US20100189651A1 - Modified antibody compositions, methods of making and using thereof - Google Patents

Modified antibody compositions, methods of making and using thereof Download PDF

Info

Publication number
US20100189651A1
US20100189651A1 US12/686,344 US68634410A US2010189651A1 US 20100189651 A1 US20100189651 A1 US 20100189651A1 US 68634410 A US68634410 A US 68634410A US 2010189651 A1 US2010189651 A1 US 2010189651A1
Authority
US
United States
Prior art keywords
target
antibody
binding
aas
modified antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US12/686,344
Other languages
English (en)
Inventor
Nancy E. Stagliano
James W. West
Kathryn Kamath
Paul H. Bessette
Frederick Gluck
Jason Sagert
Patrick Daugherty
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cytomx Therapeutics Inc
Original Assignee
Cytomx Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US12/686,344 priority Critical patent/US20100189651A1/en
Application filed by Cytomx Therapeutics Inc filed Critical Cytomx Therapeutics Inc
Assigned to CYTOMX THERAPEUTICS, LLC reassignment CYTOMX THERAPEUTICS, LLC ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: BESSETTE, PAUL H., DAUGHERTY, PATRICK, GLUCK, FREDERICK W., KAMATH, KATHRYN, SAGERT, JASON, STAGLIANO, NANCY E., WEST, JAMES W.
Publication of US20100189651A1 publication Critical patent/US20100189651A1/en
Assigned to CYTOMX THERAPEUTICS, INC. reassignment CYTOMX THERAPEUTICS, INC. CHANGE OF NAME (SEE DOCUMENT FOR DETAILS). Assignors: CYTOMX THERAPEUTICS, LLC
Priority to US13/315,623 priority patent/US8563269B2/en
Priority to US13/455,924 priority patent/US8513390B2/en
Priority to US13/784,407 priority patent/US20130309230A1/en
Assigned to CYTOMX THERAPEUTICS, INC. reassignment CYTOMX THERAPEUTICS, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: CYTOMX THERAPEUTICS, LLC
Priority to US14/038,232 priority patent/US9453078B2/en
Priority to US15/140,944 priority patent/US10059762B2/en
Priority to US15/245,859 priority patent/US10118961B2/en
Priority to US16/110,597 priority patent/US10875913B2/en
Priority to US17/077,778 priority patent/US20210284721A1/en
Priority to US18/400,894 priority patent/US20240228603A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6845Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a cytokine, e.g. growth factors, VEGF, TNF, a lymphokine or an interferon
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/08Drugs for disorders of the urinary system of the prostate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/001Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/241Tumor Necrosis Factors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2839Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the integrin superfamily
    • C07K16/2845Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the integrin superfamily against integrin beta2-subunit-containing molecules, e.g. CD11, CD18
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2875Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/06Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6803General methods of protein analysis not limited to specific proteins or families of proteins
    • G01N33/6845Methods of identifying protein-protein interactions in protein mixtures
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854Immunoglobulins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/51Complete heavy chain or Fd fragment, i.e. VH + CH1
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/515Complete light chain, i.e. VL + CL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/31Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site

