that following engagement by an Fc domain of an antibody elicits signaling events that stimulate the receptor-bearing cell to perform effector functions.
- Human activating Fc receptors include Fc ⁇ RIIIa (CD16a), Fc ⁇ RI (CD64), Fc ⁇ RIIa (CD32), and Fc ⁇ RI (CD89).
- Antibody-dependent cell-mediated cytotoxicity is an immune mechanism leading to the lysis of antibody-coated target cells by immune effector cells.
- the target cells are cells to which antibodies or derivatives thereof comprising an Fc region specifically bind, generally via the protein part that is N-terminal to the Fc region.
- reduced ADCC is defined as either a reduction in the number of target cells that are lysed in a given time, at a given concentration of antibody in the medium surrounding the target cells, by the mechanism of ADCC defined above, and/or an increase in the concentration of antibody in the medium surrounding the target cells, required to achieve the lysis of a given number of target cells in a given time, by the mechanism of ADCC.
- the reduction in ADCC is relative to the ADCC mediated by the same antibody produced by the same type of host cells, using the same standard production, purification, formulation and storage methods (which are known to those skilled in the art), but that has not been engineered.
- the reduction in ADCC mediated by an antibody comprising in its Fc domain an amino acid substitution that reduces ADCC is relative to the ADCC mediated by the same antibody without this amino acid substitution in the Fc domain.
- Suitable assays to measure ADCC are well known in the art (see e.g. PCT publication no. WO 2006/082515 or PCT patent application no. PCT/EP2012/055393).
- an “effective amount” of an agent refers to the amount that is necessary to result in a physiological change in the cell or tissue to which it is administered.
- a “therapeutically effective amount” of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
- a therapeutically effective amount of an agent for example eliminates, decreases, delays, minimizes or prevents adverse effects of a disease.
- mammals include, but are not limited to, domesticated animals (e.g. cows, sheep, cats, dogs, and horses), primates (e.g. humans and non-human primates such as monkeys), rabbits, and rodents (e.g. mice and rats). Particularly, the individual or subject is a human.
- domesticated animals e.g. cows, sheep, cats, dogs, and horses
- primates e.g. humans and non-human primates such as monkeys
- rabbits e.g. mice and rats
- rodents e.g. mice and rats
- composition refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
- a “pharmaceutically acceptable carrier” refers to an ingredient in a pharmaceutical composition, other than an active ingredient, which is nontoxic to a subject.
- a pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
- treatment refers to clinical intervention in an attempt to alter the natural course of a disease in the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
- T cell activating bispecific antigen binding molecules of the invention are used to delay development of a disease or to slow the progression of a disease.
- package insert is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
- the present invention provides bispecific antigen binding molecules designed for T cell activation and re-direction that combine good efficacy and produceability and methods of making and using the same.
- this invention relates to bispecific molecules wherein at least two binding moieties have identical light chains and, in some embodiments, corresponding remodeled heavy chains that confer the specific binding to a T cell activating bispecific antigen and a target cell antigen, respectively.
- This so-called ‘common light chain’ principle i.e. combining two binders that share one light chain but still have separate specificities, prevents light chain mispairing.
- there are less side products during production facilitating the homogenous preparation of T cell activating bispecific antigen binding molecules.
- the present invention particularly pertains to a predefined rare light chain which contributes significantly to antigen binding and heteromultimeric pairing with different binding partners, e.g., heavy chains and fragments thereof.
- This common light chain is, thus, suitable as for use in a library from which new bi- or multispecific antigen binding molecules can be prepared.
- the common light chain used in connection with antigen binding molecules and methods disclosed herein can be used to form an antigen binding molecule useful for T cell activation.
- One of skill in the art can recognize the advantageous efficiency of having such light chain that can function in both, T cell activating antigen binding moieties and target antigen binding moieties. This allows for efficient production of T cell activating bispecific antigen binding molecules that comprise the T cell activation component and a target antigen binding component.
- the common light chain a lambda constant light chain domain.
- the common light chain is a human or humanized lambda light chain.
- the common light chain is of the rare human lambda 7 family of light chain. Using a light chain of the lambda, particularly, the rare lambda 7 family was an uncommon approach and would have been expected to decrease the likelihood of identifying suitable heavy chain binding partners to create antigen binding molecules specific for a variety of targets. Thus, prior to the inventor's work disclosed herein, it was not known that a lambda 7 light chain with suitable properties could be developed for a variety of different unrelated target antigens such as, e.g., FolR1, MUC1, and BCMA.
- a lambda light chain could be developed to generate stable, functional, high affinity binders to improve production of T cell activating bispecific antigen binding molecules with CD3 specificity and a target antigen specificity, where the target antigens are unrelated, e.g., FolR1, MUC1, and BCMA.
- such common light chain can be used to construct a common light chain (CLC) library which is based on a specific CD3 binder, not a germline antibody, to generate specifically CD3 binders contributing to the binder, as described below.
- CLC common light chain
- the advantage of this approach is that it allows for maintaining the previously identified and validated CD3 binder such that merely a new target antigen binder for the target antigen binding moiety of a T cell activating bispecific antigen binding molecules has to be identified based on the heavy chain.
- This allows for a module approach to generating different T cell activating bispecific antigen binding molecules with identical or highly homologous chains. While the light chain is identical within a given T cell activating antigen binding molecule, the light chains of different T cell activating bispecific antigen binding molecules might be identical or highly homologous.
- highly homologous is meant that the light chains of different T cell activating bispecific antigen binding molecules produced by this module approach comprise an amino acid sequence that is at least about 95%, 96%, 97%, 98%, or 99% identical.
- highly homologous light chains of the invention have identical variable light chain regions and differ only on their constant region.
- the amino acid variance is confined to the linker region.
- the common light chain comprises a kappa constant light chain domain.
- the T cell activating bispecific antigen binding molecule uses Fabs as building blocks.
- a common light chain could be generated that can not only serve as common light chain in a bi- or multispecific molecule but also support the functional property of T cell activation of a T cell activating bispecific antigen binding molecule. Furthermore, prior to the inventors' work described herein, it was not known that a common light chain could be generated that significantly contributes to antigen binding properties of the antigen binding moiety within a T cell activating bispecific antigen binding molecule. A well-established strategy is to identify heavy chains or fragments thereof that contribute most of the binding properties, such as strength and specificity. According to the present invention, the common light chain significantly contributes to the binding properties.
- the invention provides a T cell activating bispecific antigen binding molecule comprising a first and a second antigen binding moiety, wherein the first antigen binding moiety comprises a first light chain and wherein the first antigen binding moiety is capable of specific binding to an activating T cell antigen, wherein the second antigen binding moiety comprises a second light chain and wherein the second antigen binding moiety is capable of specific binding to a target cell antigen, wherein the amino acid sequence of the first and the second light chain is identical.
- the first antigen binding moiety is a Fab.
- the second antigen binding moiety is a Fab.
- the invention provides a T cell activating bispecific antigen binding molecule comprising a first and a second antigen binding moiety, one of which is a Fab molecule capable of specific binding to an activating T cell antigen and the other one of which is a Fab molecule capable of specific binding to a target cell antigen, wherein the first and the second Fab molecule have identical light chains (variable light chain and constant light chain region, VLCL).
- the light chain (VLCL) comprises the light chain CDRs of SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34.
- said identical light chain (VLCL) comprises SEQ ID NO. 35.
- T cell activating bispecific antigen binding molecule can be fused to each other in a variety of configurations. Exemplary configurations include but are not limited to those depicted in FIGS. 1A-D .
- said T cell activating bispecific antigen binding molecule further comprises an Fc domain composed of a first and a second subunit capable of stable association.
- T cell activating bispecific antigen binding molecule comprising an Fc domain are described. All these T cell activating bispecific antigen binding molecules comprise at least two Fab fragments having identical light chains (VLCL) and having different heavy chains (VHCL) which confer the specifities to two different antigens, i.e. one Fab fragment is capable of specific binding to a T cell activating antigen and the other Fab fragment is capable of specific binding to a target cell antigen.
- VLCL identical light chains
- VHCL variable heavy chains
- the first and the second antigen binding moiety of the T cell activating bispecific antigen binding molecule are fused to each other, optionally via a peptide linker.
- the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding moiety.
- the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the second antigen binding moiety.
- the second antigen binding moiety is fused at the C-terminus of the Fab light chain to the N-terminus of the Fab light chain of the first antigen binding moiety.
- the first antigen binding moiety is fused at the C-terminus of the Fab light chain to the N-terminus of the Fab light chain of the second antigen binding moiety.
- the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first or the second subunit of the Fc domain.
- the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the second antigen binding moiety.
- the T cell activating bispecific antigen binding molecule essentially consists of a first and a second antigen binding moiety which comprise identical (VLCL) light chains, an Fc domain composed of a first and a second subunit, and optionally one or more peptide linkers, wherein the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the second antigen binding moiety, and the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first or the second subunit of the Fc domain.
- the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first or second subunit of the Fc domain.
- the T cell activating bispecific antigen binding molecule essentially consists of a first and a second antigen binding moiety which comprise identical (VLCL) light chains, an Fc domain composed of a first and a second subunit, and optionally one or more peptide linkers, wherein the first and the second antigen binding moiety are each fused at the C-terminus of the Fab heavy chain to the N-terminus of one of the subunits of the Fc domain.
- the second antigen binding moiety is fused at the C-terminus of the Fab light chain to the N-terminus of the Fab light chain of the first antigen binding moiety.
- the T cell activating bispecific antigen binding molecule essentially consists of a first and a second antigen binding moiety which comprise identical (VLCL) light chains, an Fc domain composed of a first and a second subunit, and optionally one or more peptide linkers, wherein the first antigen binding moiety is fused at the N-terminus of the Fab light chain to the C-terminus of the Fab light chain of the second antigen binding moiety, and the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first or the second subunit of the Fc domain.
- the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first or second subunit of the Fc domain.
- the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding moiety.
- the T cell activating bispecific antigen binding molecule essentially consists of a first and a second antigen binding moiety which comprise identical (VLCL) light chains, an Fc domain composed of a first and a second subunit, and optionally one or more peptide linkers, wherein the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding moiety, and the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first or the second subunit of the Fc domain.
- the first antigen binding moiety is capable of specific binding to an activating T cell antigen. In other embodiments, the first antigen binding moiety is capable of specific binding to a target cell antigen.
- the antigen binding moieties may be fused to the Fc domain or to each other directly or through a peptide linker, comprising one or more amino acids, typically about 2-20 amino acids.
- Peptide linkers are known in the art and are described herein. Suitable, non-immunogenic peptide linkers include, for example, (G 4 S) n (SEQ ID NO: 41), (SG 4 ) n (SEQ ID NO: 42), (G 4 S) n (SEQ ID NO: 41) or G 4 (SG 4 ) n (SEQ ID NO: 43) peptide linkers.
- “n” is generally a number between 1 and 10, typically between 2 and 4.
- a particularly suitable peptide linker for fusing the Fab light chains of the first and the second antigen binding moiety to each other is (G 4 5) 2 (SEQ ID NO: 44).
- linkers may comprise (a portion of) an immunoglobulin hinge region. Particularly where an antigen binding moiety is fused to the N-terminus of an Fc domain subunit, it may be fused via an immunoglobulin hinge region or a portion thereof, with or without an additional peptide linker.
- a T cell activating bispecific antigen binding molecule with a single antigen binding moiety capable of specific binding to a target cell antigen is useful, particularly in cases where internalization of the target cell antigen is to be expected following binding of a high affinity antigen binding moiety. In such cases, the presence of more than one antigen binding moiety specific for the target cell antigen may enhance internalization of the target cell antigen, thereby reducing its availablity.
- T cell activating bispecific antigen binding molecule comprising two or more antigen binding moieties specific for a target cell antigen, for example to optimize targeting to the target site or to allow crosslinking of target cell antigens.
- the T cell activating bispecific antigen binding molecule of the invention further comprises a third antigen binding moiety which is a Fab molecule capable of specific binding to a target cell antigen.
- the third antigen binding moiety is capable of specific binding to the same target cell antigen as the first or second antigen binding moiety.
- the first antigen binding moiety is capable of specific binding to an activating T cell antigen
- the second and third antigen binding moieties are capable of specific binding to a target cell antigen.
- the first, second and third antigen binding moeity comprise identical (VLCL) light chains.
- the third antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first or second subunit of the Fc domain.
- the first and the third antigen binding moiety are each fused at the C-terminus of the Fab heavy chain to the N-terminus of one of the subunits of the Fc domain, and the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding moiety.
- the T cell activating bispecific antigen binding molecule essentially consists of a first, a second and a third antigen binding moiety (Fab fragment), an Fc domain composed of a first and a second subunit, and optionally one or more peptide linkers, wherein the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the first antigen binding moiety, and the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the first subunit of the Fc domain, and wherein the third antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the second subunit of the Fc domain.
- Fab fragment antigen binding moiety
- Fc domain composed of a first and a second subunit
- optionally one or more peptide linkers wherein the second antigen binding moiety is fused at the C-terminus of the Fab heavy chain
- the first antigen binding moiety is capable of specific binding to an activating T cell antigen
- the second and third antigen binding moieties are capable of specific binding to a target cell antigen
- the first, second and third antigen binding moeities are Fab fragments which comprise identical (VLCL) light chains.
- the second and the third antigen binding moiety are each fused at the C-terminus of the Fab heavy chain to the N-terminus of one of the subunits of the Fc domain, and the first antigen binding moiety is fused at the C-terminus of the Fab heavy chain to the N-terminus of the Fab heavy chain of the second antigen binding moiety.
- the T cell activating bispecific antigen binding molecule essentially consists of an immunoglobulin molecule capable of specific binding to a target cell antigen, and a Fab molecule capable of specific binding to an activating T cell antigen, fused to the N-terminus of one of the immunoglobulin heavy chains, optionally via a peptide linker.
- the immunoglobulin molecule capable of specific binding to a target cell antigen and the Fab molecule capable of specific binding to an activating T cell antigen comprise identical (VLCL) light chains.
- first and the third antigen binding moiety may be fused to the Fc domain directly or through a peptide linker.
- first and the third antigen binding moiety are each fused to the Fc domain through an immunoglobulin hinge region.
- the immunoglobulin hinge region is a human IgG 1 hinge region.
- first and the third antigen binding moiety (or the second and the third antigen binding moiety, respectively) and the Fc domain are part of an immunoglobulin molecule.
- the immunoglobulin molecule is an IgG class immunoglobulin.
- the immunoglobulin is an IgG 1 subclass immunoglobulin.
- the immunoglobulin is an IgG 4 subclass immunoglobulin.
- the immunoglobulin is a human immunoglobulin.
- the immunoglobulin is a chimeric immunoglobulin or a humanized immunoglobulin.
- the Fc domain of the T cell activating bispecific antigen binding molecule consists of a pair of polypeptide chains comprising heavy chain domains of an immunoglobulin molecule.
- the Fc domain of an immunoglobulin G (IgG) molecule is a dimer, each subunit of which comprises the CH2 and CH3 IgG heavy chain constant domains.
- the two subunits of the Fc domain are capable of stable association with each other.
- the T cell activating bispecific antigen binding molecule of the invention comprises not more than one Fc domain.
- the Fc domain of the T cell activating bispecific antigen binding molecule is an IgG Fc domain.
- the Fc domain is an IgG 1 Fc domain.
- the Fc domain is an IgG 4 Fc domain.
- the Fc domain is an IgG 4 Fc domain comprising an amino acid substitution at position S228 (Kabat numbering), particularly the amino acid substitution S228P. This amino acid substitution reduces in vivo Fab arm exchange of IgG 4 antibodies (see Stubenrauch et al., Drug Metabolism and Disposition 38, 84-91 (2010)).
- the Fc domain is human.
- T cell activating bispecific antigen binding molecules comprise different antigen binding moieties, fused to one or the other of the two subunits of the Fc domain, thus the two subunits of the Fc domain are typically comprised in two non-identical polypeptide chains. Recombinant co-expression of these polypeptides and subsequent dimerization leads to several possible combinations of the two polypeptides. To improve the yield and purity of T cell activating bispecific antigen binding molecules in recombinant production, it will thus be advantageous to introduce in the Fc domain of the T cell activating bispecific antigen binding molecule a modification promoting the association of the desired polypeptides.
- the Fc domain of the T cell activating bispecific antigen binding molecule comprises a modification promoting the association of the first and the second subunit of the Fc domain.
- the site of most extensive protein-protein interaction between the two subunits of a human IgG Fc domain is in the CH3 domain of the Fc domain.
- said modification is in the CH3 domain of the Fc domain.
- said modification is a so-called “knob-into-hole” modification, comprising a “knob” modification in one of the two subunits of the Fc domain and a “hole” modification in the other one of the two subunits of the Fc domain.
- the knob-into-hole technology is described e.g. in U.S. Pat. No. 5,731,168; U.S. Pat. No. 7,695,936; Ridgway et al., Prot Eng 9, 617-621 (1996) and Carter, J Immunol Meth 248, 7-15 (2001).
- the method involves introducing a protuberance (“knob”) at the interface of a first polypeptide and a corresponding cavity (“hole”) in the interface of a second polypeptide, such that the protuberance can be positioned in the cavity so as to promote heterodimer formation and hinder homodimer formation.
- Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g.
- Compensatory cavities of identical or similar size to the protuberances are created in the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine).
- an amino acid residue is replaced with an amino acid residue having a larger side chain volume, thereby generating a protuberance within the CH3 domain of the first subunit which is positionable in a cavity within the CH3 domain of the second subunit, and in the CH3 domain of the second subunit of the Fc domain an amino acid residue is replaced with an amino acid residue having a smaller side chain volume, thereby generating a cavity within the CH3 domain of the second subunit within which the protuberance within the CH3 domain of the first subunit is positionable.
- the protuberance and cavity can be made by altering the nucleic acid encoding the polypeptides, e.g. by site-specific mutagenesis, or by peptide synthesis.
- the threonine residue at position 366 in the CH3 domain of the first subunit of the Fc domain the threonine residue at position 366 is replaced with a tryptophan residue (T366W), and in the CH3 domain of the second subunit of the Fc domain the tyrosine residue at position 407 is replaced with a valine residue (Y407V).
- the threonine residue at position 366 in the second subunit of the Fc domain additionally the threonine residue at position 366 is replaced with a serine residue (T366S) and the leucine residue at position 368 is replaced with an alanine residue (L368A).
- the serine residue at position 354 is replaced with a cysteine residue (S354C)
- the tyrosine residue at position 349 is replaced by a cysteine residue (Y349C).
- the antigen binding moiety capable of binding to an activating T cell antigen is fused (optionally via the antigen binding moiety capable of binding to a target cell antigen) to the first subunit of the Fc domain (comprising the “knob” modification).
- fusion of the antigen binding moiety capable of binding to an activating T cell antigen to the knob-containing subunit of the Fc domain will (further) minimize the generation of antigen binding molecules comprising two antigen binding moieties capable of binding to an activating T cell antigen (steric clash of two knob-containing polypeptides).
- a modification promoting association of the first and the second subunit of the Fc domain comprises a modification mediating electrostatic steering effects, e.g. as described in PCT publication WO 2009/089004.
- this method involves replacement of one or more amino acid residues at the interface of the two Fc domain subunits by charged amino acid residues so that homodimer formation becomes electrostatically unfavorable but heterodimerization electrostatically favorable.
- the Fc domain confers to the T cell activating bispecific antigen binding molecule favorable pharmacokinetic properties, including a long serum half-life which contributes to good accumulation in the target tissue and a favorable tissue-blood distribution ratio. At the same time it may, however, lead to undesirable targeting of the T cell activating bispecific antigen binding molecule to cells expressing Fc receptors rather than to the preferred antigen-bearing cells. Moreover, the co-activation of Fc receptor signaling pathways may lead to cytokine release which, in combination with the T cell activating properties and the long half-life of the antigen binding molecule, results in excessive activation of cytokine receptors and severe side effects upon systemic administration. Activation of (Fc receptor-bearing) immune cells other than T cells may even reduce efficacy of the T cell activating bispecific antigen binding molecule due to the potential destruction of T cells e.g. by NK cells.
- the Fc domain of the T cell activating bispecific antigen binding molecules according to the invention exhibits reduced binding affinity to an Fc receptor and/or reduced effector function, as compared to a native IgG 1 Fc domain.
- the Fc domain (or the T cell activating bispecific antigen binding molecule comprising said Fc domain) exhibits less than 50%, preferably less than 20%, more preferably less than 10% and most preferably less than 5% of the binding affinity to an Fc receptor, as compared to a native IgG 1 Fc domain (or a T cell activating bispecific antigen binding molecule comprising a native IgG 1 Fc domain), and/or less than 50%, preferably less than 20%, more preferably less than 10% and most preferably less than 5% of the effector function, as compared to a native IgG 1 Fc domain domain (or a T cell activating bispecific antigen binding molecule comprising a native IgG 1 Fc domain).
- the Fc domain domain (or the T cell activating bispecific antigen binding molecule comprising said Fc domain) does not substantially bind to an Fc receptor and/or induce effector function.
- the Fc receptor is an Fc ⁇ receptor.
- the Fc receptor is a human Fc receptor.
- the Fc receptor is an activating Fc receptor.
- the Fc receptor is an activating human Fc ⁇ receptor, more specifically human Fc ⁇ RIIIa, Fc ⁇ RI or Fc ⁇ RIIa, most specifically human Fc ⁇ RIIIa.
- the effector function is one or more selected from the group of CDC, ADCC, ADCP, and cytokine secretion. In a particular embodiment the effector function is ADCC.
- the Fc domain domain exhibits substantially similar binding affinity to neonatal Fc receptor (FcRn), as compared to a native IgG 1 Fc domain domain.
- FcRn neonatal Fc receptor
- Substantially similar binding to FcRn is achieved when the Fc domain (or the T cell activating bispecific antigen binding molecule comprising said Fc domain) exhibits greater than about 70%, particularly greater than about 80%, more particularly greater than about 90% of the binding affinity of a native IgG 1 Fc domain (or the T cell activating bispecific antigen binding molecule comprising a native IgG 1 Fc domain) to FcRn.
- the Fc domain is engineered to have reduced binding affinity to an Fc receptor and/or reduced effector function, as compared to a non-engineered Fc domain.
- the Fc domain of the T cell activating bispecific antigen binding molecule comprises one or more amino acid mutation that reduces the binding affinity of the Fc domain to an Fc receptor and/or effector function. Typically, the same one or more amino acid mutation is present in each of the two subunits of the Fc domain.
- the amino acid mutation reduces the binding affinity of the Fc domain to an Fc receptor.
- the amino acid mutation reduces the binding affinity of the Fc domain to an Fc receptor by at least 2-fold, at least 5-fold, or at least 10-fold.
- the combination of these amino acid mutations may reduce the binding affinity of the Fc domain to an Fc receptor by at least 10-fold, at least 20-fold, or even at least 50-fold.
- the T cell activating bispecific antigen binding molecule comprising an engineered Fc domain exhibits less than 20%, particularly less than 10%, more particularly less than 5% of the binding affinity to an Fc receptor as compared to a T cell activating bispecific antigen binding molecule comprising a non-engineered Fc domain.
- the Fc receptor is an Fc ⁇ receptor.
- the Fc receptor is a human Fc receptor.
- the Fc receptor is an activating Fc receptor.
- the Fc receptor is an activating human Fc ⁇ receptor, more specifically human Fc ⁇ RIIIa, Fc ⁇ RI or Fc ⁇ RIIa, most specifically human Fc ⁇ RIIIa.
- binding to each of these receptors is reduced.
- binding affinity to a complement component, specifically binding affinity to C1q is also reduced.
- binding affinity to neonatal Fc receptor (FcRn) is not reduced. Substantially similar binding to FcRn, i.e.
- the Fc domain (or the T cell activating bispecific antigen binding molecule comprising said Fc domain) exhibits greater than about 70% of the binding affinity of a non-engineered form of the Fc domain (or the T cell activating bispecific antigen binding molecule comprising said non-engineered form of the Fc domain) to FcRn.
- the Fc domain, or T cell activating bispecific antigen binding molecules of the invention comprising said Fc domain may exhibit greater than about 80% and even greater than about 90% of such affinity.
- the Fc domain of the T cell activating bispecific antigen binding molecule is engineered to have reduced effector function, as compared to a non-engineered Fc domain.
- the reduced effector function can include, but is not limited to, one or more of the following: reduced complement dependent cytotoxicity (CDC), reduced antibody-dependent cell-mediated cytotoxicity (ADCC), reduced antibody-dependent cellular phagocytosis (ADCP), reduced cytokine secretion, reduced immune complex-mediated antigen uptake by antigen-presenting cells, reduced binding to NK cells, reduced binding to macrophages, reduced binding to monocytes, reduced binding to polymorphonuclear cells, reduced direct signaling inducing apoptosis, reduced crosslinking of target-bound antibodies, reduced dendritic cell maturation, or reduced T cell priming.
- CDC complement dependent cytotoxicity
- ADCC reduced antibody-dependent cell-mediated cytotoxicity
- ADCP reduced antibody-dependent cellular phagocytosis
- reduced immune complex-mediated antigen uptake by antigen-presenting cells reduced binding to NK cells, reduced binding to macrophages, reduced binding to monocytes, reduced binding to polymorphonuclear cells, reduced direct signaling inducing
- the reduced effector function is one or more selected from the group of reduced CDC, reduced ADCC, reduced ADCP, and reduced cytokine secretion. In a particular embodiment the reduced effector function is reduced ADCC. In one embodiment the reduced ADCC is less than 20% of the ADCC induced by a non-engineered Fc domain (or a T cell activating bispecific antigen binding molecule comprising a non-engineered Fc domain).
- the amino acid mutation that reduces the binding affinity of the Fc domain to an Fc receptor and/or effector function is an amino acid substitution.
- the Fc domain comprises an amino acid substitution at a position selected from the group of E233, L234, L235, N297, P331 and P329.
- the Fc domain comprises an amino acid substitution at a position selected from the group of L234, L235 and P329.
- the Fc domain comprises the amino acid substitutions L234A and L235A.
- the Fc domain is an IgG 1 Fc domain, particularly a human IgG 1 Fc domain.
- the Fc domain comprises an amino acid substitution at position P329.
- the amino acid substitution is P329A or P329G, particularly P329G.
- the Fc domain comprises an amino acid substitution at position P329 and a further amino acid substitution at a position selected from E233, L234, L235, N297 and P331.
- the further amino acid substitution is E233P, L234A, L235A, L235E, N297A, N297D or P331S.
- the Fc domain comprises amino acid substitutions at positions P329, L234 and L235.
- the Fc domain comprises the amino acid mutations L234A, L235A and P329G (“P329G LALA”).
- the Fc domain is an IgG 1 Fc domain, particularly a human IgG 1 Fc domain.
- the “P329G LALA” combination of amino acid substitutions almost completely abolishes Fc ⁇ receptor binding of a human IgG 1 Fc domain, as described in PCT patent application no. PCT/EP2012/055393, incorporated herein by reference in its entirety.
- PCT/EP2012/055393 also describes methods of preparing such mutant Fc domains and methods for determining its properties such as Fc receptor binding or effector functions.
- the Fc domain of the T cell activating bispecific antigen binding molecules of the invention is an IgG 4 Fc domain, particularly a human IgG 4 Fc domain.
- the IgG 4 Fc domain comprises amino acid substitutions at position S228, specifically the amino acid substitution S228P.
- the IgG 4 Fc domain comprises an amino acid substitution at position L235, specifically the amino acid substitution L235E.
- the IgG 4 Fc domain comprises an amino acid substitution at position P329, specifically the amino acid substitution P329G.
- the IgG 4 Fc domain comprises amino acid substitutions at positions S228, L235 and P329, specifically amino acid substitutions S228P, L235E and P329G.
- IgG 4 Fc domain mutants and their Fc ⁇ receptor binding properties are described in PCT patent application no. PCT/EP2012/055393, incorporated herein by reference in its entirety.
- the Fc domain exhibiting reduced binding affinity to an Fc receptor and/or reduced effector function, as compared to a native IgG 1 Fc domain is a human IgG 1 Fc domain comprising the amino acid substitutions L234A, L235A and optionally P329G, or a human IgG 4 Fc domain comprising the amino acid substitutions S228P, L235E and optionally P329G.
- N-glycosylation of the Fc domain has been eliminated.