Definitions

  • Protein-based therapies have changed the face of medicine, finding application in a variety of different diseases.
  • antibody-based therapies have proven effective treatments for some diseases but in some cases, toxicities due to broad target expression have limited their therapeutic effectiveness.
  • prodrugs of an active chemical entity are administered in a relatively inactive (or significantly less active) form. Once administered, the prodrug is metabolized in vivo into the active compound.
  • prodrug strategies can provide for increased selectivity of the drug for its intended target and for a reduction of adverse effects.
  • Drugs used to target hypoxic cancer cells through the use of redox-activation, utilize the large quantities of reductase enzyme present in the hypoxic cell to convert the drug into its cytotoxic form, essentially activating it.
  • prodrug Since the prodrug has low cytotoxicity prior to this activation, there is a markedly decreased risk of damage to non-cancerous cells, thereby providing for reduced side-effects associated with the drug. There is a need in the field for a strategy for providing features of a prodrug to antibody-based therapeutics.
  • the present disclosure provides for modified and activatable antibody compositions useful for therapeutics and diagnostics.
  • the activatable antibody compositions exhibit increased bioavailability and biodistribution compared to conventional antibody therapeutics with prodrug features. Also provided are methods for use in diagnostics and therapeutics, as well as screening for and construction of such compositions.
  • the present disclosure provides a modified antibody comprising an antibody or antibody fragment (AB), capable of specifically binding its target, coupled to a masking moiety (MM), wherein the coupling of the MM reduces the ability of the AB to bind its target such that that the dissociation constant (K d ) of the AB coupled to the MM towards the target is at least 100 times greater, at least 1000 times greater, or at least 10,000 times greater than the K d of the AB not coupled to the MM towards the target.
  • AB antibody or antibody fragment
  • MM masking moiety
  • the present disclosure provides a modified antibody comprising an antibody or antibody fragment (AB), capable of specifically binding its target, coupled to a masking moiety (MM), wherein the coupling of the MM to the AB reduces the ability of the AB to bind the target by at least 90%, as compared to the ability of the AB not coupled to the MM to bind the target, when assayed in vitro using a target displacement assay.
  • AB antibody or antibody fragment
  • MM masking moiety
  • the modified antibody is further coupled to a cleavable moiety (CM).
  • CM cleavable moiety
  • the CM is capable of being cleaved by an enzyme, or the CM is capable of being reduced by a reducing agent, or the CM is capable of being photolysed.
  • the CM is capable of being specifically cleaved, reduced, or photolysed at a rate of about at least 1 ⁇ 10 4 M ⁇ 1 S ⁇ 1 , or at least 5 ⁇ 10 4 M ⁇ 1 S, or at least 10 ⁇ 10 4 M ⁇ 1 S.
  • the CM of the modified antibody is be within the MM.
  • the dissociation constant (K d ) of the MM towards the AB in the modified antibodies provided herein is usually at least 100 times greater than the K d of the AB towards the target.
  • the K d of the MM towards the AB is lower than 10 nM, or lower than 5 nM, or about 1 nM.
  • the MM of the modified antibody reduces the AB's ability to bind its target by specifically binding to the antigen-binding domain of the AB. Such binding can be non-covalent.
  • the MM of the modified antibody can reduce the AB's ability to bind its target allosterically or sterically.
  • the MM of the modified antibody does not comprise more than 50% amino acid sequence similarity to a natural binding partner of the AB.
  • the AB of the modified antibody is an antibody fragment that is selected from the group consisting of a Fab′ fragment, a F(ab′) 2 fragment, a scFv, a scAB a dAb, a single domain heavy chain antibody, and a single domain light chain antibody.
  • the AB of the modified antibody is selected from the group consisting of the antibodies in Table 2 or specifically the source of the AB is cetuximab, panitumumab, infliximab, adalimumab, efalizumab, ipilimumab, tremelimumab, adecatumumab, Hu5c8, alemtuzumab, ranibizumab, tositumomab, ibritumomab tiuxetan, rituximab, infliximab, bevacizumab, or figitumumab.
  • the modified antibody is not alemtuzumab.
  • the target of the AB is selected from the group consisting of the targets in Table 1.
  • the target is EGFR, TNFalpha, CD11a, CSFR, CTLA-4, EpCAM, VEGF, CD40, CD20, Notch 1, Notch 2, Notch 3, Notch 4, Jagged 1, Jagged 2, CD52, MUC1, IGF1R, transferrin, gp130, VCAM-1, CD44, DLL4, or IL4.
  • the target is not CD52.
  • the modified antibody further comprises a second AB wherein the target for the second AB is selected from the group consisting of the targets in Table 1.
  • the CM is a substrate for an enzyme selected from the group consisting of the enzymes in Table 3.
  • the CM is a substrate for legumain, plasmin, TMPRSS-3/4, MMP-9, MT1-MMP, cathepsin, caspase, human neutrophil elastase, beta-secretase, uPA, or PSA.
  • the modified AB comprises a CM
  • the AB is selected from the group consisting of the antibodies in Table 2; and specifically can be from cetuximab, panitumumab, infliximab, adalimumab, efalizumab, ipilimumab, tremelimumab, adecatumumab, Hu5c8, alemtuzumab, ranibizumab, tositumomab, ibritumomab tiuxetan, rituximab, infliximab, bevacizumab, or figitumumab.
  • the AB is not alemtuzumab.
  • the target is selected from the group consisting of the targets in Table 1; or the target is EGFR, TNFalpha, CD11a, CSFR, CTLA-4, EpCAM, VEGF, CD40, CD20, Notch 1, Notch 2, Notch 3, Notch 4, Jagged 1, Jagged 2, CD52, MUC1, IGF1R, transferrin, gp130, VCAM-1, CD44, DLL4, or IL4.
  • the target is not CD52.
  • the modified antibody can be further coupled to a second cleavable moiety (CM), capable of being specifically modified by an enzyme.
  • CM cleavable moiety
  • the second cleavable is a substrate for legumain, plasmin, TMPRSS-3/4, MMP-9, MT1-MMP, cathepsin, caspase, human neutrophil elastase, beta-secretase, uPA, or PSA.
  • the modified antibody further comprises a linker peptide, wherein the linker peptide is positioned between the AB and the MM; or the modified antibody further comprises a linker peptide, wherein the linker peptide is positioned between the MM and the CM; or the modified antibody further comprises a linker peptide, wherein the linker peptide is positioned between the AB and the CM; or the modified antibody further comprises two linker peptides, wherein the first linker peptide is between the AB and the CM and the second linker peptide is positioned between the MM and the CM.
  • the linker is selected from the group consisting of a cleavable linker, a non-cleavable linker, and a branched linker.
  • the modified antibody further comprises a detectable moiety.
  • the detectable moiety is a diagnostic agent.
  • the modified antibodies described herein further comprise an agent conjugated to the AB.
  • the agent is a therapeutic agent, for example an antineoplastic agent.
  • the agent is conjugated to a carbohydrate moiety of the AB, wherein the carbohydrate moiety can be located outside the antigen-binding region of the AB.
  • the agent is conjugated to a sulfhydryl group of the AB.
  • modified antibodies provided herein exhibit a serum half-life of at least 5 days when administered to an organism.
  • CISPRGC SEQ ID NO: 1
  • C(N/P)H(H/V/F)(Y/T)(F/W/T/L)(Y/G/T/S)(T/S/Y/H)CGCISPRGCG SEQ ID NO: 2
  • xCxxYQCLxxxxxx SEQ ID NO: 3
  • XXQPxPPRVXX SEQ ID NO: 4
  • PxPGFPYCxxxx SEQ ID NO: 5
  • xxxxQxxPWPP SEQ ID NO: 6
  • GxGxCYTILExxCxxxR SEQ ID NO: 7
  • GxxxCYxlxExxCxxxx SEQ ID NO: 8
  • GxxxCYxIxExWCxxxx SEQ ID NO: 9
  • xxxCCxxYxIxxCCxxx SEQ ID NO: 10
  • xxxxxYxILExxxxx SEQ ID NO: 11
  • an activatable antibody comprising an antibody or antibody fragment (AB), capable of specifically binding its target; a masking moiety (MM) coupled to the AB, capable of inhibiting the specific binding of the AB to its target; and a cleavable moiety (CM) coupled to the AB, capable of being specifically cleaved by an enzyme; wherein when the AA is not in the presence of sufficient enzyme activity to cleave the CM, the MM reduces the specific binding of the AB to its target by at least 90% when compared to when the AA is in the presence of sufficient enzyme activity to cleave the CM and the MM does not inhibit the specific binding of the AB to its target.
  • the binding of the AB to its target is reduced for at least 12 hours, or for at least 24 hours, or for at least 72 hours.
  • the dissociation constant (K d ) of the AB coupled to the MM and CM towards the target is at least 100 times greater than the K d of the AB not coupled to the MM and CM towards the target.
  • the dissociation constant (K d ) of the MM towards the AB is at least 100 times greater than the K d of the AB towards the target.
  • the K d of the MM towards the AB is lower than 10 nM, or lower than 5 nM, or about 1 nM.
  • the MM is capable of specifically binding to the antigen-binding domain of the AB.
  • the CM is capable of being specifically cleaved by an enzyme at a rate of about at least 1 ⁇ 10 4 M ⁇ 1 S ⁇ 1 , or at least 5 ⁇ 10 4 M ⁇ 1 S, or at least 10 ⁇ 10 4 M ⁇ 1 S.
  • the antibody fragment is selected from the group consisting of a Fab′ fragment, a F(ab′) 2 fragment, a scFv, a scAB a dAb, a single domain heavy chain antibody, and a single domain light chain antibody.
  • the AB of the AA is selected from the group consisting of the antibodies in Table 2.
  • the AB is cetuximab, panitumumab, infliximab, adalimumab, efalizumab, ipilimumab, tremelimumab, adecatumumab, Hu5c8, alemtuzumab, ranibizumab, tositumomab, ibritumomab tiuxetan, rituximab, infliximab, bevacizumab, or figitumumab.
  • the target of the AA is selected from the group consisting of the targets in Table 1.
  • the target is EGFR, TNFalpha, CD11a, CSFR, CTLA-4, EpCAM, VEGF, CD40, CD20, Notch 1, Notch 2, Notch 3, Notch 4, Jagged 1, Jagged 2, CD52, MUC1, IGF1R, transferrin, gp130, VCAM-1, CD44, DLL4, or IL4.
  • the AB is not alemtuzumab and target is not CD52.
  • the CM of the AA is a substrate for legumain, plasmin, TMPRSS-3/4, MMP-9, MT1-MMP, cathepsin, caspase, human neutrophil elastase, beta-secretase, uPA, or PSA.
  • the AA is further coupled to a second cleavable moiety (CM), capable of being specifically modified by an enzyme.
  • the second CM is a substrate for legumain, plasmin, TMPRSS-3/4, MMP-9, MT1-MMP, cathepsin, caspase, human neutrophil elastase, beta-secretase, uPA, or PSA.
  • the CM is located within the MM.
  • the MM does not comprise more than 50% amino acid sequence similarity to a natural binding partner of the AB.
  • the AA further comprises a linker peptide, wherein the linker peptide is positioned between the MM and the CM. In specific embodiments, the linker peptide is positioned between the AB and the CM.
  • the AAs provided herein further comprise a detectable moiety or an agent conjugated to the AB.
  • an activatable antibody complex comprising: two antibodies or antibody fragments (AB1 and AB2), each capable of specifically binding its target; at least one masking moiety (MM) coupled to either AB1 or AB2, capable of inhibiting the specific binding of AB1 and AB2 to their targets; and at least one cleavable moiety (CM) coupled to either AB1 or AB2, capable of being specifically cleaved by an enzyme whereby activating the AAC composition; wherein when the AAC is in an uncleaved state, the MM inhibits the specific binding of AB1 and AB2 to their targets and when the AAC is in a cleaved state, the MM does not inhibit the specific binding of AB1 and AB2 to their targets.
  • AAC activatable antibody complex
  • the AAC is bispecific, wherein AB1 and AB2 bind the same epitope on the same target; or the AB1 and AB2 bind to different epitopes on the same target; or the AB1 and AB2 bind to different epitopes on different targets.
  • the CM is capable of being specifically cleaved by an enzyme at a rate of about at least 1 ⁇ 10 4 M ⁇ 1 S ⁇ 1 .
  • the antibody fragment is selected from the group consisting of a Fab′ fragment, a F(ab′) 2 fragment, a scFv, a scAB a dAb, a single domain heavy chain antibody, and a single domain light chain antibody.
  • the AB1 and/or AB 2 are selected from the group consisting of the antibodies in Table 2.
  • the AB1 and/or AB2 is cetuximab, panitumumab, infliximab, adalimumab, efalizumab, ipilimumab, tremelimumab, adecatumumab, Hu5c8, alemtuzumab, ranibizumab, tositumomab, ibritumomab tiuxetan, rituximab, infliximab, bevacizumab, or figitumumab.
  • the target for the AB1 and/or AB2 is selected from the group consisting of the targets in Table 1.
  • the target of the AB1 and/or AB2 is EGFR, TNFalpha, CD11a, CSFR, CTLA-4, EpCAM, VEGF, CD40, CD20, Notch 1, Notch 2, Notch 3, Notch 4, Jagged 1, Jagged 2, CD52, MUC1, IGF1R, transferrin, gp130, VCAM-1, CD44, DLL4, or IL4.
  • the AB1 and AB2 are capable of binding to EGFR and VEGF, a Notch Receptor and EGFR, a Jagged ligand and EGFR or cMET and VEGF, respectively.
  • the CM is a substrate for an enzyme selected from the group consisting of the enzymes in Table 3.
  • the CM is a substrate for legumain, plasmin, TMPRSS-3/4, MMP-9, MT1-MMP, cathepsin, caspase, human neutrophil elastase, beta-secretase, uPA, or PSA.
  • the AAC is further coupled to a second cleavable moiety (CM), capable of being specifically cleaved by an enzyme and the second CM is a substrate for legumain, plasmin, TMPRSS-3/4, MMP-9, MT1-MMP, cathepsin, caspase, human neutrophil elastase, beta-secretase, uPA, or PSA.
  • CM cleavable moiety
  • the MM does not comprise more than 50% amino acid sequence similarity to a natural binding partner of the AB.
  • the AAC further comprises a detectable moiety or is further conjugated to an agent.
  • Also provided herein is a method of treating or diagnosing a condition in a subject including administering to the subject a composition comprising: an antibody or antibody fragment (AB), capable of specifically binding its target; a masking moiety (MM) coupled to the AB, capable of inhibiting the specific binding of the AB to its target; and a cleavable moiety (CM) coupled to the AB, capable of being specifically cleaved by an enzyme; wherein upon administration to the subject, when the AA is not in the presence of sufficient enzyme activity to cleave the CM, the MM reduces the specific binding of the AB to its target by at least 90% when compared to when the AA is in the presence of sufficient enzyme activity to cleave the CM and the MM does not inhibit the specific binding of the AB to its target.
  • AB antibody or antibody fragment
  • MM masking moiety
  • CM cleavable moiety
  • the AB is selected from the group consisting of a Fab′ fragment, a F(ab′) 2 fragment, a scFv, a scAB a dAb, a single domain heavy chain antibody, and a single domain light chain antibody.
  • the condition is cancer.
  • the MM is not the natural binding partner of the AB.
  • the AB is selected from the group consisting of the antibodies in Table 2. Specifically in some embodiments, the AB is cetuximab, panitumumab, infliximab, adalimumab, efalizumab, ipilimumab, tremelimumab, adecatumumab, Hu5c8, alemtuzumab, ranibizumab, tositumomab, ibritumomab tiuxetan, rituximab, infliximab, bevacizumab, or figitumumab.
  • the target is selected from the group of targets in Table 1.
  • the target is EGFR, TNFalpha, CD11a, CSFR, CTLA-4, EpCAM, VEGF, CD40, CD20, Notch 1, Notch 2, Notch 3, Notch 4, Jagged 1, Jagged 2, CD52, MUC1, IGF1R, transferrin, gp130, VCAM-1, CD44, DLL4, or IL4.
  • the AB is not alemtuzumab and the target is not CD52.
  • the CM is a substrate for an enzyme selected from the group consisting of the enzymes in Table 3.
  • the CM is a substrate for legumain, plasmin, TMPRSS-3/4, MMP-9, MT1-MMP, cathepsin, caspase, human neutrophil elastase, beta-secretase, uPA, or PSA.
  • Also provided herein is a method of inhibiting angiogenesis in a mammalian subject comprising administering to a subject in need thereof a therapeutically effective amount of a pharmaceutical composition comprising a modified AB, an AA, an AAC, or an AACJ wherein the target is EGFR, TNFalpha, CD11a, CSFR, CTLA-4, EpCAM, VEGF, CD40, CD20, Notch 1, Notch 2, Notch 3, Notch 4, Jagged 1, Jagged 2, CD52, MUC1, IGF1R, transferrin, gp130, VCAM-1, CD44, DLL4, or IL4.
  • a pharmaceutical composition comprising a modified AB, an AA, an AAC, or an AACJ wherein the target is EGFR, TNFalpha, CD11a, CSFR, CTLA-4, EpCAM, VEGF, CD40, CD20, Notch 1, Notch 2, Notch 3, Notch 4, Jagged 1, Jagged 2, CD52, MUC1, IGF1R, transferrin
  • the AB is cetuximab, panitumumab, infliximab, adalimumab, efalizumab, ipilimumab, tremelimumab, adecatumumab, Hu5c8, alemtuzumab, ranibizumab, tositumomab, ibritumomab tiuxetan, rituximab, infliximab, bevacizumab, or figitumumab;
  • the CM is a substrate for legumain, plasmin, TMPRSS-3/4, MMP-9, MT1-MMP, cathepsin, caspase, human neutrophil elastase, beta-secretase, uPA, or PSA.
  • an activatable antibody (AA) composition comprising: providing an antibody or antibody fragment (AB) capable of specifically binding its target; coupling a masking moiety (MM) to the AB, capable of inhibiting the specific binding of the AB to its target; and coupling a cleavable moiety (CM) to the AB, capable of being specifically cleaved by an enzyme; wherein the dissociation constant (K d ) of the AB coupled to the MM towards the target is at least 100 times greater than the K d of the AB not coupled to the MM towards the target.
  • AA activatable antibody
  • the AB is or is derived from an antibody selected from the group consisting of the antibodies in Table 2.
  • the AB is or is derived from cetuximab, panitumumab, infliximab, adalimumab, efalizumab, ipilimumab, tremelimumab, adecatumumab, Hu5c8, alemtuzumab, ranibizumab, tositumomab, ibritumomab tiuxetan, rituximab, infliximab, bevacizumab, or figitumumab.
  • the AB is not alemtuzumab and the target is not CD52.
  • the CM is a substrate for an enzyme selected from the group consisting of the enzymes in Table 3.
  • the CM is a substrate for legumain, plasmin, TMPRSS-3/4, MMP-9, MT1-MMP, cathepsin, caspase, human neutrophil elastase, beta-secretase, uPA, or PSA.
  • Also provided herein is a method of screening candidate peptides to identify a masking moiety (MM) peptide capable of binding an antibody or antibody fragment (AB) comprising: providing a library of peptide scaffolds, wherein each peptide scaffold comprises: a transmembrane protein (TM); and a candidate peptide; contacting an AB with the library; identifying at least one candidate peptide capable of binding the AB; and determining whether the dissociation constant (K d ) of the candidate peptide towards the AB is between 1-10 nM.
  • TM transmembrane protein
  • K d dissociation constant
  • the library comprises viruses, cells or spores.
  • the library comprises E. coli .
  • the peptide scaffold further comprises a detectable moiety.
  • MM masking moiety
  • AB antibody or antibody fragment
  • another screening method to identify a masking moiety (MM) peptide capable of masking an antibody or antibody fragment (AB) with an optimal masking efficiency comprising: providing a library comprising a plurality of ABs, each coupled to a candidate peptide, wherein the ABs are capable of specifically binding a target; incubating each library member with the target; and comparing the binding affinity of each library member towards the target with the binding affinity of each AB not coupled to a candidate peptide towards the target.
  • the optimal binding efficiency is when the binding affinity of a library member to the target is 10% compared to the binding affinity of the unmodified AB to the target.
  • an antibody therapeutic having an improved bioavailability wherein the affinity of binding of the antibody therapeutic to its target is lower in a first tissue when compared to the binding of the antibody therapeutic to its target in a second tissue.
  • a pharmaceutical composition comprising: an antibody or antibody fragment (AB), capable of specifically binding its target; and a pharmaceutically acceptable excipient; wherein the affinity of the antibody or antibody fragment to the target in a first tissue is lower than the affinity of the antibody or antibody fragment to the target in a second tissue.
  • the affinity in the first tissue is 10-1,000 times lower than the affinity in the second tissue.
  • the AB is coupled to a masking moiety (MM), capable of reducing the binding of the AB to its target and a cleavable moiety (CM), capable of specifically being cleaved by an enzyme.
  • the target is EGFR, TNFalpha, CD11a, CSFR, CTLA-4, EpCAM, VEGF, CD40, CD20, Notch 1, Notch 2, Notch 3, Notch 4, Jagged 1, Jagged 2, CD52, MUC1, IGF1R, transferrin, gp130, VCAM-1, CD44, DLL4, or IL4.
  • the CM is a substrate for legumain, plasmin, TMPRSS-3/4, MMP-9, MT1-MMP, cathepsin, caspase, human neutrophil elastase, beta-secretase, uPA, or PSA.
  • the antibody or antibody fragment is cetuximab, panitumumab, infliximab, adalimumab, efalizumab, ipilimumab, tremelimumab, adecatumumab, Hu5c8, alemtuzumab, ranibizumab, tositumomab, ibritumomab tiuxetan, rituximab, infliximab, bevacizumab, or figitumumab.
  • the first tissue is a healthy tissue and the second tissue is a diseased tissue; or the first tissue is an early stage tumor and the second tissue is a late stage tumor; the first tissue is a benign tumor and the second tissue is a malignant tumor; or the first tissue and second tissue are spatially separated; or the first tissue is epithelial tissue and the second tissue is breast, head, neck, lung, pancreatic, nervous system, liver, prostate, urogenital, or cervical tissue.
  • the antibody therapeutic is further coupled to an agent.
  • the agent is an antineoplastic agent.
  • compositions for diagnostic and therapeutic use comprising a legumain-activatable antibody or antibody fragment (AB) coupled to a masking moiety (MM); a composition comprising a plasmin-activatable antibody or antibody fragment (AB) coupled to a masking moiety (MM); a composition comprising a caspase-activatable antibody or antibody fragment (AB) coupled to a masking moiety (MM); a composition comprising a TMPRSS-3/4-activatable antibody or antibody fragment (AB) coupled to a masking moiety (MM); a composition comprising a PSA-activatable antibody or antibody fragment (AB) coupled to a masking moiety (MM); a composition comprising a cathepsin-activatable antibody or antibody fragment (AB) coupled to a masking moiety (MM); a composition comprising a human neutrophil elastase-activatable antibody or antibody fragment (AB) coupled to a masking moiety (MM); a
  • FIG. 1 shows a protease-activated AA containing an antibody (an AB), a masking moiety (MM), and a cleavable moiety (CM).
  • FIG. 2 shows the activity of an exemplary AA in vivo.
  • Panel A shows healthy tissue where the AA is not able to bind, side effects are minimal;
  • Panel B shows diseased tissue where the AA is activated by a disease-specific protease/reducing agent allowing the AA to bind to target and be efficacious.
  • FIG. 3 illustrates a process to produce a protease-activated AA, involving: screening for MMs; screening for CMs; assembling the MM, CM, and an AB; expressing and purifying the assembled construct; and assaying the assembled construct for activity and toxicity in vitro and in vivo.
  • FIG. 4 provides an exemplary MMP-9 cleavable masked anti-VEGF scFv amino acid sequence (SEQ ID NO: 350).
  • FIG. 5 provides ELISA data showing the MMP-9 activation of the MBP:anti-VEGFscFv AAs with the MMs 306 and 314. Samples were treated with TEV to remove the MBP fusion partner and subsequently activated by MMP-9 digestion.
  • FIG. 6 provides ELISA data demonstrating the MMP-9-dependent VEGF binding of the anti-VEGFscFv His construct with the 306 mM.
  • FIG. 7 provides ELISA data demonstrating the MMP-9-dependent VEGF binding of anti-VEGFscFv-Fc AAs with the MMs 306 and 314 from HEK cell supernatants.
  • FIG. 8 provides ELISA data showing the MMP-9-dependent VEGF binding of anti-VEGF scFv-Fc AA constructs with the MMs 306 and 314 that were purified using a Protein A column.
  • FIG. 9 shows that the 306 MM, which binds to an anti-VEGF antibody with an affinity of >600 nM, does not efficiently preclude binding to VEGF.
  • FIG. 10 shows light and heavy chains of anti-CTLA4 joined via SOE-PCR to generate scFv constructs in both orientations, V H V L and V L V H .
  • FIG. 11 shows the use of PCR to add sites for MM cloning, CM cleavage sequence, (GGS) 2 (SEQ ID NO: 111) linker on the N-terminus of the anti-CTLA4 scFv V H V L and V L V H constructs.
  • FIG. 12 shows the activation of an AA by MMP-9.
  • FIG. 13 shows that when the CM is cleaved to remove the MM, the binding of the AB is restored.
  • FIG. 14 shows the activation of an AA by a protease that leads to antibody binding indistinguishable from unmodified antibodies.
  • FIG. 15 illustrates that an AA comprising an AB with specific binding affinity to VEGF is inhibited; the activated AA binds VEGF with picomolar affinity.
  • FIG. 16 depicts that an AA comprising an AB with specific binding affinity to VEGF inhibits HUVEC proliferation.
  • FIG. 17 illustrates that cultured tumor cells demonstrate robust in situ activation of an AA comprising an AB with specific binding affinity to VEGF.
  • FIG. 18 illustrates that an AA is inactive in normal and cancer patient plasma
  • FIG. 19 illustrates the binding of anti-CTLA4 scFv to both murine and human CTLA4.
  • FIG. 20 shows a protease-activated AACJ-containing an antibody (containing an AB), a masking moiety (MM), a cleavable moiety (CM), and a conjugated agent. Upon cleavage of the CM and unmasking, the conjugated AB is released.
  • FIG. 21 shows that binding of the eCPX3.0 clones JS306, JS1825, JS1827, and JS1829 were analyzed on FACS at 3 different concentrations of DyLight labeled anti-VEGF. All three of the affinity matured peptides displayed at least 10 fold higher affinity than the JS306.
  • FIG. 22 shows the process for affinity maturation of some of the EGFR MM's.
  • FIG. 23 shows the binding curves for the on-cell affinty measurement of C225 Fab binding to MM's 3690, 3954 and 3957.
  • MMs 3954 and 3957 displayed at least 100 fold higher affinity than 3690.
  • FIG. 24 displays the Target Displacement Assay and extent of equilibrium binding as a percent of parental antibody binding.
  • FIG. 25 shows that unlike the uPA control and substrate SM16, KK1203, 1204 and 1214 show resistance to cleavage by KLK5, KLK7 and Plasmin.
  • FIG. 26 shows that unlike a non-optimized substrate, the optimized substrates Plas1237, Plas129 and Plas 1254 show resistance to cleavage by KLK5, KLK7.
  • FIG. 27 Panel A shows activation of ScFv AAs containing legumain substrates AANL (SEQ ID NO: 361) and PTNL (SEQ ID NO: 362) following treatment with 5 mg/mL legumain.
  • Panel B shows activation of an anti-VEGF IgG AA containing the legumain substrate PTNL (SEQ ID NO: 362).
  • FIG. 29 shows that masked single-chain Fv-Fc fusion pro-antibodies exhibit increased serum half-life.
  • FIG. 30 shows that the scFv-Fc serum concentration in healthy mice over 10 days.
  • the AA concentration remained stable 7 days post dose, whereas the parent scFv-Fc concentration decreased after 3 days and was almost undetectable at 10 days.
  • FIG. 31 shows that AA scFv-Fc concentrations are elevated and persist longer in serum compared with parent scFv-Fc in tumor-bearing mice. A higher percentage of the initial AA dose was detected in the serum at 3 days (B) and 3 and 7 days (A).
  • FIG. 32 shows that AA scFv-Fcs persist at higher concentrations in a multidose study in Tumor-bearing mice. AAs maintained significantly higher serum concentrations than the parent throughout the study.
  • FIG. 33 shows that AAs persist at high levels in serum of normal mice as compared to the parental antibody not modified with a MM.
  • FIG. 34 shows protease-activated activatable antibody complexes (AACs) containing one or more antibodies or fragments thereof (in this figure the ABs are referred to as ABDs), a masking moiety (MM), and a cleavable moiety (CM), where ABD1 and ABD2 are arbitrary designations for first and second ABs.
  • the MM1 and MM2 bind the domains containing ABD1 and ABD2, respectively, and act as masking moieties to interfere with target binding to an uncleaved dual target-binding AAC.
  • the target capable of binding the ABs may be the same or different target, or different binding sites of the same target.
  • FIGS. 1A , 1 D, 1 F binding of MM1 to the domain containing ABD2 on the opposite molecule forms the complex capable of acting as a masking moiety of ABD1 and ABD2.
  • FIG. 35 shows an AAC with cross-masking occurring such that target binding by both ABs is attenuated in the uncleaved state, and target binding is increased in the presence of an agent that cleaves the CM allowing the complex to disassemble.
  • the AB1 and AB2 are referred to as the ABD1 and ABD2, respectively.
  • FIG. 36 shows an AAC formed by covalent linkage of MM1 with ABD1 (AB1) such that target binding by ABD2 (AB2) is attenuated in the uncleaved state, and target binding by ABD2 (AB2) is increased in the presence of an agent that cleaves the CM allowing the complex to disassemble.
  • the AB1 and AB2 are referred to as the ABD1 and ABD2, respectively.
  • the present disclosure provides modified antibody compositions and that are useful for therapeutics and diagnostics.
  • the compositions described herein allow for greater biodistribution and improved bioavailability.
  • modified antibody compositions described herein contain at least an antibody or antibody fragment thereof (collectively referred to as AB throughout the disclosure), capable of specifically binding a target, wherein the AB is modified by a masking moiety (MM).
  • AB an antibody or antibody fragment thereof
  • MM masking moiety
  • the K d of the AB modified with a MM towards the target can be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or greater, or between 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100-1,000, 100-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000-100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-1,000,000, 10,000-10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times greater than the K d of the AB not modified with an MM or the parental AB towards the target.
  • the binding affinity of the AB modified with a MM towards the target can be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or greater, or between 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100-1,000, 100-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000-100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-1,000,000, 10,000-10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times lower than the binding affinity of the AB not modified with an MM or the parental AB towards the target.
  • the dissociation constant (K d ) of the MM towards the AB is generally greater than the K d of the AB towards the target.
  • the K d of the MM towards the AB can be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 100,000, 1,000,000 or even 10,000,000 times greater than the K d of the AB towards the target.
  • the binding affinity of the MM towards the AB is generally lower than the binding affinity of the AB towards the target.
  • the binding affinity of MM towards the AB can be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 100,000, 1,000,000 or even 10,000,000 times lower than the binding affinity of the AB towards the target.
  • the AB's ability to bind the target when modified with an MM can be reduced by at least 50%, 60%, 70%, 80%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and even 100% for at least 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, 96, hours, or 5, 10, 15, 30, 45, 60, 90, 120, 150, 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months or greater when measured in vivo or in a Target Displacement in vitro immunoabsorbant assay, as described herein.
  • the MM can inhibit the binding of the AB to the target.
  • the MM can bind the antigen binding domain of the AB and inhibit binding of the AB to its target.
  • the MM can sterically inhibit the binding of the AB to the target.
  • the MM can allosterically inhibit the binding of the AB to its target.
  • the AB when the AB is modified or coupled to a MM and in the presence of target, there is no binding or substantially no binding of the AB to the target, or no more than 0.001%, 0.01%, 0.1%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% binding of the AB to the target, as compared to the binding of the AB not modified with an MM, the parental AB, or the AB not coupled to an MM to the target, for at least 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, 96, hours, or 5, 10, 15, 30, 45, 60, 90, 120, 150, 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months or greater when measured in vivo or in a Target Displacement in vitro immunoabsorbant assay, as described herein.
  • the MM can ‘mask’ or reduce, or inhibit the specific binding of the AB to its target.
  • such coupling or modification can effect a structural change which reduces or inhibits the ability of the AB to specifically bind its target.
  • An AB coupled to or modified with an MM can be represented by the following formulae (in order from an amino (N) terminal region to carboxyl (C) terminal region:
  • the MM is not a natural binding partner of the AB.
  • the MM may be a modified binding partner for the AB which contains amino acid changes that at least slightly decrease affinity and/or avidity of binding to the AB.
  • the MM contains no or substantially no homology to the AB's natural binding partner.
  • the MM is no more than 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or 80% similar to the natural binding partner of the AB.
  • the present disclosure also provides activatable antibodies (AAs) where the AB modified by an MM can further include one or more cleavable moieties (CM). Such AAs exhibit activatable/switchable binding, to the AB's target.
  • AAs generally include an antibody or antibody fragment (AB), modified by or coupled to a masking moiety (MM) and a modifiable or cleavable moiety (CM).
  • CM contains an amino acid sequence that serves as a substrate for a protease of interest.
  • the CM provides a cysteine-cysteine disulfide bond that is cleavable by reduction.
  • the CM provides a photolytic substrate that is activatable by photolysis.
  • FIG. 1 A schematic of an exemplary AA is provided in FIG. 1 .
  • the elements of the AA are arranged so that the CM is positioned such that in a cleaved (or relatively active state) and in the presence of a target, the AB binds a target, while in an uncleaved (or relatively inactive state) in the presence of the target, specific binding of the AB to its target is reduced or inhibited.
  • the specific binding of the AB to its target can be reduced due to the due to the inhibition or masking of the AB's ability to specifically bind its target by the MM.
  • the K d of the AB modified with a MM and a CM towards the target can be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or greater, or between 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100-1,000, 100-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000-100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-1,000,000, 10,000-10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times greater than the K d of the AB not modified with an MM and a CM or the parental AB towards the target.
  • the binding affinity of the AB modified with a MM and a CM towards the target can be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or greater, or between 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100-1,000, 100-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000-100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-1,000,000, 10,000-10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times lower than the binding affinity of the AB not modified with an MM and a CM or the parental AB towards the target.
  • a modifying agent for example an enzyme, protease, reduction agent, light
  • specific binding of the AB to its target can be reduced or inhibited, as compared to the specific binding of the AB not modified with an MM and a CM or the parental AB to the target.
  • the AB's ability to bind the target when modified with an MM and a CM can be reduced by at least 50%, 60%, 70%, 80%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and even 100% for at least 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, 96 hours, or 5, 10, 15, 30, 45, 60, 90, 120, 150, 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months or greater when measured in vivo or in a Target Displacement in vitro immunoabsorbant assay, as described herein.
  • cleaved state refers to the condition of the AA following modification of the CM by a protease and/or reduction of a cysteine-cysteine disulfide, bond of the CM, and/or photoactivation.
  • uncleaved state refers to the condition of the AA in the absence of cleavage of the CM by a protease and/or in the absence reduction of a cysteine-cysteine disulfide bond of the CM, and/or in the absence of light.
  • AA is used herein to refer to an AA in both its uncleaved (native) state, as well as in its cleaved state.
  • a cleaved AA may lack an MM due to cleavage of the CM by protease, resulting in release of at least the MM (e.g., where the MM is not joined to the AA by a covalent bond (e.g., a disulfide bond between cysteine residues).
  • activatable or switchable By activatable or switchable is meant that the AA exhibits a first level of binding to a target when in a inhibited, masked or uncleaved state (i.e., a first conformation), and a second level of binding to the target in the uninhibited, unmasked and/or cleaved state (i.e., a second conformation), where the second level of target binding is greater than the first level of binding.
  • the access of target to the AB of the AA is greater in the presence of a cleaving agent capable of cleaving the CM than in the absence of such a cleaving agent.
  • the AB when the AA is in the uncleaved state, the AB is inhibited from target binding and can be masked from target binding (i.e., the first conformation is such the AB can not bind the target), and in the cleaved state the AB is not inhibited or is unmasked to target binding.
  • the CM and AB of the AA may be selected so that the AB represents a binding moiety for a target of interest, and the CM represents a substrate for a protease that is co-localized with the target at a treatment site in a subject.
  • the CM is a cysteine-cysteine disulfide bond that is cleavable as a result of reduction of this disulfide bond.
  • AAs contain at least one of a protease-cleavable CM or a cysteine-cysteine disulfide bond, and in some embodiments include both kinds of CMs.
  • the AAs can alternatively or further include a photolabile substrate, activatable by a light source.
  • the AAs disclosed herein find particular use where, for example, a protease capable of cleaving a site in the CM is present at relatively higher levels in target-containing tissue of a treatment site (for example diseased tissue; for example for therapeutic treatment or diagnostic treatment) than in tissue of non-treatment sites (for example in healthy tissue), as exemplified in FIG. 2 .
  • the AAs disclosed herein also find particular use where, for example, a reducing agent capable of reducing a site in the CM is present at relatively higher levels in target-containing tissue of a treatment or diagnostic site than in tissue of non-treatment non-diagnostic sites.
  • the AAs disclosed herein also find particular use where, for example, a light source, for example, by way of laser, capable of photolysing a site in the CM is introduced to a target-containing tissue of a treatment or diagnostic site.
  • AAs can provide for reduced toxicity and/or adverse side effects that could otherwise result from binding of the AB at non-treatment sites if the AB were not masked or otherwise inhibited from binding its target.
  • the AA contains a CM that is cleavable by a reducing agent that facilitates reduction of a disulfide bond
  • the ABs of such AAs may selected to exploit activation of an AB where a target of interest is present at a desired treatment site characterized by elevated levels of a reducing agent, such that the environment is of a higher reduction potential than, for example, an environment of a non-treatment site.
  • an AA can be designed by selecting an AB of interest and constructing the remainder of the AA so that, when conformationally constrained, the MM provides for masking of the AB or reduction of binding of the AB to its target. Structural design criteria to be taken into account to provide for this functional feature.
  • dual-target binding AAs are provided in the present disclosure. Such dual target binding AAs contain two ABs, which may bind the same or different target. In specific embodiments, dual-targeting AAs contain bispecific antibodies or antibody fragments. In one specific exemplary embodiment, the AA contains an IL17 AB and an IL23 AB.
  • the AA contains a IL12 AB and a IL23 AB, or a EGFR AB and a VEGF AB, or a IGF1R AB and EGFR AB, or a cMET AB and IGF1R AB, or a EGFR AB and a VEGF AB, or a Notch Receptor AB and a EGFR AB, or a Jagged ligand AB and a EGFR AB, or a cMET AB and a VEGF AB.
  • Dual target binding AAs can be designed so as to have a CM cleavable by a cleaving agent that is co-localized in a target tissue with one or both of the targets capable of binding to the ABs of the AA.
  • Dual target binding AAs with more than one AB to the same or different targets can be designed so as to have more than one CM, wherein the first CM is cleavable by a cleaving agent in a first target tissue and wherein the second CM is cleavable by a cleaving agent in a second target tissue, with one or more of the targets capable of binding to the ABs of the AA.
  • the first and second target tissues can be spatially separated, for example, at different sites in the organism.
  • the first and second target tissues can be the same tissue temporally separated, for example the same tissue at two different points in time, for example the first time point can be when the tissue is a healthy tumor, and the second time point can be when the tissue is a necrose
  • Dynamic range generally refers to a ratio of (a) a maximum detected level of a parameter under a first set of conditions to (b) a minimum detected value of that parameter under a second set of conditions.
  • the dynamic range refers to the ratio of (a) a maximum detected level of target protein binding to an AA in the presence of protease capable of cleaving the CM of the AA to (b) a minimum detected level of target protein binding to an AA in the absence of the protease.
  • the dynamic range of an AA can be calculated as the ratio of the equilibrium dissociation constant of an AA cleaving agent (e.g., enzyme) treatment to the equilibrium dissociation constant of the AA cleaving agent treatment.
  • the greater the dynamic range of an AA the better the switchable phenotype of the AA.
  • AAs having relatively higher dynamic range values exhibit more desirable switching phenotypes such that target protein binding by the AA occurs to a greater extent (e.g., predominantly occurs) in the presence of a cleaving agent (e.g., enzyme) capable of cleaving the CM of the AA than in the absence of a cleaving agent.
  • AAs can be provided in a variety of structural configurations. Exemplary formulae for AAs are provided below. It is specifically contemplated that the N- to C-terminal order of the AB, MM and CM may be reversed within an AA. It is also specifically contemplated that the CM and MM may overlap in amino acid sequence, e.g., such that the CM is contained within the MM.
  • AAs can be represented by the following formula (In order from an amino (N) terminal region to carboxyl (C) terminal region:
  • a linker e.g., flexible linkers
  • the AB, MM, and/or CM may not contain a sufficient number of residues (e.g., Gly, Ser, Asp, Asn, especially Gly and Ser, particularly Gly) to provide the desired flexibility.
  • the switchable phenotype of such AA constructs may benefit from introduction of one or more amino acids to provide for a flexible linker.
  • a flexible linker can be operably inserted to facilitate formation and maintenance of a cyclic structure in the uncleaved AA.
  • an AA comprises one of the following formulae (where the formula below represent an amino acid sequence in either N- to C-terminal direction or C- to N-terminal direction):
  • ABs directed against any antigen or hapten may be used.
  • ABs used in the present invention may be directed against any determinant, e.g., tumor, bacterial, fungal, viral, parasitic, mycoplasmal, histocompatibility, differentiation and other cell membrane antigens, pathogen surface antigens, toxins, enzymes, allergens, drugs, intracellular targets, and any biologically active molecules. Additionally, a combination of ABs reactive to different antigenic determinants may be used.
  • the AB is a full length antibody or an antibody fragment containing an antigen binding domain, which is capable of binding, especially specific binding, to a target of interest, usually a protein target of interest.
  • a schematic of an AA is provided in FIG. 1 .
  • the AB can be but is not limited to variable or hypervariable regions of light and/or heavy chains of an antibody (V L , V H ), variable fragments (Fv), Fab′ fragments, F(ab′) 2 fragments, Fab fragments, single chain antibodies (scAb), single chain variable regions (scFv), complementarity determining regions (CDR), domain antibodies (dAbs), single domain heavy chain immunoglobulins of the BHH or BNAR type, single domain light chain immunoglobulins, or other polypeptides known in the art containing an AB capable of binding target proteins or epitopes on target proteins.
  • the AB may be a chimera or hybrid combination containing more than on AB, for example a first AB and a second AB such that each AB is capable of binding to the same or different target.
  • the AB is a bispecific antibody or fragment thereof, designed to bind two different antigens.
  • the origin of the AB can be a naturally occurring antibody or fragment thereof, a non-naturally occurring antibody or fragment thereof, a synthetic antibody or fragment thereof, a hybrid antibody or fragment thereof, or an engineered antibody or fragment thereof.
  • the antibody can be a humanized antibody or fragment thereof.
  • more than one AB is contained in the AA.
  • the ABs can be derived from bispecific antibodies or fragments thereof.
  • the AA can be synthetically engineered so as to incorporate ABs derived from two different antibodies or fragments thereof.
  • the ABs can be designed to bind two different targets, two different antigens, or two different epitopes on the same target.
  • An AB containing a plurality of ABs capable of binding more than one target site are usually designed to bind to different binding sites on a target or targets of interest such that binding of a first AB of the AA does not substantially interfere with binding of a second AB of the AA to a target.
  • AAs containing multiple ABs can further include multiple AB-MM units, which may optionally be separated by additional CMs so that upon exposure to a modifying agent, the ABs are no longer inhibited from specifically binding their targets, or are ‘unmasked’.
  • Fab′ fragments of IgG immunoglobulins are obtained by cleaving the antibody with pepsin [resulting in a bivalent fragment, (Fab′) 2] or with papain [resulting in 2 univalent fragments, (2 Fab)].
  • pepsin resulting in a bivalent fragment, (Fab′) 2
  • papain resulting in 2 univalent fragments, (2 Fab)].
  • the bivalent (Fab′) 2 fragment can be split by mild reduction of one or a few disulfide bonds to yield univalent Fab′ fragments.
  • an AA may be delivered at an in vivo site (such as a tumor) to a pregnant female without exposing the fetus.
  • V H and V L variable regions of heavy and light chains of an antibody
  • Fv variable regions of heavy and light chains of an antibody
  • F(ab′)2, Fab fragments single chain antibodies
  • scAb single chain variable regions
  • CDR complementarity determining regions
  • dAbs domain antibodies
  • peptides such as MMs, CMs or linkers may be coupled to modify antibodies to generate the modified ABs and AAs of the disclosure.
  • AAs that contain protease-activated ABs can be developed and produced with standard methods, as described in the schematic in FIG. 3 .
  • the antibody or fragment thereof (collectively referred to as AB) is capable of specifically binding a protein target.
  • An AB of the invention can specifically bind to its target with a dissociation constant (K d ) of no more than 1000 nM, 100 nM, 50 nM, 10 nM, 5 nM, 1 nM, 500 pM, 400 pM, 350 pM, 300 pM, 250 pM, 200 pM, 150 pM, 100 pM, 50 pM, 25 pM, 10 pM, 5 pM, 1 pM, 0.5 pM, or 0.1 pM.
  • K d dissociation constant
  • Exemplary classes of targets of an AB include, but are not necessarily limited to, cell surface receptors and secreted binding proteins (e.g., growth factors), soluble enzymes, structural proteins (e.g. collagen, fibronectin) and the like.
  • AAs contemplated by the present disclosure are those having an AB capable of binding an extracellular target, usually an extracellular protein target.
  • AAs can be designed such that they are capable of cellular uptake and are designed to be switchable inside a cell.
  • the AB is a binding partner for any target listed in Table 1.
  • the AB is a binding partner for EGFR, TNFalpha, CD11a, CSFR, CTLA-4, EpCAM, VEGF, CD40, CD20, Notch 1, Notch 2, Notch 3, Notch 4, Jagged 1, Jagged 2, CD52, MUC1, IGF1R, transferrin, gp130, VCAM-1, CD44, DLL4, or IL4.
  • the AB is not a binding partner for CD52.
  • exemplary sources for ABs are listed in Table 2.
  • the source for an AB of the invention is cetuximab, panitumumab, infliximab, adalimumab, efalizumab, ipilimumab, tremelimumab, adecatumumab, Hu5c8, alemtuzumab, ranibizumab, tositumomab, ibritumomab tiuxetan, rituximab, infliximab, bevacizumab, or figitumumab.
  • the source for the AB is not alemtuzumab or is not CampathTM
  • Target Avastin TM (bevacizumab) VEGF Lucentis TM (ranibizumab) VEGF Erbitux TM (cetuximab) EGFR Vectibix TM (panitumumab) EGFR Remicade TM (infliximab) TNF ⁇ Humira TM (adalimumab) TNF ⁇ Tysabri TM (natalizumab) Integrin ⁇ 4 Simulect TM (basiliximab) IL2R Soliris TM (eculizumab) Complement C5 Raptiva TM (efalizumab) CD11a Bexxar TM (tositumomab) CD20 Zevalin TM (ibritumomab tiuxetan) CD20 Rituxan TM (rituximab) CD20 Zenapax TM (daclizumab) CD25 My
  • RaptivaTM (efalizumab): Sequence listed in Werther W A, Gonzalez T N, O'Connor S J, McCabe S, Chan B, Hotaling T, Champe M, Fox J A, Jardieu P M, Berman P W, Presta L G. Humanization of an anti-lymphocyte function-associated antigen (LFA)-1 monoclonal antibody and reengineering of the humanized antibody for binding to rhesus LFA-1. J. Immunol. 1996 Dec. 1; 157(11):4986-95.
  • LFA anti-lymphocyte function-associated antigen
  • MylotargTM (gemtuzumab ozogamicin): (Sequence listed in CO MS, Avdalovic N M, Caron P C, Avdalovic M V, Scheinberg D A, Queen C: Chimeric and humanized antibodies with specificity for the CD33 antigen. J Immunol 148:1149, 1991) (Caron P C, Schwartz M A, Co M S, Queen C, Finn R D, Graham M C, Divgi C R, Larson S M, Scheinberg D A. Murine and humanized constructs of monoclonal antibody M195 (anti-CD33) for the therapy of acute myelogenous leukemia. Cancer. 1994 Feb. 1; 73(3 Suppl):1049-56).
  • SolirisTM (eculizumab):_Hillmen P, Young N, Schubert J, Brodsky R, Socié G, Muus P, Röth A, Szer J, Elebute M, Nakamura R, Browne P, Risitano A, Hill A, Schrezenmeier H, Fu C, Maciejewski J, Rollins S, Mojcik C, Rother R, Luzzatto L (2006).
  • TysabriTM (natalizumab): Sequence listed in Leger O J, Yednock T A, Tanner L, Horner H C, Hines D K, Keen S, Saldanha J, Jones S T, Fritz L C, Bendig M M. Humanization of a mouse antibody against human alpha-4 integrin: a potential therapeutic for the treatment of multiple sclerosis. Hum Antibodies. 1997; 8(1):3-16.
  • SynagisTM (palivizumab): Sequence listed in Johnson S, Oliver C, Prince G A, Hemming V G, Reifen D S, Wang S C, Dormitzer M, O'Grady J, Koenig S, Tamura J K, Woods R, Bansal G, Couchenour D, Tsao E, Hall W C, Young J F. Development of a humanized monoclonal antibody (MEDI-493) with potent in vitro and in vivo activity against respiratory syncytial virus. J Infect Dis. 1997 November; 176(5):1215-24. Ipilimumab: J.
  • Ipilimumab Anti-CTLA4 Antibody
  • Ipilimumab causes Regression of Metastatic Renal Cell Cancer Associated With Enteritis and Hypophysitis; James C. Yang, Marybeth Hughes, Udai Kammula, Richard Royal, Richard M. Sherry, Suzanne L. Topalian, Kimberly B. Suri, Catherine Levy, Tamika Allen, Sharon Mavroukakis, Israel Lowy, Donald E. White, and Steven A. Rosenberg. Tremelimumab: Oncologist 2007; 12; 153-883; Blocking Monoclonal Antibody in Clinical Development for Patients with Cancer; Antoni Ribas, Douglas C. Hanson, Dennis A. Noe, Robert Millham, Deborah J. Guyot, Steven H. Bernstein, Paul C. Canniff, Amarnath Sharma and Jesus Gomez-Navarro.
  • the masking moiety (MM) of the present disclosure generally refers to an amino acid sequence coupled to the AB and positioned such that it reduces the AB's ability to specifically bind its target. In some cases the MM is coupled to the AB by way of a linker.
  • the K d of the AB modified with a MM towards the AB's target is generally greater than the K d of the AB not modified with a MM or the K d of parental AB towards the target.
  • the binding affinity of the AB modified with a MM towards the target is generally lower than the binding affinity of the AB not modified with a MM or the parental AB towards the target.
  • the dissociation constant (K d ) of the MM towards the AB is generally greater than the K d of the AB towards the target. Conversely, the binding affinity of the MM towards the AB is generally lower than the binding affinity of the AB towards the target.
  • the AB When the AB is modified with a MM and is in the presence of the target, specific binding of the AB to its target can be reduced or inhibited, as compared to the specific binding of the AB not modified with an MM or the specific binding of the parental AB to the target.
  • the AB When the AB is modified with a CM and a MM and is in the presence of the target but not sufficient enzyme or enzyme activity to cleave the CM, specific binding of the modified AB to the target is reduced or inhibited, as compared to the specific binding of the AB modified with a CM and a MM in the presence of the target and sufficient enzyme or enzyme activity to cleave the CM.
  • the MM can inhibit the binding of the AB to the target.
  • the MM can bind the antigen binding domain of the AB and inhibit binding of the AB to its target.
  • the MM can sterically inhibit the binding of the AB to the target.
  • the MM can allosterically inhibit the binding of the AB to its target.
  • the AB when the AB is modified or coupled to a MM and in the presence of target, there is no binding or substantially no binding of the AB to the target, or no more than 0.001%, 0.01%, 0.1%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% binding of the AB to the target, as compared to the binding of the AB not modified with an MM, the binding of the parental AB, or the binding of the AB not coupled to an MM to the target, for at least 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, 96 hours, or 5, 10, 15, 30, 45, 60, 90, 120, 150, 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months or greater when measured in vivo or in a Target Displacement in vitro immunoabsorbant assay, as described herein.
  • the MM is not a natural binding partner of the AB.
  • the MM may be a modified binding partner for the AB which contains amino acid changes that at least slightly decrease affinity and/or avidity of binding to the AB.
  • the MM contains no or substantially no homology to the AB's natural binding partner.
  • the MM is no more than 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or 80% similar to the natural binding partner of the AB.
  • the MM When the AB is in a ‘masked’ state, even in the presence of a target for the AB, the MM interferes with or inhibits the binding of the AB to the target. However, in the unmasked state of the AB, the MM's interference with target binding to the AB is reduced, thereby allowing greater access of the AB to the target and providing for target binding.
  • the modified antibody when the modified antibody is an AA and comprises a CM, the AB can be unmasked upon cleavage of the CM, in the presence of enzyme, preferably a disease-specific enzyme.
  • the MM is one that when the AA is uncleaved provides for masking of the AB from target binding, but does not substantially or significantly interfere or compete for binding of the target to the AB when the AA is in the cleaved conformation.
  • the combination of the MM and the CM facilitates the switchable/activatable phenotype, with the MM decreasing binding of target when the AA is uncleaved, and cleavage of the CM by protease providing for increased binding of target.
  • the structural properties of the MM will vary according to a variety of factors such as the minimum amino acid sequence required for interference with AB binding to target, the target protein-AB binding pair of interest, the size of the AB, the length of the CM, whether the CM is positioned within the MM and also serves to mask the AB in the uncleaved AA, the presence or absence of linkers, the presence or absence of a cysteine within or flanking the AB that is suitable for providing a CM of a cysteine-cysteine disulfide bond, and the like.
  • One strategy for masking an antibody or fragment thereof (AB) in an AA is to provide the AA in a loop that sterically hinders access of target to the AB.
  • cysteines are positioned at or near the N-terminus, C-terminus, or AB of the AA, such that upon formation of a disulfide bond between the cysteines, the AB is masked.
  • the MM is coupled to the AA by covalent binding.
  • the AA composition is prevented from binding to the target by binding the MM to an N-terminus of the AA.
  • the AA is coupled to the MM by cysteine-cysteine disulfide bridges between the MM and the AA.
  • the MM can be provided in a variety of different forms.
  • the MM can be selected to be a known binding partner of the AB, provided that the MM binds the AB with less affinity and/or avidity than the target protein to which the AB is designed to bind following cleavage of the CM so as to reduce interference of MM in target-AB binding.
  • the MM is one that masks the AB from target binding when the AA is uncleaved, but does not substantially or significantly interfere or compete for binding for target when the AA is in the cleaved conformation.
  • the AB and MM do not contain the amino acid sequences of a naturally-occurring binding partner pair, such that at least one of the AB and MM does not have the amino acid sequence of a member of a naturally occurring binding partner
  • the efficiency of the MM to inhibit the binding of the AB to its target when coupled can be measured by a Masking Efficiency measure, using an immunoabsorbant Target Displacement Assay, as described herein in the Examples section of the disclosure.
  • Masking efficiency of MMs is determined by at least two parameters: affinity of the MM for the antibody or fragment thereof and the spatial relationship of the MM relative to the binding interface of the AB to its target.
  • an MM may have high affinity but only partially inhibit the binding site on the AB, while another MM may have a lower affinity for the AB but fully inhibit target binding.
  • the lower affinity MM may show sufficient masking; in contrast, over time, that same MM may be displaced by the target (due to insufficient affinity for the AB).
  • two MMs with the same affinity may show different extents of masking based on how well they promote inhibition of the binding site on the AB or prevention of the AB from binding its target.
  • a MM with high affinity may bind and change the structure of the AB so that binding to its target is completely inhibited while another MM with high affinity may only partially inhibit binding.
  • discovery of an effective MM cannot be based only on affinity but can include an empirical measure of Masking Efficiency.
  • the time-dependent target displacement of the MM in the AA can be measured to optimize and select for MMs.
  • a novel Target Displacement Assay is described herein for this purpose.
  • the MM can be identified through a screening procedure from a library of candidates AAs having variable MMs.
  • an AB and CM can be selected to provide for a desired enzyme/target combination, and the amino acid sequence of the MM can be identified by the screening procedure described below to identify an MM that provides for a switchable phenotype.
  • a random peptide library (e.g., from about 2 to about 40 amino acids or more) may be used in the screening methods disclosed herein to identify a suitable MM.
  • MMs with specific binding affinity for an antibody or fragment thereof can be identified through a screening procedure that includes providing a library of peptide scaffolds consisting of candidate MMs wherein each scaffold is made up of a transmembrane protein and the candidate MM.
  • the library is then contacted with an entire or portion of an AB such as a full length antibody, a naturally occurring antibody fragment, or a non-naturally occurring fragment containing an AB (also capable of binding the target of interest), and identifying one or more candidate MMs having detectably bound AB.
  • Screening can include one more rounds of magnetic-activated sorting (MACS) or fluorescence-activated sorting (FACS). Screening can also included determination of the dissociation constant (K d ) of MM towards the AB and subsequent determination of the Masking Efficiency.
  • MCS magnetic-activated sorting
  • FACS fluorescence-activated sorting
  • AAs having an MM that inhibits binding of the AB to the target in an uncleaved state and allows binding of the AB to the target in a cleaved state can be identified, and can further provide for selection of an AA having an optimal dynamic range for the switchable phenotype. Methods for identifying AAs having a desirable switching phenotype are described in more detail below.
  • the MM may not specifically bind the AB, but rather interfere with AB-target binding through non-specific interactions such as steric hindrance.
  • the MM may be positioned in the uncleaved AA such that the tertiary or quaternary structure of the AA allows the MM to mask the AB through charge-based interaction, thereby holding the MM in place to interfere with target access to the AB.
  • AAs can also be provided in a conformationally constrained structure, such as a cyclic structure, to facilitate the switchable phenotype. This can be accomplished by including a pair of cysteines in the AA construct so that formation of a disulfide bond between the cysteine pairs places the AA in a loop or cyclic structure. Thus the AA remains cleavable by the desired protease while providing for inhibition of target binding to the AB. Upon cleavage of the CM, the cyclic structure is opened, allowing access of target to the AB.
  • a conformationally constrained structure such as a cyclic structure
  • the cysteine pairs can be positioned in the AA at any position that provides for a conformationally constrained AA, but that, following CM reduction, does not substantially or significantly interfere with target binding to the AB.
  • the cysteine residues of the cysteine pair are positioned in the MM and a linker flanked by the MM and AB, within a linker flanked by the MM and AB, or other suitable configurations.
  • the MM or a linker flanking an MM can include one or more cysteine residues, which cysteine residue forms a disulfide bridge with a cysteine residue positioned opposite the MM when the AA is in a folded state.
  • cysteine residues of the cysteine pair be positioned outside the AB so as to avoid interference with target binding following cleavage of the AA.
  • a cysteine of the cysteine pair to be disulfide bonded is positioned within the AB, it is desirable that it be positioned to as to avoid interference with AB-target binding following exposure to a reducing agent.
  • Exemplary AAs capable of forming a cyclic structure by disulfide bonds between cysteines can be of the general formula (which may be from either N- to C-terminal or from C- to N-terminal direction):
  • X n1 and X n2 are independently, optionally present or absent and, when present, independently represent any amino acid, and can optionally include an amino acid sequence of a flexible linker (e.g., at least one Gly, Ser, Asn, Asp, usually at least one Gly or Ser, usually at least one Gly), and n 1 and n 2 are independently selected from zero or any integer, usually nor more than 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10;
  • a flexible linker e.g., at least one Gly, Ser, Asn, Asp, usually at least one Gly or Ser, usually at least one Gly
  • n 1 and n 2 are independently selected from zero or any integer, usually nor more than 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10;
  • Cys 1 and Cys 2 represent first and second cysteines of a pair capable of forming a disulfide bond
  • X m represents amino acids of a masking motif (MM), where X is any amino acid, wherein X m can optionally include a flexible linker (e.g., at least one Gly, Ser, Asn, Asp, usually at least one Gly or Ser, usually at least one Gly); and where m is an integer greater than 1, usually 2, 3, 4, 5, 6, 7, 8, 9, 10 or more (as described above);
  • MM masking motif
  • CM represents a cleavable moiety (as described herein);
  • AB represents an antibody or fragment thereof (as described herein).
  • cyclo indicates a disulfide bond in the AA that provides for a cyclic structure of the AA.
  • formula above contemplate dual target-binding AAs wherein MM refers to an AB1 and AB refers to AB2, where AB1 and AB2 are arbitrary designations for first and second ABs, and where the target capable of binding the ABs may be the same or different target, or the same or different binding sites of the same target.
  • the AB1 and/or AB2 acts as a masking moiety to interfere with target binding to an uncleaved dual target-binding AA.
  • the cysteines can thus be positioned in the AA allow for one or two tails (represented by X n1 and X n2 above), thereby generating a lasso or omega structure when the AA is in a disulfide-bonded structure (and thus conformationally constrained state).
  • the amino acid sequence of the tail(s) can provide for additional AA features, such as binding to a target receptor to facilitate localization of the AA.
  • the MM does not inhibit cellular entry of the AA.
  • the cleavable moiety (CM) of the AA may include an amino acid sequence that can serve as a substrate for a protease, usually an extracellular protease.
  • the CM comprises a cysteine-cysteine pair capable of forming a disulfide bond, which can be cleaved by action of a reducing agent.
  • the CM comprises a substrate capable of being cleaved upon photolysis.
  • the CM is positioned in the AA such that when the CM is cleaved by a cleaving agent (e.g., a protease substrate of a CM is cleaved by the protease and/or the cysteine-cysteine disulfide bond is disrupted via reduction by exposure to a reducing agent) or by light-induced photolysis, in the presence of a target, resulting in a cleaved state, the AB binds the target, and in an uncleaved state, in the presence of the target, binding of the AB to the target is inhibited by the MM ( FIG. 2 ).
  • a cleaving agent e.g., a protease substrate of a CM is cleaved by the protease and/or the cysteine-cysteine disulfide bond is disrupted via reduction by exposure to a reducing agent
  • the AB binds the target, and in an uncleave
  • amino acid sequence of the CM may overlap with or be included within the MM, such that all or a portion of the CM facilitates masking of the AB when the AA is in the uninhibited or uncleaved or unmasked conformation.
  • the CM may be selected based on a protease that is co-localized in tissue with the desired target of the AB of the AA.
  • a target of interest is co-localized with a protease, where the substrate of the protease is known in the art.
  • the target tissue can be a cancerous tissue, particularly cancerous tissue of a solid tumor.
  • proteases having known substrates in a number of cancers, e.g., solid tumors. See, e.g., La Rocca et al, (2004) British J. of Cancer 90(7): 1414-1421.
  • Non-liming examples of disease include: all types of cancers (breast, lung, colorectal, prostate, head and neck, pancreatic, etc), rheumatoid arthritis, Crohn's disease, melanomas, SLE, cardiovascular damage, ischemia, etc.
  • anti-angiogenic targets such as VEGF
  • a suitable CM will be one which comprises a peptide substrate that is cleavable by a protease that is present at the cancerous treatment site, particularly that is present at elevated levels at the cancerous treatment site as compared to non-cancerous tissues.
  • the AB of an AA can bind VEGF and the CM can be a matrix metalloprotease (MMP) substrate, and thus is cleavable by an MMP.
  • MMP matrix metalloprotease
  • the AB of an AA can bind a target of interest and the CM can be, for example, legumain, plasmin, TMPRSS-3/4, MMP-9, MT1-MMP, cathepsin, caspase, human neutrophil elastase, beta-secretase, uPA, or PSA.
  • the AA is activated by other disease-specific proteases, in diseases other than cancer such as multiple sclerosis or rheumatoid arthritis.
  • the unmodified or uncleaved CM can allow for efficient inhibition or masking of the AB by tethering the MM to the AB.
  • the CM is modified (cleaved, reduced, photolysed), the AB is no longer inhibited or unmasked and can bind its target.
  • the AA can comprise more than one CM such that the AA would comprise, for example, a first CM (CM1) and a second CM (CM2).
  • CM1 and CM2 can be different substrates for the same enzyme (for example exhibiting different binding affinities to the enzyme), or different substrates for different enzymes, or CM1 can be an enzyme substrate and CM2 can be a photolysis substrate, or CM1 can be an enzyme substrate and CM2 can be a substrate for reduction, or CM1 can be a substrate for photolysis and CM2 can be a substrate for reduction, and the like.
  • the CM is capable of being specifically modified (cleaved, reduced or photolysed) by an agent (ie enzyme, reducing agent, light) at a rate of about 0.001-1500 ⁇ 10 4 M ⁇ 1 S ⁇ 1 or at least 0.001, 0.005, 0.01, 0.05, 0.1, 0.5, 1, 2.5, 5, 7.5, 10, 15, 20, 25, 50, 75, 100, 125, 150, 200, 250, 500, 750, 1000, 1250, or 1500 ⁇ 10 4 M ⁇ 1 S ⁇ 1 .
  • an agent ie enzyme, reducing agent, light
  • CM For specific cleavage by an enzyme, contact between the enzyme and CM is made.
  • the AA comprising an AB coupled to a MM and a CM
  • the CM can be cleaved.
  • Sufficient enzyme activity can refer to the ability of the enzyme to make contact with the CM and effect cleavage. It can readily be envisioned that an enzyme may be in the vicinity of the CM but unable to cleave because of other cellular factors or protein modification of the enzyme.
  • Exemplary substrates can include but are not limited to substrates cleavable by one or more of the following enzymes or proteases in Table 3.
  • the AB of an AA can be one that binds a target of interest and the CM can involve a disulfide bond of a cysteine pair, which is thus cleavable by a reducing agent such as, for example, but not limited to a cellular reducing agent such as glutathione (GSH), thioredoxins, NADPH, flavins, ascorbate, and the like, which can be present in large amounts in tissue of or surrounding a solid tumor.
  • GSH glutathione
  • thioredoxins thioredoxins
  • NADPH flavins
  • flavins ascorbate
  • Linkers suitable for use in compositions described herein are generally ones that provide flexibility of the modified AB or the AA to facilitate the inhibition of the binding of the AB to the target. Such linkers are generally referred to as flexible linkers. Suitable linkers can be readily selected and can be of any of a suitable of different lengths, such as from 1 amino acid (e.g., Gly) to 20 amino acids, from 2 amino acids to 15 amino acids, from 3 amino acids to 12 amino acids, including 4 amino acids to 10 amino acids, 5 amino acids to 9 amino acids, 6 amino acids to 8 amino acids, or 7 amino acids to 8 amino acids, and may be 1, 2, 3, 4, 5, 6, or 7 amino acids.
  • 1 amino acid e.g., Gly
  • Linkers can be readily selected and can be of any of a suitable of different lengths, such as from 1 amino acid (e.g., Gly) to 20 amino acids, from 2 amino acids to 15 amino acids, from 3 amino acids to 12 amino acids, including 4 amino acids to 10 amino acids, 5 amino acids to 9 amino acids, 6 amino
  • Exemplary flexible linkers include glycine polymers (G) n , glycine-serine polymers (including, for example, (GS) n , (GSGGS) n (SEQ ID NO: 12) and (GGGS) n (SEQ ID NO: 13), where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine-serine polymers are relatively unstructured, and therefore may be able to serve as a neutral tether between components.
  • Exemplary flexible linkers include, but are not limited to Gly-Gly-Ser-Gly (SEQ ID NO: 14), Gly-Gly-Ser-Gly-Gly (SEQ ID NO: 15), Gly-Ser-Gly-Ser-Gly (SEQ ID NO: 16), Gly-Ser-Gly-Gly-Gly (SEQ ID NO: 17), Gly-Gly-Gly-Ser-Gly (SEQ ID NO: 18), Gly-Ser-Ser-Ser-Gly (SEQ ID NO: 19), and the like.
  • the ordinarily skilled artisan will recognize that design of an AA can include linkers that are all or partially flexible, such that the linker can include a flexible linker as well as one or more portions that confer less flexible structure to provide for
  • modified ABs and AAs can contain additional elements such as, for example, amino acid sequence N- or C-terminal of the AA.
  • AAs can include a targeting moiety to facilitate delivery to a cell or tissue of interest.
  • the AA can be provided in the context of a scaffold protein to facilitate display of the AA on a cell surface.
  • compositions and AAs provided here in can be useful for a variety of purposes including therapeutics and diagnostics.
  • An exemplary AA provided herein can be a legumain-activatable anti-EGFR coupled to a MM, plasmin-activatable anti-EGFR coupled to a MM, TMPRSS-3/4 activatable anti-EGFR coupled to a MM, legumain-activatable cetuximab coupled to a MM, plasmin-activatable cetuximab coupled to a MM, TMPRSS-3/4 activatable cetuximab coupled to a MM, legumain-activatable vectibix coupled to a MM, plasmin-activatable vectibix coupled to a MM, or a TMPRSS-3/4 activatable vectibix coupled to a MM.
  • these AAs can be useful for the treatment of diagnosis of head and neck carcinomas, or colon, lung, or pancreatic carcinomas.
  • An exemplary AA provided herein can be a MMP9-activatable anti-TNFalpha coupled to a MM, MT1-MMP-activatable anti-TNFalpha coupled to a MM, cathepsin-activatable anti-TNFalpha coupled to a MM, MMP9-activatable infliximab coupled to a MM, MT1-MMP-activatable infliximab coupled to a MM, cathepsin-activatable infliximab coupled to a MM, MMP9-activatable adalimumab coupled to a MM, MT1-MMP-activatable adalimumab coupled to a MM, or a cathepsin-activatable adalimumab coupled to a MM.
  • these AAs can be useful for the treatment of diagnosis of rheumatoid arthritis or multiple sclerosis.
  • An exemplary AA provided herein can be a legumain-activatable anti-CD11a coupled to a MM, plasmin-activatable anti-CD11a coupled to a MM, caspase-activatable anti-CD11a coupled to a MM, cathepsin-activatable anti-CD11a coupled to a MM, legumain-activatable efalizumab coupled to a MM, plasmin-activatable efalizumab coupled to a MM, caspase-activatable efalizumab coupled to a MM, cathepsin-activatable efalizumab coupled to a MM, legumain-activatable anti-CSFR coupled to a MM, plasmin-activatable anti-CSFR coupled to a MM, caspase-activatable anti-CSFR coupled to a MM, or a cathepsin-activatable anti-CSFR coupled to a MM.
  • An exemplary AA provided herein can be a plasmin-activatable anti-CTLA-4 coupled to a MM, caspase-activatable anti-CTLA-4 coupled to a MM, MT1-MMP-activatable anti-CTLA-4 coupled to a MM, plasmin-activatable ipilimumab coupled to a MM, caspase-activatable ipilimumab coupled to a MM,
  • these AAs can be useful for the treatment or diagnosis of malignant melanomas.
  • An exemplary AA provided herein can be a PSA-activatable anti-EPCAM coupled to a MM, legumain-activatable anti-EPCAM coupled to a MM, PSA-activatable adecatumumab coupled to a MM or a legumain-activatable adecatumumab coupled to a MM.
  • these AAs can be useful for the treatment or diagnosis of prostate cancer.
  • An exemplary AA provided herein can be a human neutrophil elastase-activatable anti-CD40L coupled to a MM, or a human neutrophil elastase-activatable Hu5c8 coupled to a MM. In some embodiments these AAs can be useful for the treatment or diagnosis of lymphomas.
  • An exemplary AA provided herein can be a beta-secretase-activatable anti-Notch1 coupled to a MM, legumain-activatable anti-Notch1 coupled to a MM, plasmin-activatable anti-Notch1 coupled to a MM, uPA-activatable anti-Notch1 coupled to a MM, beta-secretase-activatable anti-Notch3 coupled to a MM, legumain-activatable anti-Notch3 coupled to a MM, plasmin-activatable anti-Notch3 coupled to a MM, uPA-activatable anti-Notch3 coupled to a MM, beta-secretase-activatable anti-Jagged1 coupled to a MM, legumain-activatable anti-Jagged1 coupled to a MM, plasmin-activatable anti-Jagged1 coupled to a MM, uPA-activatable anti-Jagged1 coupled to a MM, beta
  • An exemplary AA provided herein can be a MMP-activatable anti-CD52 coupled to a MM, or a MMP-activatable anti-campath coupled to a MM. In some embodiments these AAs can be useful for the treatment or diagnosis of multiple sclerosis.
  • An exemplary AA provided herein can be a MMP-activatable anti-MUC1 coupled to a MM, legumain-activatable anti-MUC1 coupled to a MM, plasmin-activatable anti-MUC1 coupled to a MM, or a uPA-activatable anti-MUC1 coupled to a MM.
  • these AAs can be useful for the treatment or diagnosis of epithelial derived tumors.
  • An exemplary AA provided herein can be a legumain-activatable anti-IGF1R coupled to a MM, plasmin-activatable anti-IGF1R coupled to a MM, caspase-activatable anti-IGF1R coupled to a MM, legumain-activatable anti-figitumumab coupled to a MM, plasmin-activatable anti-figitumumab coupled to a MM, or a caspase-activatable anti-figitumumab coupled to a MM.
  • these AAs can be useful for the treatment or diagnosis of non-small cell lung, and other epithelial tumors.
  • An exemplary AA provided herein can be a legumain-activatable anti-transferrin receptor coupled to a MM, plasmin-activatable anti-transferrin receptor coupled to a MM, or a caspase-activatable anti-transferrin receptor coupled to a MM. In some embodiments these AAs can be useful for the treatment or diagnosis of solid tumors, pancreatic tumors.
  • An exemplary AA provided herein can be a legumain-activatable anti-gp130 coupled to a MM, plasmin-activatable anti-gp130 coupled to a MM, or a uPA-activatable anti-gp130 coupled to a MM. In some embodiments these AAs can be useful for the treatment or diagnosis of solid tumors.
  • activatable antibody compositions include an legumain masked AB specific for Notch1, a uPA activatable masked AB specific for Jagged1, a plasmin activatable, masked anti-VEGF scFv, a MMP-9 activatable, masked anti-VCAM scFv, and a MMP-9 activatable masked anti-CTLA4.
  • AAs are provided by way of example only and such enzyme activatable masked antibody AAs could be designed to any target as listed in but not limited to those in Table 1 and by using any antibody as listed in but not limited to those in Table 2.
  • the AA exists as a complex (AAC) comprising two or more ABs, as depicted in FIGS. 34-36 .
  • AACs activatable antibodies
  • AACs generally include one or more antibodies or antibody fragments (ABs), masking moieties (MMs), and cleavable moieties (CMs).
  • ABs antibodies or antibody fragments
  • MMs masking moieties
  • CMs cleavable moieties
  • the CM contains an amino acid sequence that serves as a substrate for a protease of interest.
  • the CM provides a cysteine-cysteine disulfide bond that is cleavable by reduction.
  • the AAC exhibits an activatable conformation such that at least one AB is less accessible to target when unmodified than after modification of the CM, e.g., in the presence of a cleavage agent (e.g., a protease that recognizes the cleavage site of the CM) or a reducing agent (e.g. a reducing agent that reduces disulfide bonds in the CM).
  • a cleavage agent e.g., a protease that recognizes the cleavage site of the CM
  • a reducing agent e.g. a reducing agent that reduces disulfide bonds in the CM
  • the CM and AB of the AAC may be selected so that the AB represents a binding moiety for a target of interest, and the CM represents a substrate for a protease that is co-localized with the target at a treatment site in a subject.
  • AACs can provide for reduced toxicity and/or adverse side effects that could otherwise result from binding of the ABs at non-treatment sites if they were not masked.
  • the AAC can further comprise a detectable moiety or a diagnostic agent.
  • the AAC is conjugated to a therapeutic agent located outside the antigen binding region.
  • AACs can also be used in diagnostic and/or imaging methods or to detect the presence or absence of a cleaving agent in a sample.
  • FIG. 43 A schematic of an AAC is provided in FIG. 43 .
  • the elements of the AAC are arranged so that the CM is positioned such that in a cleaved state (or relatively active state) and in the presence of a target, the AB binds a target, while in an uncleaved state (or relatively inactive state) in the presence of the target, binding of the ABs to the target is inhibited due to the masking of the ABs by the MM in the complex.
  • the term cleaved state refers to the condition of the AAC following cleavage of the CM by a protease and/or reduction of a cysteine-cysteine disulfide bond of the CM.
  • uncleaved state refers to the condition of the AAC in the absence of cleavage of the CM by a protease and/or in the absence reduction of a cysteine-cysteine disulfide bond of the CM.
  • AAC is used herein to refer to AAC in both its uncleaved (native) state, as well as in its cleaved state.
  • a cleaved AAC may lack an MM due to cleavage of the CM by protease, resulting in release of at least the MM (e.g., where the MM is not joined to the AAC by a covalent bond.)
  • activatable or switchable By activatable or switchable is meant that the AAC exhibits a first level of binding to a target when in a native or uncleaved state (i.e., a first conformation), and a second level of binding to the target in the cleaved state (i.e., a second conformation), where the second level of target binding is greater than the first level of binding.
  • access of target to the AB of the AAC is greater in the presence of a cleaving agent capable of cleaving the CM than in the absence of such a cleaving agent.
  • the AB in the native or uncleaved state the AB is masked from target binding (i.e., the first conformation is such that it interferes with access of the target to the AB), and in the cleaved state the AB is unmasked to target binding.
  • an AAC can be designed by selecting an AB(s) of interest and constructing the remainder of the AAC so that, when conformationally constrained, the MM provides for masking of the AB.
  • Dual target binding AACs contain two ABs, which may bind the same or different target.
  • dual-targeting AACs contain bispecific antibodies or antibody fragments.
  • a complex is comprised of two activatable antibodies (AA), each containing an AB, CM, and MM such that cross-masking occurs—that is, the MM on one AA interferes with target binding by the AB on the other AA ( FIG. 34A ).
  • a complex is comprised of two AAs, with each AA containing an AB and one containing a CM and MM such that universal cross-masking occurs—that is, the MM effects formation of the complex and interferes with target binding by the ABs on both AAs ( FIG. 34B ).
  • a complex is comprised of two AAs, each containing two ABs, CMs, and MMs such that cross-masking occurs—that is, the MMs on one AA interfere with target binding by the ABs on the other AA ( FIG. 34C ).
  • a complex is comprised of two AAs, with one AA containing two ABs, CMs, and MMs such that universal cross-masking occurs—that is, the MMs interfere with target binding by the ABs on both AAs ( FIG. 34D ).
  • a complex is comprised of two molecules of a bispecific AA where the bispecific AA contains two ABs, CMs, and MMs such that cross-masking occurs in the complex—that is, the MM1 interferes with target binding by the AB1 on the opposite molecule, and the MM2 interferes with target binding by the AB2 on the opposite molecule ( FIG. 34E ).
  • a complex is comprised of two molecules of a bispecific AA where the bispecific AA contains two ABs, one CM, and one MM such that universal cross-masking occurs in the complex—that is, the MM interferes with target binding by both ABs ( FIG. 34F ).
  • disassembly of the AAC and access of targets to at least one of the ABs of the AACs are greater in the presence of a cleaving agent capable of cleaving the CMs than in the absence of such a cleaving agent ( FIG. 35 ).
  • the two AAs of a complex may contain ABs that bind different targets, or that bind different epitopes on the same target.
  • One of the MM/AB pairs of the complex may be used for stable complex formation and have no therapeutic target on its own.
  • a high affinity MM for the non-therapeutic AB allows a stable complex to form, even with a lower affinity MM for the therapeutic AB.
  • the low affinity MM for the therapeutic AB in the context of the multivalent complex, will be sufficient for masking the therapeutic AB, but after cleavage will more readily dissociate.
  • the difference in affinity of the MM and target for the AB should be maximized
  • an AB may form a covalent linkage to an MM on the opposite molecule of the complex.
  • the complex In the presence of a cleaving agent the complex disassembles such that at least one of the other ABs will bind its target ( FIG. 36 ).
  • Such a covalent linkage may form between reactive amino acid side chains in the MM and AB, eg. disulfide bond between cysteines, or by chemical conjugation of reactive groups to the MM and a catalytic AB.
  • covalent binding antibodies see Chmura A. J. et al., Proc Natl Acad Sci USA. 2001 Jul. 17, 98(15): 8480-8484; Rader, C. et al., Proc Natl Acad Sci USA. 2003 Apr. 29, 100(9): 5396-5400; Armentano, F. et al., Immunology Letters 2006 Feb. 28, 103(1): 51-57.
  • MM and CM are indicated as distinct components, it is contemplated that the amino acid sequences of the MM and the CM could overlap, e.g., such that the CM is completely or partially contained within the MM.
  • linkers e.g., flexible linkers
  • the AACs can contain additional elements such as, for example, amino acid sequence N- or C-terminal of the AAC.
  • the AB of the AA is further conjugated to an agent such as a therapeutic agent, thus producing activatable antibody conjugates (AACJs), a specific type of AA.
  • AACJs activatable antibody conjugates
  • the agent is attached either directly or via a linker to the AB.
  • Such agents or linkers are selectively attached to those areas of ABs which are not a part of nor directly involved with the antigen binding site of the molecule.
  • An exemplary AACJ is pictured in FIG. 20 .
  • an agent may be conjugated to an AB.
  • immunoglobulin classes that are known to activate complement are used.
  • carrier immunoglobulins may be used which are not capable of complement activation.
  • immunoglobulin carriers may include: certain classes of antibodies such IgM, IgA, IgD, IgE; certain subclasses of IgG; or certain fragments of immunoglobulins, e.g., half ABs (a single heavy: light chain pair), or Fab, Fab′ or (Fab′) 2 fragments.
  • Exemplary AACJs are AAs coupled to a therapeutic agent wherein the AB is directed to EGFR, CD44, Notch1, 2, 3 or 4 Jagged1 or 2, EpCAM, or IGF-1R.
  • the chemical linking methods described herein allow the resulting AACJ to retain the ability to bind antigen and to activate the complement cascade (when the unconjugated AA also had such ability).
  • the linker is designed to be susceptible to cleavage by complement and so the agent can be cleaved at the target site by one or more of the enzymes of the complement cascade. The majority of the release of the agent occurs following delivery to the target site.
  • AACJs deliver the agent to the target cells. More importantly, however, once attached to the target cell, the method described in the present invention allows the release or activation of the active or activatable therapeutic agent.
  • Release or activation may be mediated by the individual's activated by but not limited to the following: complement enzymes, tissue plasminogen activator, urokinase, plasmin or another enzyme having proteolytic activity, or by activation of a photosensitizer or substrate modification.
  • the agent is then free to permeate the target sites, e.g., tumor mass.
  • the agent will act on tumor cells that do not possess the antigenic determinant or could not internalize the conjugate. Additionally, the entire process is not dependent upon internalization of the conjugate.
  • the present invention utilizes several methods for attaching agents to ABs (which include antibodies and fragments thereof), two exemplary methods being attachment to the carbohydrate moieties of the AB, or attachment to sulfhydryl groups of the AB.
  • the attachment does not significantly change the essential characteristics of the AB or the AA itself, such as immunospecificity and immunoreactivity. Additional considerations include simplicity of reaction and stability of the antibody conjugate produced.
  • the AB is first conjugated to one or more agents of interest followed by attachment of an MM and CM to produce an AACJ.
  • the AB is first attached to a MM and CM following which an agent of interest is further conjugated producing an AACJ.
  • agents may be conjugated to the carbohydrate moiety of an AB.
  • Some of the carbohydrate moieties are located on the Fc region of the immunoglobulin and are required in order for Cl binding to occur.
  • the carbohydrate moiety of the Fc region of an immunoglobulin may be utilized in the scheme described herein in the embodiments where the AB is an antibody or antibody fragment that includes at least part of an Fc region.
  • the Fab or Fab′ fragments of any immunoglobulins which contain carbohydrate moieties may be utilized in the reaction scheme described herein.
  • An example of such an immunoglobulin is the human IgM sequenced by Putnam et al. (1973, Science 182: 287).
  • the carbohydrate side chains of antibodies, Fab or Fab′ fragments or other fragments containing an AB may be selectively oxidized to generate aldehydes.
  • oxidizing agents can be used, such as periodic acid, paraperiodic acid, sodium metaperiodate and potassium metaperiodate.
  • the resulting aldehydes may then be reacted with amine groups (e.g., ammonia derivatives such as primary amine, secondary amine, hydroxylamine, hydrazine, hydrazide, phenylhydrazine, semicarbazide or thiosemicarbazide) to form a Schiff base or reduced Schiff base (e.g., imine, enamine, oxime, hydrazone, phenylhydrazone, semicarbazone, thiosemicarbazone or reduced forms thereof).
  • amine groups e.g., ammonia derivatives such as primary amine, secondary amine, hydroxylamine, hydrazine, hydrazide, phenylhydrazine, semicarbazide or thiosemicarbazide
  • Oxidation of antibodies with these oxidizing agents can be carried out by known methods.
  • the AB is used generally in the form of an aqueous solution, the concentration being generally less than 100 mg/ml, preferably 1 to 20 mg/ml.
  • an oxygen acid or a salt thereof is used as the oxidizing agent, it is used generally in the form of an aqueous solution, and the concentration is generally 0.001 to 10 mM, sometimes 1.0 to 10 mM.
  • the amount of the oxygen acid or salt thereof depends on the kind of AB, but generally it is used in excess, for example, twice to ten times as much as the amount of the oxidizable carbohydrate. The optimal amount, however, can be determined by routine experimentation.
  • the optional ranges include a pH of from about 4 to 8, a temperature of from 0° to 37° C., and a reaction period of from about 15 minutes to 12 hours.
  • the reaction can be carried in minimal light to prevent over oxidation.
  • the carbohydrate moiety of the AB may be modified by enzymatic techniques so as to enable attachment to or reaction with other chemical groups.
  • an enzyme is galactose oxidase which oxidizes galactose in the presence of oxygen to form an aldehyde. Oxidation of the carbohydrate portion of ABs may also be done with the enzyme, galactose oxidase (Cooper et al., 1959, J. Biol. Chem. 234:445-448).
  • the antibody is used in aqueous solution, the concentration being generally 0.5 to 20 mg/ml.
  • the enzyme generally is used at about 5 to 100 units per ml of solution, at a pH ranging from about 5.5 to about 8.0. The influence of pH, substrate concentration, buffers and buffer concentrations on enzyme reaction are reported in Cooper et al., supra.
  • the AB conjugates, AA conjugates, or AB linker-intermediates of the invention may be produced by reacting the oxidized AB with any linker or agent having an available amine group selected from the group consisting of primary amine, secondary amine, hydrazine, hydrazide, hydroxylamine, phenylhydrazine, semicarbazide and thiosemicarbazide groups.
  • a solution of the oxidized AB or AB linker at a concentration of from about 0.5 to 20 mg/ml is mixed with the agent or linker (molar ratios of reactive amine group to antibody aldehyde ranging from about 1 to about 10,000) and the solution incubated for from about 1 to 18 hours. Suitable temperatures are from 0° to 37° C. and pH may be from about 6 to 8.
  • a suitable reducing agent such as sodium cyanoborohydride or sodium borohydride.
  • free sulfhydryl groups can be generated from the disulfide bonds of the immunoglobulin molecule. This is accomplished by mild reduction of the antibody.
  • the disulfide bonds of IgG which are generally susceptible to reduction, are those that link the two heavy chains.
  • the disulfide bonds located near the antigen binding region of the antibody remain relatively unaffected. Such reduction results in the loss of ability to fix complement but does not interfere with antibody-antigen binding ability (Karush et al, 1979, Biochem. 18: 2226-2232).
  • the free sulfhydryl groups generated in the intra-heavy chain region can then react with reactive groups of a linker or agent to form a covalent bond which will reduce intereference with the antigen binding site of the immunoglobulin.
  • reactive groups include, but are not limited to, reactive haloalkyl groups (including, for example, haloacetyl groups), p-mercuribenzoate groups and groups capable of Michael-type addition reactions (including, for example, maleimides and groups of the type described in Mitra and Lawton, 1979, J. Amer. Chem. Soc. 101: 3097-3110).
  • the haloalkyl can be any alkyl group substituted with bromine, iodine or chlorine.
  • AB-agent conjugates which are produced by attachment to free sulfhydryl groups of reduced immunoglobulin or reduced antibody fragments do not or negligibly activate complement.
  • these conjugates may be used in in vivo systems where cleavage and release of the agent is not desirable (e.g., an enzyme that acts on a specific substrate).
  • Such conjugates may also be used when non-complement mediated release is desired.
  • the agent may be linked to sulfhydryl groups on the reduced AB via linkers which are susceptible to cleavage by enzymes having proteolytic activity, including but not limited to trypsin, urokinase, plasmin, tissue plasminiogen activator and the like.
  • an agent joined to a complement-sensitive substrate linker can be attached to sulfhydryls of reduced ABs or AAs and delivered to the target in a mixture with non conjugated AAs that are capable of activating complement. The latter would activate complement which would cleave the agent from the former.
  • the substrate linkers or the agents are modified by attaching an iodoalkyl group to one end of the linker.
  • the unmodified site on the linker may or may not be covalently attached to an agent.
  • the substrate linkers which are ester or amide linked to agents are modified by the addition of an iodoalkyl group thus forming an iodoalkyl derivative.
  • the linker may be one that is susceptible or resistant to cleavage by activated complement, trypsin, plasmin, tissue plasminogen activator, urokinase or another specific enzyme having proteolytic activity.
  • ABs may be attached to any agent which retains its essential properties after reaction with the AB, and which enables the AB to substantially retain immunospecificity and immunoreactivity allowing the AA to function as appropriate.
  • the agent can include all chemical modifications and derivatives of agents which substantially retain their biological activity.
  • the agent When it is desired to attach an aldehyde of the oxidized carbohydrate portion of an AB to an agent, the agent should contain an amine group selected from the group consisting of primary amine, secondary amine, hydrazine, hydrazide, hydroxylamine, phenylhydrazine, semicarbazide and thiosemicarbazide groups. If the agent does not contain any such amino group, the agent can be modified to introduce a suitable amine group available for coupling.
  • the agent to be attached to an AB for use in an AA is selected according to the purpose of the intended application (i.e, killing, prevention of cell proliferation, hormone therapy or gene therapy).
  • agents may include but is not limited to, for example, pharmaceutical agents, toxins, fragments of toxins, alkylating agents, enzymes, antibiotics, antimetabolites, antiproliferative agents, hormones, neurotransmitters, DNA, RNA, siRNA, oligonucleotides, antisense RNA, aptamers, diagnostics, radioopaque dyes, radioactive isotopes, fluorogenic compounds, magnetic labels, nanoparticles, marker compounds, lectins, compounds which alter cell membrane permeability, photochemical compounds, small molecules, liposomes, micelles, gene therapy vectors, viral vectors, and the like.
  • Non-limiting Table 4 lists some of the exemplary pharmaceutical agents that may be employed in the herein described invention but in no way is meant to be an exhaustive list. Finally, combinations of agents or combinations of different classes of agents
  • photochemicals including photosensitizers and photothermolytic agents may be used as agents.
  • Efficient photosensitizers include, but are not limited to porphyrins and modified porphyrins (e.g., hematoporphyrin, hematoporphyrin dihyddrazide, deuteroporphyrin dihydrazide and protoporphyrin dihydrazide), rose bengal, acridines, thiazines, xanthenes, anthraquinones, azines, flavin and nonmetal-containing porphyrins, porphyrin-like compounds, methylene blue, eosin, psoralin and the like.
  • photosensitizers include, but are not limited to tetracyclines (e.g., dimethylchlor tetracycline) sulfonamides (e.g., sulfanilamide), griseofulvin, phenothiazines, (e.g., chlorpromazine), thiazides, sulfonylurea, and many others.
  • Photochemicals may be designed or synthetically prepared to absorb light at specific wavelengths. Photothermolytic agents, such as Azure A, which are activated at the site of action by a light source (see Anderson and Parrish, 1983, Science 220: 524-527) may be utilized as agents.
  • enzymes that catalyze substrate modification with the production of cytotoxic by-products may be used as agents.
  • examples of such enzymes include but are not limited to glucose oxidase, galactose oxidase, xanthene oxidase and the like.
  • ANTIVIRALS Acyclovir Burroughs-Wellcome Vira A ester/amide Parke-Davis Symmetrel amide Endo III.
  • the present invention utilizes several methods for attaching agents to ABs: (a) attachment to the carbohydrate moieties of the AB, or (b) attachment to sulfhydryl groups of the AB.
  • ABs may be covalently attached to an agent through an intermediate linker having at least two reactive groups, one to react with AB and one to react with the agent.
  • the linker which may include any compatible organic compound, can be chosen such that the reaction with AB (or agent) does not adversely affect AB reactivity and selectivity. Furthermore, the attachment of linker to agent might not destroy the activity of the agent.
  • Suitable linkers for reaction with oxidized antibodies or oxidized antibody fragments include those containing an amine selected from the group consisting of primary amine, secondary amine, hydrazine, hydrazide, hydroxylamine, phenylhydrazine, semicarbazide and thiosemicarbazide groups.
  • Such reactive functional groups may exist as part of the structure of the linker, or may be introduced by suitable chemical modification of linkers not containing such groups.
  • suitable linkers for attachment to reduced ABs include those having certain reactive groups capable of reaction with a sulfhydryl group of a reduced antibody or fragment.
  • reactive groups include, but are not limited to: reactive haloalkyl groups (including, for example, haloacetyl groups), p-mercuribenzoate groups and groups capable of Michael-type addition reactions (including, for example, maleimides and groups of the type described by Mitra and Lawton, 1979, J. Amer. Chem. Soc. 101: 3097-3110).
  • the agent may be attached to the linker before or after the linker is attached to the AB. In certain applications it may be desirable to first produce an AB-linker intermediate in which the linker is free of an associated agent. Depending upon the particular application, a specific agent may then be covalently attached to the linker. In other embodiments the AB is first attached to the MM, CM and associated linkers and then attached to the linker for conjugation purposes.
  • branched linkers which have multiple sites for attachment of agents are utilized.
  • a single covalent attachment to an AB would result in an AB-linker intermediate capable of binding an agent at a number of sites.
  • the sites may be aldehyde or sulfhydryl groups or any chemical site to which agents can be attached.
  • higher specific activity can be achieved by attachment of a single site linker at a plurality of sites on the AB.
  • This plurality of sites may be introduced into the AB by either of two methods. First, one may generate multiple aldehyde groups and/or sulfhydryl groups in the same AB. Second, one may attach to an aldehyde or sulfhydryl of the AB a “branched linker” having multiple functional sites for subsequent attachment to linkers.
  • the functional sites of the branched linker or multiple site linker may be aldehyde or sulfhydryl groups, or may be any chemical site to which linkers may be attached. Still higher specific activities may be obtained by combining these two approaches, that is, attaching multiple site linkers at several sites on the AB.
  • Peptide linkers which are susceptible to cleavage by enzymes of the complement system, such as but not limited to urokinase, tissue plasminogen activator, trypsin, plasmin, or another enzyme having proteolytic activity may be used in one embodiment of the present invention.
  • an agent is attached via a linker susceptible to cleavage by complement.
  • the antibody is selected from a class which can activate complement. The antibody-agent conjugate, thus, activates the complement cascade and releases the agent at the target site.
  • an agent is attached via a linker susceptible to cleavage by enzymes having a proteolytic activity such as a urokinase, a tissue plasimogen activator, plasmin, or trypsin.
  • a linker susceptible to cleavage by enzymes having a proteolytic activity such as a urokinase, a tissue plasimogen activator, plasmin, or trypsin.
  • Non-liming examples of cleavable linker sequences are provided in Table 5.
  • agents may be attached via disulfide bonds (for example, the disulfide bonds on a cysteine molecule) to the AB. Since many tumors naturally release high levels of glutathione (a reducing agent) this can reduce the disulfide bonds with subsequent release of the agent at the site of delivery.
  • glutathione a reducing agent
  • the reducing agent that would modify a CM would also modify the linker of the conjugated AA.
  • linker in such a way as to optimize the spacing between the agent and the AB of the AA. This may be accomplished by use of a linker of the general structure:
  • W is either —NH—CH 2 — or —CH 2 —;
  • Q is an amino acid, peptide; and
  • n is an integer from 0 to 20.
  • the linker may comprise a spacer element and a cleavable element.
  • the spacer element serves to position the cleavable element away from the core of the AB such that the cleavable element is more accessible to the enzyme responsible for cleavage.
  • Certain of the branched linkers described above may serve as spacer elements.
  • linker to agent or of spacer element to cleavable element, or cleavable element to agent
  • attachment of linker to agent need not be particular mode of attachment or reaction. Any reaction providing a product of suitable stability and biological compatibility is acceptable.
  • an AB that is an antibody of a class which can activate complement is used.
  • the resulting conjugate retains both the ability to bind antigen and activate the complement cascade.
  • an agent is joined to one end of the cleavable linker or cleavable element and the other end of the linker group is attached to a specific site on the AB.
  • the agent has an hydroxy group or an amino group, it may be attached to the carboxy terminus of a peptide, amino acid or other suitably chosen linker via an ester or amide bond, respectively.
  • such agents may be attached to the linker peptide via a carbodimide reaction.
  • the agent contains functional groups that would interfere with attachment to the linker, these interfering functional groups can be blocked before attachment and deblocked once the product conjugate or intermediate is made.
  • the opposite or amino terminus of the linker is then used either directly or after further modification for binding to an AB which is capable of activating complement.
  • Linkers may be of any desired length, one end of which can be covalently attached to specific sites on the AB of the AA.
  • the other end of the linker or spacer element may be attached to an amino acid or peptide linker
  • conjugates when administered to a subject, will accomplish delivery and release of the agent at the target site, and are particularly effective for the in vivo delivery of pharmaceutical agents, antibiotics, antimetabolites, antiproliferative agents and the like as presented in but not limited to those in Table 4.
  • the AA may be conjugated to one or more therapeutic agents using certain biochemical cross-linkers.
  • Cross-linking reagents form molecular bridges that tie together functional groups of two different molecules.
  • hetero-bifunctional cross-linkers can be used that eliminate unwanted homopolymer formation. Exemplary hetero-bifunctional cross-linkers are referenced in Table 6.
  • the conjugate may be designed so that the agent is delivered to the target but not released. This may be accomplished by attaching an agent to an AB either directly or via a non-cleavable linker.
  • non-cleavable linkers may include amino acids, peptides, D-amino acids or other organic compounds which may be modified to include functional groups that can subsequently be utilized in attachment to ABs by the methods described herein.
  • A-general formula for such an organic linker could be
  • W is either —NH—CH2- or —CH2-;
  • Q is an amino acid, peptide; and
  • n is an integer from 0 to 20.
  • a compound may be attached to ABs which do not activate complement.
  • this attachment may be accomplished using linkers that are susceptible to cleavage by activated complement or using linkers that are not susceptible to cleavage by activated complement.
  • AA-agent conjugates (AACJs) of the invention are useful in therapeutics, diagnostics, substrate modification and the like.
  • the AACJs of the invention are useful in a variety of therapeutic in vivo applications such as but not limited to the treatment of neoplasms, including cancers, adenomas, and hyperplasias; certain immunological disorders, including autoimmune diseases, graft-versus-host diseases (e.g., after bone marrow transplantation), immune suppressive diseases, e.g., after kidney or bone marrow transplantation.
  • Treatment of such cellular disorders involving, for example, bone marrow transplantation may include purging (by killing) undesired cells, e.g., malignant cells or mature T lymphocytes.
  • Therapeutic applications center generally on treatment of various cellular disorders, including those broadly described above, by administering an effective amount of the antibody-agent conjugates of the invention.
  • the properties of the antibody are such that it is immunospecific for and immunoreactive with a particular antigen render it ideally suited for delivery of agents to specific cells, tissues, organs or any other site having that particular antigen.
  • the AACJ functions to deliver the conjugate to the target site.
  • ABs, linkers, and agents used to make the AACJs depends upon the purpose of delivery.
  • the delivery and release or activation of agents at specific target sites may result in selective killing or inhibition of proliferation of tumor cells, cancer cells, fungi, bacteria, parasites, or virus.
  • the targeted delivery of hormones, enzymes, or neurotransmitters to selected sites may also be accomplished.
  • the method of the present invention may have an application in gene therapy programs wherein DNA or specific genes may be delivered in vivo or in vitro to target cells that are deficient in that particular gene.
  • the conjugates may be used to reduce or prevent the activation of oncogenes, such as myc, ras and the like.