- the Fc domain comprises an amino acid mutation at position N297, particularly an amino acid substitution replacing asparagine by alanine (N297A) or aspartic acid (N297D).
- Fc domains with reduced Fc receptor binding and/or effector function also include those with substitution of one or more of Fc domain residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056).
- Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called “DANA” Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581).
- Mutant Fc domains can be prepared by amino acid deletion, substitution, insertion or modification using genetic or chemical methods well known in the art. Genetic methods may include site-specific mutagenesis of the encoding DNA sequence, PCR, gene synthesis, and the like. The correct nucleotide changes can be verified for example by sequencing.
- Binding to Fc receptors can be easily determined e.g. by ELISA, or by Surface Plasmon Resonance (SPR) using standard instrumentation such as a BIAcore instrument (GE Healthcare), and Fc receptors such as may be obtained by recombinant expression. A suitable such binding assay is described herein. Alternatively, binding affinity of Fc domains or cell activating bispecific antigen binding molecules comprising an Fc domain for Fc receptors may be evaluated using cell lines known to express particular Fc receptors, such as human NK cells expressing Fc ⁇ IIIa receptor.
- Effector function of an Fc domain, or a T cell activating bispecific antigen binding molecule comprising an Fc domain can be measured by methods known in the art.
- a suitable assay for measuring ADCC is described herein.
- Other examples of in vitro assays to assess ADCC activity of a molecule of interest are described in U.S. Pat. No. 5,500,362; Hellstrom et al. Proc Natl Acad Sci USA 83, 7059-7063 (1986) and Hellstrom et al., Proc Natl Acad Sci USA 82, 1499-1502 (1985); U.S. Pat. No. 5,821,337; Bruggemann et al., J Exp Med 166, 1351-1361 (1987).
- non-radioactive assays methods may be employed (see, for example, ACTITM non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, Calif.); and CytoTox 96® non-radioactive cytotoxicity assay (Promega, Madison, Wis.)).
- Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
- PBMC peripheral blood mononuclear cells
- NK Natural Killer
- ADCC activity of the molecule of interest may be assessed in vivo, e.g. in a animal model such as that disclosed in Clynes et al., Proc Natl Acad Sci USA 95, 652-656 (1998).
- binding of the Fc domain to a complement component, specifically to C1q is reduced.
- said reduced effector function includes reduced CDC.
- C1q binding assays may be carried out to determine whether the T cell activating bispecific antigen binding molecule is able to bind C1q and hence has CDC activity. See e.g., C1q and C3c binding ELISA in WO 2006/029879 and WO 2005/100402.
- a CDC assay may be performed (see, for example, Gazzano-Santoro et al., J Immunol Methods 202, 163 (1996); Cragg et al., Blood 101, 1045-1052 (2003); and Cragg and Glennie, Blood 103, 2738-2743 (2004)).
- the antigen binding molecule of the invention is bispecific, i.e. it comprises at least two antigen binding moieties capable of specific binding to two distinct antigenic determinants.
- the antigen binding moieties are Fab molecules (i.e. antigen binding domains composed of a heavy and a light chain, each comprising a variable and a constant region), wherein the light chain (VLCL) of the at least two Fab molecules comprises identical sequences.
- said VLCL light chain of the Fab molecules capable of specific binding to a target cell antigen and a T cell activating antigen, respectively comprises the light chain CDRs of SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34.
- said VLCL light chain of the Fab molecules capable of specific binding to a target cell antigen and a T cell activating antigen, respectively comprises SEQ ID NO: 31.
- said Fab molecules are human. In another embodiment said Fab molecules are humanized. In yet another embodiment said Fab molecules comprise human heavy and light chain constant regions.
- the T cell activating bispecific antigen binding molecule is capable of simultaneous binding to a target cell antigen, particularly a tumor cell antigen, and an activating T cell antigen.
- the T cell activating bispecific antigen binding molecule is capable of crosslinking a T cell and a target cell by simultaneous binding to a target cell antigen and an activating T cell antigen.
- simultaneous binding results in lysis of the target cell, particularly a tumor cell.
- simultaneous binding results in activation of the T cell.
- such simultaneous binding results in a cellular response of a T lymphocyte, particularly a cytotoxic T lymphocyte, selected from the group of: proliferation, differentiation, cytokine secretion, cytotoxic effector molecule release, cytotoxic activity, and expression of activation markers.
- a T lymphocyte particularly a cytotoxic T lymphocyte, selected from the group of: proliferation, differentiation, cytokine secretion, cytotoxic effector molecule release, cytotoxic activity, and expression of activation markers.
- binding of the T cell activating bispecific antigen binding molecule to the activating T cell antigen without simultaneous binding to the target cell antigen does not result in T cell activation.
- the T cell activating bispecific antigen binding molecule is capable of re-directing cytotoxic activity of a T cell to a target cell.
- said re-direction is independent of MHC-mediated peptide antigen presentation by the target cell and and/or specificity of the T cell.
- a T cell according to any of the embodiments of the invention is a cytotoxic T cell.
- the T cell is a CD4 + or a CD8 + T cell, particularly a CD8 + T cell.
- the T cell activating bispecific antigen binding molecule of the invention comprises at least one antigen binding moiety capable of binding to an activating T cell antigen (also referred to herein as an “activating T cell antigen binding moiety”).
- the T cell activating bispecific antigen binding molecule comprises not more than one antigen binding moiety capable of specific binding to an activating T cell antigen.
- the T cell activating bispecific antigen binding molecule provides monovalent binding to the activating T cell antigen.
- the activating T cell antigen binding moiety is a Fab molecule and comprises an identical VLCL light chain as the antigen binding moiety capable of specific binding to a target cell antigen.
- the activating T cell antigen is CD3, particularly human CD3 or cynomolgus CD3, most particularly human CD3.
- the activating T cell antigen binding moiety is cross-reactive for (i.e. specifically binds to) human and cynomolgus CD3.
- the activating T cell antigen is the epsilon subunit of CD3 (SEQ ID NO: 56).
- the activating T cell antigen binding moiety can compete with monoclonal antibody H2C (described in PCT publication no. WO2008/119567) for binding an epitope of CD3.
- the activating T cell antigen binding moiety can compete with monoclonal antibody V9 (described in Rodrigues et al., Int J Cancer Suppl 7, 45-50 (1992) and U.S. Pat. No. 6,054,297) for binding an epitope of CD3.
- the activating T cell antigen binding moiety can compete with monoclonal antibody FN18 (described in Nooij et al., Eur J Immunol 19, 981-984 (1986)) for binding an epitope of CD3.
- the activating T cell antigen binding moiety can compete with monoclonal antibody SP34 (described in Pessano et al., EMBO J 4, 337-340 (1985)) for binding an epitope of CD3.
- the activating T cell antigen binding moiety binds to the same epitope of CD3 as monoclonal antibody SP34.
- the activating T cell antigen binding moiety comprises the heavy chain CDR1 of SEQ ID NO: 14, the heavy chain CDR2 of SEQ ID NO: 15, the heavy chain CDR3 of SEQ ID NO: 16, the light chain CDR1 of SEQ ID NO: 32, the light chain CDR2 of SEQ ID NO: 33, and the light chain CDR3 of SEQ ID NO: 34.
- the activating T cell antigen binding moiety comprises a heavy chain variable region sequence that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 36, or variants thereof that retain functionality.
- the activating T cell antigen binding moiety comprises a light chain variable region sequence that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 31, or variants thereof that retain functionality.
- the activating T cell antigen binding moiety comprises a heavy chain comprising the sequence of SEQ ID NO: 36 and a light chain comprising the sequence of SEQ ID NO: 31.
- the activating T cell antigen binding moiety comprises a heavy chain of SEQ ID NO: 40 and a light chain comprising of SEQ ID NO: 35.
- the T cell activating bispecific antigen binding molecule of the invention comprises at least one antigen binding moiety capable of binding to a target cell antigen (also referred to herein as an “target cell antigen binding moiety”).
- the T cell activating bispecific antigen binding molecule comprises two antigen binding moieties capable of binding to a target cell antigen. In a particular such embodiment, each of these antigen binding moieties specifically binds to the same antigenic determinant.
- the T cell activating bispecific antigen binding molecule comprises an immunoglobulin molecule capable of specific binding to a target cell antigen. In one embodiment the T cell activating bispecific antigen binding molecule comprises not more than two antigen binding moieties capable of binding to a target cell antigen.
- the target cell antigen binding moiety is generally a Fab molecule that binds to a specific antigenic determinant and is able to direct the T cell activating bispecific antigen binding molecule to a target site, for example to a specific type of tumor cell that bears the antigenic determinant.
- Said Fab molecule has an identical VLCL light chain as the Fab molecule capable of specific binding to a T cell activating antigen.
- said VLCL light chain of the Fab molecule capable of specific binding to a target cell antigen and the Fab molecule capable of specific binding to a T cell activating antigen comprise the light chain CDR1 of SEQ ID NO: 32, the light chain CDR2 of SEQ ID NO: 33, and the light chain CDR3 of SEQ ID NO: 34.
- said VLCL light chain of the Fab molecule capable of specific binding to a target cell antigen and the Fab molecule capable of specific binding to a T cell activating antigen comprise a VLCL light chain of SEQ ID NO. 31.
- the target cell antigen binding moiety comprises a light chain variable region sequence that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 31, or variants thereof that retain functionality.
- the target cell antigen binding moiety comprises a light chain sequence that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 35, or variants thereof that retain functionality.
- the target cell antigen binding moiety is directed to an antigen associated with a pathological condition, such as an antigen presented on a tumor cell or on a virus-infected cell.
- Suitable antigens are cell surface antigens, for example, but not limited to, cell surface receptors.
- the antigen is a human antigen.
- the target cell antigen is selected from the group of Folate Receptor 1 (FolR1), Mucin-1 (MUC1), and B Cell Maturation Antigen (BCMA).
- the T cell activating bispecific antigen binding molecule comprises a polypeptide sequence encoded by a polynucleotide sequence that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to a sequence selected from the group of SEQ ID NO: 183, SEQ ID NO: 193, SEQ ID NO: 263, SEQ ID NO: 264, SEQ ID NO: 191, SEQ ID NO: 198, SEQ ID NO: 267, and SEQ ID NO: 272, including functional fragments or variants thereof.
- the invention further provides isolated polynucleotides encoding a T cell activating bispecific antigen binding molecule as described herein or a fragment thereof.
- Polynucleotides of the invention include those that are at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequences set forth in SEQ ID NO: 183, SEQ ID NO: 193, SEQ ID NO: 263, SEQ ID NO: 264, SEQ ID NO: 191, SEQ ID NO: 198, SEQ ID NO: 267, and SEQ ID NO: 272, including functional fragments or variants thereof.
- the polynucleotides encoding T cell activating bispecific antigen binding molecules of the invention may be expressed as a single polynucleotide that encodes the entire T cell activating bispecific antigen binding molecule or as multiple (e.g., two or more) polynucleotides that are co-expressed. Polypeptides encoded by polynucleotides that are co-expressed may associate through, e.g., disulfide bonds or other means to form a functional T cell activating bispecific antigen binding molecule.
- the light chain portion of an antigen binding moiety may be encoded by a separate polynucleotide from the portion of the T cell activating bispecific antigen binding molecule comprising the heavy chain portion of the antigen binding moiety, an Fc domain subunit and optionally (part of) another antigen binding moiety.
- the heavy chain polypeptides When co-expressed, the heavy chain polypeptides will associate with the light chain polypeptides to form the antigen binding moiety.
- the portion of the T cell activating bispecific antigen binding molecule comprising one of the two Fc domain subunits and optionally (part of) one or more antigen binding moieties could be encoded by a separate polynucleotide from the portion of the T cell activating bispecific antigen binding molecule comprising the the other of the two Fc domain subunits and optionally (part of) an antigen binding moiety. When co-expressed, the Fc domain subunits will associate to form the Fc domain.
- RNA for example, in the form of messenger RNA (mRNA).
- mRNA messenger RNA
- RNA of the present invention may be single stranded or double stranded.
- T cell activating bispecific antigen binding molecules of the invention may be obtained, for example, by solid-state peptide synthesis (e.g. Merrifield solid phase synthesis) or recombinant production.
- solid-state peptide synthesis e.g. Merrifield solid phase synthesis
- Such polynucleotide may be readily isolated and sequenced using conventional procedures.
- a vector, preferably an expression vector, comprising one or more of the polynucleotides of the invention is provided.
- the expression vector can be part of a plasmid, virus, or may be a nucleic acid fragment.
- the expression vector includes an expression cassette into which the polynucleotide encoding the T cell activating bispecific antigen binding molecule (fragment) (i.e. the coding region) is cloned in operable association with a promoter and/or other transcription or translation control elements.
- a “coding region” is a portion of nucleic acid which consists of codons translated into amino acids.
- a “stop codon” (TAG, TGA, or TAA) is not translated into an amino acid, it may be considered to be part of a coding region, if present, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, introns, 5′ and 3′ untranslated regions, and the like, are not part of a coding region.
- Two or more coding regions can be present in a single polynucleotide construct, e.g. on a single vector, or in separate polynucleotide constructs, e.g. on separate (different) vectors.
- any vector may contain a single coding region, or may comprise two or more coding regions, e.g.
- a vector of the present invention may encode one or more polypeptides, which are post- or co-translationally separated into the final proteins via proteolytic cleavage.
- a vector, polynucleotide, or nucleic acid of the invention may encode heterologous coding regions, either fused or unfused to a polynucleotide encoding the T cell activating bispecific antigen binding molecule (fragment) of the invention, or variant or derivative thereof.
- Heterologous coding regions include without limitation specialized elements or motifs, such as a secretory signal peptide or a heterologous functional domain. An operable association is when a coding region for a gene product, e.g.
- a polypeptide is associated with one or more regulatory sequences in such a way as to place expression of the gene product under the influence or control of the regulatory sequence(s).
- Two DNA fragments (such as a polypeptide coding region and a promoter associated therewith) are “operably associated” if induction of promoter function results in the transcription of mRNA encoding the desired gene product and if the nature of the linkage between the two DNA fragments does not interfere with the ability of the expression regulatory sequences to direct the expression of the gene product or interfere with the ability of the DNA template to be transcribed.
- a promoter region would be operably associated with a nucleic acid encoding a polypeptide if the promoter was capable of effecting transcription of that nucleic acid.
- the promoter may be a cell-specific promoter that directs substantial transcription of the DNA only in predetermined cells.
- Other transcription control elements besides a promoter, for example enhancers, operators, repressors, and transcription termination signals, can be operably associated with the polynucleotide to direct cell-specific transcription.
- Suitable promoters and other transcription control regions are disclosed herein.
- a variety of transcription control regions are known to those skilled in the art. These include, without limitation, transcription control regions, which function in vertebrate cells, such as, but not limited to, promoter and enhancer segments from cytomegaloviruses (e.g. the immediate early promoter, in conjunction with intron-A), simian virus 40 (e.g.
- transcription control regions include those derived from vertebrate genes such as actin, heat shock protein, bovine growth hormone and rabbit â-globin, as well as other sequences capable of controlling gene expression in eukaryotic cells. Additional suitable transcription control regions include tissue-specific promoters and enhancers as well as inducible promoters (e.g. promoters inducible tetracyclins). Similarly, a variety of translation control elements are known to those of ordinary skill in the art.
- the expression cassette may also include other features such as an origin of replication, and/or chromosome integration elements such as retroviral long terminal repeats (LTRs), or adeno-associated viral (AAV) inverted terminal repeats (ITRs).
- LTRs retroviral long terminal repeats
- AAV adeno-associated viral
- Polynucleotide and nucleic acid coding regions of the present invention may be associated with additional coding regions which encode secretory or signal peptides, which direct the secretion of a polypeptide encoded by a polynucleotide of the present invention.
- additional coding regions which encode secretory or signal peptides, which direct the secretion of a polypeptide encoded by a polynucleotide of the present invention.
- DNA encoding a signal sequence may be placed upstream of the nucleic acid encoding a T cell activating bispecific antigen binding molecule of the invention or a fragment thereof.
- proteins secreted by mammalian cells have a signal peptide or secretory leader sequence which is cleaved from the mature protein once export of the growing protein chain across the rough endoplasmic reticulum has been initiated.
- polypeptides secreted by vertebrate cells generally have a signal peptide fused to the N-terminus of the polypeptide, which is cleaved from the translated polypeptide to produce a secreted or “mature” form of the polypeptide.
- the native signal peptide e.g.
- an immunoglobulin heavy chain or light chain signal peptide is used, or a functional derivative of that sequence that retains the ability to direct the secretion of the polypeptide that is operably associated with it.
- a heterologous mammalian signal peptide, or a functional derivative thereof may be used.
- the wild-type leader sequence may be substituted with the leader sequence of human tissue plasminogen activator (TPA) or mouse ⁇ -glucuroni dase.
- DNA encoding a short protein sequence that could be used to facilitate later purification (e.g. a histidine tag) or assist in labeling the T cell activating bispecific antigen binding molecule may be included within or at the ends of the T cell activating bispecific antigen binding molecule (fragment) encoding polynucleotide.
- a host cell comprising one or more polynucleotides of the invention.
- a host cell comprising one or more vectors of the invention.
- the polynucleotides and vectors may incorporate any of the features, singly or in combination, described herein in relation to polynucleotides and vectors, respectively.
- a host cell comprises (e.g. has been transformed or transfected with) a vector comprising a polynucleotide that encodes (part of) a T cell activating bispecific antigen binding molecule of the invention.
- the term “host cell” refers to any kind of cellular system which can be engineered to generate the T cell activating bispecific antigen binding molecules of the invention or fragments thereof.
- Host cells suitable for replicating and for supporting expression of T cell activating bispecific antigen binding molecules are well known in the art. Such cells may be transfected or transduced as appropriate with the particular expression vector and large quantities of vector containing cells can be grown for seeding large scale fermenters to obtain sufficient quantities of the T cell activating bispecific antigen binding molecule for clinical applications.
- Suitable host cells include prokaryotic microorganisms, such as E. coli, or various eukaryotic cells, such as Chinese hamster ovary cells (CHO), insect cells, or the like.
- polypeptides may be produced in bacteria in particular when glycosylation is not needed. After expression, the polypeptide may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
- eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for polypeptide-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been “humanized”, resulting in the production of a polypeptide with a partially or fully human glycosylation pattern. See Gerngross, Nat Biotech 22, 1409-1414 (2004), and Li et al., Nat Biotech 24, 210-215 (2006).
- Suitable host cells for the expression of (glycosylated) polypeptides are also derived from multicellular organisms (invertebrates and vertebrates).
- invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells. Plant cell cultures can also be utilized as hosts. See e.g. U.S. Pat. Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIESTM technology for producing antibodies in transgenic plants). Vertebrate cells may also be used as hosts.
- mammalian cell lines that are adapted to grow in suspension may be useful.
- useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293T cells as described, e.g., in Graham et al., J Gen Virol 36, 59 (1977)), baby hamster kidney cells (BHK), mouse sertoli cells (TM4 cells as described, e.g., in Mather, Biol Reprod 23, 243-251 (1980)), monkey kidney cells (CV1), African green monkey kidney cells (VERO-76), human cervical carcinoma cells (HELA), canine kidney cells (MDCK), buffalo rat liver cells (BRL 3A), human lung cells (W138), human liver cells (Hep G2), mouse mammary tumor cells (MMT 060562), TRI cells (as described, e.g., in Mather et al., Annals N.Y.
- MRC 5 cells MRC 5 cells
- FS4 cells Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including dhfr ⁇ CHO cells (Urlaub et al., Proc Natl Acad Sci USA 77, 4216 (1980)); and myeloma cell lines such as YO, NS0, P3X63 and Sp2/0.
- CHO Chinese hamster ovary
- dhfr ⁇ CHO cells Urlaub et al., Proc Natl Acad Sci USA 77, 4216 (1980)
- myeloma cell lines such as YO, NS0, P3X63 and Sp2/0.
- Yazaki and Wu Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, N.J.), pp. 255-268 (2003).
- Host cells include cultured cells, e.g., mammalian cultured cells, yeast cells, insect cells, bacterial cells and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue.
- the host cell is a eukaryotic cell, preferably a mammalian cell, such as a Chinese Hamster Ovary (CHO) cell, a human embryonic kidney (HEK) cell or a lymphoid cell (e.g., Y0, NS0, Sp20 cell).
- CHO Chinese Hamster Ovary
- HEK human embryonic kidney
- a lymphoid cell e.g., Y0, NS0, Sp20 cell.
- Cells expressing a polypeptide comprising either the heavy or the light chain of an antigen binding domain such as an antibody may be engineered so as to also express the other of the antibody chains such that the expressed product is an antibody that has both a heavy and a light chain.
- a method of producing a T cell activating bispecific antigen binding molecule according to the invention comprises culturing a host cell comprising a polynucleotide encoding the T cell activating bispecific antigen binding molecule, as provided herein, under conditions suitable for expression of the T cell activating bispecific antigen binding molecule, and recovering the T cell activating bispecific antigen binding molecule from the host cell (or host cell culture medium).
- T cell activating bispecific antigen binding molecule The components of the T cell activating bispecific antigen binding molecule are genetically fused to each other.
- T cell activating bispecific antigen binding molecule can be designed such that its components are fused directly to each other or indirectly through a linker sequence.
- the composition and length of the linker may be determined in accordance with methods well known in the art and may be tested for efficacy. Examples of linker sequences between different components of T cell activating bispecific antigen binding molecules are found in the sequences provided herein. Additional sequences may also be included to incorporate a cleavage site to separate the individual components of the fusion if desired, for example an endopeptidase recognition sequence.
- the one or more antigen binding moieties of the T cell activating bispecific antigen binding molecules comprise at least an antibody variable region capable of binding an antigenic determinant.
- Variable regions can form part of and be derived from naturally or non-naturally occurring antibodies and fragments thereof.
- Methods to produce polyclonal antibodies and monoclonal antibodies are well known in the art (see e.g. Harlow and Lane, “Antibodies, a laboratory manual”, Cold Spring Harbor Laboratory, 1988).
- Non-naturally occurring antibodies can be constructed using solid phase-peptide synthesis, can be produced recombinantly (e.g. as described in U.S. Pat. No. 4,186,567) or can be obtained, for example, by screening combinatorial libraries comprising variable heavy chains and variable light chains (see e.g. U.S. Pat. No. 5,969,108 to McCafferty).
- any animal species of antibody, antibody fragment, antigen binding domain or variable region can be used in the T cell activating bispecific antigen binding molecules of the invention.
- Non-limiting antibodies, antibody fragments, antigen binding domains or variable regions useful in the present invention can be of murine, primate, or human origin. If the T cell activating bispecific antigen binding molecule is intended for human use, a chimeric form of antibody may be used wherein the constant regions of the antibody are from a human.
- a humanized or fully human form of the antibody can also be prepared in accordance with methods well known in the art (see e. g. U.S. Pat. No. 5,565,332 to Winter).
- Humanization may be achieved by various methods including, but not limited to (a) grafting the non-human (e.g., donor antibody) CDRs onto human (e.g. recipient antibody) framework and constant regions with or without retention of critical framework residues (e.g. those that are important for retaining good antigen binding affinity or antibody functions), (b) grafting only the non-human specificity-determining regions (SDRs or a-CDRs; the residues critical for the antibody-antigen interaction) onto human framework and constant regions, or (c) transplanting the entire non-human variable domains, but “cloaking” them with a human-like section by replacement of surface residues.
- a grafting the non-human (e.g., donor antibody) CDRs onto human (e.g. recipient antibody) framework and constant regions with or without retention of critical framework residues (e.g. those that are important for retaining good antigen binding affinity or antibody functions)
- SDRs or a-CDRs the residues critical for the antibody-antigen interaction
- Human antibodies and human variable regions can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr Opin Pharmacol 5, 368-74 (2001) and Lonberg, Curr Opin Immunol 20, 450-459 (2008). Human variable regions can form part of and be derived from human monoclonal antibodies made by the hybridoma method (see e.g. Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987)). Human antibodies and human variable regions may also be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge (see e.g.
- Human antibodies and human variable regions may also be generated by isolating Fv clone variable region sequences selected from human-derived phage display libraries (see e.g., Hoogenboom et al. in Methods in Molecular Biology 178, 1-37 (O′Brien et al., ed., Human Press, Totowa, N.J., 2001); and McCafferty et al., Nature 348, 552-554; Clackson et al., Nature 352, 624-628 (1991)). Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments.
- scFv single-chain Fv
- the antigen binding moieties useful in the present invention are engineered to have enhanced binding affinity according to, for example, the methods disclosed in U.S. Pat. Appl. Publ. No. 2004/0132066, the entire contents of which are hereby incorporated by reference.
- the ability of the T cell activating bispecific antigen binding molecule of the invention to bind to a specific antigenic determinant can be measured either through an enzyme-linked immunosorbent assay (ELISA) or other techniques familiar to one of skill in the art, e.g.
- Competition assays may be used to identify an antibody, antibody fragment, antigen binding domain or variable domain that competes with a reference antibody for binding to a particular antigen, e.g. an antibody that competes with the V9 antibody for binding to CD3.
- a competing antibody binds to the same epitope (e.g. a linear or a conformational epitope) that is bound by the reference antibody.
- immobilized antigen e.g. CD3
- a first labeled antibody that binds to the antigen (e.g. V9 antibody)
- a second unlabeled antibody that is being tested for its ability to compete with the first antibody for binding to the antigen.
- the second antibody may be present in a hybridoma supernatant.
- immobilized antigen is incubated in a solution comprising the first labeled antibody but not the second unlabeled antibody. After incubation under conditions permissive for binding of the first antibody to the antigen, excess unbound antibody is removed, and the amount of label associated with immobilized antigen is measured. If the amount of label associated with immobilized antigen is substantially reduced in the test sample relative to the control sample, then that indicates that the second antibody is competing with the first antibody for binding to the antigen. See Harlow and Lane (1988) Antibodies: A Laboratory Manual ch.14 (Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.).
- T cell activating bispecific antigen binding molecules prepared as described herein may be purified by art-known techniques such as high performance liquid chromatography, ion exchange chromatography, gel electrophoresis, affinity chromatography, size exclusion chromatography, and the like.
- the actual conditions used to purify a particular protein will depend, in part, on factors such as net charge, hydrophobicity, hydrophilicity etc., and will be apparent to those having skill in the art.
- affinity chromatography purification an antibody, ligand, receptor or antigen can be used to which the T cell activating bispecific antigen binding molecule binds.
- a matrix with protein A or protein G may be used for affinity chromatography purification of T cell activating bispecific antigen binding molecules of the invention.
- Sequential Protein A or G affinity chromatography and size exclusion chromatography can be used to isolate a T cell activating bispecific antigen binding molecule essentially as described in the Examples.
- the purity of the T cell activating bispecific antigen binding molecule can be determined by any of a variety of well known analytical methods including gel electrophoresis, high pressure liquid chromatography, and the like.
- the heavy chain fusion proteins expressed as described in the Examples were shown to be intact and properly assembled as demonstrated by reducing SDS-PAGE. Three bands were resolved at approximately Mr 25,000, Mr 50,000 and Mr 75,000, corresponding to the predicted molecular weights of the T cell activating bispecific antigen binding molecule light chain, heavy chain and heavy chain/light chain fusion protein.
- T cell activating bispecific antigen binding molecules provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays known in the art.
- the affinity of the T cell activating bispecific antigen binding molecule for an Fc receptor or a target antigen can be determined in accordance with the methods set forth in the Examples by surface plasmon resonance (SPR), using standard instrumentation such as a BIAcore instrument (GE Healthcare), and receptors or target proteins such as may be obtained by recombinant expression.
- SPR surface plasmon resonance
- BIAcore instrument GE Healthcare
- receptors or target proteins such as may be obtained by recombinant expression.
- binding of T cell activating bispecific antigen binding molecules for different receptors or target antigens may be evaluated using cell lines expressing the particular receptor or target antigen, for example by flow cytometry (FACS).
- FACS flow cytometry
- K D is measured by surface plasmon resonance using a BIACORE® T100 machine (GE Healthcare) at 25° C.
- CM5 chips To analyze the interaction between the Fc-portion and Fc receptors, His-tagged recombinant Fc-receptor is captured by an anti-Penta His antibody (Qiagen) (“Penta His” disclosed as SEQ ID NO: 45) immobilized on CM5 chips and the bispecific constructs are used as analytes. Briefly, carboxymethylated dextran biosensor chips (CM5, GE Healthcare) are activated with N-ethyl-N′-(3-dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N-hydroxysuccinimide (NETS) according to the supplier's instructions.
- CM5 carboxymethylated dextran biosensor chips
- EDC N-ethyl-N′-(3-dimethylaminopropyl)-carbodiimide hydrochloride
- NETS N-hydroxysuccinimide
- Penta-His antibody (“Penta His” disclosed as SEQ ID NO: 45) is diluted with 10 mM sodium acetate, pH 5.0, to 40 ⁇ g/ml before injection at a flow rate of 5 ⁇ l/min to achieve approximately 6500 response units (RU) of coupled protein. Following the injection of the ligand, 1 M ethanolamine is injected to block unreacted groups. Subsequently the Fc-receptor is captured for 60 s at 4 or 10 nM.
- HBS-EP GE Healthcare, 10 mM HEPES, 150 mM NaCl, 3 mM EDTA, 0.05% Surfactant P20, pH 7.4
- HBS-EP GE Healthcare, 10 mM HEPES, 150 mM NaCl, 3 mM EDTA, 0.05% Surfactant P20, pH 7.4
- bispecific constructs are captured by an anti human Fab specific antibody (GE Healthcare) that is immobilized on an activated CM5-sensor chip surface as described for the anti Penta-His antibody (“Penta His” disclosed as SEQ ID NO: 45).
- the final amount of coupled protein is approximately 12000 RU.
- the bispecific constructs are captured for 90 s at 300 nM.
- the target antigens are passed through the flow cells for 180 s at a concentration range from 250 to 1000 nM with a flowrate of 30 ⁇ l/min. The dissociation is monitored for 180 s.
- Biological activity of the T cell activating bispecific antigen binding molecules of the invention can be measured by various assays as described in the Examples. Biological activities may for example include the induction of proliferation of T cells, the induction of signaling in T cells, the induction of expression of activation markers in T cells, the induction of cytokine secretion by T cells, the induction of lysis of target cells such as tumor cells, and the induction of tumor regression and/or the improvement of survival.
- compositions Compositions, Formulations, and Routes of Administration
- the invention provides pharmaceutical compositions comprising any of the T cell activating bispecific antigen binding molecules provided herein, e.g., for use in any of the below therapeutic methods.
- a pharmaceutical composition comprises any of the T cell activating bispecific antigen binding molecules provided herein and a pharmaceutically acceptable carrier.
- a pharmaceutical composition comprises any of the T cell activating bispecific antigen binding molecules provided herein and at least one additional therapeutic agent, e.g., as described below.
- a method of producing a T cell activating bispecific antigen binding molecule of the invention in a form suitable for administration in vivo comprising (a) obtaining a T cell activating bispecific antigen binding molecule according to the invention, and (b) formulating the T cell activating bispecific antigen binding molecule with at least one pharmaceutically acceptable carrier, whereby a preparation of T cell activating bispecific antigen binding molecule is formulated for administration in vivo.
- compositions of the present invention comprise a therapeutically effective amount of one or more T cell activating bispecific antigen binding molecule dissolved or dispersed in a pharmaceutically acceptable carrier.
- pharmaceutically acceptable refers to molecular entities and compositions that are generally non-toxic to recipients at the dosages and concentrations employed, i.e. do not produce an adverse, allergic or other untoward reaction when administered to an animal, such as, for example, a human, as appropriate.
- the preparation of a pharmaceutical composition that contains at least one T cell activating bispecific antigen binding molecule and optionally an additional active ingredient will be known to those of skill in the art in light of the present disclosure, as exemplified by Remington's Pharmaceutical Sciences, 18th Ed.
- compositions are lyophilized formulations or aqueous solutions.
- pharmaceutically acceptable carrier includes any and all solvents, buffers, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g.
- antibacterial agents antifungal agents
- isotonic agents absorption delaying agents, salts, preservatives, antioxidants, proteins, drugs, drug stabilizers, polymers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, such like materials and combinations thereof, as would be known to one of ordinary skill in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, pp. 1289-1329, incorporated herein by reference). Except insofar as any conventional carrier is incompatible with the active ingredient, its use in the therapeutic or pharmaceutical compositions is contemplated.
- T cell activating bispecific antigen binding molecules of the present invention can be administered intravenously, intradermally, intraarterially, intraperitoneally, intralesionally, intracranially, intraarticularly, intraprostatically, intrasplenically, intrarenally, intrapleurally, intratracheally, intranasally, intravitreally, intravaginally, intrarectally, intratumorally, intramuscularly, intraperitoneally, subcutaneously, subconjunctivally, intravesicularlly, mucosally, intrapericardially, intraumbilically, intraocularally, orally, topically, locally, by inhalation (e.g.
- aerosol inhalation injection, infusion, continuous infusion, localized perfusion bathing target cells directly, via a catheter, via a lavage, in cremes, in lipid compositions (e.g. liposomes), or by other method or any combination of the forgoing as would be known to one of ordinary skill in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, incorporated herein by reference).
- Parenteral administration in particular intravenous injection, is most commonly used for administering polypeptide molecules such as the T cell activating bispecific antigen binding molecules of the invention.
- compositions include those designed for administration by injection, e.g. subcutaneous, intradermal, intralesional, intravenous, intraarterial intramuscular, intrathecal or intraperitoneal injection.
- the T cell activating bispecific antigen binding molecules of the invention may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hanks' solution, Ringer's solution, or physiological saline buffer.
- the solution may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- the T cell activating bispecific antigen binding molecules may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- Sterile injectable solutions are prepared by incorporating the T cell activating bispecific antigen binding molecules of the invention in the required amount in the appropriate solvent with various of the other ingredients enumerated below, as required. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and/or the other ingredients. In the case of sterile powders for the preparation of sterile injectable solutions, suspensions or emulsion, the preferred methods of preparation are vacuum-drying or freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered liquid medium thereof.
- the liquid medium should be suitably buffered if necessary and the liquid diluent first rendered isotonic prior to injection with sufficient saline or glucose.
- the composition must be stable under the conditions of manufacture and storage, and preserved against the contaminating action of microorganisms, such as bacteria and fungi. It will be appreciated that endotoxin contamination should be kept minimally at a safe level, for example, less that 0.5 ng/mg protein.
- Suitable pharmaceutically acceptable carriers include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides
- Aqueous injection suspensions may contain compounds which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, dextran, or the like.
- the suspension may also contain suitable stabilizers or agents which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions.
- suspensions of the active compounds may be prepared as appropriate oily injection suspensions.
- Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl cleats or triglycerides, or liposomes.
- Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
- colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
- Sustained-release preparations may be prepared.
- sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the polypeptide, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
- prolonged absorption of an injectable composition can be brought about by the use in the compositions of agents delaying absorption, such as, for example, aluminum monostearate, gelatin or combinations thereof.
- the T cell activating bispecific antigen binding molecules may also be formulated as a depot preparation. Such long acting formulations may be administered by implantation (for example subcutaneously or intramuscularly) or by intramuscular injection.
- the T cell activating bispecific antigen binding molecules may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
- compositions comprising the T cell activating bispecific antigen binding molecules of the invention may be manufactured by means of conventional mixing, dissolving, emulsifying, encapsulating, entrapping or lyophilizing processes.
- Pharmaceutical compositions may be formulated in conventional manner using one or more physiologically acceptable carriers, diluents, excipients or auxiliaries which facilitate processing of the proteins into preparations that can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
- the T cell activating bispecific antigen binding molecules may be formulated into a composition in a free acid or base, neutral or salt form.
- Pharmaceutically acceptable salts are salts that substantially retain the biological activity of the free acid or base. These include the acid addition salts, e.g., those formed with the free amino groups of a proteinaceous composition, or which are formed with inorganic acids such as for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric or mandelic acid.
- Salts formed with the free carboxyl groups can also be derived from inorganic bases such as for example, sodium, potassium, ammonium, calcium or ferric hydroxides; or such organic bases as isopropylamine, trimethylamine, histidine or procaine. Pharmaceutical salts tend to be more soluble in aqueous and other protic solvents than are the corresponding free base forms.
- T cell activating bispecific antigen binding molecules may be used in therapeutic methods.
- T cell activating bispecific antigen binding molecules of the invention can be used as immunotherapeutic agents, for example in the treatment of cancers.
- T cell activating bispecific antigen binding molecules of the invention would be formulated, dosed, and administered in a fashion consistent with good medical practice.
- Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
- T cell activating bispecific antigen binding molecules of the invention for use as a medicament are provided.
- T cell activating bispecific antigen binding molecules of the invention for use in treating a disease are provided.
- T cell activating bispecific antigen binding molecules of the invention for use in a method of treatment are provided.
- the invention provides a T cell activating bispecific antigen binding molecule as described herein for use in the treatment of a disease in an individual in need thereof.
- the invention provides a T cell activating bispecific antigen binding molecule for use in a method of treating an individual having a disease comprising administering to the individual a therapeutically effective amount of the T cell activating bispecific antigen binding molecule.
- the disease to be treated is a proliferative disorder.
- the disease is cancer.
- the method further comprises administering to the individual a therapeutically effective amount of at least one additional therapeutic agent, e.g., an anti-cancer agent if the disease to be treated is cancer.
- the invention provides a T cell activating bispecific antigen binding molecule as described herein for use in inducing lysis of a target cell, particularly a tumor cell.
- the invention provides a T cell activating bispecific antigen binding molecule for use in a method of inducing lysis of a target cell, particularly a tumor cell, in an individual comprising administering to the individual an effective amount of the T cell activating bispecific antigen binding molecule to induce lysis of a target cell.
- An “individual” according to any of the above embodiments is a mammal, preferably a human.
- the invention provides for the use of a T cell activating bispecific antigen binding molecule of the invention in the manufacture or preparation of a medicament.
- the medicament is for the treatment of a disease in an individual in need thereof.
- the medicament is for use in a method of treating a disease comprising administering to an individual having the disease a therapeutically effective amount of the medicament.
- the disease to be treated is a proliferative disorder.
- the disease is cancer.
- the method further comprises administering to the individual a therapeutically effective amount of at least one additional therapeutic agent, e.g., an anti-cancer agent if the disease to be treated is cancer.
- the medicament is for inducing lysis of a target cell, particularly a tumor cell.
- the medicament is for use in a method of inducing lysis of a target cell, particularly a tumor cell, in an individual comprising administering to the individual an effective amount of the medicament to induce lysis of a target cell.
- An “individual” according to any of the above embodiments may be a mammal, preferably a human.
- the invention provides a method for treating a disease.
- the method comprises administering to an individual having such disease a therapeutically effective amount of a T cell activating bispecific antigen binding molecule of the invention.
- a composition is administered to said individual, comprising the T cell activating bispecific antigen binding molecule of the invention in a pharmaceutically acceptable form.
- the disease to be treated is a proliferative disorder.
- the disease is cancer.
- the method further comprises administering to the individual a therapeutically effective amount of at least one additional therapeutic agent, e.g., an anti-cancer agent if the disease to be treated is cancer.
- An “individual” according to any of the above embodiments may be a mammal, preferably a human.
- the invention provides a method for inducing lysis of a target cell, particularly a tumor cell.
- the method comprises contacting a target cell with a T cell activating bispecific antigen binding molecule of the invention in the presence of a T cell, particularly a cytotoxic T cell.
- a method for inducing lysis of a target cell, particularly a tumor cell, in an individual is provided.
- the method comprises administering to the individual an effective amount of a T cell activating bispecific antigen binding molecule to induce lysis of a target cell.
- an “individual” is a human.
- the disease to be treated is a proliferative disorder, particularly cancer.
- cancers include bladder cancer, brain cancer, head and neck cancer, pancreatic cancer, lung cancer, breast cancer, ovarian cancer, uterine cancer, cervical cancer, endometrial cancer, esophageal cancer, colon cancer, colorectal cancer, rectal cancer, gastric cancer, prostate cancer, blood cancer, skin cancer, squamous cell carcinoma, bone cancer, and kidney cancer.
- the cancer is chosen from the group consisting of renal cell cancer, skin cancer, lung cancer, colorectal cancer, breast cancer, brain cancer, head and neck cancer.
- T cell activating bispecific antigen binding molecule may not provide a cure but may only provide partial benefit.
- a physiological change having some benefit is also considered therapeutically beneficial.
- an amount of T cell activating bispecific antigen binding molecule that provides a physiological change is considered an “effective amount” or a “therapeutically effective amount”.
- the subject, patient, or individual in need of treatment is typically a mammal, more specifically a human.
- an effective amount of a T cell activating bispecific antigen binding molecule of the invention is administered to a cell. In other embodiments, a therapeutically effective amount of a T cell activating bispecific antigen binding molecule of the invention is administered to an individual for the treatment of disease.
- the appropriate dosage of a T cell activating bispecific antigen binding molecule of the invention (when used alone or in combination with one or more other additional therapeutic agents) will depend on the type of disease to be treated, the route of administration, the body weight of the patient, the type of T cell activating bispecific antigen binding molecule, the severity and course of the disease, whether the T cell activating bispecific antigen binding molecule is administered for preventive or therapeutic purposes, previous or concurrent therapeutic interventions, the patient's clinical history and response to the T cell activating bispecific antigen binding molecule, and the discretion of the attending physician.
- the practitioner responsible for administration will, in any event, determine the concentration of active ingredient(s) in a composition and appropriate dose(s) for the individual subject.
- Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
- the T cell activating bispecific antigen binding molecule is suitably administered to the patient at one time or over a series of treatments.
- about 1 ⁇ g/kg to 15 mg/kg (e.g. 0.1 mg/kg-10 mg/kg) of T cell activating bispecific antigen binding molecule can be an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion.
- One typical daily dosage might range from about 1 ⁇ g/kg to 100 mg/kg or more, depending on the factors mentioned above.
- the treatment would generally be sustained until a desired suppression of disease symptoms occurs.
- a dose may also comprise from about 1 microgram/kg body weight, about 5 microgram/kg body weight, about 10 microgram/kg body weight, about 50 microgram/kg body weight, about 100 microgram/kg body weight, about 200 microgram/kg body weight, about 350 microgram/kg body weight, about 500 microgram/kg body weight, about 1 milligram/kg body weight, about 5 milligram/kg body weight, about 10 milligram/kg body weight, about 50 milligram/kg body weight, about 100 milligram/kg body weight, about 200 milligram/kg body weight, about 350 milligram/kg body weight, about 500 milligram/kg body weight, to about 1000 mg/kg body weight or more per administration, and any range derivable therein.
- a range of about 5 mg/kg body weight to about 100 mg/kg body weight, about 5 microgram/kg body weight to about 500 milligram/kg body weight, etc. can be administered, based on the numbers described above.
- one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 5.0 mg/kg or 10 mg/kg (or any combination thereof) may be administered to the patient.
- Such doses may be administered intermittently, e.g. every week or every three weeks (e.g. such that the patient receives from about two to about twenty, or e.g. about six doses of the T cell activating bispecific antigen binding molecule).
- An initial higher loading dose, followed by one or more lower doses may be administered.
- other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
- the T cell activating bispecific antigen binding molecules of the invention will generally be used in an amount effective to achieve the intended purpose.
- the T cell activating bispecific antigen binding molecules of the invention, or pharmaceutical compositions thereof are administered or applied in a therapeutically effective amount. Determination of a therapeutically effective amount is well within the capabilities of those skilled in the art, especially in light of the detailed disclosure provided herein.
- a therapeutically effective dose can be estimated initially from in vitro assays, such as cell culture assays.
- a dose can then be formulated in animal models to achieve a circulating concentration range that includes the IC 50 as determined in cell culture. Such information can be used to more accurately determine useful doses in humans.
- Initial dosages can also be estimated from in vivo data, e.g., animal models, using techniques that are well known in the art. One having ordinary skill in the art could readily optimize administration to humans based on animal data.
- Dosage amount and interval may be adjusted individually to provide plasma levels of the T cell activating bispecific antigen binding molecules which are sufficient to maintain therapeutic effect.
- Usual patient dosages for administration by injection range from about 0.1 to 50 mg/kg/day, typically from about 0.5 to 1 mg/kg/day.
- Therapeutically effective plasma levels may be achieved by administering multiple doses each day. Levels in plasma may be measured, for example, by HPLC.
- the effective local concentration of the T cell activating bispecific antigen binding molecules may not be related to plasma concentration.
- One having skill in the art will be able to optimize therapeutically effective local dosages without undue experimentation.
- a therapeutically effective dose of the T cell activating bispecific antigen binding molecules described herein will generally provide therapeutic benefit without causing substantial toxicity.
- Toxicity and therapeutic efficacy of a T cell activating bispecific antigen binding molecule can be determined by standard pharmaceutical procedures in cell culture or experimental animals. Cell culture assays and animal studies can be used to determine the LD 50 (the dose lethal to 50% of a population) and the ED 50 (the dose therapeutically effective in 50% of a population). The dose ratio between toxic and therapeutic effects is the therapeutic index, which can be expressed as the ratio LD 50 /ED 50 . T cell activating bispecific antigen binding molecules that exhibit large therapeutic indices are preferred.
- the T cell activating bispecific antigen binding molecule according to the present invention exhibits a high therapeutic index.
- the data obtained from cell culture assays and animal studies can be used in formulating a range of dosages suitable for use in humans.
- the dosage lies preferably within a range of circulating concentrations that include the ED 50 with little or no toxicity.
- the dosage may vary within this range depending upon a variety of factors, e.g., the dosage form employed, the route of administration utilized, the condition of the subject, and the like.
- the exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition (see, e.g., Fingl et al., 1975, in: The Pharmacological Basis of Therapeutics, Ch. 1, p. 1, incorporated herein by reference in its entirety).
- the attending physician for patients treated with T cell activating bispecific antigen binding molecules of the invention would know how and when to terminate, interrupt, or adjust administration due to toxicity, organ dysfunction, and the like. Conversely, the attending physician would also know to adjust treatment to higher levels if the clinical response were not adequate (precluding toxicity).
- the magnitude of an administered dose in the management of the disorder of interest will vary with the severity of the condition to be treated, with the route of administration, and the like. The severity of the condition may, for example, be evaluated, in part, by standard prognostic evaluation methods. Further, the dose and perhaps dose frequency will also vary according to the age, body weight, and response of the individual patient.
- the T cell activating bispecific antigen binding molecules of the invention may be administered in combination with one or more other agents in therapy.
- a T cell activating bispecific antigen binding molecule of the invention may be co-administered with at least one additional therapeutic agent.
- therapeutic agent encompasses any agent administered to treat a symptom or disease in an individual in need of such treatment.
- additional therapeutic agent may comprise any active ingredients suitable for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
- an additional therapeutic agent is an immunomodulatory agent, a cytostatic agent, an inhibitor of cell adhesion, a cytotoxic agent, an activator of cell apoptosis, or an agent that increases the sensitivity of cells to apoptotic inducers.
- the additional therapeutic agent is an anti-cancer agent, for example a microtubule disruptor, an antimetabolite, a topoisomerase inhibitor, a DNA intercalator, an alkylating agent, a hormonal therapy, a kinase inhibitor, a receptor antagonist, an activator of tumor cell apoptosis, or an antiangiogenic agent.
- Such other agents are suitably present in combination in amounts that are effective for the purpose intended.
- the effective amount of such other agents depends on the amount of T cell activating bispecific antigen binding molecule used, the type of disorder or treatment, and other factors discussed above.
- the T cell activating bispecific antigen binding molecules are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
- combination therapies noted above encompass combined administration (where two or more therapeutic agents are included in the same or separate compositions), and separate administration, in which case, administration of the T cell activating bispecific antigen binding molecule of the invention can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent and/or adjuvant.
- T cell activating bispecific antigen binding molecules of the invention can also be used in combination with radiation therapy.
- an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above comprises a container and a label or package insert on or associated with the container.
- Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc.
- the containers may be formed from a variety of materials such as glass or plastic.
- the container holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- At least one active agent in the composition is a T cell activating bispecific antigen binding molecule of the invention.
- the label or package insert indicates that the composition is used for treating the condition of choice.
- the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the composition comprises a T cell activating bispecific antigen binding molecule of the invention; and (b) a second container with a composition contained therein, wherein the composition comprises a further cytotoxic or otherwise therapeutic agent.
- the article of manufacture in this embodiment of the invention may further comprise a package insert indicating that the compositions can be used to treat a particular condition.
- the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
- BWFI bacteriostatic water for injection
- phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
- BWFI bacteriostatic water for injection
- phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
- BWFI bacteriostatic water for injection
- Ringer's solution such as phosphate
- Described herein is the advantageous efficiency of using a single light chain or highly homologous variants thereof for methods of identifying appropriate heavy chain variable regions to construct a T cell activating bispecific antigen binding molecules.
- the light chain not only has to be able to pair with various heavy chains to produce binding moieties of different specificity but also retain the ability to form a binding moiety that can activate the T cells to which it binds.
- the light chain described herein can be used as a common light chain (CLC) for identifying appropriate heavy chain variable regions, e.g., by screeining a library of heavy chan variable regions. This allows for maintaining the previously identified and validated CD3 binder such that merely a new target antigen binder for the target antigen binding moiety of a T cell activating bispecific antigen binding molecules has to be identified.
- CLC common light chain
- the invention provides for a method for identifying a variable heavy chain for use in a bispecific antigen binding molecule specific for a T cell activation antigen and a target cell antigen, comprising the step of screening a combinatorial library comprising variable heavy chains with a light chain comprising the amino acid sequence of SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34.
- the light chain comprises the amino acid sequence of SEQ ID NO: 31.
- the light chain comprises the amino acid sequence of SEQ ID NO: 35.
- This method can be used to develop stable, functional, high affinity binders to improve production of T cell activating bispecific antigen binding molecules with, e.g., CD3 specificity and a target antigen specificity, where the target antigens are unrelated, e.g., FolR1, MUC1, and BCMA.
- DNA sequences were determined by standard double strand sequencing at Synergene (Schlieren).
- Desired gene segments where required were either generated by PCR using appropriate templates or were synthesized by Geneart AG (Regensburg, Germany) from synthetic oligonucleotides and PCR products by automated gene synthesis. In cases where no exact gene sequence was available, oligonucleotide primers were designed based on sequences from closest homologues and the genes were isolated by RT-PCR from RNA originating from the appropriate tissue. The gene segments flanked by singular restriction endonuclease cleavage sites were cloned into standard cloning/sequencing vectors. The plasmid DNA was purified from transformed bacteria and concentration determined by UV spectroscopy. The DNA sequence of the subcloned gene fragments was confirmed by DNA sequencing. Gene segments were designed with suitable restriction sites to allow sub-cloning into the respective expression vectors. All constructs were designed with a 5′-end DNA sequence coding for a leader peptide which targets proteins for secretion in eukaryotic cells.
- PBMCs Peripheral blood mononuclear cells
- enriched lymphocyte preparations obtained from local blood banks or from fresh blood from healthy human donors. Briefly, blood was diluted with sterile PBS and carefully layered over a Histopaque gradient (Sigma, H8889). After centrifugation for 30 minutes at 450 ⁇ g at room temperature (brake switched off), part of the plasma above the PBMC containing interphase was discarded. The PBMCs were transferred into new 50 ml Falcon tubes and tubes were filled up with PBS to a total volume of 50 ml. The mixture was centrifuged at room temperature for 10 minutes at 400 ⁇ g (brake switched on).
- the supernatant was discarded and the PBMC pellet washed twice with sterile PBS (centrifugation steps at 4° C. for 10 minutes at 350 ⁇ g).
- the resulting PBMC population was counted automatically (ViCell) and stored in RPMI1640 medium, containing 10% FCS and 1% L-alanyl-L-glutamine (Biochrom, K0302) at 37° C., 5% CO 2 in the incubator until assay start.
- T cell enrichment from PBMCs was performed using the Pan T Cell Isolation Kit II (Miltenyi Biotec #130-091-156), according to the manufacturer's instructions. Briefly, the cell pellets were diluted in 40 ⁇ l cold buffer per 10 million cells (PBS with 0.5% BSA, 2 mM EDTA, sterile filtered) and incubated with 10 ⁇ l Biotin-Antibody Cocktail per 10 million cells for 10 min at 4° C. 30 ⁇ l cold buffer and 20 ⁇ l Anti-Biotin magnetic beads per 10 million cells were added, and the mixture incubated for another 15 min at 4° C. Cells were washed by adding 10-20 ⁇ the current volume and a subsequent centrifugation step at 300 ⁇ g for 10 min.
- PBMCs Peripheral blood mononuclar cells
- enriched lymphocyte preparations obtained from local blood banks or from fresh blood from healthy human donors.
- T-cell enrichment from PBMCs was performed using the Naive CD8 + T cell isolation Kit from Miltenyi Biotec (#130-093-244), according to the manufacturer's instructions, but skipping the last isolation step of CD8 + T cells (also see description for the isolation of primary human pan T cells).
- Spleens were isolated from C57BL/6 mice, transferred into a GentleMACS C-tube (Miltenyi Biotech #130-093-237) containing MACS buffer (PBS+0.5% BSA+2 mM EDTA) and dissociated with the GentleMACS Dissociator to obtain single-cell suspensions according to the manufacturer's instructions.
- the cell suspension was passed through a pre-separation filter to remove remaining undissociated tissue particles. After centrifugation at 400 ⁇ g for 4 min at 4° C., ACK Lysis Buffer was added to lyse red blood cells (incubation for 5 min at room temperature). The remaining cells were washed with MACS buffer twice, counted and used for the isolation of murine pan T cells.
- the negative (magnetic) selection was performed using the Pan T Cell Isolation Kit from Miltenyi Biotec (#130-090-861), following the manufacturer's instructions.
- the resulting T cell population was automatically counted (ViCell) and immediately used for further assays.
- PBMCs Peripheral blood mononuclar cells
- Heparinized blood was diluted 1:3 with sterile PBS
- Lymphoprep medium (Axon Lab #1114545) was diluted to 90% with sterile PBS.
- Two volumes of the diluted blood were layered over one volume of the diluted density gradient and the PBMC fraction was separated by centrifugation for 30 min at 520 ⁇ g, without brake, at room temperature.
- the PBMC band was transferred into a fresh 50 ml Falcon tube and washed with sterile PBS by centrifugation for 10 min at 400 ⁇ g at 4° C.
- One low-speed centrifugation was performed to remove the platelets (15 min at 150 ⁇ g, 4° C.), and the resulting PBMC population was automatically counted (ViCell) and immediately used for further assays.
- the antigen is expressed in two different versions.
- a non-Fc containing construct the extracellular domain is fused to an avi-His tag attached to its C-terminus.
- an Fc fusion using the knob-into-hole technology to the N-terminus of a heterodimeric Fc part is applied (Merchant et al.) to have only one molecule of the protein of interest per Fc dimer. This is done to avoid the formation of any artificial dimeric structures of the protein of interest.
- the avi-tag is here attached to the C-terminus of the Fc.
- proteins can easily be transiently expressed in mammalian cells like HEK or CHO, purified via ProteinA chromatography, biotinylted and can be attached to streptavidin beads for phage selections via the biotinylated avi-tag according to standard methods.
- Affinity maturation of the Fab fragments coming out of a CLC-library has to be limited to the heavy chain only, in order to retain the light chain in an unchanged manner to have the CD3e binding affinity retained. Since our initial library is randomized in the CDR3 of the heavy chain only, we focus for the maturation step on the CDRs 1 and 2. For this we design PCR primers for each framework that will introduce randomization in to CDR1 and CDR2 separately. Each primer is designed to bind to one of the six heavy chain frameworks and can be used in a generic way for each antibody clone coming from that particular phage library. The process of maturation is carried out as described by Knappik, or by Steidl (Knappik et al., J. Mol.
- Phage panning is carried out as described above, with the difference that the concentrations of the soluble antigen is used at 2 ⁇ 10 ⁇ 8M and is decreased to a final concentration to 2 ⁇ 10 ⁇ 10M.
- variable region of heavy and light chain DNA sequences are subcloned in frame with either the constant heavy chain or the constant light chain pre-inserted into the respective recipient mammalian expression vector.
- the antibody expression is driven by an MPSV promoter and carries a synthetic polyA signal sequence at the 3′ end of the CDS.
- each vector contains an EBV OriP sequence for transient expression in HEK293-EBNA cells.
- antibody isotypes IgG1 P329G LALA or IgG4 SPLE PG are used.