  • In vivo administration may involve use of agents of AACJs in any suitable adjuvant including serum or physiological saline, with or without another protein, such as human serum albumin. Dosage of the conjugates may readily be determined by one of ordinary skill, and may differ depending upon the nature of the cellular disorder and the agent used. Route of administration may be parenteral, with intravenous administration generally preferred.
  • substrate activation by the agent may be used to mediate formation of singlet oxygen or peroxides and induce cell killing.
  • the agent is an enzyme.
  • galactose oxidase will oxidize galactose and some galactose derivatives at the C6 position.
  • molecular oxygen is converted into hydrogen peroxide which is toxic to neighboring cells.
  • glucose oxidase a flavoenzyme
  • This enzyme is highly specific for ⁇ -D-glucose and can act as an antibiotic due to peroxide formation.
  • the enzyme may be attached to an AB either directly or via a non-cleavable linker.
  • a subject is given an effective dosage of this AACJ and is then perfused with substrate.
  • Cell killing is mediated through the formation of peroxides by the methods described above.
  • the toxic effect of peroxides may be amplified by administration of a second enzyme, preferably of human origin, to convert its peroxide to a more toxic hypochlorous acid.
  • suitable enzymes include but are not limited to myeloperoxidase, lactoperoxidase and chloroperoxidase.
  • the screening methods to identify an AA and/or to optimize an AA for a switchable phenotype can involve production of a library of replicable biological entities that display on their surface a plurality of different candidate AAs. These libraries can then be subjected to screening methods to identify candidate AAs having one or more desired characteristics of an AA.
  • the candidate AA libraries can contain candidate AAs that differ by one or more of the MM, linker (which may be part of the MM), CM (which may be part of the MM), and AB.
  • the AAs in the library are variable for the MM and/or the linker, with the AB and CM being preselected.
  • the AA is to include pairs of cysteine residues to provide a disulfide bond in the AA, the relative position of the cysteines in the AA can be varied.
  • the library for screening is generally provided as a library of replicable biological entities which display on their surface different candidate AAs.
  • a library of candidate AAs can include a plurality of candidate AAs displayed on the surface of population of a replicable biological entities, wherein each member of said plurality of candidate AAs comprises: (a) an antibody or fragment thereof (AB); (b) a cleavable moiety (CM); and (c) a candidate masking moiety (candidate MM), wherein the AB, CM and candidate MM are positioned such that the ability of the candidate MM to inhibit binding of the AB to a target in an uncleaved state and allow binding of the AB to the target in a cleaved state can be determined
  • Suitable replicable biological entities include cells (e.g., bacteria (e.g., E. coli ), yeast (e.g., S. cerevesiae ), protozoan cells, mammalian cells), bacteriophage, and viruses.
  • a variety of display technologies using replicable biological entities are known in the art. These methods and entities include, but are not limited to, display methodologies such as mRNA and ribosome display, eukaryotic virus display, and bacterial, yeast, and mammalian cell surface display. See Wilson, D. S., et al. 2001 PNAS USA 98(7):3750-3755; Muller, O. J., et al. (2003) Nat. Biotechnol. 3:312; Bupp, K. and M. J. Roth (2002) Mol. Ther. 5(3):329 3513; Georgiou, G., et al., (1997) Nat. Biotechnol. 15(1):29 3414; and Boder, E. T. and K. D.
  • a display scaffold refers to a polypeptide which when expressed in a host cell is presented on an extracellularly accessible surface of the host cell and provides for presentation of an operably linked heterologous polypeptide.
  • display scaffolds find use in the methods disclosed herein to facilitate screening of candidate AAs.
  • Display scaffolds can be provided such that a heterologous polypeptide of interest can be readily released from the display scaffold, e.g. by action of a protease that facilitates cleavage of the fusion protein and release of a candidate AA from the display scaffold.
  • Phage display involves the localization of peptides as terminal fusions to the coat proteins, e.g., pIII, pIIV of bacteriophage particles. See Scott, J. K. and G. P. Smith (1990) Science 249(4967):386 390; and Lowman, H. B., et al. (1991) Biochem. 30(45):10832 10838.
  • polypeptides with a specific function of binding are isolated by incubating with a target, washing away non-binding phage, eluting the bound phage, and then re-amplifying the phage population by infecting a fresh culture of bacteria.
  • phage display and cell display compositions and methods are described in U.S. Pat. Nos. 5,223,409; 5,403,484; 7,118,159; 6,979,538; 7,208,293; 5,571,698; and 5,837,500.
  • Additional exemplary display scaffolds and methods include those described in U.S. Patent Application Publication No: 2007/0065158, published Mar. 22, 2007.
  • the display scaffold can include a protease cleavage site (different from the protease cleavage site of the CM) to allow for cleavage of an AA or candidate AA from a surface of a host cell.
  • a protease cleavage site different from the protease cleavage site of the CM
  • suitable display scaffolds include circularly permuted Escherichia coli outer membrane protein OmpX (CPX) described by Rice et al, Protein Sci . (2006) 15: 825-836. See also, U.S. Pat. No. 7,256,038, issued Aug. 14, 2007.
  • CPX circularly permuted Escherichia coli outer membrane protein OmpX
  • nucleic acid constructs which include sequences coding for AAs and/or candidate AAs.
  • Suitable nucleic acid constructs include, but are not limited to, constructs which are capable of expression in a prokaryotic or eukaryotic cell. Expression constructs are generally selected so as to be compatible with the host cell in which they are to be used.
  • non-viral and/or viral constructs vectors may be prepared and used, including plasmids, which provide for replication of an AA- or candidate AA-encoding DNA and/or expression in a host cell.
  • the choice of vector will depend on the type of cell in which propagation is desired and the purpose of propagation. Certain constructs are useful for amplifying and making large amounts of the desired DNA sequence.
  • Other vectors are suitable for expression in cells in culture. The choice of appropriate vector is well within the skill of the art. Many such vectors are available commercially. Methods for generating constructs can be accomplished using methods well known in the art.
  • the polynucleotide encoding an AA or candidate AA is operably linked to a regulatory sequence as appropriate to facilitate the desired expression properties.
  • regulatory sequences can include promoters, enhancers, terminators, operators, repressors, silencers, inducers, and 3′ or 5′ UTRs.
  • Expression constructs generally also provide a transcriptional and translational initiation region as may be needed or desired, which may be inducible or constitutive, where the coding region is operably linked under the transcriptional control of the transcriptional initiation region, and a transcriptional and translational termination region. These control regions may be native to the species from which the nucleic acid is obtained, or may be derived from exogenous sources.
  • Promoters may be either constitutive or regulatable. In some situations it may be desirable to use conditionally active promoters, such as inducible promoters, e.g., temperature-sensitive promoters.
  • inducible elements are DNA sequence elements that act in conjunction with promoters and may bind either repressors (e.g. lacO/LAC Iq repressor system in E. coli ) or inducers (e.g. gal1/GAL4 inducer system in yeast). In such cases, transcription is virtually shut off until the promoter is de-repressed or induced, at which point transcription is turned-on.
  • Constructs can also include a selectable marker operative in the host to facilitate, for example, growth of host cells containing the construct of interest.
  • selectable marker genes can provide a phenotypic trait for selection of transformed host cells such as dihydrofolate reductase or neomycin resistance for eukaryotic cell culture.
  • Expression constructs can include convenient restriction sites to provide for the insertion and removal of nucleic acid sequences encoding the AA and/or candidate AA.
  • the expression constructs can include flanking sequences that can serve as the basis for primers to facilitate nucleic acid amplification (e.g., PCR-based amplification) of an AA-coding sequence of interest.
  • the above described expression systems may be employed with prokaryotes or eukaryotes in accordance with conventional ways, depending upon the purpose for expression.
  • a unicellular organism such as E. coli, B. subtilis, S. cerevisiae , insect cells in combination with baculovirus vectors, or cells of a higher organism such as vertebrates, e.g. COS 7 cells, HEK 293, CHO, Xenopus Oocytes, etc.
  • vertebrates e.g. COS 7 cells, HEK 293, CHO, Xenopus Oocytes, etc.
  • Expression systems for each of these classes and types of host cells are known in the art.
  • the present disclosure contemplates methods of making the libraries of AAs and/or candidate AAs described herein.
  • a method of making an AA library and/or candidate AA library comprises: (a) constructing a set of recombinant DNA vectors as described herein that encode a plurality of AAs and/or candidate AAs; (b) transforming host cells with the vectors of step (a); and (c) culturing the host cells transformed in step (b) under conditions suitable for expression and display of the fusion polypeptides.
  • Production of candidate AAs for use in the screening methods can be accomplished using methods known in the art.
  • Polypeptide display, single chain antibody display, antibody display and antibody fragment display are methods well known in the art.
  • an element of an AA e.g., MM to be varied in the candidate AA library is selected for randomization.
  • the candidate AAs in the library can be fully randomized or biased in their randomization, e.g. in nucleotide/residue frequency generally or in position of amino acid(s) within an element.
  • the present disclosure provides methods of identifying AAs, which can be enzymatically activated AAs, reducing agent-susceptible AAs, or an AA that is activatable by either or both of enzymatic activation or reducing agent-based activation.
  • the methods include contacting a plurality of candidate AAs with a target capable of binding an AB of the AAs and a protease capable of cleaving a CM of the AAs, selecting a first population of members of said plurality which bind to the target when exposed to protease, contacting said first population with the target in the absence of the protease, and selecting a second population of members from said first population by depleting from said first population members that bind the target in the absence of the protease, wherein said method provides for selection of candidate AAs which exhibit decreased binding to the target in the absence of the protease as compared to target binding in the presence of the protease.
  • the method for screening for candidate AAs having a desired switchable phenotype is accomplished through a positive screening step (to identify members that bind target following exposure to protease) and a negative screening step (to identify members that do not bind target when not exposed to protease).
  • the negative screening step can be accomplished by, for example, depleting from the population members that bind the target in the absence of the protease.
  • the library screening methods described herein can be initiated by conducting the negative screening first to select for candidates that do not bind labeled target in the absence of enzyme treatment (i.e., do not bind labeled target when not cleaved), and then conducting the positive screening (i.e., treating with enzyme and selecting for members which bind labeled target in the cleaved state).
  • the positive screening i.e., treating with enzyme and selecting for members which bind labeled target in the cleaved state.
  • the screening method is described below with the positive selection as a first step.
  • the positive and negative screening steps can be conveniently conducted using flow cytometry to sort candidate AAs based on binding of a detectably labeled target.
  • One round or cycle of the screening procedure involves both a positive selection step and a negative selection step.
  • the methods may be repeated for a library such that multiple cycles (including complete and partial cycles, e.g., 1.5 cycles, 2.5 cycles, etc.) are performed. In this manner, members of the plurality of candidate AAs that exhibit the switching characteristics of an AA may be enriched in the resulting population.
  • the screening methods are conducted by first generating a nucleic acid library encoding a plurality of candidate AAs in a display scaffold, which is in turn introduced into a display scaffold for expression on the surface of a replicable biological entity.
  • a plurality of candidate AAs refers to a plurality of polypeptides having amino acid sequences encoding candidate AAs, where members of the plurality are variable with respect to the amino acid sequence of at least one of the components of an AA, e.g., the plurality is variable with respect to the amino acid sequence of the MM, the CM or the AB, usually the MM.
  • a library can be generated to include candidate AAs having an MM that is designed to position a cysteine residue such that disulfide bond formation with another cysteine in the candidate AA is favored (with other residues selected to provide an MM having an amino acid sequence that is otherwise fully or at least partially randomized).
  • a library can be generated to include candidate AAs in which the MM includes a fully randomized amino acid sequence. Such libraries can contain candidate AAs designed by one or more of these criterion.
  • each member of the plurality of candidate AAs is displayed on the surface of a replicable biological entity (exemplified here by bacterial cells).
  • the members of the plurality are exposed to a protease capable of cleaving the CM of the candidate AAs and contacted with a target which is a binding partner of the AB of the candidate AAs.
  • Bacterial cells displaying members comprising ABs which bind the target after exposure to the protease are identified and/or separated via detection of target binding (e.g., detection of a target-AB complex).
  • Members comprising ABs which bind the target after protease exposure are then contacted with the target in the absence of the protease.
  • Bacterial cells displaying members comprising ABs which exhibit decreased or undetectable binding to the target in the absence of cleavage are identified and/or separated via detection of cells lacking bound target. In this manner, members of the plurality of candidate AAs which bind target in a cleaved state and exhibit decreased or undetectable target binding in an uncleaved state are identified and/or selected.
  • candidate AA libraries can be constructed so as to screen for one or more aspects of the AA constructs, e.g., to provide for optimization of a switchable phenotype for one or more of the MM, the CM, and the AB.
  • One or more other elements of the AA can be varied to facilitate optimization. For example: vary the MM, including varying the number or position of cysteines or other residues that can provide for different conformational characteristics of the AA in the absence of cleaving agent (e.g., enzyme): vary the CM to identify a substrate that is optimized for one or more desired characteristics (e.g., specificity of enzyme cleavage, and the like); and/or vary the AB to provide for optimization of switchable target binding.
  • cleaving agent e.g., enzyme
  • the elements of the candidate AA libraries are selected according to a target protein of interest, where the AA is to be activated to provide for enhanced binding of the target in the presence of a cleaving agent (e.g., enzyme) that cleaves the CM.
  • a cleaving agent e.g., enzyme
  • the CM and AB are held fixed among the library members, the CM is selected such that it is cleavable by a cleaving agent (e.g., enzyme) that is co-localized with a target of interest, where the target of interest is a binding partner of the AB.
  • a cleaving agent e.g., enzyme
  • the CM of the candidate AA is selected to be a substrate for an enzyme and/or a reducing agent that is co-localized with VEGF (e.g., a CM cleavable by a matrix-metalloprotease).
  • the CM of the candidate AA is selected to be a substrate for an enzyme and/or a reducing agent that is co-localized with the Notch receptor, Jagged ligand, or EGFR (e.g., a CM cleavable by a uPA or plasmin).
  • an AB is generally selected according to a target of interest.
  • targets are known in the art.
  • Biological targets of interest include protein targets that have been identified as playing a role in disease. Such targets include but are not limited to cell surface receptors and secreted binding proteins (e.g., growth factors), soluble enzymes, structural proteins (e.g. collagen, fibronectin), intracellular targets, and the like. Exemplary non-limiting targets are presented in Table 1, but other suitable targets will be readily identifiable by those of ordinary skill in the art.
  • many proteases are known in the art which co-localize with targets of interest. As such, persons of ordinary skill in the art will be able to readily identify appropriate enzymes and enzyme substrates for use in the above methods.
  • the screening method it may be desirable to enrich for cells expressing an appropriate peptide display scaffold on the cell surface.
  • the optional enrichment allows for removal of cells from the cell library that (1) do not express peptide display scaffolds on the cell outer membrane or (2) express non-functional peptide display scaffolds on the cell outer membrane.
  • a non-functional peptide display scaffold does not properly display a candidate AA, e.g., as a result of a stop codon or a deletion mutation.
  • Enrichment for cells can be accomplished by growing the cell population and inducing expression of the peptide display scaffolds. The cells are then sorted based on, for example, detection of a detectable signal or moiety incorporated into the scaffold or by use of a detectably-labeled antibody that binds to a shared portion of the display scaffold or the AA. These methods are described in greater detail in U.S. Patent Application Publication No: 2007/0065158, published Mar. 22, 2007.
  • the candidate AA library Prior to screening, the candidate AA library can be expanded (e.g., by growth in a suitable medium in culture under suitable conditions). Subsequent to the optional expansion, or as an initial step, the library is subjected to a first screen to identify candidate AAs that bind target following exposure to protease. Accordingly, this step is often referred to herein as the positive selection step.
  • the candidate AA library is contacted with a protease capable of cleaving the CM of the displayed candidate AAs for an amount of time sufficient and under conditions suitable to provide for cleavage of the protease substrate of the CM.
  • a protease-CM combinations will be readily ascertainable by those of ordinary skill in the art, where the protease is one which is capable of cleaving the CM and one which co-localizes in vivo with a target of interest (which is a binding partner of the AB).
  • the target of interest is a solid tumor associated target (e.g.
  • suitable enzymes include, for example, Matrix-Metalloproteases (e.g., MMP-2), A Disintegrin and Metalloprotease(s) (ADAMs)/ADAM with thrombospondin-like motifs (ADAMTS), Cathepsins and Kallikreins.
  • MMP-2 Matrix-Metalloproteases
  • ADAMs Disintegrin and Metalloprotease(s)
  • ADAMTS ADAM with thrombospondin-like motifs
  • Cathepsins thrombospondin-like motifs
  • Kallikreins Kallikreins.
  • the amino acid sequences of substrates useful as CMs in the AAs described herein are known in the art and, where desired, can be screened to identify optimal sequences suitable for use as a CM by adaptation of the methods described herein.
  • Exemplary substrates can include but are not limited to substrates cleavable by enzymes listed in Table 3.
  • the candidate AA library is also exposed to target for an amount of time sufficient and under conditions suitable for target binding, which conditions can be selected according to conditions under which target binding to the AB would be expected.
  • the candidate AA library can be exposed to the protease prior to exposure to target (e.g., to provide a population of candidate AAs which include cleaved AAs) or in combination with exposure to target, usually the latter so as to best model the expected in vivo situation in which both protease and target will be present in the same environmental milieu.
  • the library is then screened to select members having bound target, which include candidate AAs in a target-AB complex.
  • Detection of target-bound candidate AAs can be accomplished in a variety of ways.
  • the target may be detectably labeled and the first population of target-bound candidate AAs may be selected by detection of the detectable label to generate a second population having bound target (e.g., a positive selection for target-bound candidate AAs).
  • the population of candidate AAs selected for target binding following exposure to protease can then be expanded (e.g., by growth in a suitable medium in culture under suitable conditions), and the expanded library subjected to a second screen to identify members exhibiting decreased or no detectable binding to target in the absence of protease exposure.
  • the population resulting from this second screen will include candidate AAs that, when uncleaved, do not bind target significantly or to a detectable level. Accordingly, this step is often referred to herein as the negative selection step.
  • the population that resulted from the first screen is contacted with target in the absence of the protease for a time sufficient and under conditions suitable for target binding, which conditions can be selected according to conditions under which target binding to the AB would be expected.
  • a negative selection can then be performed to identify candidate AAs that are relatively decreased for target binding, including those which exhibit no detectably target binding.
  • This selection can be accomplished by, for example, use of a detectably labeled target, and subjecting the target-exposed population to flow cytometry analysis to sort into separate subpopulation those cells that display a candidate AA that exhibits no detectable target binding and/or which exhibit a relatively lower detectable signal. This subpopulation is thus enriched for cells having a candidate AA that exhibit decreased or undetectable binding to target in the absence of cleavage.
  • a detectable label and detectable moiety are used interchangeably to refer to a molecule capable of detection, including, but not limited to, radioactive isotopes, fluorescers, chemiluminescers, chromophores, enzymes, enzyme substrates, enzyme cofactors, enzyme inhibitors, chromophores, dyes, metal ions, metal sols, ligands (e.g., biotin, avidin, strepavidin or haptens) and the like.
  • fluorescer refers to a substance or a portion thereof which is capable of exhibiting fluorescence in the detectable range.
  • Exemplary detectable moieties suitable for use as target labels include affinity tags and fluorescent proteins.
  • affinity tag is used herein to denote a peptide segment that can be attached to a target that can be detected using a molecule that binds the affinity tag and provides a detectable signal (e.g., a fluorescent compound or protein).
  • a detectable signal e.g., a fluorescent compound or protein.
  • any peptide or protein for which an antibody or other specific binding agent is available can be used as an affinity tag.
  • Exemplary affinity tags suitable for use include, but are not limited to, a monocytic adaptor protein (MONA) binding peptide, a T7 binding peptide, a streptavidin binding peptide, a polyhistidine tract, protein A (Nilsson et al., EMBO J. 4:1075 (1985); Nilsson et al., Methods Enzymol.
  • MONA monocytic adaptor protein
  • Any fluorescent polypeptide (also referred to herein as a fluorescent label) well known in the art is suitable for use as a detectable moiety or with an affinity tag of the peptide display scaffolds described herein.
  • a suitable fluorescent polypeptide will be one that can be expressed in a desired host cell, such as a bacterial cell or a mammalian cell, and will readily provide a detectable signal that can be assessed qualitatively (positive/negative) and quantitatively (comparative degree of fluorescence).
  • Exemplary fluorescent polypeptides include, but are not limited to, yellow fluorescent protein (YFP), cyan fluorescent protein (CFP), GFP, mRFP, RFP (tdimer2), HCRED, etc., or any mutant (e.g., fluorescent proteins modified to provide for enhanced fluorescence or a shifted emission spectrum), analog, or derivative thereof.
  • YFP yellow fluorescent protein
  • CFP cyan fluorescent protein
  • RFP tdimer2
  • HCRED HCRED
  • any mutant e.g., fluorescent proteins modified to provide for enhanced fluorescence or a shifted emission spectrum
  • suitable fluorescent polypeptides as well as specific examples of those listed herein, are provided in the art and are well known.
  • a cell displaying an AA of interest may be separated by FACS, immunochromatography or, where the detectable label is magnetic, by magnetic separation.
  • the population is enriched for cells that exhibit the desired characteristic, e.g., exhibit binding to target following cleavage or have decreased or no detectable binding to target in the absence of cleavage.
  • selection of candidate AAs having bound detectably labeled target can be accomplished using a variety of techniques known in the art. For example, flow cytometry (e.g., FACS®) methods can be used to sort detectably labeled candidate AAs from unlabeled candidate AAs.
  • flow cytometry e.g., FACS®
  • Flow cyomtery methods can be implemented to provide for more or less stringent requirements in separation of the population of candidate AAs, e.g., by modification of gating to allow for dimmer or to require brighter cell populations in order to be separated into the second population for further screening.
  • immunoaffinity chromatography can be used to separate target-bound candidate AAs from those that do not bind target.
  • a support e.g., column, magnetic beads
  • Candidate AAs having bound target bind to the anti-target antibody, thus facilitating separation from candidate AAs lacking bound target.
  • the screening step is to provide for a population enriched for uncleaved candidate AAs that have relatively decreased target binding or no detectable target binding (e.g., relative to other candidate AAs)
  • the subpopulation of interest is those members that lack or have a relatively decreased detectably signal for bound target.
  • the subpopulation of interest is that which is not bound by the anti-target support.
  • Methods for screening disclosed herein can be readily adapted to identify dual target-binding AAs having two ABs.
  • the method involves a library containing a plurality of candidate AAs, wherein each member of said plurality comprises a first AB, a second AB, a first CM and/or a second CM, a first MM, and/or a second MM.
  • the library is contacted with target capable of binding at least the first AB and a cleaving agent capable of cleaving the first CM.
  • a first population of members of the library is selected for binding the target in the presence of the cleaving agent (e.g., protease for the CM).
  • the cleaving agent e.g., protease for the CM
  • This selected population is then subjected to the negative screen above, in which binding of target to the library members in the absence of the cleaving agent is assessed.
  • a second population of members is then generated by depleting the subpopulation of members that bind to said target in the absence of the cleaving agent. This can be accomplished by, for example, sorting members that are not bound to target away from those that are bound to target, as determined by detection of a detectably labeled target.
  • This method thus provides for selection of candidate AAs which exhibit decreased binding to the target in the absence of the cleaving agent as compared to binding to said target in the presence of the cleaving agent. This method can be repeated for both targets.
  • the above methods may be modified to select for populations and library members that demonstrate desired characteristics.
  • Masking efficiency of MMs is determined by at least two parameters: affinity of the MM for antibody or fragment thereof and the spatial relationship of the MM relative to the binding interface of the AB to its target.
  • an MM may have high affinity but only partially inhibit the binding site on the AB, while another MM may have a lower affinity for the AB but fully inhibit target binding.
  • the lower affinity MM may show sufficient masking; in contrast, over time, that same MM may be displaced by the target (due to insufficient affinity for the AB).
  • two MMs with the same affinity may show different extents of masking based on how well they promote inhibition of the binding site on the AB or prevention of the AB from binding its target.
  • a MM with high affinity may bind and change the structure of the AB so that binding to its target is completely inhibited while another MM with high affinity may only partially inhibit binding.
  • discovery of an effective MM cannot be based only on affinity but can include an empirical measure of masking efficiency.
  • the time-dependent target displacement of the MM in the AA can be measured to optimize and select for MMs.
  • a novel Target Displacement Assay (TDA) is described herein for this purpose.
  • the TDA assay can be used for the discovery and validation of efficiently masked AAs comprises empirical determination of masking efficiency, comparing the ability of the masked AB to bind the target in the presence of target to the ability of the unmasked and/or parental AB to bind the target in the presence of the target.
  • the binding efficiency can be expressed as a % of equilibrium binding, as compared to unmasked/parental AB binding.
  • the AB's ability to bind the target when modified with an MM can be reduced by at least 50%, 60%, 70%, 80%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and even 100% for at least 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, 96, hours, or 5, 10, 15, 30, 45, 60, 90, 120, 150, 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months or greater when measured in vivo or in a Target Displacement in vitro immunosorbant assay, as described herein.
  • candidate AA libraries described herein can be readily adapted to provide for identification and/or optimization of one or more elements of an AA.
  • candidate AAs that vary with respect to any one or more of AB, CM, linkers, and the like can be produced and subjected to the screening methods described herein.
  • an AA or candidate AA with a CM that can facilitate formation of a cysteine-cysteine disulfide bond in an AA and can also be subjected to the screening methods disclosed herein.
  • Such AAs may or may not further include a CM (which may be the same or different CM) that may or may not comprise a protease substrate.
  • the positive screen described above may be conducted by exposing an AA or candidate AA to a reducing agent (e.g., to reducing conditions) capable of cleaving the disulfide bond of the cysteine-cysteine pair of the AA.
  • the negative screen can then be conducted in the absence of the reducing conditions.
  • a library produced having may be enriched for AAs which are activatable by exposure to disulfide bond reducing conditions.
  • an AA or candidate AA with a CM that is photo-sensitive, and can be activated upon photolysis are also provided.
  • the positive screen described above may be conducted by exposing an AA or candidate AA to light.
  • the negative screen can then be conducted in the absence of light.
  • a library produced having may be enriched for AAs which are activatable by exposure to light.
  • populations and library members that demonstrate improved switching characteristics can be identified. Any number of cycles of screening can be performed.
  • candidate AAs can be isolated and subjected to screening so as to determine the dynamic range of the candidate AA.
  • Candidate AAs can also be tested for a desired switchable phenotype separate from the scaffold, i.e., the candidate AA can be expressed or otherwise generated separate from the display scaffold, and the switchable phenotype of the candidate AA assessed in the absence of the scaffold and, where desired, in a cell-free system (e.g., using solubilized AA).
  • the above methods may be modified to optimize the performance of an AA, e.g., an AA identified in the screening method described herein.
  • an AA e.g., an AA identified in the screening method described herein.
  • the amino acid sequences of the AB and the CM may be fixed in a candidate AA library, and the MM varied such that members of a library have variable MMs relative to each other.
  • the MM may be optimized in a variety of ways including alteration in the number and or type of amino acids that make up the MM.
  • each member of the plurality of candidate AAs may comprise a candidate MM, wherein the candidate MM comprises at least one cysteine amino acid residue and the remaining amino acid residues are variable between the members of the plurality.
  • each member of the plurality of candidate AAs may comprise a candidate MM, wherein the candidate MM comprises a cysteine amino acid residue and a random sequence of amino acid residues, e.g., a random sequence of 5 amino acids.
  • AAs having a desired dynamic range with respect to target binding in the unmasked/cleaved versus masked/uncleaved state are also of interest.
  • Such AAs are those that, for example, have no detectable binding in the presence of target at physiological levels found at treatment and non-treatment sites in a subject but which, once cleaved by protease, exhibit high affinity and/or high avidity binding to target.
  • the greater the dynamic range of an AA the better the switchable phenotype of the AA.
  • AAs can be optimized to select for those having an expanded dynamic range for target binding in the presence and absence of a cleaving agent.
  • the screening methods described herein can be modified so as to enhance selection of AAs having a desired and/or optimized dynamic range. In general, this can be accomplished by altering the concentrations of target utilized in the positive selection and negative selection steps of the method such that screening for target binding of AAs exposed to protease (i.e., the screening population that includes cleaved AAs) is performed using a relatively lower target concentration than when screening for target binding of uncleaved AAs. Accordingly, the target concentration is varied between the steps so as to provide a selective pressure toward a switchable phenotype. Where desired, the difference in target concentrations used at the positive and negative selection steps can be increased with increasing cycle number.
  • the screen involving protease-exposed AAs can be performed at a target concentration that is from about 2 to about 100 fold lower, about 2 to 50 fold lower, about 2 to 20 fold lower, about 2 to 10-fold lower, or about 2 to 5-folder lower than the Kd of the AB-target interaction.
  • the selected population will be enriched for AAs that exhibit higher affinity and/or avidity binding relative to other AAs in the population.
  • the screen involving AAs that have not been exposed to protease can be performed at a target concentration that is from about 2 to about 100 fold higher, about 2 to 50 fold higher, about 2 to 20 fold higher, about 2 to 10-fold higher, or about 2 to 5-folder higher, than the Kd of the AB-target interaction.
  • the selected population will be enriched for AAs that exhibit lower binding for target when in the uncleaved state relative to other uncleaved AAs in the population.
  • the selected population will be enriched for AAs for which target binding to AB is inhibited, e.g., due to masking of the AB from target binding.
  • the screening method described above can be adapted to provide for AAs having a desired dynamic range for a first target that is capable of binding a first AB and for a second target that is capable of binding a second AB.
  • Target binding to an AB that is located on a portion of the AA that is cleaved away from the AA presented on a display scaffold can be evaluated by assessing formation of target-AB complexes in solution (e.g., in the culture medium), e.g., immunochromatography having an anti-AA fragment antibody to capture cleaved fragment, then detecting bound, detectably labeled target captured on the column.
  • Candidate AAs can be tested for their ability to maintain a switchable phenotype while in soluble form.
  • One such method involves the immobilization of target to support (e.g., an array, e.g., a BiacoreTM CM5 sensor chip surface). Immobilization of a target of interest can be accomplished using any suitable techniques (e.g., standard amine coupling). The surface of the support can be blocked to reduce non-specific binding.
  • the method can involve use of a control (e.g., a support that does not contain immobilized target (e.g., to assess background binding to the support) and/or contains a compound that serves as a negative control (e.g., to assess specificity of binding of the candidate AA to target versus non-target).
  • a control e.g., a support that does not contain immobilized target (e.g., to assess background binding to the support) and/or contains a compound that serves as a negative control (e.g., to assess specificity of binding of the candidate AA to target versus non-target).
  • the candidate AA is contacted with the support under conditions suitable to allow for specific binding to immobilized target.
  • the candidate AA can be contacted with the support-immobilized target in the presence and in the absence of a suitable cleavage agent in order to assess the switchable phenotype.
  • Assessment of binding of the candidate AA in the presence of cleavage agent as compared to in the absence of cleavage agent and, optionally, compared to binding in a negative control provides a binding response, which in turn is indicative of the switchable phenotype.
  • a candidate AA e.g., an AB, MM or CM
  • known methods of identifying peptide substrates cleavable by specific proteases can be utilized to identify CMs for use in AAs designed for activation by such proteases.
  • a variety of methods are available for identifying peptide sequences which bind to a target of interest. These methods can be used, for example, to identify ABs which binds to a particular target or to identify a MM which binds to a particular AB.
  • the above methods include, for example, methods in which a moiety of a candidate AA, e.g., an AB, MM or CM, is displayed using a replicable biological entity.
  • a moiety of a candidate AA e.g., an AB, MM or CM
  • the screening methods described herein are automated to provide convenient, real time, high volume methods of screening a library of AAs for a desired switchable activity.
  • Automated methods can be designed to provide for iterative rounds of positive and negative selection, with the selected populations being separated and automatically subjected to the next screen for a desired number of cycles.
  • Assessing candidate AAs in a population may be carried out over time iteratively, following completion of a positive selection step, a negative selection step, or both.
  • information regarding the average dynamic range of a population of candidate AAs at selected target concentrations in the positive and negative selection steps can be monitored and stored for later analysis, e.g. so as to assess the effect of selective pressure of the different target concentrations.
  • a executable platform such as a computer software product can control operation of the detection and/or measuring means and can perform numerical operations relating to the above-described steps, and generate a desired output (e.g., flow cytometry analysis, etc.).
  • Computer program product comprises a computer readable storage medium having computer-readable program code means embodied in the medium.
  • Hardware suitable for use in such automated apparatus will be apparent to those of skill in the art, and may include computer controllers, automated sample handlers, fluorescence measurement tools, printers and optical displays.
  • the measurement tool may contain one or more photodetectors for measuring the fluorescence signals from samples where fluorescently detectable molecules are utilized.
  • the measurement tool may also contain a computer-controlled stepper motor so that each control and/or test sample can be arranged as an array of samples and automatically and repeatedly positioned opposite a photodetector during the step of measuring fluorescence intensity.
  • the measurement tool can be operatively coupled to a general purpose or application-specific computer controller.
  • the controller can comprise a computer program produce for controlling operation of the measurement tool and performing numerical operations relating to the above-described steps.
  • the controller may accept set-up and other related data via a file, disk input or data bus.
  • a display and printer may also be provided to visually display the operations performed by the controller. It will be understood by those having skill in the art that the functions performed by the controller may be realized in whole or in part as software modules running on a general purpose computer system. Alternatively, a dedicated stand-alone system with application specific integrated circuits for performing the above described functions and operations may be provided.
  • AAs can be incorporated into pharmaceutical compositions containing, for example, a therapeutically effective amount of an AA of interest and a carrier that is a pharmaceutically acceptable excipient (also referred to as a pharmaceutically acceptable carrier).
  • a pharmaceutically acceptable excipient also referred to as a pharmaceutically acceptable carrier.
  • Many pharmaceutically acceptable excipients are known in the art, are generally selected according to the route of administration, the condition to be treated, and other such variables that are well understood in the art. Pharmaceutically acceptable excipients have been amply described in a variety of publications, including, for example, A. Gennaro (2000) Remington: The Science and Practice of Pharmacy, 20th edition, Lippincott, Williams, & Wilkins; Pharmaceutical Dosage Forms and Drug Delivery Systems (1999) H. C.
  • compositions can also include other components such as pH adjusting and buffering agents, tonicity adjusting agents, stabilizers, wetting agents and the like.
  • nanoparticles or liposomes carry a pharmaceutical composition comprising an AA.
  • Suitable components for pharmaceutical compositions of AAs can be guided by pharmaceutical compositions that may be already available for an AB of the AA.
  • the AA includes an antibody to EGFR, TNFalpha, CD11a, CSFR, CTLA-4, EpCAM, VEGF, CD40, CD20, Notch 1, Notch 2, Notch 3, Notch 4, Jagged 1, Jagged 2, CD52, MUC1, IGF1R, transferrin, gp130, VCAM-1, CD44, DLL4, or IL4, for example, such AAs can be formulated in a pharmaceutical formulation according to methods and compositions suitable for use with that antibody.
  • AAs are prepared for storage by mixing the AA having a desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions.
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arg
  • formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
  • Pharmaceutical formulations may also contain more than one active compound as necessary for the particular indication being treated, where the additional active compounds generally are those with activities complementary to an AA. Such compounds are suitably present in combination in amounts that are effective for the purpose intended.
  • the pharmaceutical formulation can be provided in a variety of dosage forms such as a systemically or local injectable preparation.
  • the components can be provided in a carrier such as a microcapsule, e.g., such as that prepared by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsule and poly-(methylmethacylate) microcapsule, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • macroemulsions for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • sustained-release preparations are also within the scope of an AA-containing formulations.
  • Exemplary sustained-release preparations can include semi-permeable matrices of solid hydrophobic polymers containing the AA, which matrices are in the form of shaped articles, e.g., films, or microcapsule.
  • sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No.
  • copolymers of L-glutamic acid and y-ethyl-L-glutamate non-degradable ethylene-vinyl acetate
  • degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate)
  • poly-D-( ⁇ )-3-hydroxybutyric acid While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
  • encapsulated AAs When encapsulated AAs remain in the body for a long time, they may denature or aggregate as a result of exposure to moisture at physiological temperature ( ⁇ 37° C.), resulting in decreased biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be undesirable intermolecular S—S bond formation through thio-disulfide interchange, stabilization may be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions.
  • AAs can be conjugated to delivery vehicles for targeted delivery of an active agent that serves a therapeutic purpose.
  • AAs can be conjugated to nanoparticles or liposomes having drugs encapsulated therein or associated therewith. In this manner, specific, targeted delivery of the drug can be achieved.
  • Methods of linking polypeptides to liposomes are well known in the art and such methods can be applied to link AAs to liposomes for targeted and or selective delivery of liposome contents.
  • polypeptides can be covalently linked to liposomes through thioether bonds.
  • PEGylated gelatin nanoparticles and PEGylated liposomes have also been used as a support for the attachment of polypeptides, e.g., single chain antibodies. See, e.g., Immordino et al. (2006) Int J Nanomedicine . September; 1(3): 297-315, incorporated by reference herein for its disclosure of methods of conjugating polypeptides, e.g., antibody fragments, to liposomes.
  • AAs described herein can be selected for use in methods of treatment of suitable subjects according to the CM-AB combination provided in the AA.
  • the AA can be administered by any suitable means, including oral, parenteral, subcutaneous, intraperitoneal, intrapulmonary, and intranasal, and, if desired for local injection (e.g., at the site of a solid tumor).
  • Parenteral administration routes include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.
  • treatment site or disease site is meant to refer to a site at which an AA is designed to be switchable, as described herein, e.g., a site at which a target for one or both ABs of an AA and a cleaving agent capable of cleaving a CM of the AA are co-localized, as pictorially represented in FIG. 2 .
  • Treatment sites include tissues that can be accessed by local administration (e.g., injection, infusion (e.g., by catheter), etc.) or by systemic administration (e.g., administration to a site remote from a treatment site).
  • Treatment sites include those that are relatively biologically confined (e.g., an organ, sac, tumor site, and the like).
  • AA a compound that has a therapeutically active property
  • the appropriate dosage of an AA will depend on the type of disease to be treated, the severity and course of the disease, the patient's clinical history and response to the AA, and the discretion of the attending physician.
  • AAs can suitably be administered to the patient at one time or over a series of treatments.
  • AAs can be administered along with other treatments and modes of therapies, other pharmaceutical agents, and the like.
  • ⁇ g/kg to 15 mg/kg (e.g., 0.1-20 mg/kg) of an AA can serve as an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion.
  • a typical daily dosage might range from about 1 ⁇ g/kg to 100 mg/kg or more, depending on factors such as those mentioned herein.
  • the treatment is sustained until a desired suppression of disease symptoms occurs.
  • other dosage regimens may be useful.
  • the AA composition will be formulated, dosed, and administered in a fashion consistent with good medical practice.
  • Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the AA, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
  • the therapeutically effective amount of an AA to be administered will be governed by such considerations, and is the minimum amount necessary to prevent, ameliorate, or treat a disease or disorder.
  • alleviation or treatment of a disease or disorder involves the lessening of one or more symptoms or medical problems associated with the disease or disorder.
  • the therapeutically effective amount of the drug can accomplish one or a combination of the following: reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., to decrease to some extent and/or stop) cancer cell infiltration into peripheral organs; inhibit tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the cancer.
  • a composition of this invention can be used to prevent the onset or reoccurrence of the disease or disorder in a subject or mammal.
  • AAs can be used in combination (e.g., in the same formulation or in separate formulations) with one or more additional therapeutic agents or treatment methods (combination therapy).
  • An AA can be administered in admixture with another therapeutic agent or can be administered in a separate formulation.
  • Therapeutic agents and/or treatment methods that can be administered in combination with an AA, and which are selected according to the condition to be treated, include surgery (e.g., surgical removal of cancerous tissue), radiation therapy, bone marrow transplantation, chemotherapeutic treatment, certain combinations of the foregoing, and the like.
  • the AAs of the present invention when localized to a healthy tissue, show little or no activation and the AB remains in a ‘masked’ state, or otherwise exhibits little or no binding to the target.
  • the AB in the presence of a disease-specific protease, for example, capable of cleaving the CM of the AA, the AB becomes ‘unmasked’ or can specifically bind the target.
  • a healthy tissue refers to a tissue that produces little or no disease-specific agent capable of specifically cleaving or otherwise modifying the CM of the AA, for example a disease-specific protease, a disease-specific enzyme, or a disease-specific reducing agent.
  • a diseased tissue refers to a tissue that produces a disease-specific agent capable of specifically cleaving or otherwise modifying the CM of the AA, for example a disease-specific protease, a disease-specific enzyme, or a disease-specific reducing agent.
  • the AAs described herein are coupled to more than one CM.
  • Such an AA can be activated in different stages of a disease, or activated in different compartments of the diseased tissue.
  • an AB coupled to both a MMP-9 cleavable CM and a cathepsin D-cleavable CM can be activated in an early stage tumor and in a late stage, necrosing tumor.
  • the CM can be cleaved and the AA unmasked by MMP-9.
  • the CM In the late stage tumor, the CM can be cleaved and the AA unmasked by cathepsin D which is upregulated in the dying center of late stage tumors.
  • an AB coupled to an MM and to a MMP-9-activatable CM and a caspase-activatable CM can be cleaved at both early and late stage tumors.
  • plasmin at active sites of angiogenesis (early stage tumor) can cleave a plasmin-cleavable CM and legumain in disease tissues with invading macrophages can cleave a leugamain-specific CM in a late stage tumor.
  • the AA contains an AB that binds a mediator of angiogenesis such as EGFR, TNFalpha, CD11a, CSFR, CTLA-4, EpCAM, VEGF, CD40, CD20, Notch 1, Notch 2, Notch 3, Notch 4, Jagged 1, Jagged 2, CD52, MUC1, IGF1R, transferrin, gp130, VCAM-1, CD44, DLL4, or IL4, the AA finds use in treatment of conditions in which inhibition of angiogenesis is desired, particularly those conditions in which inhibition of VEGF is of interest.
  • a mediator of angiogenesis such as EGFR, TNFalpha, CD11a, CSFR, CTLA-4, EpCAM, VEGF, CD40, CD20, Notch 1, Notch 2, Notch 3, Notch 4, Jagged 1, Jagged 2, CD52, MUC1, IGF1R, transferrin, gp130, VCAM-1, CD44, DLL4, or IL4
  • VEGF-binding AAs can include dual target binding AAs having an AB that binds to VEGF as well as an AB that binds to a second growth factor, such as a fibroblast growth factor (e.g., FGF-2), and inhibits FGF activity.
  • a cleaving agent e.g., enzyme, such as a MMP or other enzymes such as one presented in Table 3 which co-localizes at a site of aberrant angiogenesis.
  • Angiogenesis-inhibiting AAs find use in treatment of solid tumors in a subject (e.g., human), particularly those solid tumors that have an associated vascular bed that feeds the tumor such that inhibition of angiogenesis can provide for inhibition or tumor growth.
  • Anti-VEGF-based anti-angiogenesis AAs also find use in other conditions having one or more symptoms amenable to therapy by inhibition of abnormal angiogenesis.
  • abnormal angiogenesis occurs when new blood vessels either grow excessively, insufficiently or inappropriately (e.g., the location, timing or onset of the angiogenesis being undesired from a medical standpoint) in a diseased state or such that it causes a diseased state.
  • Excessive, inappropriate or uncontrolled angiogenesis occurs when there is new blood vessel growth that contributes to the worsening of the diseased state or causes a diseased state, such as in cancer, especially vascularized solid tumors and metastatic tumors (including colon, lung cancer (especially small-cell lung cancer), or prostate cancer), diseases caused by ocular neovascularisation, especially diabetic blindness, retinopathies, primarily diabetic retinopathy or age-induced macular degeneration and rubeosis; psoriasis, psoriatic arthritis, haemangioblastoma such as haemangioma; inflammatory renal diseases, such as glomerulonephritis, especially mesangioproliferative glomerulonephritis, haemolytic uremic syndrome, diabetic nephropathy or hypertensive neplirosclerosis; various inflammatory diseases, such as arthritis, especially rheumatoid arthritis, inflammatory bowel disease, psorsasis,
  • AA-based anti-angiogenesis therapies can also find use in treatment of graft rejection, lung inflammation, nephrotic syndrome, preeclampsia, pericardial effusion, such as that associated with pericarditis, and pleural effusion, diseases and disorders characterized by undesirable vascular permeability, e.g., edema associated with brain tumors, ascites associated with malignancies, Meigs' syndrome, lung inflammation, nephrotic syndrome, pericardial effusion, pleural effusion, permeability associated with cardiovascular diseases such as the condition following myocardial infarctions and strokes and the like.
  • vascular permeability e.g., edema associated with brain tumors, ascites associated with malignancies, Meigs' syndrome, lung inflammation, nephrotic syndrome, pericardial effusion, pleural effusion, permeability associated with cardiovascular diseases such as the condition following myocardial infarctions and strokes and the like.
  • angiogenesis-dependent diseases that may be treated using anti-angiogenic AAs as described herein include angiofibroma (abnormal blood of vessels which are prone to bleeding), neovascular glaucoma (growth of blood vessels in the eye), arteriovenous malformations (abnormal communication between arteries and veins), nonunion fractures (fractures that will not heal), atherosclerotic plaques (hardening of the arteries), pyogenic granuloma (common skin lesion composed of blood vessels), scleroderma (a form of connective tissue disease), hemangioma (tumor composed of blood vessels), trachoma (leading cause of blindness in the third world), hemophilic joints, vascular adhesions and hypertrophic scars (abnormal scar formation).
  • angiofibroma abnormal blood of vessels which are prone to bleeding
  • neovascular glaucoma growth of blood vessels in the eye
  • arteriovenous malformations as abnormal communication between arteries and veins
  • Amounts of an AA for administration to provide a desired therapeutic effect will vary according to a number of factors such as those discussed above.
  • a therapeutically effective amount of an AA is an amount that that is effective to inhibit angiogenesis, and thereby facilitate reduction of, for example, tumor load, atherosclerosis, in a subject by at least about 5%, at least about 10%, at least about 20%, at least about 25%, at least about 50%, at least about 75%, at least about 85%, or at least about 90%, up to total eradication of the tumor, when compared to a suitable control.
  • a suitable control may be a genetically identical animal not treated with the agent.
  • a suitable control may be the tumor load present before administering the agent.
  • Other suitable controls may be a placebo control.
  • Whether a tumor load has been decreased can be determined using any known method, including, but not limited to, measuring solid tumor mass; counting the number of tumor cells using cytological assays; fluorescence-activated cell sorting (e.g., using antibody specific for a tumor-associated antigen) to determine the number of cells bearing a given tumor antigen; computed tomography scanning, magnetic resonance imaging, and/or x-ray imaging of the tumor to estimate and/or monitor tumor size; measuring the amount of tumor-associated antigen in a biological sample, e.g., blood or serum; and the like.
  • a biological sample e.g., blood or serum
  • the methods are effective to reduce the growth rate of a tumor by at least about 5%, at least about 10%, at least about 20%, at least about 25%, at least about 50%, at least about 75%, at least about 85%, or at least about 90%, up to total inhibition of growth of the tumor, when compared to a suitable control.
  • effective amounts of an AA are amounts that are sufficient to reduce tumor growth rate by at least about 5%, at least about 10%, at least about 20%, at least about 25%, at least about 50%, at least about 75%, at least about 85%, or at least about 90%, up to total inhibition of tumor growth, when compared to a suitable control.
  • a suitable control may be tumor growth rate in a genetically identical animal not treated with the agent.
  • a suitable control may be the tumor load or tumor growth rate present before administering the agent.
  • Other suitable controls may be a placebo control.
  • Whether growth of a tumor is inhibited can be determined using any known method, including, but not limited to, an in vivo assay for tumor growth; an in vitro proliferation assay; a 3 H-thymidine uptake assay; and the like.
  • Interleukin-binding AAs can include dual target binding AAs having an AB that binds to for example IL12 as well as an AB that binds to IL23, or an AA where a first AB binds to IL17 and a second AB binds to IL23.
  • a cleaving agent e.g., enzyme, such as a MMP or other enzyme such as one presented in Table 3 which co-localizes at a site of inflammation.
  • AAs can also be used in diagnostic and/or imaging methods.
  • AAs having an enzymatically cleavable CM can be used to detect the presence or absence of an enzyme that is capable of cleaving the CM.
  • Such AAs can be used in diagnostics, which can include in vivo detection (e.g., qualitative or quantitative) of enzyme activity (or, in some embodiments, an environment of increased reduction potential such as that which can provide for reduction of a disulfide bond) accompanied by presence of a target of interest through measured accumulation of activated AAs in a given tissue of a given host organism.
  • the CM can be selected to be a protease substrate for a protease found at the site of a tumor, at the site of a viral or bacterial infection at a biologically confined site (e.g., such as in an abscess, in an organ, and the like), and the like.
  • the AB can be one that binds a target antigen.
  • a detectable label e.g., a fluorescent label
  • Suitable detectable labels are discussed in the context of the above screening methods and additional specific examples are provided below.
  • AAs will exhibit increased rate of binding to disease tissue relative to tissues where the CM specific enzyme is not present at a detectable level or is present at a lower level than in disease tissue. Since small proteins and peptides are rapidly cleared from the blood by the renal filtration system, and because the enzyme specific for the CM is not present at a detectable level (or is present at lower levels in non-diseased tissues), accumulation of activated AA in the diseased tissue is enhanced relative to non-disease tissues.
  • AAs can be used in to detect the presence or absence of a cleaving agent in a sample.
  • the AA can be used to detect (either qualitatively or quantitatively) the presence of an enzyme in the sample.
  • the AA can be used to detect (either qualitatively or quantitatively) the presence of reducing conditions in a sample.
  • the AA can be detectably labeled, and can be bound to a support (e.g., a solid support, such as a slide or bead).
  • the detectable label can be positioned on a portion of the AA that is released following cleavage.
  • the assay can be conducted by, for example, contacting the immobilized, detectably labeled AA with a sample suspected of containing an enzyme and/or reducing agent for a time sufficient for cleavage to occur, then washing to remove excess sample and contaminants.
  • the presence or absence of the cleaving agent e.g., enzyme or reducing agent
  • a change in detectable signal of the AA prior to contacting with the sample e.g., a reduction in detectable signal due to cleavage of the AA by the cleaving agent in the sample and the removal of an AA fragment to which the detectable label is attached as a result of such cleavage.
  • Such detection methods can be adapted to also provide for detection of the presence or absence of a target that is capable of binding the AB of the AA.
  • the in vitro assays can be adapted to assess the presence or absence of a cleaving agent and the presence or absence of a target of interest.
  • the presence or absence of the cleaving agent can be detected by a decrease in detectable label of the AA as described above, and the presence or absence of the target can be detected by detection of a target-AB complex, e.g., by use of a detectably labeled anti-target antibody.
  • the AAs disclosed herein can comprise a detectable label.
  • the AA comprises a detectable label which can be used as a diagnostic agent.
  • detectable labels include imaging agents containing radioisotopes such as indium or technetium; contrasting agents for MRI and other applications containing iodine, gadolinium or iron oxide; enzymes such as horse radish peroxidase, alkaline phosphatase, or B-galactosidase; fluorescent substances and fluorophores such as GFP, europium derivatives; luminescent substances such as N-methylacrydium derivatives or the like.
  • VCAM-1 is upregulated both in regions prone to atherosclerosis as well as at the borders of established lesions. Iiyama, et al. (1999) Circulation Research, Am Heart Assoc. 85: 199-207. Collagenases, such as MMP-1, MMP-8 and MMP-13, are overexpressed in human atheroma which may contribute to the rupture of atheromatous plaques. Fricker, J. (2002) Drug Discov Today 7(2): 86-88.
  • AAs disclosed herein find use in diagnostic and/or imaging methods designed to detect and/or label atherosclerotic plaques, e.g., vulnerable atherosclerotic plaques. By targeting proteins associated with atherosclerotic plaques, AAs can be used to detect and/or label such plaques.
  • AAs comprising an anti-VCAM-1 AB and a detectable label find use in methods designed to detect and/or label atherosclerotic plaques. These AAs can be tested in animal models, such as ApoE mice.
  • compositions described herein allow for greater biodistribution and bioavailability of the modified AB or the AA.
  • the compositions described herein provide an antibody therapeutic having an improved bioavailability wherein the affinity of binding of the antibody therapeutic to the target is lower in a healthy tissue when compared to a diseased tissue.
  • a pharmaceutical composition comprising an AB coupled to a MM can display greater affinity to the target in a diseased tissue than in a healthy tissue.
  • the affinity in the diseased tissue is 5-10,000,000 times greater than the affinity in the healthy tissue.
  • the present disclosure provides for an antibody therapeutic having an improved bioavailability wherein the affinity of binding of the antibody therapeutic to its target is lower in a first tissue when compared to the binding of the antibody therapeutic to its target in a second tissue.
  • the first tissue is a healthy tissue and the second tissue is a diseased tissue; or the first tissue is an early stage tumor and the second tissue is a late stage tumor; the first tissue is a benign tumor and the second tissue is a malignant tumor; the first tissue and second tissue are spatially separated; or in a specific example, the first tissue is epithelial tissue and the second tissue is breast, head, neck, lung, pancreatic, nervous system, liver, prostate, urogenital, or cervical tissue.
  • compositions comprising antibodies and fragments thereof (AB) coupled to MMs with desired optimal binding and dissociation characteristics
  • libraries of candidate MMs are screened.
  • MMs having different variable amino acid sequences, varying positions of the cysteine, various lengths, and the like are generated.
  • Candidate MMs are tested for their affinity of binding to ABs of interest.
  • MMs not containing the native amino acid sequence of the binding partner of the AB are selected for construction of the modified antibodies.
  • Affinity maturation of MMs for ABs of interest to select for MMs with an affinity of about 1-10 nM is carried out.
  • modified antibodies and AAs having desired switching characteristics i.e., decreased target binding when in an masked and/or uncleaved conformation relative to target binding when in a masked and/or cleaved conformation
  • desired switching characteristics i.e., decreased target binding when in an masked and/or uncleaved conformation relative to target binding when in a masked and/or cleaved conformation
  • libraries of candidate modified antibodies and candidate AAs having different variable amino acid sequences in the masking moieties (MMs), varying positions of the cysteine in the MM, various linker lengths, and various points of attachment to the parent AB are generated.
  • a scheme for screening/sorting method to identify candidate AAs that display the switchable phenotype is provided here.
  • the libraries are introduced via expression vectors resulting in display of the AAs on the surface of bacterial cells.
  • cells displaying the AA polypeptides are then treated with the appropriate enzyme or reducing agent to provide for cleavage or reduction of the CM.
  • Treated cells are then contacted with fluorescently labeled target and the cells are sorted by FACS to isolate cells displaying AAs which bind target after cleavage/reduction.
  • the cells that display target-binding constructs are then expanded by growth in culture.
  • the cells are then contacted with labeled target and sorted by FACS to isolate cells displaying AAs which fail to bind labeled target in the absence of enzyme/reducing agent. These steps represent one cycle of the screening procedure.
  • the cells can then be subjected to additional cycles by expansion by growth in culture and again subjecting the culture to all or part of the screening steps.
  • Library screening and sorting can also be initiated by first selecting for candidates that do not bind labeled target in the absence of enzyme/reduction agent treatment (i.e., do not bind target when not cleaved/reduced).
  • ABs coupled to different MMs or ABs coupled to the same MMs at different points of attachment, or ABs coupled to the same MM via linkers of different lengths and/or sequences are generated.
  • the masking efficiency of MMs can be determined by the affinity of the MM for AB and the spatial relationship of the MM relative to the binding interface of the AB to its target. Discovery of an effective MM is based on affinity and as well optionally an empirical measure of masking efficiency. The time-dependent target displacement of the MM in the modified antibody or AA can be measured to optimize and select for MMs.
  • a immunoabsorbant Target Displacement Assay (TDA) is described herein for the discovery and validation of efficiently masked antibodies
  • the ability of an MM to inhibit AB binding to its target at therapeutically relevant concentrations and times is measured.
  • the assay allows for measurement of the time-dependent target displacement of the MM.
  • the antibody target is adsorbed to the wells of an ELISA plate overnight a about 4° C.
  • the plate is blocked by addition of about 150 ⁇ l 2% non-fat dry milk (NFDM) in PBS, about 0.5% (v/v) Tween20 (PBST), and incubation at room temperature for about 1 hour.
  • PBST Tween20
  • the plate is then washed about three times with PBST.
  • About 50 ⁇ l superblock is added (Thermo Scientific) and supplemented with protease inhibitors (Complete, Roche).
  • About 50 ⁇ l of an AB coupled to a MM is dissolved in superblock with protease inhibitors (Complete, Roch) and incubated at about 37° C. for different periods of time.
  • the plate is washed about three times with PBST. About 100 ml of anti-huIgG-HRP is added in about 2% NFDM/PBST and incubated at room temperature for about 1 hour. The plate is washed about four times with PBST and about twice with PBS. The assay is developed using TMB (Thermo Scientific) as per manufacturer's directions.
  • AAs comprising an anti-Jagged1 scFv are described herein. These AAs are inactive (masked) under normal conditions due to the attached MM. When the scFv reaches the site of disease, however, a disease-specific enzyme such as ADAM17 will cleave a substrate linker connecting the peptide inhibitor to the scFv allowing it to bind to Jagged1. Bacterial cell surface display is used to find suitable MMs for the anti-Jagged1 scFv. In this example, selected MMs are combined with an enzyme substrate to be used as a trigger to create a scFv construct that becomes competent for targeted binding after protease activation.
  • ADAM17 disease-specific enzyme
  • Genes encoding AAs comprising a Jagged1 antibody in single-chain form are produced by overlap extension PCR or total gene synthesis and ligated into a similarly digested expression plasmid or any other suitable bacterial, yeast, or mammalian expression vector familiar to one skilled in the art.
  • Full length antibodies can be alternatively produced using commercially available expression vectors incorporating half-life extending moieties (e.g. the Fc region of an IgG, serum albumin, or transferrin) and methods familiar to one skilled in the art.
  • the expression plasmid is then transformed or transfected into an appropriate expression host such as BL21 for E. coli or HEK293t cells.
  • Single chain antibodies are harvested from overnight cultures using a Periplasmic fraction extraction kit (Pierce), and purified by immobilized metal ion affinity chromatography, and by size exclusion chromatography.
  • constructs containing an anti-VEGF scFv were generated (the AB).
  • An anti-VEGF scFv AB (V L -linker L-V H ) was designed from the published sequence of ranibizumab (Genentech, Chen, Y., Wiesmann, C., Fuh, G., Li, B., Christinger, H., McKay, P., de Vos, A. M., Lowman, H. B.
  • Ranibizumab is a monoclonal antibody Fab fragment derived from the same parent murine antibody as bevacizumab (Presta L G, Chen H, O'Connor S J, et al Humanization of an anti-vascular endothelial growth factor monoclonal antibody for the therapy of solid tumors and other disorders. Cancer Res, 57: 4593-9, 1997). It is smaller than the parent molecule and has been affinity matured to provide stronger binding to VEGF-A. Ranibizumab binds to and inhibits all subtypes of vascular endothelial growth factor A (VEGF-A). A His6 tag (SEQ ID NO: 48) at the N-terminus and a TEV protease cleavage site were included in the design.
  • VEGF-A vascular endothelial growth factor A
  • the TEV protease is a protease isolated from tobacco etch virus, is very specific, and is used to separate fusion proteins following purification.
  • the anti-VEGF scFv nucleotide and amino acid sequences are provided below in Tables 7 and 8.
  • Ranibizumab was used to screen a pooled random peptide library, consisting of peptides that are X 15 (8.3 ⁇ 10 9 ), X 4 CX 7 CX 4 (3.6 ⁇ 10 9 ), or X 12 CX 3 (1.1 ⁇ 10 9 ), where X is any amino acid and the number represents the total diversity of the library.
  • the total diversity of the pooled library was 1.3 ⁇ 10 10 .
  • the screening consisted of one round of MACS and two rounds of FACS sorting. In the first round MACS screen, 1 ⁇ 10 11 cells were probed with 150 nM biotinylated-ranibizumab, and 5.5 ⁇ 10 7 binding cells were isolated.
  • CM substrate for MMP-9
  • CM substrate for MMP-9
  • masked anti-VEGF scFv construct to provide a cleavable, masked AA.
  • An exemplary construct is provided in FIG. 4 .
  • Primers utilized for construction of the exemplary constructs are represented in Table 10 below.
  • a MBP:anti-VEGF scFv AB fusion was cloned.
  • the MBP maltose binding protein expresses well in E. coli , as a fusion protein, and can be purified on a maltose column, a method well known in the art to make fusion proteins.
  • the MBP was used to separate the masked scFv.
  • Anti-VEGF scFv AB was cloned into the pMal-c4x vector (NEB) as a C-terminal fusion with MBP using the EcoRI and HindIII restriction sites in the multiple cloning site (MCS).
  • the primers CX0233 and CX0249 (Table 10) were used to amplify the Anti-VEGF scFv AB and introduce the EcoRI and HindIII sites, respectively.
  • the accepting vector for the AA was synthesized using polymerase chain reaction (PCR) with the overlapping primers CX0271 and CX0270 which placed the cloning site for the peptide MM's, linker sequences, and MMP-9 CM protease site between the TEV protease site and the anti-VEGF scFv AB.
  • the primers CX0271 and CX0249 were used to amplify the C-terminal portion of the construct, while the primers CX0270 and CX0288 (Table 10) were used to amplify the N-terminal portion. Products from both the above reactions were combined for a final PCR reaction using the outside primers, CX0249 and CX0288 (Table 10), and cloned into the pMal vector as an MBP fusion using the Sad and HindIII restriction sites.
  • CM/Anti-VEGF scFv AB vector nucleotide sequence atgggccatcaccatcaccatcacggtggggaaaatctgtattttcagggccagtctggccagctcgagtgggccaaggtggccaagtgcacatgccactggg cttcctgggtccgggtgggccaaggtggccaagtgcacatgccactgggccctgggtccgggcggttctgatattcaactgacccagagcccttctccctgagtgccagggtgaccgtgttacgatcacttgctcggccagccaa gatatttctaactacctgaattggtaccagcagaagccaggaaggcaccaaaagtcctgatctacttcacaagttcactgcattccggcgtaccg
  • the 306 MM and 314 MM (Table 9) were amplified from the ecpX display vector using the primers CX0289 and CX0290 (Table 10), and directionally cloned into the N-terminally masked vector using the SfiI restriction sites.
  • the corresponding nucleotide and amino acid sequences are provided in Table 12 below.
  • Expression of the MBP:AA fusions were conducted in a K12 TB1 strain of E. coli An ampicillin-resistant colony containing the desired construct was used to inoculate a 5 ml overnight culture containing LB medium supplemented with 50 ⁇ g/mL Ampicillin. The entire overnight culture was used to inoculate 500 mL of fresh LB medium supplemented with 50 ⁇ g/mL ampicillin and 0.2% Glucose and allowed to grow at 37° C. shaking at 250 rpm until an O.D. of 0.5 was reached.
  • Isopropylthio- ⁇ -D-galactosidase was then added to a final concentration of 0.3 mM and the culture was allowed to grow for a further 3 hrs under the same conditions after which the cells were harvested by centrifugation at 3000 ⁇ g.
  • Inclusion bodies were purified using standard methods. Briefly, 10 mls of BPER II cell lysis reagent (Pierce). Insoluble material was collected by centrifugation at 14,000 ⁇ g and the soluble proteins were discarded.
  • the insoluble materials were resuspended in 5 mls BPER II supplemented with 1 mg/mL lysozyme and incubated on ice for 10 minutes after which 5 mls of BPER II diluted in water 1:20 was added and the samples were spun at 14,000 ⁇ g. The supernatant was removed and the pellets were wash twice in 1:20 BPERII.
  • the purified inclusion bodies were solubilized in PBS 8 M Urea, 10 mM BME, pH 7.4.
  • the MBP fusion proteins were diluted to a concentration of approximately 1 mg/mL and refolded using a stepwise dialysis in PBS pH 7.4 from 8 to 0 M urea through 6, 4, 2, 0.5, and 0 M urea.
  • a stepwise dialysis in PBS pH 7.4 from 8 to 0 M urea through 6, 4, 2, 0.5, and 0 M urea.
  • the 0M Urea dialysis included 0.2 M Arginine.
  • the proteins were dialyzed against 0.05 M Arginine followed by and extensive dialysis against PBS pH 7.4. All dialysis were conducted at 4° C. overnight. To remove aggregates, each protein was subjected to size exclusion chromatography on a sephacryl S-200 column. Fractions containing the correctly folded proteins were concentrated using an Amicon Ultra centrifugal filter.
  • the primers CX0308 and CX0310 (Table 10) were used to amplify and add a NcoI restriction site to the 5′ end and a HindIII restriction site and His6 tag (SEQ ID NO: 48) to the 3′ end, respectively, of the (MM accepting site/MMP-9 CM/VEGFscFv AB) vector which was subsequently cloned into a vector containing the pelB signal peptide.
  • Anti-VEGF scFv MMs were cloned as previously described. The corresponding nucleotide and amino acid sequences are provided in Table 13.
  • Expression of the Anti-VEGF scFv His AAs was conducted in a K12 TB1 strain of E. coli An ampicillin-resistant colony containing the desired construct was used to inoculate a 5 ml overnight culture containing LB medium supplemented with 50 ⁇ g/mL Ampicillin. 2.5 ml of overnight culture was used to inoculate 250 mL of fresh LB medium supplemented with 50 ⁇ g/mL ampicillin and 0.2% Glucose and allowed to grow at 37° C. shaking at 250 rpm until an O.D. of 1.0 was reached.
  • Isopropylthio-13-D-galactosidas was then added to a final concentration of 0.3 mM and the culture was allowed to grow for a further 5 hrs at 30° C. after which the cells were harvested by centrifugation at 3000 ⁇ g.
  • the periplasmic fraction was immediately purified using the lysozyme/osmotic shock method. Briefly, the cell pellet was resuspended in 3 mLs of 50 mM Tris, 200 mM NaCl, 10 mM EDTA, 20% Sucrose, pH 7.4 and 2 uL/mL ready-use lysozyme solution was added. After a 15 min incubation on ice, 1.5 volumes of water (4.5 mLs) was added and the cells were incubated for another 15 min on ice. The soluble periplasmic fraction was recovered by centrifugation at 14,000 ⁇ g.
  • the Anti-VEGF scFv His proteins were partially purified using Ni-NTA resin. Crude periplasmic extracts were loaded onto 0.5 ml of Ni-NTA resin and washed with 50 mM phosphate, 300 mM NaCl, pH 7.4. His tagged proteins were eluted with 50 mM phosphate, 300 mM NaCl, 200 mM Imidizale, pH 6.0. Proteins were concentrated to approximately 600 ⁇ L and buffer exchanged into PBS using Amicon Ultra centrifugal concentrators.
  • the primers CX0312 and CXO314 were used to amplify the sequence encoding MMP-9 CM/Anti-VEGF scFv.
  • the primers also included sequences for a 5′ EcoRI restriction site and a 3′ NcoI restriction site and linker sequence. Cutting the PCR amplified sequence with EcoRI and NcoI and subsequent cloning into the pFUSE-hIgG1-Fc2 vector generated vectors for the expression of Fc fusion proteins.
  • Anti-VEGF scFv AB MMs were inserted into these vectors as previously described.
  • 10 ⁇ g of expression vectors for 306 MM/MMP-9 CM/anti-VEGFscFv-Fc, 314 MM/MMP-9 CM/anti-VEGFscFv-Fc or anti-VEGFscFv-Fc were introduced into 10 7 HEK-293 freestyle cells (Invitrogen, CA) by transfection using transfectamine 2000 as per manufacturer's protocol (Invitrogen, CA). The transfected cells were incubated for an additional 72 hours. After incubation, the conditioned media was harvested and cleared of cells and debris by centrifugation. The conditioned media was assayed for activity by ELISA.
  • HEK cell supernatant Fifty microliters of HEK cell supernatant was added to 200 ⁇ L MMP-9 digestion buffer and incubated with or without ⁇ 19U MMP-9 for 2 hrs at 37° C. Samples were then diluted 1:1 in PBST, 10% Superblock and 100 ⁇ L were added to the ELISA wells. Detection of the AA was achieved using Anti-human Fc-HRP conjugate at a dilution of 1:2500. MMP-9 activation of MMP-9 cleavable masked anti-VEGF scFv-Fc is presented in FIG. 7 .
  • Anti-VEGF scFv Fc AAs were purified using a Protein A column chromatography. Briefly, 10 mLs of HEK cell supernatants were diluted 1:1 with PBS and added to 0.5 mL Protein A resin pre-equilibrated in PBS. Columns were washed with 10 column volumes of PBS before eluting bound protein with 170 mM acetate, 300 mL NaCl pH. 2.5 and immediately neutralized 1 mL fractions with 200 ⁇ L of 2 M Tris pH 8.0. Fractions containing protein were then concentrated using Amicon Ultra centrifugal concentrators. ELISA was conducted as with HEK cell supernatants. ELISA data showing the MMP-9 dependent VEGF binding of Anti-VEGFscFv Fc AA constructs with the MMs 306 and 314 that were purified using a Protein A column are presented in FIG. 8 .
  • VEGF was adsorbed to the wells of a 96-well micro-titer plate, washed and blocked with milk protein. 25 ml of culture media containing anti-VEGF antibody or anti-VEGF AA's containing the MM JS306, was added to the coated wells and incubated for 1, 2, 4, 8 or 24 hours. Following incubation, the wells were washed and the extent of bound AA's was measured by anti-huIgG immunodetection.
  • FIG. 9 shows mask 306 can completely inhibit binding to VEGF at one hour; however, at 16 hours, >50% of the 306-antiVEGF AA is bound to its antigen, VEGF.
  • the 306 mask which binds to anti-VEGF antibody with an affinity of >600 nM, does not efficiently preclude binding to VEGF.
  • CTLA4 antibody masking moieties were isolated from a combinatorial library of 10 10 random 15mer peptides displayed on the surface of E. coli according to the method of Bessette et al (Bessette, P. H., Rice, J. J and Daugherty, P.S. Rapid isolation of high-affinity protein binding peptides using bacterial display. Protein Eng. Design & Selection. 17:10,731-739, 2004).
  • Biotinylated mouse anti-CTLA4 antibody (clone UC4 F10-11, nM) was incubated with the library and antibody-bound bacteria expressing putative binding peptides were magnetically sorted from non-binders using streptavidin-coated magnetic nanobeads.
  • Relative affinity and off-rate screening of individual clones were performed using a ficin digested Dylight-labeled Fab antibody fragment to reduce avidity effects of the bivalent antibody due to the expression of multiple peptides on the bacterial surface.
  • individual clones were screened for binding in the presence of 20 uM E. Coli depleted IgG as a competitor
  • Amino acid and nucleotide sequences of the 4 clones chosen for MM optimization are shown in Table 15. These sequences will interchangeably referred to as 115 MM, 184 MM, 182 MM, and 175 MM.
  • MM candidates with a range of off-rates were chosen, to determine the effects of off-rates on MM dissociation after cleavage. An MM that did not bind anti-CTLA4 was used as a negative control.
  • Anti-CTLA4 ScFv was cloned from the HB304 hybridoma cell line (American Type Culture Collection) secreting UC4F10-11 hamster anti-mouse CTLA4 antibody according to the method of Gilliland et al. (Gilliland L. K., N. A. Norris, H. Marquardt, T. T. Tsu, M. S. Hayden, M. G. Neubauer, D. E. Yelton, R. S. Mittler, and J. A. Ledbetter. Rapid and reliable cloning of antibody variable regions and generation of recombinant single chain antibody fragments. Tissue Antigens 47:1, 1-20, 1996).
  • the primers IgK1 (gtyttrtgngtnacytcrca (SEQ ID NO: 93)) and IgH1 (acdatyttyttrtcnacyttngt (SEQ ID NO: 94)) were used for first strand synthesis of the variable light and heavy chains, respectively.
  • a poly G tail was added with terminal transferase, followed by PCR using the 5′ ANCTAIL primer (Gilliland et al. referenced above) (cgtcgatgagctctagaattcgcatgtgcaagtccgatggtccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
  • primers were designed to PCR amplify the variable light and heavy chains individually, with half of a (GGGS) 3 linker (SEQ ID NO: 102) at either the N- or C-terminus for a subsequent ‘splicing by overlapping extension’ PCR (SOE-PCR; Horton, R. M., Hunt, H. D., Ho, S. N., Pullen, J. K. and Pease, L. R. (1989) Engineering hybrid genes without the use of restriction enzymes: gene splicing by overlap extension.
  • GGGS GGGS 3 linker
  • Linker containing ScFvs were PCR amplified, digested with Nde1 and EcoR1 (an internal restriction site in V H ) and gel purified. The PCR fragments were ligated into the vectors and transformed into E. coli The nucleotide and amino acid sequences are presented in Table 20.
  • MM sequences were PCR amplified, digested at sfi1 and xho1 sites, ligated into linker anti-CTLA4 scFv constructs, transformed into E. Coli and sequenced.
  • the complete nucleotide and amino acid sequences of the MM115-CM-AB are shown below in Tables 21 and 22 respectively.
  • 10 ug of expression vectors for p175CTLA4pfuse, p182CTLA4pfuse, p184CTLA4pfuse, p115CTLA4pfuse, or pnegCTLA4pfuse were introduced into 10 7 HEK-293 freestyle cells (Invitrogen) by transfection using transfectamine 2000 as per manufacturer's protocol (Invitrogen). The transfected cells were incubated for an additional 72 hours. After incubation the conditioned media was harvested and cleared of cells and debris by centrifugation. The conditioned media was assayed for activity by ELISA as described below.
  • 50 ul of conditioned media from cultures of transfected HEK-293 cells expressing MM175-anti-CTLA4 scFv, MM182-anti-CTLA4 scFv, MM184-anti-CTLA4 scFv, MM115-anti-CTLA4 scFv, or MMneg-anti-CTLA4 scFv that had previously been untreated or treated with MMP-9, were added to wells and incubated RT for 15 minutes. Following incubation, 50 ul of PBS containing 0.5 ug/ml biotinylated murine B71-Fc (R & D systems) was added to each well.
  • Tables 24 and 25 display nucleotide and amino acid sequences for anti-human CTLA-4 scFv, respectively.
  • M13 bacteriophage capable of binding human CTLA were supplied (under contract, by Creative Biolabs, 21 Brookhaven Blvd., Port Jefferson Station, N.Y. 11776). Phage were produced in E. coli TG-1 and purified by PEG; NaCl precipitation.
  • Phage ELISA measurement of CTLA-4 binding To measure the binding of anti-CTLA-4 scFv-C2, 100 ul of a 0.5 ug/ml Human CTLA-4-IgG or murine CTLA-4-IgG (R&D Systems) in PBS was added to microwells (96 Well Easy Wash; Corning) and incubated overnight at 4° C. Wells were then blocked for 1 hour at room temperature (RT) with 150 ul of 2% non-fat dry milk (NFDM) in PBST (PBS, pH 7.4, 0.5% Tween-20). The wells were then washed 3 ⁇ with 300 ul PBST.
  • RT room temperature
  • NFDM non-fat dry milk
  • FIG. 19 shows the binding of anti-CTLA4 scFv to both murine and human CTLA4.
  • AAs comprising an IgG as the AB
  • AAs comprising an anti-EGFR and anti-VEGF in the human IgG are described in the following sections. These AAs are masked and inactive under normal conditions. When the AAs reach the diseased tissue, they are cleaved by a disease-specific protease and can then bind their target. Bacterial display is used to discover suitable MMs for the anti-EGFR and anti-VEGF antibodies. In, these examples, selected MMs are combined with an enzyme substrate to be used as a trigger to create AAs that become competent for specific binding to target following protease activation. Furthermore, bacterial display is used to alter the discovered peptides to increase affinity for the ABs and enhance the inhibition of targeted binding in the un-cleaved state. The, increased MM affinity and enhanced inhibition is important for appropriate AA function.
  • the anti-VEGF light chain variable region was PCR amplified with primers CX0311 and CX0702 using the anti-VEGF mmp-9 306 scFv (described above) as template and then cloned into the pFIL2-CL-hk vector using the EcoRI and BsiWI restriction sites (pFIL2-VEGF-Lc).
  • the 306 mmp-9 light chain was PCR amplified with primers CX0325 and CX0702 using the anti-VEGF mmp-9 scFv as template and cloned as above (pFIL2-306 mVEGF-Lc).
  • the anti-VEGF heavy chain variable regions were PCR amplified using primers CX0700 and CX0701 using the 306 MM/MMP-9 CM/anti-VEGFscFv (described above) as template and cloned into the pFIL-CHIg-hG1 vector using the EcoRI and NheI restriction sites (pFIL-VEGF-Hc).
  • the primers are provided below in Table 26.
  • the mask 306, used for anti-VEGF AA development did not efficiently mask the target binding over long exposure to target, due to low affinity of the MM for the AB.
  • One approach to increasing the affinity of the MM is to subject the peptide to affinity maturation as described below.
  • the 306 anti-VEGF MM was affinity matured by using a soft randomization approach.
  • An ecpX cell display library was constructed in with the nucleotide ratios shown in Table 28.
  • the final library diversity (306 SR) was approximately 2.45 ⁇ 10 8 .
  • An initial MACS round was performed with protein-A labeled magnetic beads and a number of cells that provided greater than 100 ⁇ oversampling of the library. Prior to magnetic selection the cells were incubated with 100 nM anti-VEGF IgG and 10 ⁇ M 306 peptide (306P, PCSEWQSMVQPRCYYG (SEQ ID NO: 140)), to reduce the binding of variants with equal or lower affinity than the original 306 sequence. Magnetic selection resulted in the isolation of 2 ⁇ 10 7 cells.
  • the first round of FACS sorting was performed on cells labeled with 1 nM DyLight (fluor 530 nM)-anti-VEGF.
  • the second and third round of FACS was performed on cells lableled with 1 nM DyLight-anti-VEGF in the presence of 100 nM 306P. Selection gates were set so that only 5% of cells with the strongest binding were collected.
  • the population of cells sorted in the third round were first incubated with 10 nM DyLight-anti-VEGF followed by addition of 306P to a final concentration of 100 nM and incubated at 37° C. for 20 minutes. The brightest 2% of the positive population was collected, representing binding that was not competed by 306P.
  • FACS rounds 5 through 7 were done as follows; the populations were labeled with 10 nM DyLight labeled anti-VEGF and then competed off with unlabeled VEGF (100 nM) at 37° C. for 7, 10, and 15 minutes, respectively. The brightest 1% were sorted in FACS rounds 5 through 7.
  • Binding of the eCPX3.0 clones 306, JS1825, J51827, and J51829 were analyzed on FACS at 3 different concentrations of DyLight labeled anti-VEGF. The binding curves are shown in FIG. 21 . All three of the affinity matured peptides displayed at least 10 fold higher affinity than 306P.
  • Affinity matured ecpX3.0 clones (J51825, JS1827, and J51829) were PCR amplified using primers CX0289 and CX0687 and cloned into pFIL2-306 mVEGF-Lc using the SfiI restriction sites to produce the vectors pFIL2-1825 mVEGF-Lc, pFIL2-1827 mVEGF-Lc, and pFIL2-1829 mVEGF-Lc.
  • the nucleotide and amino acid sequences are provided in the tables following. Parentheses delineate the demarcations between the various sequence domains: (Linker)(MM)(Linker)(CM)(Linker)(AB).
  • 3 ug of pFIL-VEGF-Hc and 3 ⁇ g pFIL2-VEGF-Lc were co-transfected into CHO-S cells (Invitrogen) using Lipofectamine 200 (Invitrogen) according to manufacturers protocol. Transfected cells were cultured in Freestyle CHO media (Invitrogen) and selected for resistance to zeocin and blasticidin. Individual clones were isolated by limiting dilution and selected for expression of human IgG capable of binding EGFR by ELISA. All antibodies and AAs are purified by Protein-A chromatography using standard techniques.
  • each expression vector for AA light chains pFIL2-306 mVEGF-Lc, pFIL2-1825 mVEGF-Lc, pFIL2-1827 mVEGF-Lc, or pFIL2-1829 mVEGF-Lc was co-transfected into CHO-S cells with 3 ⁇ g pFIL-VEGF-Hc.
  • Transfected cells were cultured in Freestyle CHO media (Invitrogen) and selected for resistance to zeiocin and blasticiidin. Inkdivideual clones were isolated by limiting dilution and selected for expression of human IgG capable of binding EGFR by ELISA.
  • VEGF is adsorbed to the wells of a 96 well micro-titer plate, washed and blocked with milk protein. About 25 ml of culture media containing anti-VEGF antibody or anti-VEGF AA's containing the MM's JS306, JS1825, JS1827 and JS1829 is added to the coated wells and incubated for about 1, 2, 4, 8 or 24 hours. Following incubation the wells are washed and the extent of bound AA's measured by anti-huIgG immunodetection.
  • the C225 light chain variable region gene was synthesized by assembly PCR using oligos CX638-CX655 as in Bessette et al., Methods in Molecular Biology, vol. 231. The resulting product was digested with BamHI/NotI and ligated to the large fragment of pXMal digested with BamHI/NotI to create plasmid pX-scFv225-Vk. Similarly, the C225 heavy chain variable region gene was synthesized by assembly PCR using oligos CX656-CX677, digested with BglII/NotI and ligated to pXMal BamHI/NotI to create plasmid pX-scFv225-Vh.
  • variable light chain gene was then cloned from pX-scFv225-Vk as a BamHI/NotI fragment into the pX-scFv225-Vh plasmid at BamHI/Not to create the plasmid pX-scFv225m-HL, containing the scFv gene based on C225.
  • the IL2 signal sequence was moved from pINFUSE-hIgG1-Fc2 (InvivoGen) as a KasI/NcoI fragment to pFUSE2-CLIg-hk (InvivoGen) digested with KasI/NcoI, resulting in plasmid pFIL2-CL-hk.
  • the IL2 signal sequence was also moved from pINFUSE-hIgG1-Fc2 as a KasI/EcoRI fragment to pFUSE-CHIg-hG1 (InvivoGen) digested with KasI/EcoRI (large and medium fragments) in a three-way ligation, resulting in plasmid pFIL-CHIg-hG1.
  • the human IgG light chain constant region was site specifically mutated by amplification from plasmid pFIL2-CL-hk with oligos CX325/CX688, digestion with BsiWI/NheI, and cloning into pFIL2-CL-hk at BsiWI/NheI, resulting in plasmid pFIL2-CL 225 .
  • the human IgG heavy chain constant region was site specifically mutated by amplification from plasmid pFIL-CHIg-hG1 in three segments with oligos CX325/CX689, CX690/CX692, and CX693/CX694, followed by overlap PCR of all three products using outside primers CX325/CX694.
  • the resulting product was digested with EroRI/AvrII and cloned into pINFUSE-hIgG1-Fc2 at EcoRI/NheI, resulting in plasmid pFIL-CH 225 .
  • variable light chain gene segment was amplified from pX-scFv225m-HL with oligos CX695/CX696, digested with BsaI, and cloned into pFIL2-CL 225 at EcoRI/BsiWI, resulting in the C225 light chain expression vector pFIL2-C225-light.
  • variable heavy chain gene segment was amplified from pX-scFv225m-HL with oligos CX697/CX698, digested with BsaI, and cloned into pFIL-CH 225 at EcoRI/NheI, resulting in the C225 heavy chain expression vector pFIL-C225-heavy.
  • Plasmid pX-scFv225m-HL was PCR amplified in separate reactions with primers CX730/CX731 and CX732/CX733, and the resulting products were amplified by overlap PCR with outside primers CX730/CX733, digested with BglII/NotI, and cloned into pXMal at BamHI/NotI, resulting in plasmid pX-scFv225m-LH.
  • Linker sequence was added to the N-terminal side of the human IgG Fc fragment gene by PCR amplification of pFUSE-hIgG-Fc2 in a reaction with overlapping forward primers CX740, CX741 and reverse primer CX370.
  • the resulting product was digested with EcoRI/BglII, and the ⁇ 115 bp fragment was cloned into pFUSE-hIgG-Fc2 at EcoRI/BglII.
  • the resulting plasmid was digested with KpnI/BglII, and the large fragment was ligated to the KpnI/BamHI-digested PCR product of amplifying pX-scFv225m-LH with oligos CX736/CX735, resulting in plasmid pPHB3734.
  • the resulting plasmid was digested with SfiI/XhoI, and masking peptide 3690 was cloned in as an SfiI/XhoI fragment of pPHB3690, resulting in plasmid pPHB3783.
  • protease substrate SM984 was added by digesting the resulting plasmid with BamHI/KpnI and ligating the product of annealing the phosphorylated oligos CX747/CX748, resulting in plasmid pPHB3822.
  • the tandem peptide mask was constructed by digesting the resulting plasmid with XhoI, dephosphorylating the 5′ ends, and cloning in the XhoI-digested PCR product of amplifying pPHB3579 with primers CX268/CX448, resulting in plasmid pPHB3889.
  • the masking region, linker, substrate, and light chain variable region of pPHB3783, pPHB3822, and pPHB3889 were amplified by PCR with primers CX325/CX696, digested with EcoRI/BsiWI, and cloned into pFIL2-CL 225 at EcoRI/BsiWI, resulting in the AA light chain expression vectors pPHB4007, pPHB3902, and pPHB3913 respectively.
  • Affinity matured masking peptides were swapped into the AA light chain expression vectors by cloning as SfiI/XhoI fragments.
  • Protease substrates were swapped in as BamHI/KpnI compatible fragments.
  • 3 ⁇ g of pFIL-CH 225 -HL and 3 ⁇ g pFIL2-CH 225 -light were co-transfected into CHO-S cells (Invitrogen) using Lipofectamine 200 (Invitrogen) according to manufacturers protocol. Transfected cells were cultured in Freestyle CHO media (Invitrogen) and selected for resistance to zeocin and blasticidin. Individual clones were isolated by limiting dilution and selected for expression of human IgG capable of binding EGFR by ELISA. All antibodies and AAs are purified by Protein-A chromatography using standard techniques.
  • each expression vector for AA light chains was co-transfected into CHO-S cells with 3 ug pFIL-CH 225 -HL.
  • Transfected cells were cultured in Freestyle CHO media (Invitrogen) and selected for resistance to zeiocin and blasticiidin. Inkdivideual clones were isolated by limiting dilution and selected for expression of human IgG capable of binding EGFR by ELISA.
  • An initial MACS round was performed with SA dynabeads and 1.4 ⁇ 10 8 cells from the ecpX3-755 library. Prior to magnetic selection the cells were incubated with 3 nM biotin labeled C225Mab. Magnetic selection resulted in the isolation of 6 ⁇ 10 6 cells. The first round of FACS sorting was performed on 2 ⁇ 10 7 cells labeled with 0.1 nM DyLight (fluor 530 nM)-C225Mab and resulted in isolation of 1.5 ⁇ 10 5 cells with positive binding.
  • the second round of FACS was performed on cells labeled with 10 nM DyLight-C225Mab in the presence of 100 uM 3690 peptide (CISPRGC (SEQ ID NO: 1)) at 37° C.
  • the 3 rd and 4 th rounds were performed on cells labeled with 100 nM DyLight-C225Fab in the presence of 100 uM3690 peptide (CISPRGC (SEQ ID NO: 1)) at 37° C.
  • the brightest 1% of the positive population were collected, representing binding that was not competed by 3690 peptide.
  • FIG. 22 shows the process for affinity maturation of some of the EGFR MM's.
  • EGFR was adsorbed to the wells of a 96 well micro-titer plate, washed and blocked with milk protein. 25 ml of culture media containing 2 nM anti-EGFR antibody or anti-EGFR AA's containing the MM's 3690, 3957, 3954 and 3960/3579 was added to the coated wells and incubated for 1, 2, 4, 8 or 24 hours. Following incubation the wells were washed and the extent of bound AA's measured by anti-huIgG immunodetection. Anti-EGFR AA binding was normalized to anti-EGFR antibody binding (100%) for direct comparison of the masking efficiency in the AA context.
  • the consensus sequences for the EGFR MMs are provided below.
  • the 3690 MM consensus (CISPRGC (SEQ ID NO: 1)) is one major consensus sequence.
  • uPA-selective substrates were isolated from an 8eCLiPS bacterial library consisting of ⁇ 10 8 random 8-mer substrates expressed as N-terminal fusions on the surface of E. coli . Alternating rounds of positive and negative selections by FACS were used to enrich for substrates optimized for cleavage by uPA and resistant to cleavage by the off-target serine proteases klk5 and 7. The naive library was incubated with 8 ug/ml uPA for 1 h at 37° C. followed by labeling with SAPE (red) and yPET mona (green).
  • Cleavage by uPA results in loss of the SAPE tag and allows for sorting of bacteria expressing uPA substrates (green only, positive selection) from bacteria expressing uncleaved peptides (red+green).
  • uPA substrates were sorted by FACS and the enriched pool was amplified and then incubated with 5 ng/ml KLK5 and 7 for 1 h at 37° C., labeled with SAPE and yPET mona, and sorted for lack of cleavage by these off-target proteases (red+green, negative selection).
  • the pool was amplified and sorted with 4 additional alternating rounds of positive and negative FACS using decreasing concentrations of uPA (4 ug/ml, 2 ug/ml) and increasing concentrations of klk5 and 7 (5 ng/ml, 10 ng/ml).
  • Individual clones from the last 3 rounds of FACS were sequenced and grouped into several consensuses (Table 44). Clones from each consensus were then analyzed individually for cleavage by a range of concentrations of uPA, klk5 and 7 and plasmin for specificity of cleavage by on versus off-target proteases in Table 44.
  • FIG. 25 shows that unlike the uPA control and substrate SM16, KK1203, 1204 and 1214 show resistance to cleavage by KLK5, KLK7 and Plasmin.
  • Plasmin-selective substrates were isolated from a second generation plasmin 10eCLiPS bacterial library consisting of ⁇ 10 8 random 10-mer substrates expressed as N-terminal fusions on the surface of E. coli (ref). Alternating rounds of positive and negative selections by FACS were used to enrich for substrates optimized for cleavage by plasmin and resistant to cleavage by the off-target matrix metalloproteinases (represented by MMP-9) and serine proteases (represented by klk5 and klk7).
  • MMP-9 matrix metalloproteinases
  • serine proteases represented by klk5 and klk7.
  • the second generation plasmin 10eCLiPS library was incubated with 300 pM plasmin for 1 h at 37° C. followed by labeling with SAPE (red) and yPET mona (green). Cleavage by plasmin results in loss of the SAPE tag and allows for sorting of bacteria expressing plasmin substrates (green only, positive selection) from bacteria expressing uncleaved peptides (red+green). plasmin substrates were sorted by FACS and the enriched pool was amplified and then incubated with 80 U/ml MMP-9 2 h at 37° C., labeled with SAPE and yPET mona, and sorted for lack of cleavage by these off-target proteases (red+green, negative selection).
  • the pool was amplified and sorted with 4 additional alternating rounds of positive and negative FACS using plasmin (round three at 100 pM or 300 pM, round five at 100 pM or 300 pM) and klk5 and 7 (Round four at 100 ng/ml, round six at 200 ng/ml).
  • Individual clones from each the last 2 rounds of FACS were sequenced (Table 45).
  • Clones from each consensus were then analyzed individually for cleavage by plasmin, MMP-9, klk5 and klk7 for specificity of cleavage by on versus off-target proteases. Representative data showing increased specificity towards Plasmin cleavage is shown in FIG. 26 .
  • FIG. 26 shows that unlike a non-optimized substrate, the optimized substrates P1 as1237, P1 as129 and Plas 1254 show resistance to cleavage by KLK5, KLK7.
  • Nucleotide and amino acid sequences of uPA enzyme-activated anti VEGF light chain AAs are provided in the tables below. Parentheses delineate the demarcations between the various sequence domains: (Linker)(MM)(Linker)(CM)(Linker)(AB).
  • Nucleotide and amino acid sequences of plasmin enzyme-activated anti VEGF light chain AAs are provided in the tables below. Parentheses delineate the demarcations between the various sequence domains: (Linker)(MM)(Linker)(CM)(Linker)(AB).
  • Substrates were constructed in a two step process.
  • two products were PCR amplified using the CX0325 forward primer with a substrate specific reverse primer (CX0720 AANL (SEQ ID NO: 361), CX0722 PTNL (SEQ ID NO: 362), CX0724 PTN, and CX0758 DEVD (SEQ ID NO: 334)), the other PCR amplified using the CX0564 reverse primer with a substrate specific forward primer (CX0721 AANL (SEQ ID NO: 361), CX0723 PTNL (SEQ ID NO: 362), CX0725 PTN, and CX0754 DEVD (SEQ ID NO: 334).
  • the substrate for the PCR was the anti-VEGF mmp-9 306 scFv.
  • the two products were combined and PCR amplified using the outside primers CX0325 and CX0564.
  • the final products were cloned into the pFIL2-CL-anti-VEGF Lc using the EcoRI and XhoI restriction sites.
  • 3 ⁇ g of pFIL-VEGF-HL and 3 ⁇ g pFIL2-306-substrate-VEGF-light were co-transfected into CHO-S cells (Invitrogen) using Lipofectamine 200 (Invitrogen) according to manufacturers protocol. Transfected cells were cultured in Freestyle CHO media (Invitrogen) and selected for resistance to zeocin and blasticidin. Individual clones were isolated by limiting dilution and selected for expression of human IgG capable of binding EGFR by ELISA. All antibodies and AAs are purified by Protein-A chromatography using standard techniques.
  • ScFv AAs were diluted to 200 nM in assay buffer and combined with rhLegumain diluted in assay buffer at 2 ug/ml. Digests were incubated overnight at room temperature. IgG AAs were diluted to 200 nM in assay buffer and combined with rhLegumain diluted in assay buffer at concentrations form 2-40 mg/mL (final rhLegumain concentrations 1 ug/ml, 5 ug/ml, 20 ug/ml. Digests were incubated overnight a 37° C. Following digestion, the extent of activation was measured by the extent of AA binding to VEGF on ELISA plates, visualized with anti-human-Fc. FIG.
  • Panel A shows activation of ScFv AAs containing legumain substrates AANL (SEQ ID NO: 361) and PTNL (SEQ ID NO: 362) following treatment with 5 mg/mL legumain.
  • Panel B shows activation of an anti-VEGF IgG AA containing the legumain substrate PNTL.
  • a plasmin activated AA 100 ⁇ g of a plasmin activated AA,) AA PLAS VEGF, or one of the legumain activated AAs, AA AANL (SEQ ID NO: 361) VEFG or AA PTNL (SEQ ID NO:362) VEGF.
  • AA AANL SEQ ID NO: 361) VEFG or AA PTNL (SEQ ID NO:362) VEGF.
  • serum was collected.
  • Total AA concentration was calculated from ELISA measurement of total human Fc in the serum.
  • the concentration of activated antibody was calculated from a human VEGF binding ELISA measurement and is shown in FIG. 28 .
  • the ratio of activated AA to total AA at each time point is shown in FIG. 28 as the average of measurements from individual animals and is expressed as percent activated. While the plasmin activated AA is nearly completely activated at 7 days both legumain activated AAs are only minimally activated.
  • FIG. 29 shows that a masked single-chain Fv-Fc fusion pro-antibodies exhibit increased serum half-life.
  • a masking polypeptide is appended to an antibody N-terminus such that the mask can interact with the antibody combining site to increase thermodynamic stability or block neutralizing antibodies.
  • a protease substrate can be used to enable removal of the mask at different rates in serum or specific tissues.
  • FIG. 30 shows that the scFv-Fc serum concentration in healthy mice over 10 days.
  • Serum was collected at the indicated times and the concentration of total scFv-Fc was measured by ELISA.
  • the AA concentration remained stable 7 days post does, whereas the parent scFv-Fc concentration decreased after 3 days and was almost undetectable at 10 days.
  • FIG. 31 shows that AA scFv-Fc concentrations are elevated and persist longer in serum compared with parent scFv-Fc in tumor-bearing mice:
  • An equivalent single dose of anti-VEGF scFv-Fc, AA MMP VEGF (AA 1) or AA Plasmin VEGF (AA 2) was given Nude mice bearing HT29 xenografts (A) or MDA-MB-231 xenografts (B). Serum was collected at the indicated times and the concentration of total scFv-Fc was measured by ELISA. In both studies a higher percentage of the initial AA dose was detected in the serum at 3 days (B) and 3 and 7 days (A).
  • FIG. 32 shows that AAs persist at higher concentrations in a multidose study: Tumor-bearing Balb/c nu/nu mice were injected with 5 mg/kg of parental VEGF scFv-Fc, AA1, 2 or 3 every 3 days. Serum was collected at the indicated times and the concentration of AA or parent scFv-Fc was measured by ELISA. All three AAs maintained significantly higher serum concentrations than the parent throughout the study.
  • AAs contain a masking peptide and MMP substrate attached by a short linker as shown masking peptide substrate GQSGQPCSEWQSMVQPRCYY GGGSGGSGQGGQ VHMPLGFLGP GGSDIQLTQSPSSLSASVGDRVTITCS ASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVP WTFGQGTKVEIKGGGSGGGSGGGSGGGGSGGGGSGGGGSGEVQLVESGGGLVQPGGSLRLSCAASGY DFTHYGMNWVRQAPGKGLEWVGWINTYTGEPTYAADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVY YCAKYPYYYGTSHWYFDVWGQGTLVTVSGGSGAMVRSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVV
  • AAs contain a masking peptide and Plasmin substrate attached by a short linker as shown masking peptide substrate GQSGQPCSEWQSMVQPRCYY GGGSGGSGQGGQ QGPMFKSLWD GGSDIQLTQSPSSLSASVGDRVTITCS ASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVP WTFGQGTKVEIKGGGGSGGGGSGGGGSGEVQLVESGGGLVQPGGSLRLSCAASGYDFTHYGMNWVRQ APGKGLEWVGWINTYTGEPTYAADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPYYYGTSH WYFDVWGQGTLVTVSGGSGAMVRSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHE
  • VEGF AAs contain a masking peptide, Gly Ser (GS) linkers and VEGF but no substrate attached by a short linker as shown masking peptide substrate PCSEWQSMVQPRCYY GGSGGGSGQSGQGGSGGSGQGGQGSDIQLTQSPSSLSASVGDRVTITCSASQDIS NYLNWYQQKPGKAPKVLIYFTSSLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQ GTKVEIKGGGSGGGSGGGSGGGGSGGGGSGGGGSGEVQLVESGGGLVQPGGSLRLSCAASGYDFTHYG MNWVRQAPGKGLEWVGWINTYTGEPTYAADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYP YYYGTSHWYFDVWGQGTLVTVSGGSGAMVRSDKTHTCPPCPAPELLGGPSVFLFP