- the CLC TCB is produced by co-transfecting HEK293-EBNA cells with the mammalian expression vectors using polyethylenimine. The cells are transfected with the corresponding expression vectors in a 1:1:3 ratio (“vector heavy chain Fc(hole)”: “vector heavy chain Fc(knob)-FabCrossfab”): “vector common light chain”.
- HEK293 EBNA cells are cultivated in suspension serum free in CD CHO culture medium. For the production in 500 ml shake flask 400 million HEK293 EBNA cells are seeded 24 hours before transfection. For transfection cells are centrifuged for 5 min by 210 ⁇ g, supernatant is replaced by pre-warmed 20 ml CD CHO medium. Expression vectors are mixed in 20 ml CD CHO medium to a final amount of 200 g DNA. After addition of 540 ⁇ l PEI solution is vortexed for 15 s and subsequently incubated for 10 min at room temperature.
- cells are mixed with the DNA/PEI solution, transferred to a 500 ml shake flask and incubated for 3 hours by 37° C. in an incubator with a 5% CO2 atmosphere. After incubation time 160 ml F17 medium is added and cell are cultivated for 24 hours. One day after transfection 1 mM valporic acid and 7% Feed 1 is added. After 7 days cultivation supernatant is collected for purification by centrifugation for 15 min at 210 ⁇ g, the solution is sterile filtered (0.22 ⁇ m filter) and sodium azide in a final concentration of 0.01% w/v is added, and kept at 4° C.
- the secreted protein is purified from cell culture supernatants by affinity chromatography using ProteinA.
- Target protein is eluted during a gradient over 20 column volume from 20 mM sodium citrate, 0.5 M sodium chloride, pH 7.5 to 20 mM sodium citrate, 0.5 M sodium chloride, pH 2.5.
- Protein solution is neutralized by adding 1/10 of 0.5 M sodium phosphate, pH 8.
- Target protein is concentrated and filtrated prior loading on a HiLoad Superdex 200 column (GE Healthcare) equilibrated with 20 mM Histidine, 140 mM sodium chloride solution of pH 6.0.
- the protein concentration of purified protein samples is determined by measuring the optical density (OD) at 280 nm, using the molar extinction coefficient calculated on the basis of the amino acid sequence.
- the aggregate content of antibody samples is analyzed using a TSKgel G3000 SW XL analytical size-exclusion column (Tosoh) in 25 mM K2HPO4, 125 mM NaCl, 200 mM L-Arginine Monohydrocloride, 0.02% (w/v) NaN3, pH 6.7 running buffer at 25° C.
- CLC TCB The binding of CLC TCB is tested using tumor cells expressing the antigen X of interest and a CD3e-expressing immortalized T lymphocyte line (Jurkat). Briefly, cells are harvested, counted, checked for viability and resuspended at 2 ⁇ 106 cells/ml in FACS buffer (100 ⁇ l PBS 0.1% BSA). 100 ⁇ l of cell suspension (containing 0.2 ⁇ 106 cells) is incubated in round-bottom 96-well plate for 30 min at 4° C. with increasing concentrations of the CLC TCB (3 pM-200 nM), washed twice with cold PBS 0.1% BSA, re-incubated for further 30 min at 4° C.
- the following antigens and screening tools were generated as monovalent Fc fusion proteins (the extracellular domain of the antigen linked to the hinge region of Fc-knob which is co-expressed with an Fc-hole molecule).
- the antigen genes were synthesized (Geneart, Regensburg, Germany) based on sequences obtained from GenBank or SwissProt and inserted into expression vectors to generate fusion proteins with Fc-knob with a C-terminal Avi-tag for in vivo or in vitro biotinylation. In vivo biotinylation was achieved by co-expression of the bacterial birA gene encoding a bacterial biotin ligase during production. Expression of all genes was under control of a chimeric MPSV promoter on a plasmid containing an oriP element for stable maintenance of the plasmids in EBNA containing cell lines.
- HEK293 EBNA cells were seeded 24 hours before transfection.
- transfection cells were centrifuged for 5 minutes at 210 g, and supernatant was replaced by pre-warmed CD CHO medium.
- Expression vectors were resuspended in 20 mL of CD CHO medium containing 200 ⁇ g of vector DNA. After addition of 540 ⁇ L of polyethylenimine (PEI), the solution was mixed for 15 seconds and incubated for 10 minutes at room temperature. Afterwards, cells were mixed with the DNA/PEI solution, transferred to a 500 mL shake flask and incubated for 3 hours at 37° C. in an incubator with a 5% CO 2 atmosphere.
- PEI polyethylenimine
- F17 medium After the incubation, 160 mL of F17 medium was added and cells were cultured for 24 hours. One day after transfection, 1 mM valproic acid and 7% Feed 1 (Lonza) were added to the culture. The production medium was also supplemented with 100 ⁇ M biotin. After 7 days of culturing, the cell supernatant was collected by spinning down cells for 15 min at 210 g. The solution was sterile filtered (0.22 ⁇ m filter), supplemented with sodium azide to a final concentration of 0.01% (w/v), and kept at 4° C.
- Secreted proteins were purified from cell culture supernatants by affinity chromatography using Protein A, followed by size exclusion chromatography.
- pH of collected fractions was adjusted by adding 1/10 (v/v) of 0.5 M sodium phosphate, pH 8.0.
- the protein was concentrated and filtered prior to loading on a HiLoad Superdex 200 column (GE Healthcare) equilibrated with 20 mM histidine, 140 mM sodium chloride, pH 6.0.
- the protein concentration was determined by measuring the optical density (OD) at 280 nm, using the molar extinction coefficient calculated on the basis of the amino acid sequence. Purity and molecular weight of the FolR1-Fc-fusion was analyzed by SDS capillary electrophoresis in the presence and absence of a reducing agent following the manufacturer instructions (instrument Caliper LabChipGX, Perkin Elmer).
- the aggregate content of samples was analyzed using a TSKgel G3000 SW XL analytical size-exclusion column (Tosoh) equilibrated in 25 mM K2HPO4, 125 mM NaCl, 200 mM L-arginine monohydrochloride, 0.02% (w/v) NaN3, pH 6.7 running buffer at 25° C.
- the T cell activating bispecific molecules described herein comprise at least one CD3 binding moiety.
- This moiety can be generated by immunizing laboratory animals, screening phage library or using known anti-CD3 antibodies.
- the common light chain with CD3 ⁇ specificity was generated by humanizing the light chain of a murine parental anti-CD3 ⁇ antibody (CH2527).
- CH2527 murine parental anti-CD3 ⁇ antibody
- acceptor framework sequences are selected by aligning the sequence of the donor to a collection of potential acceptor sequences and choosing one that has either reasonable homology to the donor, or shows similar amino acids at some positions critical for structure and activity.
- the search for the antibody acceptor framework was performed by aligning the mouse VL-domain sequence of the parental antibody to a collection of human germline sequences and choosing the human sequence that showed high sequence identity.
- a good match in terms of framework sequence homology was found in a rather infrequent human light chain belonging to the V-domain family 7 of the lambda type, more precisely, hVL_7_46 (IMGT nomenclature, GenBank Acc No. Z73674).
- This infrequent human light chain was subsequently chosen as acceptor framework for humanization of the light chain of CH2527.
- the three complementarity determining regions (CDRs) of the mouse light chain variable domain were grafted onto this acceptor framework.
- the framework 4 region is not part of the variable region of the germline V-gene, the alignment for this region (J-element) was done individually. Hence the IGLJ3-02 sequence was chosen for humanization of this light chain. Thirteen humanized variants were generated (CH2527-VL7_46-1 to VL7_46-10, VL7_46-12 to VL7_46-14). These differ in framework residues (and combinations thereof) that were back-mutated to the murine V-domain sequence or in CDR-residues (Kabat definition) that could be kept identical to the human germline sequence.
- the following framework residues outside the CDRs were back-mutated to the murine residues in the final humanized VL-domain variant VL7_46-13 (murine residues listed): V36, E38, F44, G46, G49, and G57, respectively.
- the human J-element IGLJ3-02 was 100% identical to the J-element of the murine parental antibody.
- Humanized VL variants were assessed as chimera in a 2+1 classical format ( FIG. 1D ), i.e. humanized light chain V-domains were paired with murine heavy chain V-domains. SPR assessment was carried out on a ProteOn XPR36 instrument (Bio-Rad). More precisely, the variants were captured directly from the culture supernatant on an anti-Fab derivatized GLM sensorchip (Goat Anti-Human IgG, F(ab′)2 Fragment Specific, Jackson ImmunoResearch) in vertical orientation.
- the light chain V-domain variant that was chosen for the humanized lead molecule is VL7_46-13.
- the degree of humanness i.e. the sequence homology of the humanized V-domain to the human germline V-domain sequence was determined.
- the overall sequence identity with the closest human germline homolog is 65% before humanization and 80% afterwards. Omitting the CDR regions, the sequence identity is 92% to the closest human germline homolog.
- VL7_46-13 is the only humanized VL variant out of a panel of 13 variants that showed comparable binding to the parental murine antibody and also retained its cross-reactivity to cynomolgus CD3 ⁇ .
- the humanized VL-domain VL7_46-13 based on an infrequent human germline belonging to the V-domain family 7 of the lambda type and retaining affinity and specificity for CD3 ⁇ , is also suitable to be used as a common light chain in phage-displayed antibody libraries of the Fab-format and enables successful selection for novel specificities which greatly facilitates the generation and production of bispecific molecules binding to CD3 ⁇ and e.g. a tumor target and sharing the same ‘common’ light chain.
- All heavy chains use the IGHJ2 as J-element, except the IGHV1-69*06 which uses IGHJ6 sequence.
- the design of the randomization included the CDR-H1, CDR-H2, and CDR-H3.
- CDR-H1 and CDR-H2 a “soft” randomization strategy was chosen, and the randomization oligonucleotides were such that the codon for the amino acid of the germ-line sequence was present at 50%. All other amino acids, except cysteine, were summing up for the remaining 50%.
- oligonucleotides were designed that allow for the usage of randomized inserts between the V-element and the J-element of 4 to 9 amino acids in length. Those oligonucleotides contained in their randomized part e.g. The three amino acids G/Y/S are present to 15% each, those amino acids A/D/T/R/P/L/V/N/W/F/I/E are present to 4,6% each.
- the light chain is derived from the human sequence hVK1-39, and is used in an unmodified and non-randomized fashion. This will ensure that the same light chain can be used for other projects without additional modifications.
- 10 ⁇ 12 phagemid particles of each library are bound to 100 nM biotinylated soluble antigen for 0.5 h in a total volume of 1 ml.
- Biotinylated antigen is captured and specifically bound phage particles are isolated by addition of ⁇ 5 ⁇ 10 ⁇ 7 streptavidin-coated magnetic beads for 10 min.
- Beads are washed using 5-10 ⁇ 1 ml PBS/Tween20 and 5-10 ⁇ 1 ml PBS.
- Elution of phage particles is done by addition of 1 ml 100 mM TEA (triethylamine) for 10 min and neutralization by addition of 500 ul 1M Tris/HCl pH 7.4 and 5. Re-infection of exponentially growing E.
- TEA triethylamine
- coli TG1 bacteria infection with helper phage VCSM13 and subsequent PEG/NaCl precipitation of phagemid particles is applied in subsequent selection rounds. Selections are carried out over 3-5 rounds using either constant or decreasing (from 10 ⁇ 7M to 2 ⁇ 10 ⁇ 9M) antigen concentrations.
- capture of antigen/phage complexes is performed using neutravidin plates instead of streptavidin beads. All binding reactions are supplemented either with 100 nM bovine serum albumin, or with non-fat milk powder in order to compete for unwanted clones arising from mere sticky binding of the antibodies to the plastic support.
- Specific binders are defined as signals ca. 5 ⁇ higher than background and are identified by ELISA. Specific binders are identified by ELISA as follows: 100 ⁇ l of 10 nM biotinylated antigen per well are coated on neutravidin plates. Fab-containing bacterial supernatants are added and binding Fabs are detected via their Flag-tags by using an anti-Flag/HRP secondary antibody.
- ELISA-positive clones are bacterially expressed as soluble Fab fragments in 96-well format and supernatants are subjected to a kinetic screening experiment by SPR-analysis using ProteOn XPR36 (BioRad).
- Clones expressing Fabs with the highest affinity constants are identified and the corresponding phagemids are sequenced.
- the Fab sequences are amplified via PCR from the phagemid and cloned via appropriate restriction sites into human IgG1 expression vectors for mammalian production.
- an antibody library for the display on M13 phage is described.
- a multi framework library for the heavy chain with one constant (or “common”) light chain is designed solely for the generation of Fc-containing, but FcgR binding inactive T cell bispecific antibodies of IgG1 P329G LALA or IgG4 SPLE PG isotype.
- the antibodies 16A3, 15A1, 18D3, 19E5, 19A4, 15H7, 15B6, 16D5, 15E12, 21D1, 16F12, 21A5, 21G8, 19H3, 20G6, and 20H7 comprising the common light chain VL7_46-13 with CD3 ⁇ specificity were obtained by phage display selections against different species (human, cynomolgus and murine) of FolR1.
- Clones 16A3, 15A1, 18D3, 19E5, 19A4, 15H7, 15B6, 21D1, 16F12, 19H3, 20G6, and 20H7 were selected from a sub-library in which the common light chain was paired with a heavy chain repertoire based on the human germline VH1_46.
- CDR3 of VH1_46 has been randomized based on 6 different CDR3 lengths.
- Clones 16D5, 15E12, 21A5, and 21G8 were selected from a sub-library in which the common light chain was paired with a heavy chain repertoire based on the human germline VH3_15.
- CDR3 of VH3_15 has been randomized based on 6 different CDR3 lengths.
- Clones exhibiting signals on human FolR1 and being negative on human IgG were short-listed for further analyses and were also tested in a similar fashion against the remaining two species of FolR1. They were bacterially expressed in a 0.5 liter culture volume, affinity purified and further characterized by SPR-analysis using BioRad's ProteOn XPR36 biosensor.
- K D Affinities (K D ) of selected clones were measured by surface plasmon resonance (SPR) using a ProteOn XPR36 instrument (Biorad) at 25° C. with biotinylated human, cynomolgus, and murine FolR1 as well as human FolR2 and FolR3 (negative controls) immobilized on NLC chips by neutravidin capture.
- Immobilization of antigens (ligand) Recombinant antigens were diluted with PBST (10 mM phosphate, 150 mM sodium chloride pH 7.4, 0.005% Tween 20) to 10 ⁇ g/ml, then injected at 30 ⁇ l/minute in vertical orientation.
- the antibodies 11F8, 36F2, 9D11, 5D9, 6B6, and 14E4 were obtained by phage display selections based on generic multi-framework sub-libraries against different species (human, cynomolgus and murine) of FolR1.
- different VL-domains with randomized CDR3 (3 different lengths) are paired with different VH-domains with randomized CDR3 (6 different lengths).
- the selected clones are of the following VL/VH pairings: 11F8 (Vk_1_5/VH_1_69), 36F2 (Vk_3_20/VH_1_46), 9D11 (Vk2D_28/VH1_46), 5D9 (Vk3_20/VH1_46), 6B6 (Vk3_20/VH1_46), and 14E4 (Vk3_20/VH3_23).
- Clones exhibiting signals on human FolR1 and being negative on human IgG were short-listed for further analyses and were also tested in a similar fashion against the remaining two species of FolR1. They were bacterially expressed in a 0.5 liter culture volume, affinity purified and further characterized by SPR-analysis using BioRad's ProteOn XPR36 biosensor.
- K D Affinities (K D ) of selected clones were measured by surface plasmon resonance (SPR) using a ProteOn XPR36 instrument (Biorad) at 25° C. with biotinylated human, cynomolgus, and murine FolR1 as well as human FolR2 and FolR3 (negative controls) immobilized on NLC chips by neutravidin capture.
- Immobilization of antigens (ligand) Recombinant antigens were diluted with PBST (10 mM phosphate, 150 mM sodium chloride pH 7.4, 0.005% Tween 20) to 10 ⁇ g/ml, then injected at 30 ⁇ l/minute in vertical orientation.
- K D Equilibrium dissociation constants (K D ) for anti-FolR1 antibodies (Fab-format) selected by phage display from generic multi-framework sub-libraries K D in nM.
- K D (nM) Clone huFolR1 cyFolR1 muFolR1 huFolR2 huFolR3 11F8 632 794 1200 no binding no binding 36F2 1810 1640 737 no binding no binding 9D11 8.64 5.29 no binding no binding no binding 5D9 8.6 5.9 no binding no binding 6B6 14.5 9.4 no binding no binding no binding 14E4 no binding no binding 6.09 no binding no binding no binding
- the antibodies isolated from a common light chain- or Fab-library were converted into the corresponding human IgG1 format.
- the variable heavy and variable light chains of unique FolR1 binders from phage display were amplified by standard PCR reactions using the Fab clones as the template.
- the PCR products were purified and inserted (either by restriction endonuclease and ligase based cloning, or by ‘recombineering’ using the InFusion kit from Invitrogen) into suitable expression vectors in which they are fused to the appropriate human constant heavy or human constant light chain.
- the expression cassettes in these vectors consist of a chimeric MPSV promoter and a synthetic polyadenylation site.
- the plasmids contain the oriP region from the Epstein Barr virus for the stable maintenance of the plasmids in HEK293 cells harboring the EBV nuclear antigen (EBNA).
- EBNA EBV nuclear antigen
- HEK293 EBNA cells are cultivated in suspension serum free in CD CHO culture medium. For the production in 500 ml shake flask 400 million HEK293 EBNA cells are seeded 24 hours before transfection (for alternative scales all amounts were adjusted accordingly). For transfection cells are centrifuged for 5 min by 210 ⁇ g, supernatant is replaced by pre-warmed 20 ml CD CHO medium. Expression vectors are mixed in 20 ml CD CHO medium to a final amount of 200 ⁇ g DNA.
- PEI solution After addition of 540 ⁇ l PEI solution is vortexed for 15 s and subsequently incubated for 10 min at room temperature. Afterwards cells are mixed with the DNA/PEI solution, transferred to a 500 ml shake flask and incubated for 3 hours by 37° C. in an incubator with a 5% CO2 atmosphere. After incubation time 160 ml F17 medium is added and cell are cultivated for 24 hours. One day after transfection 1 mM valporic acid and 7% Feed 1 is added.
- Purity and molecular weight of the constructs were analyzed by SDS capillary electrophoresis in the presence and absence of a reducing agent following the manufacturer instructions (instrument Caliper LabChipGX, Perkin Elmer). Purified proteins were frozen in liquid N 2 and stored at ⁇ 80° C.
- binders were converted into a T-cell bispecific format.
- the FolR1:CD3 binding moieties are arranged in a 2:1 order with the FolR1 Fabs being located at the N-terminus.
- the CD3 binding part was generated as a CrossFab (CH1C ⁇ crossing) while for the clones from the common light chain library no crossing was necessary.
- IgG TCB Yield Monomer Monomer # Clone Library [mg/L] [%] Yield [mg/L ⁇ [%] 1 11F8 Fab 8.03 96.26 — — 2 14E4 Fab 8.90 98.12 — — 3 15B6 CLC 7.72 100.00 — — 4 15E12 CLC 6.19 100.00 — — 5 15H7 CLC 8.94 100.00 — — 6 16A3 CLC 0.60 n.d.
- T-cell bispecific formats were prepared for one common light chain binder (16D5) and three formats for one binder from the Fab library (9D11) to compare their killing properties in vitro.
- the standard format is the 2+1 inverted format as already described (FolR1:CD3 binding moieties arranged in a 2:1 order with the FolR1 Fabs located at the N-terminus).
- the FolR1:CD3 binding moieties are arranged in a 2:1 order with the CD3 Fab being located at the N-terminus.
- Two monovalent formats were also prepared.
- the 1+1 head-to-tail has the FolR1:CD3 binding moieties arranged in a 1:1 order on the same arm of the molecule with the FolR1 Fab located at the N-terminus.
- the FolR1:CD3 binding moieties are present once, each on one arm of the molecule.
- the IgGs were injected for 60 seconds at a concentration of 500 nM. IgGs binding to huFolR2 and huFolR3 were rejected for lack of specificity. Most of the binders are only crossreactive between human and cyno FolR1, additional crossreactivity to murine FolR1 went most of the time hand in hand with loss of specificity.
- Recombinant biotinylated monomeric Fc fusions of human, cynomolgus and murine Folate Receptor 1 (FolR1-Fc) were directly coupled on a SA chip using the standard coupling instruction (Biacore, Freiburg/Germany).
- the immobilization level was about 300-400 RU.
- the anti-FolR1 IgGs or T cell bispecifics were passed at a concentration range from 2.1 to 500 nM with a flow of 30 ⁇ L/minutes through the flow cells over 180 seconds. The dissociation was monitored for 600 seconds. Bulk refractive index differences were corrected for by subtracting the response obtained on reference flow cell immobilized with recombinant biotinylated IL2 receptor Fc fusion.
- folate (Sigma F7876) was added in the HBS-EP running buffer at a concentration of 2.3 ⁇ M.
- the binding curves resulting from the bivalent binding of the IgGs or T cell bispecifics were approximated to a 1:1 Langmuir binding and fitted with that model (which is not correct, but gives an idea of the avidity).
- the apparent avidity constants for the interactions were derived from the rate constants of the fitting using the Bia Evaluation software (GE Healthcare).
- the dissociation phase was monitored for 240 s and triggered by switching from the sample solution to HBS-EP.
- the chip surface was regenerated after every cycle using a double injection of 60 sec 10 mM Glycine-HCl pH 2.1 or pH 1.5. Bulk refractive index differences were corrected for by subtracting the response obtained on the reference flow cell 1.
- the affinity constants for the interactions were derived from the rate constants by fitting to a 1:1 Langmuir binding using the Bia Evaluation software (GE Healthcare).
- the chip surface was regenerated after every cycle using a double injection of 60 sec 10 mM Glycine-HCl pH 2.1. Bulk refractive index differences were corrected for by subtracting the response obtained on the reference flow cell 1.
- the affinity constants for the interactions were derived from the rate constants by fitting to a 1:1 Langmuir binding using the Bia Evaluation software (GE Healthcare).
- the anti-FolR1 T cell bispecifics were injected for 60 s at 500 nM with a flow of 30 ⁇ L/minutes through the flow cells, followed by an injection of hu CD ⁇ -Fc for 60 s at 500 nM. Bulk refractive index differences were corrected for by subtracting the response obtained on reference flow cell immobilized with recombinant biotinylated IL2 receptor Fc fusion.
- the four T cell bispecifics tested (16D5 TCB, 21A5 TCB, 51C7 TCB and 45D2 TCB) were able to bind simultaneously to Folate Receptor 1 and human CD3 as expected.
- the anti-FolR1 IgGs or T cell bispecifics were directly immobilized on a CM5 chip at pH 5.0 using the standard amine coupling kit (GE Healthcare), with a final response around 700 RU.
- 500 nM huFolR1-Fc was then captured for 60 s, followed by 500 nM of the different binders for 30 s.
- the surface was regenerated with two injections of 10 mM glycine pH 2 for 30 s each. It is assessed if the different binders can bind to huFolR1 captured on immobilized binders (Table 12).
- FolR1 binders in the IgG formats were screened by surface plasmon resonance (SPR) and by in vitro assay on cells to select the best candidates.
- the anti-FolR1 IgGs were analyzed by SPR to characterize their crossreactivity (to human, murine and cynomolgus FolR1) and specificity (to human FolR1, human FolR2, human FolR3). Unspecific binding to human FolR2 and 3 was considered an exclusion factor. Binding and specificity to human FolR1 was confirmed on cells. Some binders did not bind on cells expressing FolR1 even though they recognized the recombinant human FolR1 in SPR. Aggregation temperature was determined but was not an exclusion factor because the selected binders were all stable. Selected binders were tested in a polyreactivity ELISA to check for unspecific binding, which led to the exclusion of four binders.
- New FolR1 binders were generated via Phage Display using either a Fab library or a common light chain library using the CD3 light chain. The identified binders were converted into a human IgG1 format and binding to FolR1 high expressing HeLa cells was addressed. As reference molecule the human FolR1 binder Mov19 was included. Most of the binders tested in this assay showed intermediate to good binding to FolR1 with some clones binding equally well as Mov19 (see FIG. 2 ). The clones 16A3, 18D3, 15H7, 15B6, 21D1, 14E4 and 16F12 were excluded because binding to FolR1 on cells could not be confirmed by flow cytometry.
- HEK cells were transiently transfected with either human FolR1 or human FolR2 to address specificity.
- the clones 36F2 and 9D11 derived from the Fab library and the clones 16D5 and 21A5 derived from the CLC library bind specifically to human FolR1 and not to human FolR2 (see FIGS. 3A-B ). All the other tested clones showed at least some binding to human FolR2 (see FIGS. 3A-B ). Therefore these clones were excluded from further characterization.
- Mov19 FolR1 TCB was included in all studies. These FolR1 TCBs were then used to compare induction of internalization after binding to FolR1 on HeLa cells. All three tested clones are internalized upon binding to FolR1 comparable to internalization upon binding of Mov19 FoLR1 TCB ( FIG. 5 ). 21 A5 FolR1 TCB was discontinued due to signs of polyreactivity.
- the FolR1 TCBs were used to determine T cell mediated killing of tumor cells expressing FoLR1.
- a panel of potential target cell lines was used to determine FoLR1 binding sites by Qifikit analysis.
- the used panel of tumor cells contains FolR1 high, intermediate and low expressing tumor cells and a FolR1 negative cell line.
- Binding of the three different FoLR1 TCBs (containing 9D11, 16D5 and Mov19 binders) to this panel of tumor cell lines was determined showing that the FolR1 TCBs bind specifically to FolR1 expressing tumor cells and not to a FoLR1 negative tumor cell line.
- the amount of bound construct is proportional to the FolR1 expression level and there is still good binding of the constructs to the FolR1 low cell line HT-29 detectable.
- the intermediate expressing cell line SKOV3 and the low expressing cell line HT-29 were further on used to test T cell mediated killing and T cell activation using 16D5 TCB and 9D11 TCB; DP47 TCB was included as negative control. Both cell lines were killed in the presence of already very low levels of 16D5 TCB and 9D11 TCB and there was no difference in activity between both TCBs even though 9D11 TCB binds stronger to FolR1 than 16D5 TCB. Overall killing of SKOV3 cells was higher compared to HT-29 which reflects the higher expression levels of FolR1 on SKOV3 cells ( FIGS. 7A-D ).
- the four T cell bispecifics were transiently produced in HEK293 EBNA cells using a PEI mediated transfection procedure for the required vectors as described below.
- HEK293 EBNA cells were cultivated in suspension serum free in CD CHO culture medium.
- 400 million HEK293 EBNA cells were seeded 24 hours before transfection (for alternative scales all amounts were adjusted accordingly).
- For transfection cells were centrifuged for 5 min by 210 ⁇ g, supernatant was replaced by pre-warmed 20 ml CD CHO medium.
- Expression vectors were mixed in 20 ml CD CHO medium to a final amount of 200 ⁇ g DNA.
- PEI solution After addition of 540 ⁇ l PEI solution was vortexed for 15 s and subsequently incubated for 10 min at room temperature. Afterwards cells were mixed with the DNA/PEI solution, transferred to a 500 ml shake flask and incubated for 3 hours by 37° C. in an incubator with a 5% CO2 atmosphere. After incubation time 160 ml F17 medium was added and cell were cultivated for 24 hours. One day after transfection 1 mM valporic acid and 7% Feed 1 was added.
- Fractions containing the protein of interest were pooled and the pH of the solution was gently adjusted to pH 6.0 (using 2 M Tris pH 8.0). Samples were concentrated to 1 ml using ultra-concentrators (Vivaspin 15R 30.000 MWCO HY, Sartorius) and subsequently applied to a SuperdexTM 200 10/300 GL (GE Healthcare) equilibrated with 20 mM Histidine, pH 6.0, 140 mM NaCl, 0.01% Tween-20. The aggregate content of eluted fractions was analyzed by analytical size exclusion chromatography.
- Purity and molecular weight of the constructs were analyzed by SDS capillary electrophoresis in the presence and absence of a reducing agent following the manufacturer instructions (instrument Caliper LabChipGX, Perkin Elmer). Purified proteins were frozen in liquid N 2 and stored at -80° C.