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Urology & Nephrology (AREA)
  • Biomedical Technology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Hematology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Cell Biology (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Analytical Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Biotechnology (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Bioinformatics & Computational Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Endocrinology (AREA)
  • Mycology (AREA)
  • Rheumatology (AREA)
  • Reproductive Health (AREA)
  • Heart & Thoracic Surgery (AREA)
US12/686,344 2009-01-12 2010-01-12 Modified antibody compositions, methods of making and using thereof Abandoned US20100189651A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
US12/686,344 US20100189651A1 (en) 2009-01-12 2010-01-12 Modified antibody compositions, methods of making and using thereof
US13/315,623 US8563269B2 (en) 2009-01-12 2011-12-09 Modified antibody compositions, methods of making and using thereof
US13/455,924 US8513390B2 (en) 2009-01-12 2012-04-25 Modified antibody compositions, methods of making and using thereof
US13/784,407 US20130309230A1 (en) 2009-01-12 2013-03-04 Modified Antibody Compositions, Methods of Making and Using Thereof
US14/038,232 US9453078B2 (en) 2009-01-12 2013-09-26 Modified antibody compositions, methods of making and using thereof
US15/140,944 US10059762B2 (en) 2009-01-12 2016-04-28 Anti-EGFR activatable antibodies
US15/245,859 US10118961B2 (en) 2009-01-12 2016-08-24 Modified antibody containing the cleavable peptide with the amino acid sequence TGRGPSWV
US16/110,597 US10875913B2 (en) 2009-01-12 2018-08-23 Methods of treatment using activatable anti-EGFR antibodies
US17/077,778 US20210284721A1 (en) 2009-01-12 2020-10-22 Modified antibody compositions, methods of making and using thereof
US18/400,894 US20240228603A1 (en) 2009-01-12 2023-12-29 Modified antibody compositions, methods of making and using thereof