- N100S N95S
- N100Q N95Q
- T102A T97A
- T102N T97N
- FolR1 is expressed at low levels on primary epithelial cells. Here we wanted to test if these levels are sufficient to induce T cell mediated killing in the presence of the FolR1 TCBs. To test this we used primary human bronchial epithelial cells, primary human choroid plexus epithelial cell, primary human renal cortical epithelial cells and primary human retinal pigment epithelial cells. As positive control either FolR1 positive SKOV3 cells or HT-29 cells were included. First we verified FolR1 expression on the used primary cells and determined the amount of FolR1 binding sites on these cells.
- Bronchial epithelial cells, renal cortical epithelial cells and retinal pigment epithelial cells express very low but significant levels of FolR1 compared to the levels expressed on tumor cells.
- the choroid plexus epithelial cells do not express significant levels of FolR1.
- the primary epithelial cells that demonstrated FolR1 expression on the surface were used to address the question if these cells can be killed by T cells in the presence of FoLR1 TCBs. No significant levels of killing could be measured but induction of T cell activation in the presence of retinal pigment epithelial cells, bronchial epithelial cells and renal cortical cells resulting in upregulation of CD25 and CD69 was detected. The strongest activation is seen with retinal pigment epithelial cells resulting in upregulation of CD25 and CD69 both on CD4 + T cells and CD8 + T cells.
- T cells In the presence of bronchial epithelial cells lower activation of T cells is induced with upregulation of CD69 on CD4+ T cells and CD8+ T cells but very low upregulation of CD25 only on CD4+ T cells but not on CD8+ T cells.
- the lowest activation of T cells is obtained in the presence of renal epithelial cells with no upregulation of CD25 on CD4 T+ cells and CD8 + T cells and CD69 been only upregulated on CD8+ T cells ( FIGS. 12A-X ).
- TCB 2+1 inverted format is the most active format with the selected FolR1 binder
- different formats containing either 16D5 or 9D11 were produced and compared in target cell binding, T cell mediated killing and T cell activation.
- the 16D5 binder was tested in the TCB 2+1 inverted ( FIG. 1A ), TCB 2+1 classical ( FIG. 1D ), TCB 1+1 classical ( FIG. 1C ) and TCB 1+1 head-to-tail ( FIG. 1B ) format
- the 9D11 binder was tested in the TCB 2+1 inverted ( FIG. 1A ), TCB 1+1 classical ( FIG. 1C ) and TCB 1+1 head-to-tail ( FIG. 1B ) format.
- HeLa cells were obtained from ATCC and cultured in DMEM with 10% FCS and 2 mM Glutamine
- SKOV3 HBV-77
- OVCAR5 were obtained from NCI and cultured in RPMI with 10% FCS and 2 mM Glutamine
- HT-29 ACC-299
- MKN-45 ACC-409 were obtained from DSMZ and cultured in RPMI with 10% FCS and 2 mM Glutamine.
- HRCEpiC Human Renal Cortical Epithelial Cells (HRCEpiC), Catalog Number 4110, were cultured in Epithelial Cell Medium (EpiCM, Cat. No. 4101, ScienCell).
- HRCEpiC Human Choroid Plexus Epithelial Cells (HCPEpiC), Catalog Number 1310 were cultured in Epithelial Cell Medium (EpiCM, Cat. No. 4101, ScienCell).
- Target cells as indicated were harvested with Cell Dissociation Buffer, washed with PBS and resuspended in FACS buffer. The antibody staining was performed in a 96well round bottom plate. Therefore 200′000 cells were seeded per well. The plate was centrifuged for 4 min at 400 g and the supernatant was removed. The test antibodies were diluted in FACS buffer and 20 ⁇ l of the antibody solution were added to the cells for 30 min at 4° C.
- the cells were washed twice with FACS buffer before addition of the diluted secondary antibody (FITC conjugated AffiniPure F(ab′)2 fragment goat anti-human IgG, Fcg Fragment, Jackson ImmunoResearch #109-096-098 or PE-conjugated AffiniPure F(ab′)2 Fragment goat anti-human IgG Fcg Fragment Specific, Jackson ImmunoResearch #109-116-170. After 30 min incubation on 4° C. unbound secondary antibody was washed away. Before measurement the cells were resuspended in 200 ⁇ l FACS buffer and analyzed by flow cytometry using BD Canto II or BD Fortessa.
- the cells were harvested and the viability was determined.
- the cells were re-suspended in fresh cold medium at 2 Mio cells per ml and the cell suspension was transferred in a 15 ml falcon tube for each antibody.
- the antibodies that should be tested for internalization were added with a final concentration of 20 ⁇ g per ml to the cells.
- the tubes were incubated for 45 min in the cold room on a shaker. After incubation the cells were washed three times with cold PBS to remove unbound antibodies. 0.2 Mio cells per well were transfer to the FACS plate as time point zero.
- the labeled cells were re-suspended in warm medium and incubated at 37° C.
- Mio cells per well were transferred in cold PBS, washed in plated on the FACS plate. To detect the constructs that remain on the surface the cells were stained with PE-labeled anti-human Fc secondary antibody. Therefore 20 ⁇ l of the diluted antibody were added per well and the plate was incubated for 30 min at 4° C. Then the cells were washed twice to remove unbound antibodies and then fixed with 1% PFA to prevent any further internalization. The fluorescence was measured using BD FACS Cantoll.
- QIFIKIT® contains a series of beads, 10 ⁇ m in diameter and coated with different, but well-defined quantities of mouse Mab molecules (high-affinity anti-human CD5, Clone CRIS-1, isotype IgG2a).
- the beads mimic cells with different antigen densities which have been labeled with a primary mouse Mab, isotype IgG. Briefly, cells were labeled with primary mouse monoclonal antibody directed against the antigen of interest. In a separate test well, cells were labeled with irrelevant mouse monoclonal antibody (isotype control). Then, cells, Set-Up Beads and Calibration Beads were labeled with a fluorescein-conjugated anti-mouse secondary antibody included in the kit.
- the primary antibody used for labeling of the cells has to be used at saturating concentration.
- the primary antibody may be of any mouse IgG isotype. Under these conditions, the number of bound primary antibody molecules corresponds to the number of antigenic sites present on the cell surface.
- the secondary antibody is also used at saturating concentration. Consequently, the fluorescence is correlated with the number of bound primary antibody molecules on the cells and on the beads.
- Target cells were harvested with Trypsin/EDTA, counted and viability was checked. The cells were resuspended in their respective medium with a final concentration of 300′000 cells per ml. Then 100 ⁇ l of the target cell suspension was transferred into each well of a 96-flat bottom plate. The plate was incubated overnight at 37° C. in the incubator to allow adherence of the cells to the plate. On the next day PBMCs were isolated from whole blood from healthy donors. The blood was diluted 2:1 with PBS and overlayed on 15 ml Histopaque-1077 (# 10771, Sigma-Aldrich) in Leucosep tubes and centrifuged for 30 min at 450 g without break.
- the band containing the cells was collected with a 10 ml pipette and transferred into 50 ml tubes.
- the tubes were filled up with PBS until 50 ml and centrifuged (400 g, 10 min, room temperature). The supernatant was removed and the pellet resuspended in PBS. After centrifugation (300 g, 10 min, room temperature), supernatants were discarded, 2 tubes were pooled and the washing step was repeated (this time centrifugation 350 ⁇ g, 10 min, room temperature). Afterwards the cells were resuspended and the pellets pooled in 50 ml PBS for cell counting.
- Activation marker upregulation on T cells after tumor cell killing was measured by flow cytometry. Briefly PBMCs were harvested, transferred into a 96 well round bottom plate and stained with CD4 PE-Cy7 (#3557852, BD Bioscience), CD8 FITC (#555634, BD Bioscience), CD25 APC (#555434, BD Bioscience), CD69 PE (#310906, BioLegend) antibodies diluted in FACS buffer. After 30 min incubation at 4° C. the cells were washed twice with FACS buffer. Before measuring the fluorescence using BD Canto II the cells were resuspended in 200 ⁇ l FACS buffer.
- 280 ⁇ l of fresh blood were added into a 96 well conical deep well plate. Then 20 ⁇ l of the diluted TCBs were added to the blood and mixed well by shaking the plate. After 24 h incubation at 37° C. in an incubator the blood was mixed and 35 ⁇ l were transferred to a 96 well round bottom plate. Then 20 ⁇ l of the antibody staining mix were added consisting of CD4 PE-Cy7 (#3557852, BD Bioscience), CD8 FITC (#555634, BD Bioscience), CD25 APC (#555434, BD Bioscience), CD69 PE (#310906, BioLegend) and CD45 V500 (#560777, BD Horizon) and incubated for 15 min in the dark at room temperature. Before measuring 200 ⁇ l of the freshly prepared BD FACS lysing solution (#349202, BD FCAS) was added to the blood. After 15 min incubation at room temperature the cells were measured with BD Fortessa.
- mice Female NOD/Shi-scid/IL-2R ⁇ null (NOG) mice, age 6-7 weeks at start of the experiment (bred at Taconic, Denmark) were maintained under specific-pathogen-free condition with daily cycles of 12 h light/12 h darkness according to committed guidelines (GV-Solas; Felasa; TierschG). The experimental study protocol was reviewed and approved by local government (P 2011/128). After arrival, animals were maintained for one week to get accustomed to the new environment and for observation. Continuous health monitoring was carried out on a regular basis.
- mice were injected i.v. with 10/1/0.1 ⁇ g/mouse of the FOLR1 TCB whereas 3 mice were bled per group and time point. All mice were injected with a total volume of 200 ⁇ l of the appropriate solution. To obtain the proper amount of the FOLR1 TCB per 200 ⁇ l, the stock solutions were diluted with PBS when necessary. Serum samples were collected 5 min, 1 h, 3 h, 8 h, 24 h, 48 h, 72 h, 96 h and 168 h after therapy injection.
- FIG. 15 shows that the 16D5 FOLR1 TCB shows typical and dose proportional IgG-like PK properties in NOG mice with slow clearance.
- the FOLR1 TCB was tested in the human ovarian carcinoma cell line Skov3, injected s.c. into PBMC engrafted NOG mice.
- the Skov3 ovarian carcinoma cells were obtained from ATCC (HTB-77).
- the tumor cell line was cultured in RPMI containing 10% FCS (Gibco) at 37° C. in a water-saturated atmosphere at 5% CO 2 .
- Passage 35 was used for transplantation, at a viability >95%.
- 5 ⁇ 10 6 cells per animal were injected s.c. into the right flank of the animals in a total of 100 ⁇ l of RPMI cell culture medium (Gibco).
- mice Female NOD/Shi-scid/IL-2R ⁇ null (NOG) mice, age 6-7 weeks at start of the experiment (bred at Taconic, Denmark) were maintained under specific-pathogen-free condition with daily cycles of 12 h light/12 h darkness according to committed guidelines (GV-Solas; Felasa; TierschG). The experimental study protocol was reviewed and approved by local government (P 2011/128). After arrival, animals were maintained for one week to get accustomed to the new environment and for observation. Continuous health monitoring was carried out on a regular basis.
- mice were injected s.c. on study day 0 with 5 ⁇ 10 6 of the Skov3.
- human PBMC of a healthy donor were isolated via the Ficoll method and 10 ⁇ 10 6 cells were injected i.p. into the tumor-bearing mice.
- the mice in the vehicle group were injected with PBS.
- the stock solutions were diluted with PBS when necessary. Tumor growth was measured once weekly using a caliper ( FIG. 17 ) and tumor volume was calculated as followed:
- mice per treatment group were sacrificed at study day 32, tumors were removed and single cell suspensions were prepared through an enzymatic digestion with Collagenase V, Dispase II and DNAse for subsequent FACS-analysis ( FIGS. 19 and 20 ).
- Single cells where either used directly for staining of extracellular antigens and activation markers or were re-stimulated using 5 ng/ml PMA and 500 ng/ml Ionomycin in the presence of a protein transport inhibitor Monensin for 5 h in normal culture medium. After re-stimulation, cells were stained for surface antigens, followed by a fixation and permeabilization step. Fix samples were then stained intracellulary for TNF- ⁇ , IFN- ⁇ , IL-10 and IL-2 and analyzed by flow cytometry.
- a bispecific antibody (monovalent for each antigen) that simultaneously can bind to human CD3 and human folate receptor alpha (FolR1) without using any hetero-dimerization approach (e.g. knob-into-hole technology)
- a combination of a common light chain library with the so-called CrossMab technology was applied:
- the variable region of the humanized CD3 binder (CH2527_VL7_46/13) was fused to the CH1 domain of a standard human IgG1 antibody to form the VLVH crossed molecule (fused to Fc) which is common for both specificities.
- VHCL a CD3 specific variable heavy chain domain (CH2527_VH_23/12) was fused to a constant human ⁇ light chain whereas a variable heavy chain domain specific for human FolR1 (clone 16D5, isolated from common light chain library) was fused to a constant human ⁇ light chain.
- This enables the purification of the desired bispecific antibody by applying subsequent purification steps with KappaSelect and LambdaFabSelect columns (GE Healthcare) to remove undesired homodimeric antibodies.
- HEK293 EBNA cells were transfected with plasmids encoding the respective genes using a standard polyethlenimine (PEI) based method.
- PEI polyethlenimine
- the used plasmid ratio of the three expression vectors was 1:1:1.
- Transfected cells were cultivated for 7 days before supernatants were harvested for purification.
- the bispecific FolR1/CD3-kappa-lambda antibodies were produced and purified as follows.
- HEK293 EBNA cells were cultivated in suspension serum free in CD CHO culture medium. For the production in 500 ml shake flask 400 million HEK293 EBNA cells were seeded 24 hours before transfection (for alternative scales all amounts were adjusted accordingly). For transfection cells were centrifuged for 5 min by 210 ⁇ g, supernatant is replaced by pre-warmed 20 ml CD CHO medium. Expression vectors were mixed in 20 ml CD CHO medium to a final amount of 200 ⁇ g DNA.
- PEI solution After addition of 540 ⁇ l PEI solution is vortexed for 15 s and subsequently incubated for 10 min at room temperature. Afterwards cells were mixed with the DNA/PEI solution, transferred to a 500 ml shake flask and incubated for 3 hours by 37° C. in an incubator with a 5% CO2 atmosphere. After incubation time 160 ml F17 medium was added and cell were cultivated for 24 hours. One day after transfection 1 mM valporic acid and 7% Feed 1 was added.
- the kappa-lambda bispecific antibody was purified in three steps, using an affinity step specific for kappa light chains, followed by an affinity step specific for lambda light chains and finally by a size exclusion chromatography step for removal of aggregates.
- the protein was eluted using a pH gradient to buffer B (50 mM Tris, 100 mM glycine, 150 mM NaCl, pH 2.0) over 25 cv.
- buffer B 50 mM Tris, 100 mM glycine, 150 mM NaCl, pH 2.0
- Fractions containing the protein of interest were pooled and the pH of the solution was adjusted to pH 8.0 (using 2 M Tris pH 8.0).
- the protein was eluted using a pH gradient to buffer B (50 mM Tris, 100 mM glycine, 150 mM NaCl, pH 2.0) over 25 cv.
- buffer B 50 mM Tris, 100 mM glycine, 150 mM NaCl, pH 2.0
- Fractions containing the protein of interest were pooled and the pH of the solution was adjusted to pH 8.0 (using 2 M Tris pH 8.0).
- This solution was concentrated using ultra-concentrators (Vivaspin 15R 30.000 MWCO HY, Sartorius) and subsequently applied to a SuperdexTM 200 10/300 GL (GE Healthcare) equilibrated with 20 mM Histidine, pH 6.0, 140 mM NaCl, 0.01% Tween-20.
- the pooled fractions after size exclusion were again concentrated using ultra-concentrators (Vivaspin 15R 30.000 MWCO HY, Sartorius).
- the protein concentration was determined by measuring the optical density (OD) at 280 nm, using the molar extinction coefficient calculated on the basis of the amino acid sequence. Purity and molecular weight of the constructs were analyzed by SDS capillary electrophoresis in the presence and absence of a reducing agent following the manufacturer instructions (instrument Caliper LabChipGX, Perkin Elmer). Only small amounts of protein could be purified with a final yield of 0.17 mg/L.
- T cell mediated killing of SKOV3 cells was determined after 24 h and 48 h by LDH release. After 48 h the T cells were harvested and CD69 and CD25 upregulation on CD4 T cells and CD8 T cells was measured by flow cytometry.
- the kappa lambda FolR1 construct induces killing of SKOV3 cells in a concentration dependent manner which is accompanied by CD69 and CD25 upregulation both on CD4 T cells and on CD8 T cells.
- SKOV3 cells were incubated with PBMCs in the presence of either kappa lambda FoLR1 TCB or DP47 TCB. After 24 h and 48 h killing of tumor cells was determined by measuring LDH release ( FIG. 21 ). SKOV3 cells were incubated with PBMCs in the presence of either kappa lambda FoLR1 TCB or DP47 TCB. After 48 h CD25 and CD69 upregulation on CD4 T cells and CD8 T cells was measured by flow cytometry ( FIG. 22 ).
- Binding of anti-FolR1 16D5 in different monovalent or bivalent T-cell bispecific formats and of anti-FolR1 36F2 as IgG or as T-cell bispecific to recombinant human, cynomolgus and murine folate receptor 1 (all as Fc fusions) was assessed by surface plasmon resonance (SPR). All SPR experiments were performed on a Biacore T200 at 25° C. with HBS-EP as running buffer (0.01 M HEPES pH 7.4, 0.15 M NaCl, 3 mM EDTA, 0.005% Surfactant P20, Biacore, GE Healthcare).
- Recombinant biotinylated monomeric Fc fusions of human, cynomolgus and murine Folate Receptor 1 (FolR1-Fc) were directly coupled on a SA chip using the standard coupling instruction (Biacore, GE Healthcare).
- the immobilization level was about 300-400 RU.
- the anti-FolR1 IgGs or T cell bispecifics were passed at a concentration range from 3.7 to 900 nM with a flow of 30 ⁇ L/minutes through the flow cells over 180 seconds. The dissociation was monitored for 240 or 600 seconds.
- the chip surface was regenerated after every cycle using a double injection of 30 sec 10 mM Glycine-HCl pH 2.
- the chip surface was regenerated after every cycle using a double injection of 60 sec 10 mM Glycine-HCl pH 1.5. Bulk refractive index differences were corrected for by subtracting the response obtained on the reference flow cell 1.
- the affinity constants for the interactions were derived from the rate constants by fitting to a 1:1 Langmuir binding using the Bia Evaluation software (GE Healthcare).
- the affinity (monovalent binding) to human and cyno FolR1-Fc of 36F2 TCB is similar and around 1000 nM for both, whereas the affinity to murine FolR1-Fc is slightly better and around 300 nM.
- the 36F2 can be used in murine and primate models, there is no need for a surrogate.
- the avidity (apparent KD) of 36F2 TCB to human FolR1 is around 30 times lower than the affinity of the 16D5 TCB to human FolR1.
- 36F2 TCB is in the low nanomolar range, whereas 16D5 TCB is in the low picomolar range (1000 fold difference).
- FolR1 is expressed on tumor cells overexpressed, at intermittent and high levels, on the surface of cancer cells in a spectrum of epithelial malignancies, including ovarian, breast, renal, colorectal, lung and other solid cancers and is also expressed on the apical surface of a limited subset of polarized epithelial cells in normal tissue.
- These non-tumorous, normal cells express FolR1 only at low levels, and include, e.g., bronchiolal epithelial cells on alveolar surface, renal cortical luminal border of tubular cells, retinal pigment epithelium (basolateral membrane) and choroid plexus.
- 16D5 TCB binds to normal tissues cells expressing low amounts of FolR1 which results in their T cell mediated killing. This might, at least in part, account for limited tolerance observed at 10 ⁇ g/kg in cynomolgus monkeys.
- the inventors wanted to determine if lowering the affinity of the T cell bispecific molecule could increase the differentiation between high and low target density tissues and, thereby, lower toxicity by making use of bivalent binding and avidity.
- Low affinity binders are ordinarily not selected as suitable candidates for further analysis because low affinity is often associated with low potency and efficacy. Nevertheless, the low affinity FolR1 binder 36F2 was developed in several formats and characterized for its biological properties.
- the avidity effect (difference between monovalent and bivalent binding) is around 250 fold (1000 nM versus 4 nM).
- affinity defined the interaction and with 1000 nM led to a low potency of the TCB.
- molecule's avidity comes into play and with 4 nM led to a high activity of the TCB (see Example 32).
- the inventors generated monovalent formats of 16D5 and low affinity variant of 16D5 (affinity about 10-40 nM) in a bivalent format.
- the 16D5 binder used in a monovalent format (1+1) has an affinity of about 50 nM.
- the differentiation between high and low target density tissues can be better achieved by taking advantage of the avidity effect.
- PBMCs peripheral blood mononuclear cells
- Fresh blood was diluted with sterile PBS and layered over Histopaque gradient (Sigma, #H8889). After centrifugation (450 ⁇ g, 30 minutes, room temperature), the plasma above the PBMC-containing interphase was discarded and PBMCs transferred in a new falcon tube subsequently filled with 50 ml of PBS. The mixture was centrifuged (400 ⁇ g, 10 minutes, room temperature), the supernatant discarded and the PBMC pellet washed twice with sterile PBS (centrifugation steps 350 ⁇ g, 10 minutes).
- the resulting PBMC population was counted automatically (ViCell) and stored in RPMI1640 medium containing 10% FCS and 1% L-alanyl-L-glutamine (Biochrom, K0302) at 37° C., 5% CO2 in cell incubator until further use (no longer than 24 h).
- the antibody was added at the indicated concentrations (range of 0.005 pM-5 nM in triplicates).
- PBMCs were added to target cells at final E:T ratio of 10:1.
- DP47 TCB antibody was included as negative control. Human PBMCs were used as effectors and the killing was detected at 24 h of incubation with the bispecific antibody.
- PBMCs Peripheral blood mononuclear cells
- Histopaque density centrifugation of enriched lymphocyte preparations (buffy coats) obtained from healthy human donors. Fresh blood was diluted with sterile PBS and layered over Histopaque gradient (Sigma, #H8889). After centrifugation (450 ⁇ g, 30 minutes, room temperature), the plasma above the PBMC-containing interphase was discarded and PBMCs transferred in a new falcon tube subsequently filled with 50 ml of PBS.
- the mixture was centrifuged (400 ⁇ g, 10 minutes, room temperature), the supernatant discarded and the PBMC pellet washed twice with sterile PBS (centrifugation steps 350 ⁇ g, 10 minutes).
- the resulting PBMC population was counted automatically (ViCell) and stored in RPMI1640 medium containing 10% FCS and 1% L-alanyl-L-glutamine (Biochrom, K0302) at 37° C., 5% CO2 in cell incubator until further use (no longer than 24 h).
- the antibody was added at the indicated concentrations (range of 0.01 pM-100 nM in triplicates).
- PBMCs were added to target cells at final E:T ratio of 10:1.
- this data shows that using the 36F2 FolR1 binder in the bivalent 2+1 TCB format widens the therapeutic window compared to the 16D5 FOLR1 TCB ( FIG. 24A-C ).
- the 36F2 FOLR1 TCB differentiates between high and low expressing cells which is of special importance to reduce toxicity as the cells of some normal, non-tumorous tissues express very low levels of FolR1 (approximately less than 1000 copies per cell). Consistent with this observation, the results discussed in Example 35 below show that 36F2 TCB does not induce T-cell killing of primary cells ( FIGS. 26A-D ) whereas for 16D5 TCB some killing can be observed on HRCEpiC and HRPEpiC cells after 48 h of incubation ( FIGS. 26B and C).
- 36F2 TCB This important characteristic of 36F2 TCB allows for dosing for the treatment of FolR1-positive tumors so that it mediates potent killing of tumor tissues with high or medium FOLR1 expression, but not of normal tissues with low (partially polarized) expression. Notably, this characteristic appears to be mediated by the avidity of 36F2 TCB in the bivalent 2+1 inverted format, as it was not observed when using the 1+1 monovalent formats carrying the same low affinity 36F2 binder.
- 36F2 TCB in the bivalent 2+1 format comprises FolR1 binding moieties of relatively low affinity but it possesses an avidity effect which allows for differentiation between high and low FolR1 expressing cells. Because tumor cells express FolR1 at high or intermediate levels, this TCB selectively binds to tumor cells and not normal, non-cancerous cells that express FolR1 at low levels or not at all.
- the 36F2 TCB in the bivalent 2+1 inverted format also has the advantage that it does not require chemical cross linking or other hybrid approach. This makes it suitable for manufacture of a medicament to treat patients, for example patients having FolR1-positive cancerous tumors.
- the 36F2 TCB in the bivalent 2+1 inverted format can be produced using standard CHO processes with low aggregates.
- the 36F2 TCB in the bivalent 2+1 comprises human and humanized sequences making it superior to molecules that employ rat and murine polypeptides that are highly immunogenic when administered to humans.
- the 36F2 TCB in the bivalent 2+1 format was engineered to abolish FcgR binding and, as such, does not cause FcgR crosslinking and infusion reactions, further enhancing its safety when administered to patients.
- a further advantage of the 36F2 TCB in the bivalent 2+1 format and other embodiments disclosed herein is that their clinical development does not require the use of surrogate molecules as they bind to human, cynomous and murine FolR1. As such, the molecules disclosed herein recognize a different epitope than antibodies to FolR1 previously described that do not recognize FolR1 from all three species.
- Table 29 shows a comparison of EC50 values of 16D5 TCB and 36F2 TCB on the different cell lines tested. Out of the obtained EC50 values the delta (EC50 of 16D5 TCB minus EC50 of 36F2 TCB) and the x-fold difference (EC50 of 16D5 TCB divided by the EC50 of 36F2 TCB) was calculated.
- Tables 30 and 31 show the comparisons of the EC50 values of 16D5 TCB vs 16D5 TCB HT (Table 30) and 16D5 TCB vs 16D5 TCB 1+1 (Table 31) as well as the corresponding deltas (EC50 of 16D5 TCB minus EC50 of 16D5 TCB HT/1+1) and the x-fold differences (EC50 of 16D5 TCB divided by the EC50 of 16D5 TCB HT/1+1).
- Activation of CD8 + and CD4 ⁇ T cells after T-cell killing of FolR1-expressing Hela, SKov-3 and HT-29 tumor cells mediated by 36F2 TCB and 16D5 TCB was assessed by FACS analysis using antibodies recognizing the T cell activation markers CD25 (late activation marker) and CD69 (early activation marker).
- DP47 TCB was included as non-binding control.
- the antibody and the killing assay conditions were essentially as described above (Example 32) using the same antibody concentration range (0.01 pM-100 nM in triplicates), E:T ratio 10:1 and an incubation time of 48 h.
- PBMCs were transferred to a round-bottom 96-well plate, centrifuged at 400 ⁇ g for 4 min and washed twice with PBS containing 0.1% BSA.
- Cells were washed twice with 150 ⁇ l/well PBS containing 0.1% BSA. After centrifugation, the samples were resuspended in 200 ⁇ l/well PBS 0.1% for the FACS measurement. Samples were analyzed at BD FACS Canto II.
- 36F2 TCB induced a target-specific up-regulation of activation markers (CD25, CD69) on CD8+ and CD4+ T cells after killing of Hela ( FIG. 25A ) and SKov-3 ( FIG. 25B ) cells.
- activation markers CD25, CD69
- FIG. 25A a target-specific up-regulation of activation markers
- FIG. 25B a target-specific up-regulation of activation markers
- T-cell killing mediated by 36F2 TCB and 16D5 TCB was assessed on primary cells (Human Renal Cortical Epithelial Cells (HRCEpiC) (ScienCell Research Laboratories; Cat No 4110) and Human Retinal Pigment Epithelial Cells (HRPEpiC) (ScienCell Research Laboratories; Cat No 6540)).
- HRCEpiC Human Renal Cortical Epithelial Cells
- HRPEpiC Human Retinal Pigment Epithelial Cells
- HT-29 cells low FolR1
- DP47 TCB served as non-binding control.
- Human PBMCs were used as effectors and the killing was detected at 24 h and 48 h of incubation with the bispecific antibodies.
- PBMCs Peripheral blood mononuclear cells
- Histopaque density centrifugation of enriched lymphocyte preparations (buffy coats) obtained from healthy human donors. Fresh blood was diluted with sterile PBS and layered over Histopaque gradient (Sigma, #H8889). After centrifugation (450 ⁇ g, 30 minutes, room temperature), the plasma above the PBMC-containing interphase was discarded and PBMCs transferred in a new falcon tube subsequently filled with 50 ml of PBS.
- the mixture was centrifuged (400 ⁇ g, 10 minutes, room temperature), the supernatant discarded and the PBMC pellet washed twice with sterile PBS (centrifugation steps 350 ⁇ g, 10 minutes).
- the resulting PBMC population was counted automatically (ViCell) and stored in RPMI1640 medium containing 10% FCS and 1% L-alanyl-L-glutamine (Biochrom, K0302) at 37° C., 5% CO2 in cell incubator until further use (no longer than 24 h).
- the antibody was added at the indicated concentrations (range of 0.01 pM-10 nM in triplicates).
- PBMCs were added to target cells at final E:T ratio of 10:1.
- the “untargeted TCB” was used as a control in the above experiments.
- the bispecific antibody engages CD3e but does not bind to any other antigen and therefore cannot crosslink T cells to any target cells (and subsequently cannot induce any killing). It was therefore used as negative control in the assays to monitor any unspecific T cell activation.
- This untargeted TCB was prepared as described in WO2014/131712. In brief, the variable region of heavy and light chain DNA sequences have been subcloned in frame with either the constant heavy chain or the constant light chain pre-inserted into the respective recipient mammalian expression vector. The antibody expression was driven by an MPSV promoter and carries a synthetic polyA signal sequence at the 3′ end of the CDS. In addition each vector contains an EBV OriP sequence.
- the molecule was produced by co-transfecting HEK293-EBNA cells with the mammalian expression vectors using polyethylenimine. The cells were transfected with the corresponding expression vectors in a 1:2:1:1 ratio (“vector heavy chain Fc(hole)”: “vector light chain”: “vector light chain Crossfab”: “vector heavy chain Fc(knob)-FabCrossfab”).
- HEK293 EBNA cells were cultivated in suspension serum free in CD CHO culture medium. For the production in 500 ml shake flask 400 million HEK293 EBNA cells were seeded 24 hours before transfection. For transfection cells were centrifuged for 5 min by 210 ⁇ g, supernatant is replaced by pre-warmed 20 ml CD CHO medium. Expression vectors were mixed in 20 ml CD CHO medium to a final amount of 200 g DNA. After addition of 540 ⁇ l PEI solution was vortexed for 15 s and subsequently incubated for 10 min at room temperature.
- cells were mixed with the DNA/PEI solution, transferred to a 500 ml shake flask and incubated for 3 hours by 37° C. in an incubator with a 5% CO2 atmosphere. After incubation time 160 ml F17 medium was added and cell were cultivated for 24 hours. One day after transfection 1 mM valporic acid and 7% Feed lwas added. After 7 days cultivation supernatant was collected for purification by centrifugation for 15 min at 210 ⁇ g, the solution was sterile filtered (0.22 ⁇ m filter) and sodium azide in a final concentration of 0.01% w/v was added, and kept at 4° C.
- the secreted protein was purified from cell culture supernatants by affinity chromatography using ProteinA.
- Target protein was eluted during a gradient over 20 column volume from 20 mM sodium citrate, 0.5 M sodium chloride, pH 7.5 to 20 mM sodium citrate, 0.5 M sodium chloride, pH 2.5.
- Protein solution was neutralized by adding 1/10 of 0.5 M sodium phosphate, pH 8.
- Target protein was concentrated and filtrated prior loading on a HiLoad Superdex 200 column (GE Healthcare) equilibrated with 20 mM Histidine, 140 mM sodium chloride solution of pH 6.0.
- the protein concentration of purified protein samples was determined by measuring the optical density (OD) at 280 nm, using the molar extinction coefficient calculated on the basis of the amino acid sequence.
- the aggregate content of antibody samples was analyzed using a TSKgel G3000 SW XL analytical size-exclusion column (Tosoh) in 25 mM K2HPO4, 125 mM NaCl, 200 mM L-Arginine Monohydrocloride, 0.02% (w/v) NaN3, pH 6.7 running buffer at 25° C.
- the binding of 16D5 TCB and the corresponding CD3 deamidation variants 16D5 TCB N100A and 16D5 TCB S100aA and 9D11 TCB and the deamidation variants 9D11 TCB N100A and 9D11 TCB S100aA to human CD3 was assessed on a CD3-expressing immortalized T lymphocyte line (Jurkat). Briefly, cells were harvested, counted, checked for viability and resuspended at 2 ⁇ 10 6 cells/ml in FACS buffer (100 ⁇ l PBS 0.1% BSA). 100 ⁇ l of cell suspension (containing 0.2 ⁇ 10 6 cells) was incubated in round-bottom 96-well plates for 30 min at 4° C.
- results show reduced binding of the deamidation variants N100A and S100aA to CD3 compared to the parental antibodies 16D5 TCB ( FIG. 28A ) and 9D11 TCB ( FIG. 28B ).
- T-cell killing mediated by 16D5 TCB and the corresponding CD3 deamidation variants 16D5 TCB N100A and 16D5 TCB S100aA and 9D11 TCB and the deamidation variants 9D11 TCB N100A and 9D11 TCB S100aA was assessed on SKov-3 (medium FolR1) and HT-29 (low FolR1) cells.
- Human PBMCs were used as effectors and the killing was detected at 24 h of incubation with the bispecific antibodies. Briefly, target cells were harvested with Trypsin/EDTA, washed, and plated at a density of 25 000 cells/well using flat-bottom 96-well plates. Cells were left to adhere overnight.
- PBMCs Peripheral blood mononuclear cells
- enriched lymphocyte preparations obtained from healthy human donors.
- Fresh blood was diluted with sterile PBS and layered over Histopaque gradient (Sigma, #H8889). After centrifugation (450 ⁇ g, 30 minutes, room temperature), the plasma above the PBMC-containing interphase was discarded and PBMCs transferred in a new falcon tube subsequently filled with 50 ml of PBS. The mixture was centrifuged (400 ⁇ g, 10 minutes, room temperature), the supernatant discarded and the PBMC pellet washed twice with sterile PBS (centrifugation steps 350 ⁇ g, 10 minutes).
- the resulting PBMC population was counted automatically (ViCell) and stored in RPMI1640 medium containing 10% FCS and 1% L-alanyl-L-glutamine (Biochrom, K0302) at 37° C., 5% CO2 in cell incubator until further use (no longer than 24 h).
- the antibody was added at the indicated concentrations (range of 0.01 pM-10 nM in triplicates). PBMCs were added to target cells at final E:T ratio of 10:1.
- Desired gene segments were synthesized at Geneart AG (Regensburg, Germany) from synthetic oligonucleotides and PCR products by automated gene synthesis.
- a 500 ml culture was inoculated with the bacterial strain BL21 D3, transformed with the corresponding plasmid and a plasmid expressing BirA, and induced with 1 mM IPTG at an OD 600 0.8. Afterwards, the cultures were incubated at 25° C. overnight and harvested by centrifugation. The bacterial pellet was resuspended with 25 ml BugBuster® Protein Extraction Reagent (Millipore) and incubated for 20 min at room temperature as described in the protocol. After centrifugation for 20 min at 16000 ⁇ g, the supernatant was filtered and loaded on an IMAC column (His gravitrap, GE Healthcare).
- the column was washed with 40 ml washing buffer (500 mM NaCl, 20 mM Imidazole, 20 mM NaH 2 PO 4 pH 7.4). After the elution from the column (500 mM NaCl, 500 mM Imidazole, 20 mM NaH 2 PO 4 pH 7.4), the eluate was re-buffered using PD10 columns (GE Healthcare).
- clone 58D6 and 110A5 originate from a library that was randomized only in CDR3, while clone 106D2 was identified from a library randomized in all 3 CDRs. Positions in CDR1 and 2 that deviate from the germline sequence are printed italic. All VH variants were expressed in combination with the same common light chain (common light chain VL).
- Fabs from bacterial cultures protein sequence of variable heavy chains domains for 58D6 VH, 106D2 VH, 110A5 VH, all clones expressed the same CLC variable domain listed as SEQ ID NO: 31
- a 500 ml culture was inoculated with bacteria harboring the corresponding phagemid and induced with 1 mM IPTG at an OD 600 0.9. Afterwards, the cultures were incubated at 25° C. overnight and harvested by centrifugation.
- K D Affinity (K D ) of selected Fab clones was measured by surface plasmon resonance using a ProteOn XPR36 instrument (Biorad) at 25° C. with biotinylated MUC1 antigen immobilized on NLC chips by neutravidin capture.
- Injection of analytes For one-shot kinetics measurements, injection direction was changed to horizontal orientation, two-fold dilution series of purified Fab (varying concentration ranges between 100 and 6.25 nM) were injected simultaneously at 50 ⁇ l/min along separate channels 1-5, with association times of 250 or 300 s, and dissociation times of 300 s. Buffer (PBST) was injected along the sixth channel to provide an “in-line” blank for referencing. Association rate constants (k on ) and dissociation rate constants (k off ) were calculated using a simple one-to-one Langmuir binding model in ProteOn Manager v3.1 software by simultaneously fitting the association and dissociation sensorgrams.
- PBST Buffer
- the equilibrium dissociation constant (K D ) was calculated as the ratio k off /k on . Regeneration was performed in horizontal orientation using 10 mM Glycine, pH 1.5 at a flow rate of 100 ul/min for a contact time of 30 s. 3 clones bound specifically to MUC1 ( FIG. 32A ), but not to the “in-line” blank demonstrating the specificity of these binders. The kinetic and thermodynamic data of all measurements are summarized in FIG. 32B .
- each vector contains an EBV oriP sequence for autonomous replication in EBV-EBNA expressing cell lines.
- Binding of the produced MUC1-specific TCBs was measured by surface plasmon resonance using a ProteOn XPR36 instrument (Biorad) at 25° C. Biotinylated MUC1 antigen and an unrelated biotinylated antigen were immobilized on NLC chips by neutravidin capture. Immobilization of the antigens was performed as described before. For one-shot kinetics measurements, injection direction was changed to horizontal orientation, two-fold dilution series of the purified constructs (varying concentration ranges between 30 and 1.88 nM or between 100 and 6.25 nM) were injected simultaneously at 50 ⁇ l/min along separate channels 1-5, with association times of 120 s, and dissociation times of up to 600 s. Buffer (PBST) was injected along the sixth channel to provide an “in-line” blank for referencing.
- PBST Buffer
- Regeneration was performed in horizontal orientation using 10 mM Glycine, pH 1.5 at a flow rate of 100 ul/min for a contact time of 30 s. 3 clones specifically bound to MUC1 ( FIG. 35 ), but not to the “in-line” blank demonstrating the specificity of these binders. Due to the avidity effect of the bivalent TCB format, very strong binding to MUC1 was observed. In contrast, no binding to the unrelated antigen was detected indicating the specific binding of the TCB constructs.
- the extracellular domains of human, cynomolgus and murine BCMA that were used as antigens for phage display selections were transiently expressed as N-terminal monomeric Fc-fusion in HEK EBNA cells and in vivo site-specifically biotinylated via co-expression of BirA biotin ligase at the avi-tag recognition sequence located at the C-terminus of the Fc portion carrying the receptor chain (Fc knob chain).
- the extracellular domains of human, cynomolgus and murine BCMA comprised methionine 4 to asparagine 53, methionine 4 to asparagine 52, and alanine 2 to threonine 49, respectively. These were N-terminally fused to the hinge of a human IgG1 enabling heterodimerization with an unfused human IgG1 Fc portion (hole chain) by knobs-into-holes technology.
- BCMA expression was assessed on four human myeloma cell lines (NCI-H929, RPMI-8226, U266B1 and L-363) by flow cytometry.
- NCI-H929 cells (H929) ATCC® CRL-9068TM) were cultured in 80-90% RPMI 1640 with 10-20% heat-inactivated FCS and could contain 2 mM L-glutamine, 1 mM sodium pyruvate and 50 ⁇ M mercaptoethanol.
- RPMI-8226 cells ((RPMI) ATCC® CCL-155TM) were cultured in a media containing 90% RPMI 1640 and 10% heat-inactivated FCS.
- U266B1 (U266) ATCC® TIB-196TM) cells were cultured in RPMI-1640 medium modified to contain 2 mM L-glutamine, 10 mM HEPES, 1 mM sodium pyruvate, 4500 mg/L glucose, and 1500 mg/L sodium bicarbonate and 15% heat-inactivated FCS.
- L-363 cell line (Leibniz Institute DSMZ—German collection of microorganisms and cell cultures; DSMZ No. ACC 49) was cultured in 85% RPMI 1640 and 15% heat-inactivated FCS.
- cells were harvested, washed, counted for viability, resuspended at 50,000 cells/well of a 96-well round bottom plate and incubated with anti-human BCMA antibody (Abcam, #ab54834, mouse IgG1) at 10 ⁇ g/ml for 30 min at 4° C. (to prevent internalization).
- a mouse IgG1 was used as isotype control (BD Biosciences, #554121). Cells were then centrifuged (5 min at 350 ⁇ g), washed twice and incubated with the FITC-conjugated anti mouse secondary antibody for 30 min at 4° C.
- H929 cells expressed human BCMA with the highest density, up to 3.8 to 27-fold higher than other myeloma cell lines.
- H929 is considered as a BCMA hi -expressing myeloma cell line as compared to U266 which is BCMA med/lo -expressing myeloma cells and RPMI-8226 and L363 which are BCMA lo -expressing myeloma cells.
- Table 36 summarizes the relative BCMA receptor number on the cell surface of human multiple myeloma cell lines.
- Antibody libraries in the Fab-format are constructed on the basis of the humanized anti-CD3 antibody light chain were generated. Diversity was only introduced in the heavy chain. Six different heavy chain frameworks were used: VH1-46, VH1-69, VH3-15, VH3-23, VH4-59 and VH5-1. CDRs 1, 2 and 3 were randomized and each heavy chain library was combined with the non-randomized light chain. Libraries were generated as described by Nissim et al EMBO J. 1994 Feb. 1; 13(3):692-8, and Silacci et al. Proteomics. 2005 June; 5(9):2340-50.
- Anti-BCMA Fabs were established by phage display from synthetic Fab libraries consisting one constant VL and six different human VH sequences
- Selection rounds were performed in solution according to the following pattern: 1) pre-clearing of ⁇ 10 12 phagemid particles per library pool in immunotubes coated with 10 ug/ml of an unrelated human IgG to deplete the libraries of antibodies recognizing the Fc-portion of the antigens; 2) incubation of the non-Fc-binding phagemid particles with 100 nM biotinylated BCMA for 0.5 h in the presence of 100 nM unrelated non-biotinylated Fc knobs-into-holes construct for further depletion of Fc-binders in a total volume of 2 ml; 3) capture of biotinylated BCMA and specifically binding phage by splitting up and transferring the panning reaction into 16 wells on a neutravidin or streptavidin pre-coated microtiter plate for 20 min on a shaker; 4) washing of respective wells 10-30 ⁇ with PBS/Tween20 and 10-30 ⁇ with PBS using a plate
- streptavidin plate-based capture capture of antigen: phage complexes was performed by addition of 5.4 ⁇ 10 7 streptavidin-coated magnetic beads to the panning reaction followed by washing steps using respective magnets under the conditions described above.
- binders were identified by surface plasmon resonance-screening of Fab-containing bacterial culture supernatants using BioRad's ProteOn XPR36 biosensor.
- BioRad's ProteOn XPR36 biosensor After infection of log-phase E. coli TG1 cells with the eluted phage particles, single colony forming units (cfu) were plated and picked for inoculation of 1 ml expression cultures in 96-deep well plates.
- Fabs were captured from the supernatants on a ProteOn GLM chip that was derivatized with 8.000-10.000 RU of a goat anti-human IgG, F(ab′)2 fragment specific polyclonal antibody (Jackson ImmunoResearch, #109-005-006) in vertical orientation.
- Biotinylated recombinant human, cynomolgus and murine BCMA Fc(kih) were directly coupled on a SA chip following instructions (Biacore, Freiburg/Germany).
- the immobilization level ranged from 80 to 120 RU.
- the anti-BCMA antibodies were passed at a 4-fold concentration range (1.95 to 500 nM) with a flow of 30 ⁇ L/minutes through the flow cells over 120 seconds. The dissociation was monitored for 180 seconds. Bulk refractive index differences were corrected for by subtracting the response obtained on the reference flow cell.
- the anti-BCMA antibodies were flown over an empty surface previously activated and deactivated as described in the standard amine coupling kit.
- the affinity of the interaction between anti-BCMA antibodies or BCMA-TCB CLC antibodies and recombinant human BCMA Fc(kih) was also determined.
- Anti-human Fab antibody (GE Healthcare) was directly coupled on a CM5 chip at pH 5.0 using the standard amine coupling kit (Biacore, Freiburg/Germany). The immobilization level was about 6500 RU.
- Anti-BCMA antibody or BCMA-TCB CLC antibody was captured for 90 seconds at 25 nM.
- Recombinant human BCMA Fc(kih) was passed at a 4-fold concentration range (1.95 to 500 nM) with a flow of 30 ⁇ L/minutes through the flow cells over 120 or 180 seconds. The dissociation was monitored for 120 or 400 seconds.
- 83A10-CLC bivalent BCMA antibody was generated by substituting the native light chain of the bivalent BCMA antibody 83A10, previously described in WO/2014/122143, with the common light chain (CD3 LC (CLC)).
- the anti-BCMA antibody comprising two heavy chains of 83A10 and two common light chains were produced using the general techniques for generation of bivalent IgG antibodies as described in the Material and general methods section.
- Affinity of 83A10-CLC IgG antibody to human BCMA was measured by SPR with methods similar to the ones described in Example 41.
- Table 42 depicts the binding of recombinant human BCMA Fc(kih) to 83A10-CLC BCMA IgG antibody.
- SPR surface plasmon resonance
- Fc fused huBCMA, huBAFF-R and huTACI-R were chemically immobilized with a high immobilization level ( ⁇ 5000 RU) on different flow channels of a Biacore CM5 sensor chip at pH 5.0 using the standard amine coupling kit (GE Healthcare).
- a high immobilization level ⁇ 5000 RU
- Initially high concentrated solutions (3 ⁇ M, dissolved in HBS-EP) of anti-BCMA IgG pSCHLI372 as well as a-huTACI-R IgG or a-huBAFF-R IgG as positive controls were injected (association time: 80 s, dissociation time: 600 s, flow: 30 ⁇ l/min) to check if binding occurs.
- anti-BCMA IgG antibodies binding with fast kinetic rate constants to huBAFF-R and/or huTACI-R a careful examination of kinetic parameter with low immobilization levels (300 RU) was performed on a new CM5 sensor chip.
- Anti-BCMA IgG antibody dilutions at concentrations of 3000-93.75 nM (2-fold dilution in HBS-EP) are injected (association time: 80 s, dissociation time: 300 s, flow: 30 ⁇ l/min), and sample(s) were tested in duplicate. Regeneration was also performed when applicable i.e no fast and complete dissociation.
- Kinetic evaluation of the interaction between anti-BCMA IgG antibodies and huBAFF-R or huTACI-R was performed by global fitting of the data to a 1:1 interaction model that includes a term for mass transport (Biacore T200 evaluation Version 1.0). A steady state analysis was also performed. As depicted in FIG.
- curve 1 corresponds to the signal on reference channel
- curve 2 to the channel where the binding occurs (binding channel)
- the curve 2 ⁇ 1 is the subtracted signal (binding channel—reference channel), meaning that this is the signal due to the binding event.
- the SPR binding assay clearly demonstrated that pSCHLI372 IgG did not bind to human TACI receptor.
- another BCMA IgG known to slightly bind to TACI receptor but with very fast on- and off-rate was used (data not shown).
- bispecific antibodies were expressed by transient polymer-based cotransfection of the respective mammalian expression vectors in HEK293-EBNA cells, which were cultivated in suspension.
- HEK293-EBNA cells were seeded at 1.5 Mio viable cells/mL in Ex-Cell medium, supplemented with 6 mM of L-Glutamine.
- HEK293-EBNA cells were seeded at 1.5 Mio viable cells/mL in Ex-Cell medium, supplemented with 6 mM of L-Glutamine.
- 2.0 Mio viable cells were centrifuged (5 minutes at 210 ⁇ g). The supernatant was aspirated and the cells resuspended in 100 ⁇ L of CD CHO medium.
- the supernatant was loaded on a protein A column (HiTrap Protein A FF, 5 mL, GE Healthcare) equilibrated with 6 CV 20 mM sodium phosphate, 20 mM sodium citrate, pH 7.5. After a washing step with the same buffer the antibody was eluted from the column by step elution with 20 mM sodium phosphate, 100 mM sodium chloride, 100 mM Glycine, pH 3.0. The fractions with the desired antibody were immediately neutralized by 0.5 M Sodium Phosphate, pH 8.0 (1:10), pooled and concentrated by centrifugation. The concentrate was sterile filtered and processed further by size exclusion chromatography.
- the concentrated protein was injected in a XK16/60 HiLoad Superdex 200 column (GE Healthcare), and 20 mM Histidine, 140 mM Sodium Chloride, pH 6.0 with or without Tween20 as formulation buffer.
- the fractions containing the monomers were pooled, concentrated by centrifugation and sterile filtered into a sterile vial.
- FIG. 38A-C depicts the CE-SDS graphs (non-reduced (top panels) and reduced (bottom panels)) of the final protein preparations after Protein A (PA) affinity chromatography and size exclusion chromatographic (SEC) purification steps
- FIG. 38A pSCHLI333-TCB CLC
- FIG. 38B pSCHLI372-TCB CLC
- FIG. 38C pSCHLI373-TCB CLC.
- PA affinity chromatography and SEC purification steps applied to pSCHLI333-TCB CLC antibody resulted in a purity of 89.2% and 100% of monomer content ( FIG.
- FIG. 38A a purity of 88.5% and 100% of monomer content for pSCHLI372-TCB CLC antibody
- FIG. 38B a purity of 88.5% and 100% of monomer content for pSCHLI372-TCB CLC antibody
- FIG. 38C a purity of 91.8% and 100% of monomer content for pSCHLI372-TCB CLC antibody
- Table 43 summarizes the properties of pSCHLI333-TCB CLC, pSCHLI372-TCB CLC, and pSCHLI373-TCB CLC antibodies following PA affinity chromatography and SEC purification steps. In all BCMA-TCB CLC antibodies, >88% purity and 100% monomer content were consistently reached.
- BCMA-TCB CLC antibodies (pSCHLI333, pSCHLI372, pSCHLI373) were analyzed by flow cytometry for binding to human BCMA on BCMA hi -expressing H929 cells.
- MKN45 human gastric adenocarcinoma cell line that does not express BCMA was used as negative control.
- Viable cells are then adjusted to 2 ⁇ 10 6 cells per ml in BSA-containing FACS Stain Buffer (BD Biosciences). 100 ⁇ l of this cell suspension were further aliquoted per well into a round-bottom 96-well plate and incubated with 30 ⁇ l of the BCMA-TCB CLC antibodies or corresponding TCB control for 30 min at 4° c. All BCMA-TCB CLC antibodies (and TCB controls) were titrated and analyzed in final concentration range between 0.12-500 nM.
- FIGS. 39A-B the mean fluorescence intensity of BCMA-TCB CLC antibodies were plotted in function of antibody concentrations;
- FIG. 39A pSCHLI372-TCB CLC and pSCHLI373-TCB CLC on H929 cells;
- FIG. 39B pSCHLI372-TCB CLC and pSCHLI373-TCB CLC on MKN45 cells.
- BCMA-TCB CLC antibodies (pSCHLI333, pSCHLI372, pSCHLI373) antibodies did not bind to BCMA-negative and CD3-negative MKN45 cells at concentrations below 100 nM.
- EC50 were calculated using Prism GraphPad (LaJolla, Calif., USA) and EC50 values denoting the antibody concentration required to reach 50% of the maximal binding for the binding of anti-BCMA/anti-CD3 TCB antibodies to H929 cells are summarized in Table 44.
- BCMA-TCB CLC antibodies (pSCHLI333, pSCHLI372, pSCHLI373) were also analyzed by flow cytometry for their binding properties to human CD3 expressed on human leukemic T cells Jurkat (ATCC TIB-152).
- Jurkat T cells were cultured in RPMI supplemented with 10% heat-inactivated FCS. Briefly, cultured cells were harvested, counted and cell viability was evaluated using ViCell. Viable cells were then adjusted to 2 ⁇ 10 6 cells per ml in FACS Stain Buffer (BD Biosciences) containing 0.1% BSA. 100 ⁇ l of this cell suspension were further aliquoted per well into a round-bottom 96-well plate.
- BCMA-TCB CLC antibodies or corresponding TCB control were added to the cell-containing wells to obtain final concentrations of 0.12 nM to 500 nM.
- BCMA-TCB CLC antibodies and control IgG were used at the same molarity. After incubation for 30 min at 4° C., cells were centrifuged (5 min, 350 ⁇ g), washed twice with 150 ⁇ l/well BSA-containing FACS Stain Buffer (BD Biosciences), then cells were fixed using 100 ul BD Fixation buffer per well (#BD Biosciences, 554655) at 4° C. for 20 min, resuspended in 120 ⁇ l FACS buffer and analyzed using BD FACS CantoII.
- FIGS. 40A-B show the median fluorescence intensity for BCMA-TCB CLC antibodies (pSCHLI333, pSCHLI372, pSCHLI373) binding to Jurkat T cells ( FIG. 40A ) or MKN45 cells ( FIG. 40B ) and plotted in function of antibody concentration. EC50 values and maximal binding of anti-BCMA/anti-CD3 TCB antibodies to CD3-positive Jurkat T cells were not reached.
- Isotype control antibody did not bind to Jurkat T cells and BCMA-TCB CLC antibodies (pSCHLI333, pSCHLI372, pSCHLI373) antibodies did not bind to BCMA-negative and CD3-negative MKN45 cells at concentrations below 100 nM.
- BCMA-TCB CLC antibodies (pSCHLI372, pSCHLI373) were analyzed by flow cytometry for their ability to induce T cell activation by evaluating the surface expression of the early activation marker CD69, or the late activation marker CD25 on CD4 + and CD8 + T cells in the presence or absence of human BCMA-expressing MM cells. Briefly, BCMA-positive H929 cells were harvested with Cell Dissociation buffer, counted and checked for viability. Cells were adjusted to 0.3 ⁇ 10 6 (viable) cells per ml in modified RPMI-1640 medium, 100 ⁇ l of this cell suspension were pipetted per well into a round-bottom 96-well plate (as indicated).
- BCMA-TCB CLC antibodies were able to activate T cells specifically in the presence of target cells expressing human BCMA, wells were included that contained 3 to 10 nM of the respective BCMA-TCB CLC antibodies molecules, as well as PBMCs, but no target cells. After 48 h incubation at 37° C., 5% CO 2 , cells were centrifuged (5 min, 350 ⁇ g) and washed twice with 150 ⁇ l/well PBS containing 0.1% BSA.
- CD4 mouse IgG1, K; clone RPA-T4
- CD8 mouse IgG1, K; clone HIT8a; BD #555635
- CD69 mouse IgG2; clone L78; BD #340560
- CD25 mouse IgG1, K; clone M-A251; BD #555434
- FIG. 41 depicts the expression level of the early activation marker CD69 and the late activation marker CD25 on CD4 + and CD8 + T cells after 48 hours of incubation (representative results from two independent experiments).
- pSCHLI372-TCB CLC and pSCHLI373-TCB CLC antibodies induced an up-regulation of CD69 and CD25 activation markers in a concentration-dependent and specific manner in the presence of BCMA-positive target cells.
- BCMA-TCB CLC antibodies (pSCHLI372, pSCHLI373) were also analyzed for their potential to induce T cell-mediated apoptosis in BCMA-high expressing MM cells upon crosslinking of the construct via binding of the antigen binding moieties to BCMA on cells.
- human BCMA-expressing H929 multiple myeloma target cells were harvested with Cell Dissociation Buffer, washed and resuspended in RPMI supplemented with 10% fetal bovine serum (Invitrogen).
- maximal lysis of the H929 MM target cells was determined by incubation of the target cells with a final concentration of 1% Triton X-100, inducing cell death.
- the percentage of LDH release was plotted against the concentrations of BCMA-TCB CLC antibodies in concentration-response curves.