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US14410509P 2009-01-12 2009-01-12
US14411009P 2009-01-12 2009-01-12
US24944109P 2009-10-07 2009-10-07
US24941609P 2009-10-07 2009-10-07
US12/686,344 US20100189651A1 (en) 2009-01-12 2010-01-12 Modified antibody compositions, methods of making and using thereof

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US13/315,623 Continuation US8563269B2 (en) 2009-01-12 2011-12-09 Modified antibody compositions, methods of making and using thereof

Publications (1)

Publication Number Publication Date
US20100189651A1 true US20100189651A1 (en) 2010-07-29

Family

ID=42317225

Family Applications (10)

Application Number Title Priority Date Filing Date
US12/686,344 Abandoned US20100189651A1 (en) 2009-01-12 2010-01-12 Modified antibody compositions, methods of making and using thereof
US13/315,623 Active US8563269B2 (en) 2009-01-12 2011-12-09 Modified antibody compositions, methods of making and using thereof
US13/455,924 Active US8513390B2 (en) 2009-01-12 2012-04-25 Modified antibody compositions, methods of making and using thereof
US13/784,407 Abandoned US20130309230A1 (en) 2009-01-12 2013-03-04 Modified Antibody Compositions, Methods of Making and Using Thereof
US14/038,232 Active 2030-03-27 US9453078B2 (en) 2009-01-12 2013-09-26 Modified antibody compositions, methods of making and using thereof
US15/140,944 Active US10059762B2 (en) 2009-01-12 2016-04-28 Anti-EGFR activatable antibodies
US15/245,859 Active US10118961B2 (en) 2009-01-12 2016-08-24 Modified antibody containing the cleavable peptide with the amino acid sequence TGRGPSWV
US16/110,597 Active US10875913B2 (en) 2009-01-12 2018-08-23 Methods of treatment using activatable anti-EGFR antibodies
US17/077,778 Abandoned US20210284721A1 (en) 2009-01-12 2020-10-22 Modified antibody compositions, methods of making and using thereof
US18/400,894 Pending US20240228603A1 (en) 2009-01-12 2023-12-29 Modified antibody compositions, methods of making and using thereof

Family Applications After (9)

Application Number Title Priority Date Filing Date
US13/315,623 Active US8563269B2 (en) 2009-01-12 2011-12-09 Modified antibody compositions, methods of making and using thereof
US13/455,924 Active US8513390B2 (en) 2009-01-12 2012-04-25 Modified antibody compositions, methods of making and using thereof
US13/784,407 Abandoned US20130309230A1 (en) 2009-01-12 2013-03-04 Modified Antibody Compositions, Methods of Making and Using Thereof
US14/038,232 Active 2030-03-27 US9453078B2 (en) 2009-01-12 2013-09-26 Modified antibody compositions, methods of making and using thereof
US15/140,944 Active US10059762B2 (en) 2009-01-12 2016-04-28 Anti-EGFR activatable antibodies
US15/245,859 Active US10118961B2 (en) 2009-01-12 2016-08-24 Modified antibody containing the cleavable peptide with the amino acid sequence TGRGPSWV
US16/110,597 Active US10875913B2 (en) 2009-01-12 2018-08-23 Methods of treatment using activatable anti-EGFR antibodies
US17/077,778 Abandoned US20210284721A1 (en) 2009-01-12 2020-10-22 Modified antibody compositions, methods of making and using thereof
US18/400,894 Pending US20240228603A1 (en) 2009-01-12 2023-12-29 Modified antibody compositions, methods of making and using thereof

Country Status (9)

Country Link
US (10) US20100189651A1 (enExample)
EP (2) EP3543256A1 (enExample)
JP (5) JP5851842B2 (enExample)
CN (2) CN106995495A (enExample)
AU (4) AU2010203353B2 (enExample)
BR (1) BRPI1006141B8 (enExample)
CA (1) CA2749339A1 (enExample)
RU (1) RU2636046C2 (enExample)
WO (1) WO2010081173A2 (enExample)

Cited By (78)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090304719A1 (en) * 2007-08-22 2009-12-10 Patrick Daugherty Activatable binding polypeptides and methods of identification and use thereof
US20100221212A1 (en) * 2009-02-23 2010-09-02 Cytomx Therapeutics, Llc Proproteins and methods of use thereof
US20120149061A1 (en) * 2009-01-12 2012-06-14 Stagliano Nancy E Modified Antibody Compositions, Methods of Making and Using Thereof
WO2012122444A1 (en) * 2011-03-10 2012-09-13 Provectus Pharmaceuticals, Inc. Combination of local and systemic immunomodulative therapies for enhanced treatment of cancer
WO2013163631A3 (en) * 2012-04-27 2014-01-09 Cytomx Therapeutics, Inc. Activatable antibodies that bind epidermal growth factor receptor and methods of use thereof
WO2013192550A3 (en) * 2012-06-22 2014-04-24 Cytomx Therapeutics, Inc. Anti-jagged 1/jagged 2 cross-reactive antibodies, activatable anti-jagged antibodies and methods of use thereof
US8772459B2 (en) 2009-12-02 2014-07-08 Imaginab, Inc. J591 minibodies and Cys-diabodies for targeting human prostate specific membrane antigen (PSMA) and methods for their use
US20140363430A1 (en) * 2012-09-25 2014-12-11 Cytomx Therapeutics, Inc. Activatable Antibodies that Bind Interleukin-6 Receptor and Methods of Use Thereof
US8940298B2 (en) 2007-09-04 2015-01-27 The Regents Of The University Of California High affinity anti-prostate stem cell antigen (PSCA) antibodies for cancer targeting and detection
US8940871B2 (en) 2006-03-20 2015-01-27 The Regents Of The University Of California Engineered anti-prostate stem cell antigen (PSCA) antibodies for cancer targeting
US8951737B2 (en) 1996-05-06 2015-02-10 Cornell Research Foundation, Inc. Treatment and diagnosis of cancer
US20150079088A1 (en) * 2013-07-25 2015-03-19 Cytomx Therapeutics, Inc. Multispecific antibodies, multispecific activatable antibodies and methods of using the same
US20150087810A1 (en) * 2013-09-25 2015-03-26 Cytomx Therapeutics, Inc. Matrix Metalloproteinase Substrates And Other Cleavable Moieties And Methods Of Use Thereof
US20150218217A1 (en) * 2014-01-31 2015-08-06 Cytomx Therapeutics, Inc. Matriptase and u-plasminogen activator substrates and other cleavable moieties and methods of use thereof
WO2015175375A1 (en) 2014-05-13 2015-11-19 Short Jay M Conditionally active biological proteins
US20160230202A1 (en) * 2014-03-11 2016-08-11 Eric William Olle Process for Generating Synthetic Engineered Recombinant Proteins for Vaccination, Diagnosis and Treatment of Disease
US9540440B2 (en) 2013-10-30 2017-01-10 Cytomx Therapeutics, Inc. Activatable antibodies that bind epidermal growth factor receptor and methods of use thereof
EP3128005A1 (en) 2015-08-07 2017-02-08 Alexo Therapeutics Inc. Sirp-alpha variant constructs and uses thereof
WO2017075537A1 (en) 2015-10-30 2017-05-04 Aleta Biotherapeutics Inc. Compositions and methods for treatment of cancer
US9650445B2 (en) 2012-02-28 2017-05-16 The University Of Birmingham Immunotherapeutic molecules and uses
US9737623B2 (en) 2013-12-11 2017-08-22 Cytomx Therapeutics, Inc. Antibodies that bind activatable antibodies and methods of use thereof
US9856314B2 (en) * 2012-06-22 2018-01-02 Cytomx Therapeutics, Inc. Activatable antibodies having non-binding steric moieties and methods of using the same
US9944700B2 (en) 2013-03-13 2018-04-17 Novartis Ag Notch2 binding molecules for treating respiratory diseases
US10035856B2 (en) 2015-11-19 2018-07-31 Revitope Limited Functional antibody fragment complementation for a two-components system for redirected killing of unwanted cells
US20180215806A1 (en) * 2014-07-03 2018-08-02 City Of Hope Tumor-selective ctla-4 antagonists
US10259859B2 (en) 2015-08-07 2019-04-16 ALX Oncology Inc. Constructs having a SIRP-α domain or variant thereof
US10261083B2 (en) 2013-01-04 2019-04-16 Cytomx Therapeutics, Inc. Compositions and methods for detecting protease activity in biological systems
US10336824B2 (en) 2015-03-13 2019-07-02 Cytomx Therapeutics, Inc. Anti-PDL1 antibodies, activatable anti-PDL1 antibodies, and methods of thereof
US10513558B2 (en) 2015-07-13 2019-12-24 Cytomx Therapeutics, Inc. Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof
US10517969B2 (en) 2009-02-17 2019-12-31 Cornell University Methods and kits for diagnosis of cancer and prediction of therapeutic value
WO2020086665A1 (en) * 2018-10-26 2020-04-30 Immunogen, Inc. Epcam antibodies, activatable antibodies, and immunoconjugates, and uses thereof
US10669337B2 (en) 2014-07-25 2020-06-02 Cytomx Therapeutics, Inc. Bispecific anti-CD3 antibodies, bispecific activatable anti-CD3 antibodies, and methods of using the same
US10689423B2 (en) 2015-01-13 2020-06-23 City Of Hope CTLA4-binding protein peptide-linker masks
US10745481B2 (en) 2015-05-04 2020-08-18 Cytomx Therapeutics, Inc. Anti-CD166 antibodies, activatable anti-CD166 antibodies, and methods of use thereof
US10844134B2 (en) 2016-11-23 2020-11-24 Harpoon Therapeutics, Inc. PSMA targeting trispecific proteins and methods of use
US10858440B2 (en) * 2014-02-12 2020-12-08 Genentech, Inc. Anti-Jagged1 antibodies and methods of use
US10927180B2 (en) 2017-10-13 2021-02-23 Harpoon Therapeutics, Inc. B cell maturation antigen binding proteins
US10954311B2 (en) 2015-05-21 2021-03-23 Harpoon Therapeutics, Inc. Trispecific binding proteins and methods of use
US20210155701A1 (en) * 2018-05-30 2021-05-27 Chugai Seiyaku Kabushiki Kaisha Polypeptide comprising il-1r1 binding domain and carrying moiety
US11046759B2 (en) 2015-01-20 2021-06-29 Cytomx Therapeutics, Inc. Matrix metalloprotease-cleavable and serine protease-cleavable substrates and methods of use thereof
US11059904B2 (en) 2015-10-30 2021-07-13 Aleta Biotherapeutics Inc. Compositions and methods for tumor transduction
US11117968B2 (en) 2016-11-03 2021-09-14 Bristol-Myers Squibb Company Activatable anti-CTLA-4 antibodies and uses thereof
US11136353B2 (en) 2019-04-15 2021-10-05 Qwixel Therapeutics Llc Fusion protein composition(s) comprising masked type I interferons (IFNA and IFNB) for use in the treatment of cancer and methods thereof
US11136403B2 (en) 2017-10-13 2021-10-05 Harpoon Therapeutics, Inc. Trispecific proteins and methods of use
US11168144B2 (en) 2017-06-01 2021-11-09 Cytomx Therapeutics, Inc. Activatable anti-PDL1 antibodies, and methods of use thereof
US11180563B2 (en) 2020-02-21 2021-11-23 Harpoon Therapeutics, Inc. FLT3 binding proteins and methods of use
US11254744B2 (en) 2015-08-07 2022-02-22 Imaginab, Inc. Antigen binding constructs to target molecules
US11266745B2 (en) 2017-02-08 2022-03-08 Imaginab, Inc. Extension sequences for diabodies
US20220073613A1 (en) * 2018-12-26 2022-03-10 Xilio Development, Inc. Activatable masked anti-ctla4 binding proteins
US20220089642A1 (en) * 2020-09-17 2022-03-24 City Of Hope Fc Receptor-ACE2 Conjugates and Use Thereof
US11359016B2 (en) * 2018-02-02 2022-06-14 Adagene Inc. Anti-CTLA4 antibodies and methods of making and using the same
US11365233B2 (en) 2020-04-10 2022-06-21 Cytomx Therapeutics, Inc. Activatable cytokine constructs and related compositions and methods
US11453716B2 (en) 2016-05-20 2022-09-27 Harpoon Therapeutics, Inc. Single domain serum albumin binding protein
US11466093B2 (en) 2015-07-27 2022-10-11 The General Hospital Corporation Antibody derivatives with conditionally enabled effector function
US11472889B2 (en) 2017-10-14 2022-10-18 Cytomx Therapeutics, Inc. Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof
WO2022220841A1 (en) * 2021-04-16 2022-10-20 Provectus Pharmatech, Inc. Composition and method for oral treatment of leukemia
US11535668B2 (en) 2017-02-28 2022-12-27 Harpoon Therapeutics, Inc. Inducible monovalent antigen binding protein
US11607453B2 (en) 2017-05-12 2023-03-21 Harpoon Therapeutics, Inc. Mesothelin binding proteins
US11613564B2 (en) 2019-05-31 2023-03-28 ALX Oncology Inc. Methods of treating cancer
US11623958B2 (en) 2016-05-20 2023-04-11 Harpoon Therapeutics, Inc. Single chain variable fragment CD3 binding proteins
US11667687B2 (en) 2021-03-16 2023-06-06 Cytomx Therapeutics, Inc. Masked activatable interferon constructs
WO2023104190A1 (en) * 2021-12-09 2023-06-15 Vibrant Pharma Limited Antibody masks and uses thereof
WO2023161853A1 (en) 2022-02-23 2023-08-31 Bright Peak Therapeutics Ag Activatable il-18 polypeptides
US11807692B2 (en) 2018-09-25 2023-11-07 Harpoon Therapeutics, Inc. DLL3 binding proteins and methods of use
US11859003B2 (en) 2017-08-21 2024-01-02 Adagene Inc. Method for treating cancer using anti-CD137 antibody
US11952681B2 (en) 2018-02-02 2024-04-09 Adagene Inc. Masked activatable CD137 antibodies
US12030955B2 (en) 2017-11-28 2024-07-09 Chugai Seiyaku Kabushiki Kaisha Polypeptide including antigen-binding domain and carrying section
WO2024150175A1 (en) 2023-01-11 2024-07-18 Bright Peak Therapeutics Ag Conditionally activated proteins and methods of use
WO2024150174A1 (en) 2023-01-11 2024-07-18 Bright Peak Therapeutics Ag Conditionally activated immunocytokines and methods of use
US12049505B2 (en) 2018-12-06 2024-07-30 Cytomx Therapeutics, Inc. Matrix metalloprotease-cleavable and serine or cysteine protease-cleavable substrates and methods of use thereof
US12064507B2 (en) 2019-11-19 2024-08-20 Provectus Pharmatech, Inc. Composition and method for oral treatment of leukemia
US12077577B2 (en) 2018-05-30 2024-09-03 Chugai Seiyaku Kabushiki Kaisha Polypeptide comprising aggrecan binding domain and carrying moiety
US12098214B2 (en) 2021-05-13 2024-09-24 ALX Oncology Inc. Combination therapies for treating cancer
US12195544B2 (en) 2018-09-21 2025-01-14 Harpoon Therapeutics, Inc. EGFR binding proteins and methods of use
WO2025041101A1 (en) 2023-08-23 2025-02-27 Bright Peak Therapeutics Ag Activatable il-18 immunocytokines and uses thereof
US12415860B2 (en) 2018-05-14 2025-09-16 Harpoon Therapeutics, Inc. Binding moiety for conditional activation of immunoglobulin molecules
US12428470B2 (en) 2020-04-09 2025-09-30 Cytomx Therapeutics, Inc. Compositions containing activatable antibodies
US12498367B2 (en) 2018-07-20 2025-12-16 Cytomx Therapeutics, Inc. Methods of qualitatively and/or quantitatively analyzing properties of activatable antibodies and uses thereof