- the EC50 values were measured using Prism software (GraphPad) and determined as the TCB antibody concentration that results in 50% of maximum LDH release.
- BCMA-TCB CLC antibodies, pSCHLI372-TCB CLC ( FIG. 42A , B) and pSCHLI373-TCB CLC ( FIG. 42B ) induced a concentration-dependent killing of BCMA-positive H929 myeloma cells as measured by LDH release.
- BCMA-TCB CLC antibodies (pSCHLI372, pSCHLI373) were analyzed for their ability to induce T cell-mediated apoptosis in BCMA med/lo -expressing MM cells upon crosslinking of the construct via binding of the antigen binding moieties to BCMA on cells.
- human BCMA med/lo -expressing U266 multiple myeloma target cells were harvested with Cell Dissociation Buffer, washed and resuspended in RPMI supplemented with 10% fetal bovine serum (Invitrogen).
- lysis of the MM target cells was determined by incubation of the target cells with a final concentration of 1% Triton X-100, inducing cell death.
- LDH release from the apoptotic/necrotic MM target cells into the supernatant was then measured with the LDH detection kit (Roche Applied Science), following the manufacturer's instructions. The percentage of LDH release was plotted against the concentrations of BCMA-TCB CLC antibodies in concentration-response curves.
- the EC50 values were measured using Prism software (GraphPad) and determined as the TCB antibody concentration that results in 50% of maximum LDH release.
- Table 46 summarizes the EC50 values for redirected T-cell killing of BCMA-positive U266 cells induced by BCMA-TCB CLC antibodies.
- CD3 binder common light chain Description Sequence Seq ID No common QAVVTQEPSLTVSPGGTVTLTC GSSTGAVTTSNYAN WVQEKP 31 CD3 light GQAFRGLIG GTNKRAP GTPARFSGSLLGGKAALTLSGAQPED chain (VL) EAEYYC ALWYSNLWV FGGGTKLTVL common GSSTGAVTTSNYAN 32 CD3 light chain_CDR1 common GTNKRAP 33 CD3 light chain_CDR2 common ALWYSNLWV 34 CD3 light chain_CDR3 common QAVVTQEPSLTVSPGGTVTLTC GSSTGAVTTSNYAN WVQEKP 35 CD3 light GQAFRGLIG GTNKRAP GTPARFSGSLLGGKAALTLSGAQPED chain EAEYYC ALWYSNLWV FGGGTKLTVLGQPKAAPSVTLFPPSSE (VLCL) ELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVET
- MUC1 binders useful in common light chain format variable heavy chain SEQ ID Amino Acid NOS Description Nucleotide Sequence MUC1 Antigens 57 and MUC1 SEA- ATGAGCTTTTTTTTCCTGAGCTTTCATATTAGC MSFFFLSFHISNLQ 58 avi-His AACCTGCAGTTTAATAGCAGCCTGGAAGATCCG FNSSLEDPSTDYYQ AGCACCGATTATTATCAAGAACTGCAGCGTGAT ELQRDISEMFLQIY ATCAGCGAAATGTTTCTGCAGATCTATAAACAG KQGGFLGLSNIKFR GGTGGTTTTCTGGGTCTGAGCAACATCAAATTT PGGGGGSVVVQLTL CGTCCGGGTGGTGGCGGTGGTTCAGTTGTTGTG AFREGTINVHDVET CAGCTGACCCTGGCATTTCGTGAAGGCACCATT QFNQYKTEAASRYN AATGTTCATGATGTGGAAACCCAGTTTAACCAG LT
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Cell Biology (AREA)
- Oncology (AREA)
- Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Virology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/541,258 US20200172633A1 (en) | 2014-11-20 | 2019-08-15 | Common light chains and methods of use |
| US17/470,778 US12103982B2 (en) | 2014-11-20 | 2021-09-09 | T cell activating bispecific antigen binding molecules |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP14194097 | 2014-11-20 | ||
| EP14194097.3 | 2014-11-20 | ||
| PCT/EP2015/076745 WO2016079081A1 (en) | 2014-11-20 | 2015-11-17 | Common light chains and methods of use |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2015/076745 Continuation WO2016079081A1 (en) | 2014-11-20 | 2015-11-17 | Common light chains and methods of use |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/541,258 Division US20200172633A1 (en) | 2014-11-20 | 2019-08-15 | Common light chains and methods of use |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20170253670A1 true US20170253670A1 (en) | 2017-09-07 |
Family
ID=51951675
Family Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/600,015 Abandoned US20170253670A1 (en) | 2014-11-20 | 2017-05-19 | Common light chains and methods of use |
| US16/541,258 Abandoned US20200172633A1 (en) | 2014-11-20 | 2019-08-15 | Common light chains and methods of use |
| US17/470,778 Active 2036-11-03 US12103982B2 (en) | 2014-11-20 | 2021-09-09 | T cell activating bispecific antigen binding molecules |
Family Applications After (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/541,258 Abandoned US20200172633A1 (en) | 2014-11-20 | 2019-08-15 | Common light chains and methods of use |
| US17/470,778 Active 2036-11-03 US12103982B2 (en) | 2014-11-20 | 2021-09-09 | T cell activating bispecific antigen binding molecules |
Country Status (19)
| Country | Link |
|---|---|
| US (3) | US20170253670A1 (https=) |
| EP (2) | EP3221357B1 (https=) |
| JP (2) | JP7164949B2 (https=) |
| KR (1) | KR20170087486A (https=) |
| CN (1) | CN107207609B (https=) |
| BR (1) | BR112017010513A2 (https=) |
| CA (1) | CA2968162A1 (https=) |
| DK (1) | DK3221357T3 (https=) |
| ES (1) | ES2808853T3 (https=) |
| HR (1) | HRP20201156T1 (https=) |
| HU (1) | HUE049650T2 (https=) |
| LT (1) | LT3221357T (https=) |
| MX (1) | MX381724B (https=) |
| PL (1) | PL3221357T3 (https=) |
| PT (1) | PT3221357T (https=) |
| RS (1) | RS60615B1 (https=) |
| RU (1) | RU2747011C2 (https=) |
| SI (1) | SI3221357T1 (https=) |
| WO (1) | WO2016079081A1 (https=) |
Cited By (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9914776B2 (en) | 2014-08-04 | 2018-03-13 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
| US10087250B2 (en) | 2012-10-08 | 2018-10-02 | Roche Glycart Ag | Fc-free antibodies comprising two fab-fragments and methods of use |
| US10138293B2 (en) | 2007-12-21 | 2018-11-27 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
| US10155815B2 (en) | 2013-02-26 | 2018-12-18 | Roche Glycart Ag | Bispecific T cell activating antigen binding molecules |
| US10323099B2 (en) * | 2013-10-11 | 2019-06-18 | Hoffmann-La Roche Inc. | Multispecific domain exchanged common variable light chain antibodies |
| US10596257B2 (en) | 2016-01-08 | 2020-03-24 | Hoffmann-La Roche Inc. | Methods of treating CEA-positive cancers using PD-1 axis binding antagonists and anti-CEA/anti-CD3 bispecific antibodies |
| US10611825B2 (en) | 2011-02-28 | 2020-04-07 | Hoffmann La-Roche Inc. | Monovalent antigen binding proteins |
| US10640555B2 (en) | 2009-06-16 | 2020-05-05 | Hoffmann-La Roche Inc. | Bispecific antigen binding proteins |
| WO2020132356A1 (en) * | 2018-12-19 | 2020-06-25 | Surrozen, Inc. | Antigen binding formats for receptor complexes |
| US10766967B2 (en) | 2015-10-02 | 2020-09-08 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
| US10781262B2 (en) | 2014-11-20 | 2020-09-22 | Hoffmann-La Roche Inc. | Combination therapy of T cell activating bispecific antigen binding molecules and PD-1 axis binding antagonists |
| US10793621B2 (en) | 2011-02-28 | 2020-10-06 | Hoffmann-La Roche Inc. | Nucleic acid encoding dual Fc antigen binding proteins |
| US10882918B2 (en) | 2016-09-30 | 2021-01-05 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
| US11013801B2 (en) | 2015-12-09 | 2021-05-25 | Hoffmann-La Roche Inc. | Treatment method |
| US11179473B2 (en) | 2020-02-21 | 2021-11-23 | Silverback Therapeutics, Inc. | Nectin-4 antibody conjugates and uses thereof |
| US11242390B2 (en) | 2016-03-22 | 2022-02-08 | Hoffmann-La Roche Inc. | Protease-activated T cell bispecific molecules |
| US11286300B2 (en) | 2015-10-01 | 2022-03-29 | Hoffmann-La Roche Inc. | Humanized anti-human CD19 antibodies and methods of use |
| US11384153B2 (en) | 2018-07-19 | 2022-07-12 | Regeneran Pharmaceuticals, Inc. | Bispecific anti-BCMA x anti-CD3 antibodies and uses thereof |
| US11459404B2 (en) | 2013-02-26 | 2022-10-04 | Roche Glycart Ag | Bispecific T cell activating antigen binding molecules |
| US11541126B1 (en) | 2020-07-01 | 2023-01-03 | Silverback Therapeutics, Inc. | Anti-ASGR1 antibody TLR8 agonist comprising conjugates and uses thereof |
| US11639397B2 (en) | 2011-08-23 | 2023-05-02 | Roche Glycart Ag | Bispecific antibodies specific for T-cell activating antigens and a tumor antigen and methods of use |
| US11746150B2 (en) | 2017-12-19 | 2023-09-05 | Surrozen Operating, Inc. | Anti-LRP5/6 antibodies and methods of use |
| US11773171B2 (en) | 2017-12-19 | 2023-10-03 | Surrozen Operating, Inc. | WNT surrogate molecules and uses thereof |
| US11780920B2 (en) | 2020-06-19 | 2023-10-10 | Hoffmann-La Roche Inc. | Antibodies binding to CD3 and CD19 |
| US11866498B2 (en) | 2018-02-08 | 2024-01-09 | Genentech, Inc. | Bispecific antigen-binding molecules and methods of use |
| US12006368B2 (en) | 2017-12-19 | 2024-06-11 | Surrozen Operating, Inc. | Anti-frizzled antibodies and methods of use |
| US12103982B2 (en) | 2014-11-20 | 2024-10-01 | Hoffmann-La Roche Inc. | T cell activating bispecific antigen binding molecules |
| US12139553B2 (en) | 2014-11-20 | 2024-11-12 | Hoffmann-La Roche Inc. | T cell activating bispecific antigen binding molecules |
| US12150959B2 (en) | 2018-07-19 | 2024-11-26 | Regeneron Pharmaceuticals, Inc. | Chimeric antigen receptors with BCMA specificity and uses thereof |
| US12195547B2 (en) | 2021-04-30 | 2025-01-14 | Hoffmann-La Roche Inc. | Dosing for combination treatment with anti-CD20/anti-CD3 bispecific antibody and anti-CD79B antibody drug conjugate |
Families Citing this family (54)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PL3298033T5 (pl) | 2015-05-18 | 2023-10-30 | TCR2 Therapeutics Inc. | Kompozycje i zastosowania medyczne do reprogramowania TCR z zastosowaniem białek fuzyjnych |
| US11421028B2 (en) | 2016-02-06 | 2022-08-23 | Epimab Biotherapeutics, Inc. | Fabs-in-tandem immunoglobulin and uses thereof |
| CN108778329B (zh) | 2016-02-17 | 2022-09-16 | 西雅图基因公司 | Bcma抗体和其用以治疗癌症和免疫病症的用途 |
| WO2017165464A1 (en) | 2016-03-21 | 2017-09-28 | Elstar Therapeutics, Inc. | Multispecific and multifunctional molecules and uses thereof |
| WO2017162587A1 (en) * | 2016-03-22 | 2017-09-28 | F. Hoffmann-La Roche Ag | Protease-activated t cell bispecific molecules |
| KR20250175345A (ko) * | 2016-06-21 | 2025-12-16 | 테네오바이오, 인코포레이티드 | Cd3 결합 항체 |
| CA3032498A1 (en) | 2016-08-02 | 2018-02-08 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| JP7033328B2 (ja) * | 2016-08-16 | 2022-03-10 | エピムアブ バイオセラピューティクス インコーポレイテッド | 一価の非対称タンデムFab二重特異性抗体 |
| PE20241349A1 (es) * | 2016-09-14 | 2024-07-03 | Teneobio Inc | Anticuerpos de union a cd3 |
| WO2018067993A1 (en) | 2016-10-07 | 2018-04-12 | TCR2 Therapeutics Inc. | Compositions and methods for t-cell receptors reprogramming using fusion proteins |
| JP7291396B2 (ja) | 2016-11-22 | 2023-06-15 | ティーシーアール2 セラピューティクス インク. | 融合タンパク質を用いたtcrの再プログラミングのための組成物及び方法 |
| IL317134A (en) | 2016-12-21 | 2025-01-01 | Teneobio Inc | An antibody containing only heavy chains that binds a human B-cell maturation antigen, a pharmaceutical composition containing the same, its use in the treatment of B-cell disorders and a method for its preparation |
| WO2018139623A1 (en) * | 2017-01-30 | 2018-08-02 | Chugai Seiyaku Kabushiki Kaisha | Anti-sclerostin antibodies and methods of use |
| WO2018151820A1 (en) | 2017-02-16 | 2018-08-23 | Elstar Therapeutics, Inc. | Multifunctional molecules comprising a trimeric ligand and uses thereof |
| CN110506055A (zh) | 2017-02-17 | 2019-11-26 | 戴纳立制药公司 | 工程改造的转铁蛋白受体结合多肽 |
| EP3630836A1 (en) | 2017-05-31 | 2020-04-08 | Elstar Therapeutics, Inc. | Multispecific molecules that bind to myeloproliferative leukemia (mpl) protein and uses thereof |
| CN110945026B (zh) | 2017-06-20 | 2024-03-19 | 特纳奥尼股份有限公司 | 仅有重链的抗bcma抗体 |
| KR20250007003A (ko) | 2017-06-20 | 2025-01-13 | 테네오바이오, 인코포레이티드 | 항-bcma 중쇄-단독 항체 |
| CN111683966B (zh) | 2017-12-22 | 2023-07-11 | 特尼奥生物股份有限公司 | 与cd22结合的重链抗体 |
| US12247060B2 (en) | 2018-01-09 | 2025-03-11 | Marengo Therapeutics, Inc. | Calreticulin binding constructs and engineered T cells for the treatment of diseases |
| EP3765516A2 (en) | 2018-03-14 | 2021-01-20 | Elstar Therapeutics, Inc. | Multifunctional molecules and uses thereof |
| EP3765517A1 (en) | 2018-03-14 | 2021-01-20 | Elstar Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
| CN112384243A (zh) * | 2018-04-17 | 2021-02-19 | 英温拉公司 | 三价三特异性抗体构建体 |
| EP3788079A4 (en) | 2018-05-03 | 2022-12-21 | Shanghai Epimab Biotherapeutics Co., Ltd. | ANTIBODIES WITH HIGH AFFINITY TO PD-1 AND LAG-3 AND BI-SPECIFIC BINDING PROTEINS PRODUCTION THEREOF |
| JP7269963B2 (ja) | 2018-06-08 | 2023-05-09 | クリスタル バイオサイエンス インコーポレイテッド | 同じ軽鎖iを有する多様な抗体を産生するためのトランスジェニック動物 |
| CA3105448A1 (en) | 2018-07-03 | 2020-01-09 | Elstar Therapeutics, Inc. | Anti-tcr antibody molecules and uses thereof |
| GB2599228B (en) | 2019-02-21 | 2024-02-07 | Marengo Therapeutics Inc | Multifunctional molecules that bind to T cell related cancer cells and uses thereof |
| EP3927746A1 (en) | 2019-02-21 | 2021-12-29 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
| JP7737306B2 (ja) | 2019-02-21 | 2025-09-10 | マレンゴ・セラピューティクス,インコーポレーテッド | T細胞に結合する多機能性分子および自己免疫障害を処置するためのその使用 |
| EP3927431A1 (en) | 2019-02-21 | 2021-12-29 | Marengo Therapeutics, Inc. | Anti-tcr antibody molecules and uses thereof |
| CN119039441A (zh) | 2019-02-21 | 2024-11-29 | 马伦戈治疗公司 | 与nkp30结合的抗体分子及其用途 |
| WO2020206330A1 (en) | 2019-04-05 | 2020-10-08 | Teneobio, Inc. | Heavy chain antibodies binding to psma |
| EP3953388A1 (en) * | 2019-04-09 | 2022-02-16 | Sanofi | Trispecific binding proteins, methods, and uses thereof |
| US11613576B2 (en) | 2019-04-09 | 2023-03-28 | Sanofi | Trispecific binding proteins, methods, and uses thereof |
| CR20210622A (es) | 2019-06-14 | 2022-06-27 | Teneobio Inc | Anticuerpos multiespecíficos de cadena pesada que se unen a cd22 y cd3 |
| CN110229232B (zh) * | 2019-06-19 | 2020-05-19 | 北京智仁美博生物科技有限公司 | 双特异性抗体及其用途 |
| CN110551222B (zh) * | 2019-08-27 | 2023-06-06 | 重庆市畜牧科学院 | 一种新型双功能抗体及其用途 |
| PH12022551598A1 (en) | 2019-12-23 | 2023-11-20 | Denali Therapeutics Inc | Progranulin variants |
| CN110982839A (zh) * | 2019-12-25 | 2020-04-10 | 上海药明生物技术有限公司 | 对蛋白在细胞水平进行生物素标记的方法 |
| EP4084821A4 (en) | 2020-01-03 | 2024-04-24 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to cd33 and uses thereof |
| AU2020416273A1 (en) | 2020-01-03 | 2022-07-28 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
| CN115843312A (zh) | 2020-04-24 | 2023-03-24 | 马伦戈治疗公司 | 结合至t细胞相关癌细胞的多功能性分子及其用途 |
| IL297601A (en) | 2020-04-29 | 2022-12-01 | Teneobio Inc | Multispecific heavy chain antibodies with modified heavy chain constant regions |
| CN113563473A (zh) * | 2020-04-29 | 2021-10-29 | 三生国健药业(上海)股份有限公司 | 四价双特异性抗体、其制备方法和用途 |
| GB2616128A (en) | 2020-08-26 | 2023-08-30 | Marengo Therapeutics Inc | Antibody molecules that bind to NKp30 and uses thereof |
| AU2021331075A1 (en) | 2020-08-26 | 2023-04-06 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
| GB2616354A (en) | 2020-08-26 | 2023-09-06 | Marengo Therapeutics Inc | Methods of detecting TRBC1 or TRBC2 |
| WO2022216993A2 (en) | 2021-04-08 | 2022-10-13 | Marengo Therapeutics, Inc. | Multifuntional molecules binding to tcr and uses thereof |
| TW202544047A (zh) | 2023-12-21 | 2025-11-16 | 美商安進公司 | 穩定雙細胞異二聚體產生的同源二聚體突變 |
| GB202319967D0 (en) | 2023-12-22 | 2024-02-07 | Epsilogen Ltd | Heteromultimeric proteins |
| WO2026011013A1 (en) | 2024-07-02 | 2026-01-08 | Epibiologics, Inc. | Binding agents and uses thereof |
| WO2026037918A1 (en) | 2024-08-14 | 2026-02-19 | Epsilogen Ltd | Heteromultimeric proteins |
| WO2026050572A2 (en) | 2024-08-29 | 2026-03-05 | Marengo Therapeutics, Inc. | Multifunctional molecules binding to tcr and uses thereof |
| CN120399078B (zh) * | 2025-05-08 | 2026-03-06 | 上海天泽云泰生物医药股份有限公司 | 靶向cd117的纳米抗体及其应用 |
Family Cites Families (164)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR2388385B1 (fr) | 1977-04-18 | 1982-01-08 | Hitachi Metals Ltd | Piece d'ornement fixee par des aimants permanents |
| US6548640B1 (en) | 1986-03-27 | 2003-04-15 | Btg International Limited | Altered antibodies |
| IL85035A0 (en) | 1987-01-08 | 1988-06-30 | Int Genetic Eng | Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same |
| EP0368684B2 (en) | 1988-11-11 | 2004-09-29 | Medical Research Council | Cloning immunoglobulin variable domain sequences. |
| DE3920358A1 (de) | 1989-06-22 | 1991-01-17 | Behringwerke Ag | Bispezifische und oligospezifische, mono- und oligovalente antikoerperkonstrukte, ihre herstellung und verwendung |
| WO1991003493A1 (en) | 1989-08-29 | 1991-03-21 | The University Of Southampton | Bi-or trispecific (fab)3 or (fab)4 conjugates |
| US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| EP1400536A1 (en) | 1991-06-14 | 2004-03-24 | Genentech Inc. | Method for making humanized antibodies |
| WO1994004679A1 (en) | 1991-06-14 | 1994-03-03 | Genentech, Inc. | Method for making humanized antibodies |
| GB9114948D0 (en) | 1991-07-11 | 1991-08-28 | Pfizer Ltd | Process for preparing sertraline intermediates |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| FI941572A7 (fi) | 1991-10-07 | 1994-05-27 | Oncologix Inc | Anti-erbB-2-monoklonaalisten vasta-aineiden yhdistelmä ja käyttömenete lmä |
| CA2372813A1 (en) | 1992-02-06 | 1993-08-19 | L.L. Houston | Biosynthetic binding protein for cancer marker |
| US5798100A (en) | 1994-07-06 | 1998-08-25 | Immunomedics, Inc. | Multi-stage cascade boosting vaccine |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5547668A (en) | 1995-05-05 | 1996-08-20 | The Board Of Trustees Of The University Of Illinois | Conjugates of folate anti-effector cell antibodies |
| JPH11507535A (ja) | 1995-06-07 | 1999-07-06 | イムクローン システムズ インコーポレイテッド | 腫瘍の成長を抑制する抗体および抗体フラグメント類 |
| US7423125B2 (en) | 1995-08-01 | 2008-09-09 | Vegenics Limited | Antibodies to VEGF-C |
| ATE299938T1 (de) * | 1997-05-02 | 2005-08-15 | Genentech Inc | Ein verfahren zur herstellung multispezifischer antikörper die heteromultimere und gemeinsame komponenten besitzen |
| US6040498A (en) | 1998-08-11 | 2000-03-21 | North Caroline State University | Genetically engineered duckweed |
| DK1034298T3 (da) | 1997-12-05 | 2012-01-30 | Scripps Research Inst | Humanisering af murint antistof |
| PT1049787E (pt) | 1998-01-23 | 2005-04-29 | Vlaams Interuniv Inst Biotech | Derivados de anticorpos multipropositos |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US7125978B1 (en) | 1999-10-04 | 2006-10-24 | Medicago Inc. | Promoter for regulating expression of foreign genes |
| ES2248127T3 (es) | 1999-10-04 | 2006-03-16 | Medicago Inc. | Metodo para regular la transcripcion de genes foraneos en presencia de nigtrogeno. |
| US6773883B2 (en) | 2000-07-31 | 2004-08-10 | The Brigham & Women's Hospital, Inc. | Prognostic classification of endometrial cancer |
| US8501471B2 (en) | 2000-10-18 | 2013-08-06 | Sloan-Kettering Institute For Cancer Research | Uses of monoclonal antibody 8H9 |
| US7432063B2 (en) | 2002-02-14 | 2008-10-07 | Kalobios Pharmaceuticals, Inc. | Methods for affinity maturation |
| AU2004249673A1 (en) | 2003-05-23 | 2004-12-29 | Morphotek, Inc. | Anti alpha - folate - receptor - tetramer antibodies |
| US9296820B2 (en) | 2003-11-05 | 2016-03-29 | Roche Glycart Ag | Polynucleotides encoding anti-CD20 antigen binding molecules with increased Fc receptor binding affinity and effector function |
| EP3101034A1 (en) | 2004-02-12 | 2016-12-07 | Morphotek, Inc. | Monoclonal antibodies that specifically bind to folate receptor alpha |
| EP1740615B1 (en) | 2004-03-31 | 2014-11-05 | Genentech, Inc. | Humanized anti-tgf-beta antibodies |
| PT1737891E (pt) | 2004-04-13 | 2013-04-16 | Hoffmann La Roche | Anticorpos anti p-selectina |
| TWI380996B (zh) | 2004-09-17 | 2013-01-01 | Hoffmann La Roche | 抗ox40l抗體 |
| PL1871805T3 (pl) | 2005-02-07 | 2020-03-31 | Roche Glycart Ag | Cząsteczki wiążące antygen, które wiążą egfr, wektory kodujące te cząsteczki oraz ich zastosowania |
| EP1861425B1 (en) | 2005-03-10 | 2012-05-16 | Morphotek, Inc. | Anti-mesothelin antibodies |
| US7608413B1 (en) | 2005-03-25 | 2009-10-27 | Celera Corporation | Kidney disease targets and uses thereof |
| AU2006232287B2 (en) | 2005-03-31 | 2011-10-06 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
| CA2607444C (en) | 2005-04-22 | 2015-03-10 | Morphotek, Inc. | Antibodies with immune effector activity and that internalize in folate receptor alpha-positive cells |
| PL1874821T3 (pl) | 2005-04-26 | 2013-09-30 | Trion Pharma Gmbh | Kombinacja przeciwciał i glikokortykoidów do leczenia raka |
| BRPI0611445A2 (pt) | 2005-05-09 | 2010-09-08 | Glycart Biotechnology Ag | molécula de ligação a antìgeno glicomanipulada, polinucleotìdeo, polipeptìdeo, vetor, célula hospedeira, método para produção, uso e composição farmacêutica |
| NZ612578A (en) | 2005-08-19 | 2014-11-28 | Abbvie Inc | Dual variable domain immunoglobin and uses thereof |
| EP1940881B1 (en) | 2005-10-11 | 2016-11-30 | Amgen Research (Munich) GmbH | Compositions comprising cross-species-specific antibodies and uses thereof |
| SG153825A1 (en) | 2005-12-16 | 2009-07-29 | Ibc Pharmaceuticals Inc | Multivalent immunoglobulin-based bioactive assemblies |
| PT1999154E (pt) | 2006-03-24 | 2013-01-24 | Merck Patent Gmbh | Domínios proteicos heterodiméricos modificados |
| NZ573646A (en) | 2006-06-12 | 2012-04-27 | Wyeth Llc | Single-chain multivalent binding proteins with effector function |
| JP2009541275A (ja) | 2006-06-22 | 2009-11-26 | ノボ・ノルデイスク・エー/エス | 二重特異性抗体の生産 |
| EP1900752A1 (en) | 2006-09-15 | 2008-03-19 | DOMPE' pha.r.ma s.p.a. | Human anti-folate receptor alpha antibodies and antibody fragments for the radioimmunotherapy of ovarian carcinoma |
| RU2769948C2 (ru) | 2007-04-03 | 2022-04-11 | Эмджен Рисерч (Мьюник) Гмбх | CD3-Эпсилон-связывающий домен с межвидовой специфичностью |
| MX2009010611A (es) | 2007-04-03 | 2010-03-26 | Micromet Ag | Enlazadores biespecificos, especificos para especies. |
| RS53008B2 (sr) | 2007-04-03 | 2022-12-30 | Amgen Res Munich Gmbh | Interspecijski specifičan cd3-epsilon vezujući domen |
| WO2009070642A1 (en) | 2007-11-28 | 2009-06-04 | Medimmune, Llc | Protein formulation |
| US20090162359A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
| US8242247B2 (en) | 2007-12-21 | 2012-08-14 | Hoffmann-La Roche Inc. | Bivalent, bispecific antibodies |
| US9266967B2 (en) | 2007-12-21 | 2016-02-23 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
| US8227577B2 (en) | 2007-12-21 | 2012-07-24 | Hoffman-La Roche Inc. | Bivalent, bispecific antibodies |
| JP6157046B2 (ja) | 2008-01-07 | 2017-07-05 | アムジェン インコーポレイテッド | 静電的ステアリング(electrostaticsteering)効果を用いた抗体Fcヘテロ二量体分子を作製するための方法 |
| CA2756244A1 (en) | 2009-04-02 | 2010-10-07 | Roche Glycart Ag | Multispecific antibodies comprising full length antibodies and single chain fab fragments |
| SG175077A1 (en) | 2009-04-07 | 2011-11-28 | Roche Glycart Ag | Trivalent, bispecific antibodies |
| EP2417164A1 (en) | 2009-04-07 | 2012-02-15 | Roche Glycart AG | Bispecific anti-erbb-2/anti-c-met antibodies |
| WO2010129304A2 (en) | 2009-04-27 | 2010-11-11 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
| PE20120540A1 (es) | 2009-05-27 | 2012-05-09 | Hoffmann La Roche | Anticuerpos triespecificos o tetraespecificos |
| US9676845B2 (en) | 2009-06-16 | 2017-06-13 | Hoffmann-La Roche, Inc. | Bispecific antigen binding proteins |
| US8703132B2 (en) | 2009-06-18 | 2014-04-22 | Hoffmann-La Roche, Inc. | Bispecific, tetravalent antigen binding proteins |
| KR101528013B1 (ko) | 2009-08-31 | 2015-06-16 | 로슈 글리카트 아게 | 친화성-성숙된 인간화된 항-cea 단일클론 항체 |
| WO2011028952A1 (en) | 2009-09-02 | 2011-03-10 | Xencor, Inc. | Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens |
| CA2785907A1 (en) | 2009-12-29 | 2011-07-28 | Emergent Product Development Seattle, Llc | Ron binding constructs and methods of use thereof |
| US20130045492A1 (en) * | 2010-02-08 | 2013-02-21 | Regeneron Pharmaceuticals, Inc. | Methods For Making Fully Human Bispecific Antibodies Using A Common Light Chain |
| TWI622402B (zh) | 2010-02-24 | 2018-05-01 | 免疫遺傳股份有限公司 | 葉酸受體1抗體類和免疫共軛物類及彼等之用途 |
| TW201138821A (en) | 2010-03-26 | 2011-11-16 | Roche Glycart Ag | Bispecific antibodies |
| US9527926B2 (en) | 2010-05-14 | 2016-12-27 | Rinat Neuroscience Corp. | Heterodimeric proteins and methods for producing and purifying them |
| CN103347537A (zh) | 2010-10-20 | 2013-10-09 | 莫弗泰克股份有限公司 | 抗叶酸受体α抗体糖型 |
| ES2758994T3 (es) | 2010-11-05 | 2020-05-07 | Zymeworks Inc | Diseño anticuerpo heterodimérico estable con mutaciones en el dominio Fc |
| MX343607B (es) | 2010-11-05 | 2016-11-11 | Morphotek Inc | Receptor alfa de folato como marcador de diagnóstico y pronóstico para cánceres que expresan receptor alfa de folato. |
| PT3434767T (pt) | 2010-11-30 | 2026-01-23 | Chugai Pharmaceutical Co Ltd | Agente terapêutico indutor de citotoxicidade |
| US20120189620A1 (en) | 2011-01-21 | 2012-07-26 | Emory University | Methods for treating non-functioning pituitary adenoma |
| SG192673A1 (en) | 2011-02-10 | 2013-09-30 | Roche Glycart Ag | Mutant interleukin-2 polypeptides |
| ES2692268T5 (en) | 2011-03-29 | 2025-02-26 | Roche Glycart Ag | Antibody fc variants |
| BR112013025415B1 (pt) | 2011-04-01 | 2021-03-16 | Immunogen, Inc | uso de um imunoconjugado antirreceptor de folato 1 (folr1) |
| EA201892619A1 (ru) | 2011-04-29 | 2019-04-30 | Роше Гликарт Аг | Иммуноконъюгаты, содержащие мутантные полипептиды интерлейкина-2 |
| WO2012158818A2 (en) | 2011-05-16 | 2012-11-22 | Fabion Pharmaceuticals, Inc. | Multi-specific fab fusion proteins and methods of use |
| KR102060389B1 (ko) | 2011-05-21 | 2019-12-31 | 마크로제닉스, 인크. | 사람 및 비-사람 cd3에 결합할 수 있는 cd3-결합 분자 |
| SI2731972T1 (en) | 2011-07-15 | 2018-04-30 | Eisai R&D Management Co., Ltd. | Anti-folate receptor alpha antibodies and uses thereof |
| EP2748202B1 (en) * | 2011-08-23 | 2018-07-04 | Roche Glycart AG | Bispecific antigen binding molecules |
| JP6060162B2 (ja) | 2011-08-23 | 2017-01-11 | ロシュ グリクアート アーゲー | 2つのFabフラグメントを含むFc不含抗体および使用方法 |
| WO2013026837A1 (en) | 2011-08-23 | 2013-02-28 | Roche Glycart Ag | Bispecific t cell activating antigen binding molecules |
| NO2748201T3 (https=) | 2011-08-23 | 2018-05-12 | ||
| WO2013026839A1 (en) | 2011-08-23 | 2013-02-28 | Roche Glycart Ag | Bispecific antibodies specific for t-cell activating antigens and a tumor antigen and methods of use |
| EP2578230A1 (en) | 2011-10-04 | 2013-04-10 | Trion Pharma Gmbh | Removal of Tumor Cells from Intraoperative Autologous Blood Salvage |
| US10851178B2 (en) | 2011-10-10 | 2020-12-01 | Xencor, Inc. | Heterodimeric human IgG1 polypeptides with isoelectric point modifications |
| TWI679212B (zh) * | 2011-11-15 | 2019-12-11 | 美商安進股份有限公司 | 針對bcma之e3以及cd3的結合分子 |
| RS60499B1 (sr) | 2011-12-20 | 2020-08-31 | Medimmune Llc | Modifikovani polipeptidi za bispecifične skelete antitela |
| AU2013229786B2 (en) | 2012-03-08 | 2017-06-22 | Halozyme, Inc. | Conditionally active anti-epidermal growth factor receptor antibodies and methods of use thereof |
| US9248181B2 (en) | 2012-04-20 | 2016-02-02 | Merus B.V. | Methods and means for the production of Ig-like molecules |
| BR112014028306A2 (pt) | 2012-05-15 | 2018-04-17 | Morphotek, Inc. | métodos para tratamento de câncer gástrico. |
| MX2014014891A (es) * | 2012-06-05 | 2015-06-17 | Regeneron Pharma | Metodos para hacer anticuerpos biespecificos completamente humanos usando una cadena ligera comun. |
| WO2014004549A2 (en) | 2012-06-27 | 2014-01-03 | Amgen Inc. | Anti-mesothelin binding proteins |
| US20150203591A1 (en) | 2012-08-02 | 2015-07-23 | Regeneron Pharmaceuticals, Inc. | Mutivalent antigen-binding proteins |
| MY175687A (en) | 2012-08-07 | 2020-07-06 | Roche Glycart Ag | Composition comprising two antibodies engineered to have reduced and increased effector function |
| US9682143B2 (en) | 2012-08-14 | 2017-06-20 | Ibc Pharmaceuticals, Inc. | Combination therapy for inducing immune response to disease |
| CN104379169A (zh) | 2012-08-14 | 2015-02-25 | Ibc药品公司 | 用于治疗疾病的t-细胞重定向双特异性抗体 |
| JOP20200236A1 (ar) | 2012-09-21 | 2017-06-16 | Regeneron Pharma | الأجسام المضادة لمضاد cd3 وجزيئات ربط الأنتيجين ثنائية التحديد التي تربط cd3 وcd20 واستخداماتها |
| HUE042040T2 (hu) * | 2012-09-27 | 2019-06-28 | Merus Nv | Bispecifikus IGG antitestek mint T-sejt kapcsolók |
| RU2015117393A (ru) * | 2012-10-08 | 2016-12-10 | Роше Гликарт Аг | Лишенные fc антитела, содержащие два Fab-фрагмента, и способы их применения |
| UY35148A (es) | 2012-11-21 | 2014-05-30 | Amgen Inc | Immunoglobulinas heterodiméricas |
| US9207238B2 (en) | 2012-12-07 | 2015-12-08 | Kyowa Hakko Kirin Co., Ltd. | Anti-FOLR1 antibody |
| US9522196B2 (en) | 2012-12-25 | 2016-12-20 | Kagoshima University | Antibody recognizing folate receptors α and β |
| US10131710B2 (en) | 2013-01-14 | 2018-11-20 | Xencor, Inc. | Optimized antibody variable regions |
| US10968276B2 (en) * | 2013-03-12 | 2021-04-06 | Xencor, Inc. | Optimized anti-CD3 variable regions |
| US9605084B2 (en) | 2013-03-15 | 2017-03-28 | Xencor, Inc. | Heterodimeric proteins |
| KR102211837B1 (ko) | 2013-01-14 | 2021-02-03 | 젠코어 인코포레이티드 | 신규한 이형이량체 단백질 |
| US9701759B2 (en) | 2013-01-14 | 2017-07-11 | Xencor, Inc. | Heterodimeric proteins |
| US10487155B2 (en) | 2013-01-14 | 2019-11-26 | Xencor, Inc. | Heterodimeric proteins |
| WO2014122143A1 (en) | 2013-02-05 | 2014-08-14 | Engmab Ag | Method for the selection of antibodies against bcma |
| JO3529B1 (ar) | 2013-02-08 | 2020-07-05 | Amgen Res Munich Gmbh | مضاد التصاق خلايا الدم البيض من أجل التخفيف من الاثار السلبية الممكنة الناتجة عن مجالات ارتباط cd3- المحدد |
| EP2961770A1 (en) | 2013-02-26 | 2016-01-06 | Roche Glycart AG | Bispecific t cell activating antigen binding molecules |
| LT2961771T (lt) | 2013-02-26 | 2020-03-10 | Roche Glycart Ag | Bispecifinės t ląstelę aktyvinančios antigeną surišančios molekulės, specifinės cd3 ir cea antigenams |
| EP2961773B1 (en) | 2013-02-26 | 2019-03-20 | Roche Glycart AG | Bispecific t cell activating antigen binding molecules |
| CN105283201B (zh) | 2013-03-14 | 2019-08-02 | 斯克利普斯研究所 | 靶向剂抗体偶联物及其用途 |
| US10858417B2 (en) | 2013-03-15 | 2020-12-08 | Xencor, Inc. | Heterodimeric proteins |
| US11634502B2 (en) * | 2013-03-15 | 2023-04-25 | Amgen Inc. | Heterodimeric bispecific antibodies |
| JP2016514676A (ja) | 2013-03-15 | 2016-05-23 | メルク パテント ゲゼルシャフト ミット ベシュレンクテル ハフツングMerck Patent Gesellschaft mit beschraenkter Haftung | 四価二重特異性抗体 |
| US20140302037A1 (en) | 2013-03-15 | 2014-10-09 | Amgen Inc. | BISPECIFIC-Fc MOLECULES |
| US20140308285A1 (en) | 2013-03-15 | 2014-10-16 | Amgen Inc. | Heterodimeric bispecific antibodies |
| AU2014229282B2 (en) | 2013-03-15 | 2017-02-02 | Glaxosmithkline Intellectual Property (No.2) Limited | Low concentration antibody formulations |
| UA118028C2 (uk) | 2013-04-03 | 2018-11-12 | Рош Глікарт Аг | Біспецифічне антитіло, специфічне щодо fap і dr5, антитіло, специфічне щодо dr5, і спосіб їх застосування |
| EP2789630A1 (en) | 2013-04-09 | 2014-10-15 | EngMab AG | Bispecific antibodies against CD3e and ROR1 |
| SG11201509361TA (en) | 2013-05-28 | 2015-12-30 | Numab Ag | Novel antibodies |
| ME03675B (me) | 2013-07-05 | 2020-10-20 | Genmab As | Humanizovana ili himerna anтi-cd3 antiтela |
| CN105722859B (zh) | 2013-07-25 | 2021-05-07 | 西托姆克斯治疗公司 | 多特异性抗体、多特异性可活化抗体及其使用方法 |
| WO2015018085A1 (zh) | 2013-08-09 | 2015-02-12 | 华为技术有限公司 | Csi测量资源的配置方法、csi上报方法、基站及用户设备 |
| WO2015033223A2 (en) | 2013-09-03 | 2015-03-12 | Novimmune S.A. | Readily isolated bispecific binding molecules with native format having mutated constant regions |
| US20160257748A1 (en) | 2013-09-25 | 2016-09-08 | Amgen Inc. | V-c-fc-v-c antibody |
| IL263466B2 (en) | 2013-12-17 | 2023-10-01 | Genentech Inc | Anti-CD3 antibodies and methods of using them |
| JP2017507900A (ja) | 2013-12-17 | 2017-03-23 | ジェネンテック, インコーポレイテッド | Pd−1軸結合アンタゴニスト及び抗her2抗体を使用してher2陽性がんを治療する方法 |
| HUE045065T2 (hu) | 2014-01-31 | 2019-12-30 | Novartis Ag | TIM-3 antitest molekulák és felhasználásaik |
| UA117289C2 (uk) | 2014-04-02 | 2018-07-10 | Ф. Хоффманн-Ля Рош Аг | Мультиспецифічне антитіло |
| CA2955947A1 (en) | 2014-07-25 | 2016-01-28 | Cytomx Therapeutics, Inc. | Anti-cd3 antibodies, activatable anti-cd3 antibodies, multispecific anti-cd3 antibodies, multispecific activatable anti-cd3 antibodies, and methods of using the same |
| EP3177643B1 (en) | 2014-08-04 | 2019-05-08 | F.Hoffmann-La Roche Ag | Bispecific t cell activating antigen binding molecules |
| EP2982692A1 (en) | 2014-08-04 | 2016-02-10 | EngMab AG | Bispecific antibodies against CD3epsilon and BCMA |
| WO2016019969A1 (en) | 2014-08-08 | 2016-02-11 | Ludwig-Maximilians-Universität München | Subcutaneously administered bispecific antibodies for use in the treatment of cancer |
| DK3186283T3 (da) | 2014-08-29 | 2020-03-02 | Hoffmann La Roche | Kombinationsbehandling med tumormålrettede IL-2- immuncytokinervarianter og antistoffer mod humant PD-L1 |
| WO2016036678A1 (en) | 2014-09-02 | 2016-03-10 | Medimmune, Llc | Formulations of bispecific antibodies |
| MA40764A (fr) | 2014-09-26 | 2017-08-01 | Chugai Pharmaceutical Co Ltd | Agent thérapeutique induisant une cytotoxicité |
| EP3204415B1 (en) | 2014-10-09 | 2020-06-17 | EngMab Sàrl | Bispecific antibodies against cd3epsilon and ror1 |
| CA2963696A1 (en) | 2014-10-09 | 2016-04-14 | Engmab Ag | Bispecific antibodies against cd3epsilon and ror1 for use in the treatment of ovarian cancer |
| MX2017006016A (es) | 2014-11-11 | 2017-06-19 | Amunix Operating Inc | Composiciones conjugadas de xten direccionadas y metodos para producir las mismas. |
| PT3221356T (pt) | 2014-11-20 | 2020-10-29 | Hoffmann La Roche | Moléculas de ligação ao antigénio biespecíficas ativadoras das células t contra folr1 e cd3 |
| DK3221357T3 (da) | 2014-11-20 | 2020-08-10 | Hoffmann La Roche | Fælles letkæder og fremgangsmåder til anvendelse |
| EP3023437A1 (en) | 2014-11-20 | 2016-05-25 | EngMab AG | Bispecific antibodies against CD3epsilon and BCMA |
| EP3029068A1 (en) | 2014-12-03 | 2016-06-08 | EngMab AG | Bispecific antibodies against CD3epsilon and BCMA for use in the treatment of diseases |
| AU2016232009B2 (en) | 2015-03-17 | 2021-07-15 | Tilt Biotherapeutics Oy | Oncolytic adenoviruses coding for bi-specific antibodies and methods and uses related thereto |
| EP3288981A1 (en) | 2015-05-01 | 2018-03-07 | Genentech, Inc. | Masked anti-cd3 antibodies and methods of use |
| DK3310814T5 (da) | 2015-06-16 | 2024-10-07 | Hoffmann La Roche | Humaniserede og affinitetsmodnede antistoffer mod FcRH5 og fremgangsmåder til anvendelse |
| SI3331910T1 (sl) | 2015-08-03 | 2020-07-31 | Engmab Sarl | Monoklonska protitelesa proti humani antigen dozorevanja limfocitov B (BCMA) |
| WO2017055318A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Cd33xcd3 bispecific t cell activating antigen binding molecules |
| JP2018536389A (ja) | 2015-10-02 | 2018-12-13 | エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト | メソテリンとcd3に結合する二重特異性細胞活性化抗原結合分子 |
| PE20180484A1 (es) | 2015-10-02 | 2018-03-07 | Hoffmann La Roche | Moleculas biespecificas de union a antigeno activadoras de celulas t |
| WO2017055314A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific anti-cd19xcd3 t cell activating antigen binding molecules |
| JP2018533930A (ja) | 2015-10-02 | 2018-11-22 | エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト | 二重特異性t細胞活性化抗原結合分子 |
| IL313608A (en) | 2015-12-09 | 2024-08-01 | Hoffmann La Roche | Antibody against CD20 type II to reduce the formation of antibodies against drugs |
-
2015
- 2015-11-17 DK DK15797972.5T patent/DK3221357T3/da active
- 2015-11-17 LT LTEP15797972.5T patent/LT3221357T/lt unknown
- 2015-11-17 CA CA2968162A patent/CA2968162A1/en active Pending
- 2015-11-17 PT PT157979725T patent/PT3221357T/pt unknown
- 2015-11-17 WO PCT/EP2015/076745 patent/WO2016079081A1/en not_active Ceased
- 2015-11-17 KR KR1020177016927A patent/KR20170087486A/ko not_active Abandoned
- 2015-11-17 CN CN201580073564.0A patent/CN107207609B/zh active Active
- 2015-11-17 EP EP15797972.5A patent/EP3221357B1/en active Active
- 2015-11-17 RU RU2017121326A patent/RU2747011C2/ru active
- 2015-11-17 RS RS20200886A patent/RS60615B1/sr unknown
- 2015-11-17 BR BR112017010513-6A patent/BR112017010513A2/pt not_active Application Discontinuation
- 2015-11-17 HR HRP20201156TT patent/HRP20201156T1/hr unknown
- 2015-11-17 JP JP2017527369A patent/JP7164949B2/ja active Active
- 2015-11-17 MX MX2017006626A patent/MX381724B/es unknown
- 2015-11-17 ES ES15797972T patent/ES2808853T3/es active Active
- 2015-11-17 PL PL15797972T patent/PL3221357T3/pl unknown
- 2015-11-17 EP EP20170514.2A patent/EP3747905A1/en not_active Withdrawn
- 2015-11-17 HU HUE15797972A patent/HUE049650T2/hu unknown
- 2015-11-17 SI SI201531309T patent/SI3221357T1/sl unknown
-
2017
- 2017-05-19 US US15/600,015 patent/US20170253670A1/en not_active Abandoned
-
2019
- 2019-08-15 US US16/541,258 patent/US20200172633A1/en not_active Abandoned
-
2021
- 2021-04-28 JP JP2021075649A patent/JP2021129564A/ja active Pending
- 2021-09-09 US US17/470,778 patent/US12103982B2/en active Active
Cited By (43)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10138293B2 (en) | 2007-12-21 | 2018-11-27 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
| US10927163B2 (en) | 2007-12-21 | 2021-02-23 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
| US11673945B2 (en) | 2009-06-16 | 2023-06-13 | Hoffmann-La Roche Inc. | Bispecific antigen binding proteins |
| US10640555B2 (en) | 2009-06-16 | 2020-05-05 | Hoffmann-La Roche Inc. | Bispecific antigen binding proteins |
| US10611825B2 (en) | 2011-02-28 | 2020-04-07 | Hoffmann La-Roche Inc. | Monovalent antigen binding proteins |
| US10793621B2 (en) | 2011-02-28 | 2020-10-06 | Hoffmann-La Roche Inc. | Nucleic acid encoding dual Fc antigen binding proteins |
| US11639397B2 (en) | 2011-08-23 | 2023-05-02 | Roche Glycart Ag | Bispecific antibodies specific for T-cell activating antigens and a tumor antigen and methods of use |
| US10087250B2 (en) | 2012-10-08 | 2018-10-02 | Roche Glycart Ag | Fc-free antibodies comprising two fab-fragments and methods of use |
| US10155815B2 (en) | 2013-02-26 | 2018-12-18 | Roche Glycart Ag | Bispecific T cell activating antigen binding molecules |
| US11459404B2 (en) | 2013-02-26 | 2022-10-04 | Roche Glycart Ag | Bispecific T cell activating antigen binding molecules |
| US10781258B2 (en) | 2013-02-26 | 2020-09-22 | Roche Glycart Ag | Bispecific T cell activating antigen binding molecules |
| US10781257B2 (en) | 2013-02-26 | 2020-09-22 | Roche GlyeArt AG | Bispecific T cell activating antigen binding molecules |
| US10323099B2 (en) * | 2013-10-11 | 2019-06-18 | Hoffmann-La Roche Inc. | Multispecific domain exchanged common variable light chain antibodies |
| US10611840B2 (en) | 2014-08-04 | 2020-04-07 | Hoffman-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
| US9914776B2 (en) | 2014-08-04 | 2018-03-13 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
| US10611841B2 (en) | 2014-08-04 | 2020-04-07 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
| US11117965B2 (en) | 2014-08-04 | 2021-09-14 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
| US10781262B2 (en) | 2014-11-20 | 2020-09-22 | Hoffmann-La Roche Inc. | Combination therapy of T cell activating bispecific antigen binding molecules and PD-1 axis binding antagonists |
| US11613587B2 (en) | 2014-11-20 | 2023-03-28 | Hoffmann-La Roche Inc. | Combination therapy of T cell activating bispecific antigen binding molecules and PD-1 axis binding antagonists |
| US12139553B2 (en) | 2014-11-20 | 2024-11-12 | Hoffmann-La Roche Inc. | T cell activating bispecific antigen binding molecules |
| US12103982B2 (en) | 2014-11-20 | 2024-10-01 | Hoffmann-La Roche Inc. | T cell activating bispecific antigen binding molecules |
| US11286300B2 (en) | 2015-10-01 | 2022-03-29 | Hoffmann-La Roche Inc. | Humanized anti-human CD19 antibodies and methods of use |
| US10766967B2 (en) | 2015-10-02 | 2020-09-08 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
| US11013801B2 (en) | 2015-12-09 | 2021-05-25 | Hoffmann-La Roche Inc. | Treatment method |
| US10596257B2 (en) | 2016-01-08 | 2020-03-24 | Hoffmann-La Roche Inc. | Methods of treating CEA-positive cancers using PD-1 axis binding antagonists and anti-CEA/anti-CD3 bispecific antibodies |
| US11242390B2 (en) | 2016-03-22 | 2022-02-08 | Hoffmann-La Roche Inc. | Protease-activated T cell bispecific molecules |
| US10882918B2 (en) | 2016-09-30 | 2021-01-05 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
| US12297278B2 (en) | 2017-12-19 | 2025-05-13 | Surrozen Operating, Inc. | Wnt surrogate molecules and uses thereof |
| US11746150B2 (en) | 2017-12-19 | 2023-09-05 | Surrozen Operating, Inc. | Anti-LRP5/6 antibodies and methods of use |
| US11773171B2 (en) | 2017-12-19 | 2023-10-03 | Surrozen Operating, Inc. | WNT surrogate molecules and uses thereof |
| US12006368B2 (en) | 2017-12-19 | 2024-06-11 | Surrozen Operating, Inc. | Anti-frizzled antibodies and methods of use |
| US11866498B2 (en) | 2018-02-08 | 2024-01-09 | Genentech, Inc. | Bispecific antigen-binding molecules and methods of use |
| US12297270B2 (en) | 2018-02-08 | 2025-05-13 | Genentech, Inc. | Bispecific antigen-binding molecules and methods of use |
| US12150959B2 (en) | 2018-07-19 | 2024-11-26 | Regeneron Pharmaceuticals, Inc. | Chimeric antigen receptors with BCMA specificity and uses thereof |
| US12258412B2 (en) | 2018-07-19 | 2025-03-25 | Regeneron Pharmaceuticals, Inc. | Nucleic acid molecules encoding bispecific anti-BCMA x anti-CD3 antibodies |
| US11384153B2 (en) | 2018-07-19 | 2022-07-12 | Regeneran Pharmaceuticals, Inc. | Bispecific anti-BCMA x anti-CD3 antibodies and uses thereof |
| WO2020132356A1 (en) * | 2018-12-19 | 2020-06-25 | Surrozen, Inc. | Antigen binding formats for receptor complexes |
| US11179473B2 (en) | 2020-02-21 | 2021-11-23 | Silverback Therapeutics, Inc. | Nectin-4 antibody conjugates and uses thereof |
| US12364768B2 (en) | 2020-02-21 | 2025-07-22 | Araris Biotech Ag | Nectin-4 antibody conjugates and uses thereof |
| US12215155B2 (en) | 2020-06-19 | 2025-02-04 | Hoffmann-La Roche Inc. | Antibodies binding to CD3 and CD19 |
| US11780920B2 (en) | 2020-06-19 | 2023-10-10 | Hoffmann-La Roche Inc. | Antibodies binding to CD3 and CD19 |
| US11541126B1 (en) | 2020-07-01 | 2023-01-03 | Silverback Therapeutics, Inc. | Anti-ASGR1 antibody TLR8 agonist comprising conjugates and uses thereof |
| US12195547B2 (en) | 2021-04-30 | 2025-01-14 | Hoffmann-La Roche Inc. | Dosing for combination treatment with anti-CD20/anti-CD3 bispecific antibody and anti-CD79B antibody drug conjugate |
Also Published As
| Publication number | Publication date |
|---|---|
| PL3221357T3 (pl) | 2020-11-02 |
| BR112017010513A2 (pt) | 2018-04-03 |
| CN107207609B (zh) | 2022-07-19 |
| WO2016079081A1 (en) | 2016-05-26 |
| ES2808853T3 (es) | 2021-03-02 |
| US20200172633A1 (en) | 2020-06-04 |
| RU2747011C2 (ru) | 2021-04-23 |
| PT3221357T (pt) | 2020-07-28 |
| SI3221357T1 (sl) | 2020-09-30 |
| HUE049650T2 (hu) | 2020-11-30 |
| EP3747905A1 (en) | 2020-12-09 |
| RU2017121326A3 (https=) | 2019-06-14 |
| MX381724B (es) | 2025-03-13 |
| HRP20201156T1 (hr) | 2020-11-13 |
| MX2017006626A (es) | 2017-08-21 |
| RS60615B1 (sr) | 2020-08-31 |
| EP3221357A1 (en) | 2017-09-27 |
| RU2017121326A (ru) | 2018-12-20 |
| CA2968162A1 (en) | 2016-05-26 |
| JP2018504092A (ja) | 2018-02-15 |
| US12103982B2 (en) | 2024-10-01 |
| DK3221357T3 (da) | 2020-08-10 |
| CN107207609A (zh) | 2017-09-26 |
| EP3221357B1 (en) | 2020-06-03 |
| JP2021129564A (ja) | 2021-09-09 |
| HK1244011A1 (zh) | 2018-07-27 |
| KR20170087486A (ko) | 2017-07-28 |
| US20220213224A1 (en) | 2022-07-07 |
| LT3221357T (lt) | 2020-08-25 |
| JP7164949B2 (ja) | 2022-11-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12103982B2 (en) | T cell activating bispecific antigen binding molecules | |
| US12139553B2 (en) | T cell activating bispecific antigen binding molecules | |
| US20260116973A1 (en) | Bispecific t cell activating antigen binding molecules | |
| AU2019250201B2 (en) | Bispecific T cell activating antigen binding molecules | |
| WO2014131694A1 (en) | Bispecific t cell activating antigen binding molecules | |
| US20180282410A1 (en) | Anti-cd3xrob04 bispecific t cell activating antigen binding molecules | |
| US20260125470A1 (en) | Bispecific t cell activating antigen binding molecules |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |
|
| AS | Assignment |
Owner name: ROCHE GLYCART AG, SWITZERLAND Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:KLEIN, CHRISTIAN;MOESSNER, EKKEHARD;HOSSE, RALF;AND OTHERS;SIGNING DATES FROM 20150129 TO 20150427;REEL/FRAME:053366/0972 Owner name: F. HOFFMANN-LA ROCHE AG, SWITZERLAND Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:ROCHE GLYCART AG;REEL/FRAME:053367/0465 Effective date: 20150527 Owner name: HOFFMANN-LA ROCHE INC., NEW JERSEY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:F. HOFFMANN-LA ROCHE AG;REEL/FRAME:053367/0654 Effective date: 20150615 |