Families Citing this family (187)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU9399501A (en) 2000-10-09 2002-04-22 Isis Innovation Therapeutic antibodies
DK2006381T3 (en) 2006-03-31 2016-02-22 Chugai Pharmaceutical Co Ltd PROCEDURE FOR REGULATING ANTIBODIES BLOOD PHARMACOKINETICS
US8293685B2 (en) 2007-07-26 2012-10-23 The Regents Of The University Of California Methods for enhancing bacterial cell display of proteins and peptides
DK2202245T3 (en) 2007-09-26 2016-11-21 Chugai Pharmaceutical Co Ltd A method of modifying an antibody isoelectric point VIA amino acid substitution in CDR
PT2708559T (pt) 2008-04-11 2018-05-16 Chugai Pharmaceutical Co Ltd Molécula de ligação ao antigénio capaz de se ligar repetidamente a duas ou mais moléculas de antigénio
MX365235B (es) 2010-11-30 2019-05-28 Chugai Pharmaceutical Co Ltd Molécula de unión a antígeno capaz de unir repetidamente a la pluralidad de moléculas de antígeno.
EA034333B1 (ru) 2010-11-30 2020-01-29 Дженентек, Инк. Варианты антитела для переноса соединения через гематоэнцефалический барьер
EP3604330A1 (en) 2011-02-25 2020-02-05 Chugai Seiyaku Kabushiki Kaisha Fcgammariib-specific fc antibody
CA2830349C (en) 2011-03-17 2019-07-16 The University Of Birmingham Re-directed immunotherapy
WO2012154861A2 (en) 2011-05-09 2012-11-15 Mayo Foundation For Medical Education And Research Cancer treatments
EP2762493B1 (en) 2011-09-30 2021-06-09 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule promoting disappearance of antigens having plurality of biological activities
TW201326209A (zh) 2011-09-30 2013-07-01 Chugai Pharmaceutical Co Ltd 具有促進抗原清除之FcRn結合域的治療性抗原結合分子
BR112014013081A2 (pt) 2011-11-30 2020-10-20 Chugai Seiyaku Kabushiki Kaisha veículo contendo fármaco em célula para formação de um complexo imune
SG11201404751UA (en) 2012-02-09 2014-09-26 Chugai Pharmaceutical Co Ltd Modified fc region of antibody
US20150166654A1 (en) 2012-05-30 2015-06-18 Chugai Seiyaku Kabushiki Kaisha Target tissue-specific antigen-binding molecule
US9309510B2 (en) 2012-08-10 2016-04-12 Cytomx Therapeutics, Inc. Protease-resistant systems for polypeptide display and methods of making and using thereof
BR112015003032B1 (pt) 2012-08-13 2023-03-28 Genentech, Inc Anticorpos isolados, imunoconjugado, formulação farmacêutica e uso do anticorpo
TWI855488B (zh) 2012-08-24 2024-09-11 日商中外製藥股份有限公司 FcγRIIb特異性Fc區域變異體
EP2903610B1 (en) 2012-10-01 2021-11-03 Mayo Foundation For Medical Education And Research Cancer treatments
RU2519546C1 (ru) * 2013-01-16 2014-06-10 Общество С Ограниченной Ответственностью "Биоинтегратор" (Ооо "Биоинтегратор") КОНЪЮГАТЫ И МАЛЫЕ МОЛЕКУЛЫ, ВЗАИМОДЕЙСТВУЮЩИЕ С РЕЦЕПТОРОМ CD16а
EP2970498A4 (en) * 2013-03-15 2016-11-23 Bayer Healthcare Llc PRODUCT ANTIBODIES DIRECTED AGAINST THE INHIBITOR OF THE PATHWAY OF TISSUE FACTOR
SG11201508170TA (en) 2013-04-02 2015-11-27 Chugai Pharmaceutical Co Ltd Fc REGION VARIANT
EP3003370B1 (en) 2013-05-28 2020-01-22 Dcb-Usa Llc Antibody locker for the inactivation of protein drug
EP3003387A1 (en) 2013-06-04 2016-04-13 Cytomx Therapeutics Inc. Compositions and methods for conjugating activatable antibodies
WO2015023927A2 (en) * 2013-08-16 2015-02-19 University Of Rochester Composition and method for detection of nanomaterials
TW202446953A (zh) 2013-12-04 2024-12-01 日商中外製藥股份有限公司 因應化合物濃度使抗原結合能力變化的抗原結合分子及其資料庫
CA2936377A1 (en) 2014-01-10 2015-07-16 Shanghai Birdie Biotech, Inc. Compounds and compositions for treating egfr expressing tumors
CN106459990B (zh) 2014-02-07 2021-06-01 麦克马斯特大学 三功能t细胞抗原偶联物及其制备方法和用途
CA2950926A1 (en) 2014-06-13 2015-12-17 Mayo Foundation For Medical Education And Research Albumin-bound paclitaxel nanoparticle/rituximab complexes for treatment of cd20-expressing lymphomas
WO2015195476A1 (en) 2014-06-16 2015-12-23 Mayo Foundation For Medical Education And Research Treating myelomas
CN112546231A (zh) 2014-07-09 2021-03-26 博笛生物科技有限公司 用于治疗癌症的联合治疗组合物和联合治疗方法
EP4001311B1 (en) 2014-07-09 2025-11-05 Birdie Biopharmaceuticals Inc. Anti-pd-l1/pd-1 combinations for treating tumors
CN112546238A (zh) 2014-09-01 2021-03-26 博笛生物科技有限公司 用于治疗肿瘤的抗-pd-l1结合物
US9446148B2 (en) 2014-10-06 2016-09-20 Mayo Foundation For Medical Education And Research Carrier-antibody compositions and methods of making and using the same
EP3253419A1 (en) 2015-02-02 2017-12-13 The University of Birmingham Targeting moiety peptide epitope complexes having a plurality of t-cell epitopes
KR102790523B1 (ko) 2015-02-24 2025-04-02 바이오아트라, 인코퍼레이티드 조건부 활성 생체 단백질
HK1250997A1 (zh) 2015-05-01 2019-01-18 基因泰克公司 掩蔽抗cd3抗体和使用方法
TWI787796B (zh) 2015-05-04 2022-12-21 美商Cytomx生物製藥公司 抗cd71抗體類、可活化之抗cd71抗體類及使用彼等之方法
AU2016258988A1 (en) 2015-05-04 2017-12-07 Cytomx Therapeutics, Inc Anti-ITGa3 antibodies, activatable anti-ITGa3 antibodies, and methods of use thereof
US11400157B2 (en) 2015-05-13 2022-08-02 Chugai Seiyaku Kabushiki Kaisha Multiple antigen binding molecular fusion, pharmaceutical composition, method for identifying linear epitope, and method for preparing multiple antigen binding molecular fusion
CN107849144B (zh) 2015-05-29 2021-09-17 艾吉纳斯公司 抗-ctla-4抗体及其使用方法
CA2985818A1 (en) 2015-05-31 2016-12-08 Curegenix Corporation Combination compositions comprising an antagonist of porcupine and a pd-l/pd-1 axis antagonist for immunotherapy
WO2016204966A1 (en) 2015-06-16 2016-12-22 Genentech, Inc. Anti-cd3 antibodies and methods of use
US10822419B2 (en) 2015-06-26 2020-11-03 University Of Southern California Masking chimeric antigen receptor T cells for tumor-specific activation
TW201707725A (zh) 2015-08-18 2017-03-01 美國馬友醫藥教育研究基金會 載體-抗體組合物及其製造及使用方法
IL319047A (en) 2015-08-28 2025-04-01 Amunix Operating Inc Chimeric polypeptide composition and methods for its preparation and use
US10758886B2 (en) * 2015-09-14 2020-09-01 Arizona Board Of Regents On Behalf Of Arizona State University Conditioned surfaces for in situ molecular array synthesis
TW201713360A (en) 2015-10-06 2017-04-16 Mayo Foundation Methods of treating cancer using compositions of antibodies and carrier proteins
US11472876B2 (en) 2015-11-02 2022-10-18 Bioatla, Inc. Conditionally active polypeptides
CA3005070A1 (en) 2015-11-11 2017-05-18 Serimmune Inc. Methods and compositions for assessing antibody specificities
US11433136B2 (en) 2015-12-18 2022-09-06 The General Hospital Corporation Polyacetal polymers, conjugates, particles and uses thereof
US11571469B2 (en) 2016-01-07 2023-02-07 Mayo Foundation For Medical Education And Research Methods of treating cancer with interferon wherein the cancer cells are HLA negative or have reduced HLA expression
CN105601751B (zh) * 2016-02-01 2019-06-07 中国人民解放军第三军医大学 一种重组蛋白Vo及其制备方法和应用
EP3413874A4 (en) 2016-02-12 2020-01-22 Mayo Foundation for Medical Education and Research TREATMENTS FOR BLOOD CANCER
CA3014645C (en) 2016-02-29 2022-10-25 Regeneron Pharmaceuticals, Inc. Rodents having a humanized tmprss gene
US12128102B2 (en) 2016-03-08 2024-10-29 Takeda Pharmaceutical Company Limited Constrained conditionally activated binding proteins
EP3432928A4 (en) 2016-03-21 2019-11-20 Mayo Foundation for Medical Education and Research PROCESS FOR IMPROVING THE THERAPEUTIC INDEX FOR CHEMOTHERAPEUTIC
AU2017238119A1 (en) 2016-03-21 2018-10-11 Mayo Foundation For Medical Education And Research Methods for reducing toxicity of a chemotherapeutic drug
US10618969B2 (en) 2016-04-06 2020-04-14 Mayo Foundation For Medical Education And Research Carrier-binding agent compositions and methods of making and using the same
WO2017205560A1 (en) * 2016-05-27 2017-11-30 Albert Einstein College Of Medicine, Inc. Methods for treating cancer by targeting vcam1 and maea
WO2017205741A1 (en) 2016-05-27 2017-11-30 Genentech, Inc. Bioanalytical method for the characterization of site-specific antibody-drug conjugates
US11560433B2 (en) 2016-05-27 2023-01-24 Albert Einstein College Of Medicine Methods of treatment by targeting VCAM1 and MAEA
US11617799B2 (en) 2016-06-27 2023-04-04 Tagworks Pharmaceuticals B.V. Cleavable tetrazine used in bio-orthogonal drug activation
WO2018022957A1 (en) * 2016-07-29 2018-02-01 Tarveda Therapeutics, Inc. T cell binding conjugates and methods of use
MX2019002474A (es) 2016-09-01 2019-09-18 Mayo Found Medical Education & Res Composiciones de agente de unión de portador-ligando-1 de muerte programada y métodos de uso de las mismas para el tratamiento de cánceres.
JP2019526579A (ja) 2016-09-01 2019-09-19 マヨ ファウンデーション フォー メディカル エデュケーション アンド リサーチMayo Foundation For Medical Education And Research T細胞癌を標的とする為の方法及び組成物
CN109890422A (zh) 2016-09-06 2019-06-14 梅约医学教育与研究基金会 紫杉醇-白蛋白-结合剂组合物及使用和制备该组合物的方法
RU2019110071A (ru) 2016-09-06 2020-10-08 Мэйо Фаундейшн Фор Медикал Эдьюкейшн Энд Рисерч Способы лечения злокачественных новообразований, экспрессирующих pd-l1
WO2018048815A1 (en) 2016-09-06 2018-03-15 Nantibodyfc, Llc Methods of treating triple-negative breast cancer using compositions of antibodies and carrier proteins
CN110177875B (zh) * 2016-11-28 2023-11-28 中外制药株式会社 包含抗原结合结构域和运送部分的多肽
CA3039316A1 (en) * 2016-11-28 2018-05-31 Chugai Seiyaku Kabushiki Kaisha Ligand-binding molecule having adjustable ligand binding activity
WO2018106738A1 (en) 2016-12-05 2018-06-14 Massachusetts Institute Of Technology Brush-arm star polymers, conjugates and particles, and uses thereof
EP3551225A1 (en) 2016-12-07 2019-10-16 Agenus Inc. Antibodies and methods of use thereof
FI3551660T3 (fi) 2016-12-07 2023-12-11 Agenus Inc Anti-ctla-4-vasta-aineita ja niiden käyttömenetelmiä
CN110036034A (zh) 2016-12-09 2019-07-19 西雅图遗传学公司 卷曲螺旋掩蔽的二价抗体
CN106519034B (zh) 2016-12-22 2020-09-18 鲁南制药集团股份有限公司 抗pd-1抗体及其用途
CA3048467A1 (en) * 2016-12-29 2018-07-05 Development Center For Biotechnology Klk6-mediated cns-specific antibody prodrug activation
AU2018225164A1 (en) * 2017-02-22 2019-09-19 Aleta Biotherapeutics Inc. Compositions and methods for treatment of cancer
AU2018231127A1 (en) * 2017-03-09 2019-09-19 Cytomx Therapeutics, Inc. CD147 antibodies, activatable CD147 antibodies, and methods of making and use thereof
MY200973A (en) 2017-04-11 2024-01-26 Inhibrx Inc Multispecific Polypeptide Constructs Having Constrained Cd3 Binding And Methods Of Using The Same
CA3059542A1 (en) * 2017-04-12 2018-10-18 Pfizer Inc. Antibodies having conditional affinity and methods of use thereof
US12460208B2 (en) 2017-04-18 2025-11-04 Parr Biotechnology Co., Ltd. Immunomodulatory polynucleotides and uses thereof
CN108728444A (zh) 2017-04-18 2018-11-02 长春华普生物技术股份有限公司 免疫调节性多核苷酸及其应用
WO2018213335A1 (en) * 2017-05-16 2018-11-22 Scalmibio, Inc. Activatable antibodies and methods of use thereof
MX2019013648A (es) 2017-05-19 2021-01-08 Wuxi Biologics Shanghai Co Ltd Anticuerpos monoclonales novedosos para proteina 4 asociada con el linfocito t citotoxico (ctla-4).
CA3068318A1 (en) 2017-06-30 2019-01-03 Massachusetts Institute Of Technology Branched multi-functional macromonomers and related polymers and uses thereof
US11220544B2 (en) 2017-07-14 2022-01-11 Cytomx Therapeutics, Inc. Anti-CD166 antibodies and uses thereof
WO2019018828A1 (en) 2017-07-20 2019-01-24 Cytomx Therapeutics, Inc. METHODS OF QUALITATIVE AND / OR QUANTITATIVE ANALYSIS OF ACTIVATABLE ANTIBODY PROPERTIES AND USES THEREOF
KR102003594B1 (ko) * 2017-08-08 2019-07-24 숙명여자대학교산학협력단 염증 반응 매개 신혈관생성 질환 진단용 조성물
US11623965B2 (en) * 2017-08-16 2023-04-11 Bristol-Myers Squibb Company Prodruggable antibodies, prodrugs thereof, and methods of use and making
MX2020002198A (es) 2017-08-30 2020-07-20 Cytomx Therapeutics Inc Anticuerpos anti-cd166 activables y métodos de uso de los mismos.
CN111315773A (zh) * 2017-09-08 2020-06-19 马弗里克治疗公司 含有Fc区的条件性活化的结合部分
MX2020002667A (es) 2017-09-08 2020-08-03 Maverick Therapeutics Inc Proteinas de unión condicionalmente activadas restringidas.
WO2019071358A1 (en) 2017-10-12 2019-04-18 Mcmaster University Y182T MUTATION T CELL ANTIGEN COUPLEUR AND METHODS AND USES THEREOF
PH12020550417A1 (en) 2017-10-14 2021-04-12 Abbvie Inc Anti-cd71 activatable antibody drug conjugates and methods of use thereof
WO2019107384A1 (ja) 2017-11-28 2019-06-06 中外製薬株式会社 リガンド結合活性が調整可能なリガンド結合分子
AR113862A1 (es) * 2017-12-01 2020-06-17 Seattle Genetics Inc Anticuerpos anti-cd47 y sus usos para tratar cáncer
MX2020006297A (es) 2017-12-15 2020-12-07 Aleta Biotherapeutics Inc Variantes de cd19.
JP2021506861A (ja) 2017-12-19 2021-02-22 アコーオス インコーポレイテッド 内耳への治療用抗体のaav媒介送達
WO2019126576A1 (en) 2017-12-21 2019-06-27 Amunix Pharmaceuticals, Inc. Release segments and binding compositions comprising same
MX2020008289A (es) 2018-02-08 2020-09-25 Genentech Inc Moleculas biespecificas de union al antigeno y metodos de uso.
WO2019173771A1 (en) 2018-03-09 2019-09-12 Cytomx Therapeutics, Inc. Activatable cd147 antibodies and methods of making and use thereof
EP3769309A1 (en) 2018-03-20 2021-01-27 Cytomx Therapeutics Inc. Systems and methods for quantitative pharmacological modeling of activatable antibody species in mammalian subjects
IL323061A (en) 2018-04-11 2025-10-01 Inhibrx Biosciences Inc Multispecific polypeptide constructs with forced CD3 binding and related methods and uses
WO2019213444A1 (en) 2018-05-02 2019-11-07 Cytomx Therapeutics, Inc. Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof
EP3787691A1 (en) 2018-05-04 2021-03-10 Tagworks Pharmaceuticals B.V. Tetrazines for high click conjugation yield in vivo and high click release yield
MX2020012252A (es) 2018-05-14 2021-04-28 Werewolf Therapeutics Inc Polipeptidos de interleucina 12 activables y metodos de uso de los mismos.
CN113840832A (zh) 2018-05-14 2021-12-24 狼人治疗公司 可活化白介素-2多肽及其使用方法
EP3816182A4 (en) 2018-05-30 2022-07-13 Chugai Seiyaku Kabushiki Kaisha LIGAND BINDING MOLECULE WITH SINGLE DOMAIN ANTIBODY
US10640562B2 (en) 2018-07-17 2020-05-05 Mcmaster University T cell-antigen coupler with various construct optimizations
US11110123B2 (en) 2018-07-17 2021-09-07 Triumvira Immunologics Usa, Inc. T cell-antigen coupler with various construct optimizations
CN112789294A (zh) 2018-07-24 2021-05-11 印希比股份有限公司 含有受限cd3结合结构域和受体结合区的多特异性多肽构建体及其使用方法
BR112021001616A2 (pt) 2018-07-31 2021-05-04 Amgen Inc. formulações farmacêuticas de anticorpos mascarados
EP3835321A4 (en) 2018-08-10 2022-11-02 Chugai Seiyaku Kabushiki Kaisha ANTI-CD137 ANTIGEN-BINDING MOLECULE AND USE THEREOF
US10988491B2 (en) 2018-08-17 2021-04-27 Massachusetts Institute Of Technology Degradable polymers of a cyclic silyl ether and uses thereof
US11208485B2 (en) 2018-10-11 2021-12-28 Inhibrx, Inc. PD-1 single domain antibodies and therapeutic compositions thereof
TW202506736A (zh) 2018-10-11 2025-02-16 美商因荷布瑞克斯生物科學公司 5t4單域抗體及其治療性組合物
WO2020076970A1 (en) 2018-10-11 2020-04-16 Inhibrx, Inc. B7h3 single domain antibodies and therapeutic compositions thereof
CA3115089A1 (en) 2018-10-11 2020-04-16 Inhibrx, Inc. Dll3 single domain antibodies and therapeutic compositions thereof
MX2021005116A (es) 2018-11-02 2021-07-15 Cytomx Therapeutics Inc Anticuerpos activables anti-cd166 y metodos de uso de estos.
AU2019395266A1 (en) * 2018-12-14 2021-06-17 Proviva Therapeutics (Hong Kong) Limited IL-15 compositions and methods of use thereof
WO2020176672A1 (en) 2019-02-26 2020-09-03 Cytomx Therapeutics, Inc. Combined therapies of activatable immune checkpoint inhibitors and conjugated activatable antibodies
CN120484127A (zh) 2019-03-05 2025-08-15 武田药品工业有限公司 受约束的条件性活化的结合蛋白
AU2020234785A1 (en) 2019-03-13 2021-08-19 Merck Sharp & Dohme Llc Anti-cancer combination therapies comprising CTLA-4 and PD-1 blocking agents
WO2020191306A1 (en) 2019-03-21 2020-09-24 Immunogen, Inc. Methods of preparing cell-binding agent-drug conjugates
IL286846B2 (en) 2019-04-26 2025-06-01 Immunogen Inc Camptothecin derivatives
EP3969035A4 (en) 2019-05-14 2023-06-21 Werewolf Therapeutics, Inc. SEPARATION UNITS AND METHODS AND THEIR USE
WO2020236679A1 (en) * 2019-05-17 2020-11-26 Cytomx Therapeutics, Inc. Methods and compositions for determining the biodistribution of activatable anti-cd166 antibody conjugates
JP2022533791A (ja) 2019-05-20 2022-07-25 マサチューセッツ インスティテュート オブ テクノロジー ボロン酸エステルプロドラッグおよびそれらの使用
US20220306727A1 (en) 2019-06-05 2022-09-29 Seagen Inc. Methods of Purifying Masked Antibodies
US20220233709A1 (en) 2019-06-05 2022-07-28 Seagen Inc. Masked Antibody Formulations
KR20220017430A (ko) 2019-06-05 2022-02-11 추가이 세이야쿠 가부시키가이샤 항체 절단 부위 결합 분자
WO2020251878A1 (en) 2019-06-11 2020-12-17 Bristol-Myers Squibb Company Anti-ctla4 antibody prodruggable (probody) at a cdr position
EP3983440A1 (en) 2019-06-13 2022-04-20 CytomX Therapeutics, Inc. Use of an activatable anti-pdl1 antibody and an anti-ctla-4 antibody in a neoadjuvant combination therapy for the treatment of cancer
CN114173815A (zh) 2019-06-13 2022-03-11 西托姆克斯治疗公司 可活化抗pdl1抗体和抗ctla-4抗体在用于治疗癌症的联合疗法中的用途
IL289094A (en) 2019-06-17 2022-02-01 Tagworks Pharmaceuticals B V Tetrazines for increasing the speed and yield of the "click release" reaction
EP4382129A3 (en) 2019-06-17 2024-07-03 Tagworks Pharmaceuticals B.V. Compounds for fast and efficient click release
WO2021061867A1 (en) 2019-09-23 2021-04-01 Cytomx Therapeutics, Inc. Anti-cd47 antibodies, activatable anti-cd47 antibodies, and methods of use thereof
WO2021097376A1 (en) 2019-11-14 2021-05-20 Werewolf Therapeutics, Inc. Activatable cytokine polypeptides and methods of use thereof
GB201918230D0 (en) 2019-12-11 2020-01-22 Prec Therapeutics Ltd Antibodies and their uses
BR112022011357A2 (pt) 2019-12-13 2022-08-23 Genentech Inc Anticorpos isolado, um ou mais ácidos nucleicos isolados, um ou mais vetores, uma ou mais células hospedeiras, composição, kit, uso do anticorpo, métodos para produzir o anticorpo e método para tratar ou retardar a progressão de um câncer ly6g6d positivo
WO2021141662A1 (en) 2020-01-10 2021-07-15 Massachusetts Institute Of Technology Proteolysis targeting chimeric molecules (protacs) with functional handles and uses thereof
TW202140570A (zh) * 2020-01-23 2021-11-01 瑞士商天演藥業公司 具有Fc突變之異二聚蛋白質
CN115380047A (zh) 2020-01-29 2022-11-22 印希比股份有限公司 Cd28单结构域抗体及其多价和多特异性构建体
AU2021240872A1 (en) * 2020-03-23 2022-11-17 Zymeworks Bc Inc. Masked IL12 fusion proteins and methods of use thereof
CN111951884B (zh) * 2020-07-10 2022-03-22 中南大学 蛋白质小分子结合口袋上关键柔性氨基酸的识别方法
ES3040950T3 (en) 2020-08-11 2025-11-06 Janux Therapeutics Inc Cleavable linker compositions and methods
JP2023548310A (ja) * 2020-10-30 2023-11-16 アバクタ・ライフ・サイエンシーズ・リミテッド Fap活性化血清半減期延長型治療用コンジュゲート
JP2023548136A (ja) * 2020-10-30 2023-11-15 アバクタ・ライフ・サイエンシーズ・リミテッド 酵素活性化血清半減期延長型治療用コンジュゲート
IL303317A (en) 2020-12-01 2023-07-01 Akouos Inc ANTI-NATURAL ANTIBODY STRUCTURES AND RELATED METHODS FOR THE TREATMENT OF SYMPTOMS ASSOCIATED WITH VESTIBULAR SWANNOMA
MX2023006817A (es) 2020-12-09 2023-08-14 Janux Therapeutics Inc Composiciones y metodos relacionados con anticuerpos activados por tumores dirigidos a psma y antigenos de celulas efectoras.
WO2022170619A1 (en) * 2021-02-11 2022-08-18 Adagene Pte. Ltd. Anti-cd3 antibodies and methods of use thereof
KR20240037892A (ko) 2021-06-01 2024-03-22 트리움비라 이뮤놀로직스 유에스에이, 인크. 클라우딘 18.2 t 세포-항원 커플러 및 이의 용도
EP4329794A2 (en) 2021-06-18 2024-03-06 Nammi Therapeutics, Inc. Fusion protein composition(s) comprising masked type i interferons (ifn? and ifn?) for use in the treatment of cancer and methods thereof
US11453723B1 (en) 2021-06-25 2022-09-27 Mcmaster University BCMA T cell-antigen couplers and uses thereof
EP4370211A1 (en) 2021-07-14 2024-05-22 Seagen Inc. Antibody masking domains
WO2023034825A1 (en) 2021-08-30 2023-03-09 Cytomx Therapeutics, Inc. Method for determining protease activity in a biological sample
US20240376200A1 (en) 2021-09-24 2024-11-14 Seagen Inc. Improved Antibody Masking Domains
CA3233707A1 (en) 2021-10-08 2023-04-13 Alexey Yevgenyevich Berezhnoy Activatable cytokine constructs and combination methods
JP2024537101A (ja) 2021-10-08 2024-10-10 シートムエックス セラピューティクス,インコーポレイテッド 活性化可能サイトカイン構成体ならびに関連する組成物及び方法
AU2022367525A1 (en) 2021-10-15 2024-05-02 Amgen Inc. Activatable polypeptide complex
US20230183382A1 (en) 2021-10-15 2023-06-15 Cytomx Therapeutics, Inc. Activatable polypeptide complex
WO2023064955A1 (en) 2021-10-15 2023-04-20 Cytomx Therapeutics, Inc. Activatable anti-cd3, anti-egfr, heteromultimeric bispecific polypeptide complex
WO2023064945A2 (en) * 2021-10-15 2023-04-20 Harpoon Therapeutics, Inc. Conditional activation of immunoglobulin molecules
IL312728A (en) 2021-11-30 2024-07-01 Daiichi Sankyo Co Ltd Protease-cleavable masked antibodies
KR20240141757A (ko) 2022-02-09 2024-09-27 다이이찌 산쿄 가부시키가이샤 환경 응답성 마스킹 항체 및 그 이용
WO2023183888A1 (en) 2022-03-23 2023-09-28 Cytomx Therapeutics, Inc. Activatable antigen-binding protein constructs and uses of the same
EP4499685A1 (en) * 2022-03-25 2025-02-05 CytomX Therapeutics, Inc. Activatable dual-anchored masked molecules and methods of use thereof
EP4504257A1 (en) 2022-04-01 2025-02-12 CytomX Therapeutics, Inc. Activatable multispecific molecules and methods of use thereof
JP2025511187A (ja) 2022-04-01 2025-04-15 サイトムエックス セラピューティクス,インク. Cd3結合タンパク質及びその使用方法
CA3247048A1 (en) 2022-04-13 2023-10-19 Genentech Inc PHARMACEUTICAL COMPOSITIONS OF MOSUNETUZUMAB AND METHODS OF USE
KR20250011922A (ko) 2022-05-16 2025-01-22 비온디스 비.브이. 신규한 차폐된 항체
CN119630428A (zh) 2022-07-12 2025-03-14 西托姆克斯治疗公司 Epcam免疫缀合物及其用途
AR130076A1 (es) 2022-08-01 2024-10-30 Cytomx Therapeutics Inc Restos escindibles por proteasas, y métodos de uso de los mismos
AR130079A1 (es) 2022-08-01 2024-10-30 Cytomx Therapeutics Inc Restos escindibles por proteasas, y métodos de uso de los mismos
EP4565690A1 (en) 2022-08-01 2025-06-11 CytomX Therapeutics, Inc. Protease-cleavable moieties and methods of use thereof
WO2024030858A1 (en) 2022-08-01 2024-02-08 Cytomx Therapeutics, Inc. Protease-cleavable substrates and methods of use thereof
WO2024030850A1 (en) 2022-08-01 2024-02-08 Cytomx Therapeutics, Inc. Protease-cleavable substrates and methods of use thereof
WO2024031034A2 (en) * 2022-08-05 2024-02-08 Staidson Biopharma Inc. A novel il-15r alpha fc fusion protein and uses thereof
WO2024173795A1 (en) * 2023-02-17 2024-08-22 California Institute Of Technology Activatable drug conjugates and therapeutic applications thereof
WO2024216194A1 (en) 2023-04-12 2024-10-17 Cytomx Therapeutics, Inc. Masking polypeptides, activatable cytokine constructs, and related compositions and methods
CN120936384A (zh) 2023-04-12 2025-11-11 西托姆克斯治疗公司 掩蔽多肽、可活化细胞因子构建体以及相关组合物和方法
WO2024216170A2 (en) 2023-04-12 2024-10-17 Cytomx Therapeutics, Inc. Activatable cytokine constructs and related compositions and methods
WO2025038668A1 (en) 2023-08-14 2025-02-20 Voro Therapeutics, Inc. Therapeutic binding agents that conditionally promote myeloid cell activity against target cells and uses thereof
WO2025150556A1 (ja) * 2024-01-11 2025-07-17 第一三共株式会社 環境応答性ペプチドを利用したタンパク質の製造方法
WO2025235515A1 (en) 2024-05-07 2025-11-13 Cytomx Therapeutics, Inc. Activatable polypeptide complex formulations
WO2025240659A2 (en) 2024-05-14 2025-11-20 Cytomx Therapeutics, Inc. Activatable constructs, compositions and methods

Citations (87)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) * 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4379145A (en) * 1979-12-14 1983-04-05 Teijin Limited Antitumor protein hybrid and process for the preparation thereof
US4671958A (en) * 1982-03-09 1987-06-09 Cytogen Corporation Antibody conjugates for the delivery of compounds to target sites
US4816567A (en) * 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4867973A (en) * 1984-08-31 1989-09-19 Cytogen Corporation Antibody-therapeutic agent conjugates
US4952394A (en) * 1987-11-23 1990-08-28 Bristol-Myers Company Drug-monoclonal antibody conjugates
US4975278A (en) * 1988-02-26 1990-12-04 Bristol-Myers Company Antibody-enzyme conjugates in combination with prodrugs for the delivery of cytotoxic agents to tumor cells
US5010176A (en) * 1988-11-10 1991-04-23 Eli Lilly And Company Antibody-drug conjugates
US5144012A (en) * 1988-08-08 1992-09-01 Eli Lilly And Company Cytotoxic drug conjugates
US5162218A (en) * 1988-11-18 1992-11-10 The Regents Of The University Of California Conjugated polypeptides and methods for their preparation
US5223409A (en) * 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5306731A (en) * 1985-06-14 1994-04-26 Massachusetts Eye And Ear Infirmary Method and products for treating the eye
US5468785A (en) * 1994-04-15 1995-11-21 University Of Akron Cobaloxime photoinitiated free radical polymerizations
US5637288A (en) * 1989-12-05 1997-06-10 Immunomedics, Inc. Chimeric antibody for detection and therapy of infectious and inflammatory lesions
US5665358A (en) * 1993-03-30 1997-09-09 Eli Lilly And Company Antibody drug-conjugates
US5679548A (en) * 1993-02-02 1997-10-21 The Scripps Research Institute Methods for producing polypeptide metal binding sites and compositions thereof
US5725856A (en) * 1988-01-12 1998-03-10 Genentech, Inc. Monoclonal antibodies directed to the HER2 receptor
US5770195A (en) * 1988-01-12 1998-06-23 Genentech, Inc. Monoclonal antibodies directed to the her2 receptor
US5834247A (en) * 1992-12-09 1998-11-10 New England Biolabs, Inc. Modified proteins comprising controllable intervening protein sequences or their elements methods of producing same and methods for purification of a target protein comprised by a modified protein
US5866341A (en) * 1996-04-03 1999-02-02 Chugai Pharmaceutical Co., Ltd. Compositions and methods for screening drug libraries
US5922845A (en) * 1996-07-11 1999-07-13 Medarex, Inc. Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies
US5985626A (en) * 1994-03-10 1999-11-16 The Scripps Research Institute Catalytic antibody/substrate intermediates
US5990286A (en) * 1996-12-18 1999-11-23 Techniclone, Inc. Antibodies with reduced net positive charge
US6015557A (en) * 1999-02-24 2000-01-18 Tobinick; Edward L. Tumor necrosis factor antagonists for the treatment of neurological disorders
US6054297A (en) * 1991-06-14 2000-04-25 Genentech, Inc. Humanized antibodies and methods for making them
US6066719A (en) * 1995-04-20 2000-05-23 Genetech, Inc. Antibody fragments
US6107059A (en) * 1992-04-29 2000-08-22 Affymax Technologies N.V. Peptide library and screening method
US6217866B1 (en) * 1988-09-15 2001-04-17 Rhone-Poulenc Rorer International (Holdings), Inc. Monoclonal antibodies specific to human epidermal growth factor receptor and therapeutic methods employing same
US6235883B1 (en) * 1997-05-05 2001-05-22 Abgenix, Inc. Human monoclonal antibodies to epidermal growth factor receptor
US6258562B1 (en) * 1996-02-09 2001-07-10 Basf Aktiengesellschaft Human antibodies that bind human TNFα
US6265540B1 (en) * 1997-05-19 2001-07-24 The Johns Hopkins University School Of Medicine Tissue specific prodrug
US6268488B1 (en) * 1999-05-25 2001-07-31 Barbas, Iii Carlos F. Prodrug activation using catalytic antibodies
US6342219B1 (en) * 1999-04-28 2002-01-29 Board Of Regents, The University Of Texas System Antibody compositions for selectively inhibiting VEGF
US20020048578A1 (en) * 1996-02-20 2002-04-25 Herman Waldmann Antibody variants
US6407213B1 (en) * 1991-06-14 2002-06-18 Genentech, Inc. Method for making humanized antibodies
US20020168690A1 (en) * 1997-07-25 2002-11-14 Miller Jeffrey A. Assays and peptide substrate for determining aggrecan degrading metallo protease activity
US20030021791A1 (en) * 2000-04-25 2003-01-30 Kassis Amin I. Methods for tumor diagnosis and therapy
US6534061B1 (en) * 1999-04-12 2003-03-18 Genentech, Inc. Tumor necrosis factor receptor homologs and nucleic acids encoding the same
US6548249B1 (en) * 1998-10-08 2003-04-15 Rigel Pharmaceuticals, Inc. Fusions of scaffold proteins with random peptide libraries
US20030134824A1 (en) * 2001-11-12 2003-07-17 Ronald Breslow Beta-cyclodextrin dimers and phthalocyanines and uses thereof
US20040014652A1 (en) * 2000-06-01 2004-01-22 Andre Trouet Tumor activated prodrug compounds and methods of making and using the same
US6682736B1 (en) * 1998-12-23 2004-01-27 Abgenix, Inc. Human monoclonal antibodies to CTLA-4
US20040053829A1 (en) * 2000-09-15 2004-03-18 Klaus Pfizenmaier Fusion protein from antibody cytokine-cytokine inhibitor (selectokine) for use as target-specific prodrug
US20040082039A1 (en) * 2001-02-19 2004-04-29 Stephen Gillies Artificial proteins with reduced immunogenicity
US20040146516A1 (en) * 1999-06-17 2004-07-29 Utah Ventures Ii L.P. Lumen-exposed molecules and methods for targeted delivery
US20040147444A1 (en) * 2001-01-09 2004-07-29 Yuti Chernajovsky Latent fusion protein
US20040185053A1 (en) * 2002-12-13 2004-09-23 Immunomedics, Inc. Immunoconjugates with an intracellularly-cleavable linkage
US20040213797A1 (en) * 2001-07-25 2004-10-28 Bodmer Mark William Conjugates for the modulation of immune responses
US20050042680A1 (en) * 1997-04-30 2005-02-24 Filpula David Ray Single chain antigen-binding polypeptides for polymer conjugation
US6884879B1 (en) * 1997-04-07 2005-04-26 Genentech, Inc. Anti-VEGF antibodies
US20050106100A1 (en) * 2003-09-03 2005-05-19 Harris Thomas D. Compounds containing matrix metalloproteinase substrates and methods of their use
US6903196B1 (en) * 1999-06-17 2005-06-07 Utah Ventures Ii, L.P. Methods for identifying and isolating tissue-specific lumen-exposed molecules
US20050196754A1 (en) * 2000-03-31 2005-09-08 Drmanac Radoje T. Novel nucleic acids and polypeptides
US20050208558A1 (en) * 1999-10-19 2005-09-22 Applera Corporation Detection kits, such as nucleic acid arrays, for detecting the expression or 10,000 or more Drosophila genes and uses thereof
US6955900B1 (en) * 1993-02-02 2005-10-18 The Scripps Research Institute Methods for producing polypeptide binding sites, monoclonal antibodies and compositions thereof
US20050255555A1 (en) * 2004-02-20 2005-11-17 Johns Terrance G EGF receptor epitope peptides and uses thereof
US20050255042A1 (en) * 2003-11-24 2005-11-17 The Regents Of The University Of California Office Of Technology Transfer, University Of California On-demand cleavable linkers for radioconjugates for cancer imaging and therapy
US6984720B1 (en) * 1999-08-24 2006-01-10 Medarex, Inc. Human CTLA-4 antibodies
US20060018911A1 (en) * 2004-01-12 2006-01-26 Dana Ault-Riche Design of therapeutics and therapeutics
US6992174B2 (en) * 2001-03-30 2006-01-31 Emd Lexigen Research Center Corp. Reducing the immunogenicity of fusion proteins
US20060078901A1 (en) * 2000-04-11 2006-04-13 Carmen Buchrieser Listeria monocytogenes genome, polypeptides and uses
US7029874B2 (en) * 1998-03-17 2006-04-18 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US7060808B1 (en) * 1995-06-07 2006-06-13 Imclone Systems Incorporated Humanized anti-EGF receptor monoclonal antibody
US7060269B1 (en) * 1997-04-07 2006-06-13 Genentech, Inc. Anti-VEGF antibodies
US7087409B2 (en) * 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
US7098002B1 (en) * 1999-04-13 2006-08-29 Yeda Research And Development Co. Ltd. Preparation of biologically active molecules
US20060228348A1 (en) * 2005-04-06 2006-10-12 Genzyme Corporation Targeting of glycoprotein therapeutics
US20060246066A1 (en) * 2001-12-17 2006-11-02 Morgan Bryan P Cleavable reagents for specific delivery to disease sites
US20060252130A1 (en) * 1999-11-03 2006-11-09 Acgt Pregenomics Ag Method for linking molecular substances
US20060265274A1 (en) * 2000-08-08 2006-11-23 Commins Alfred D Balanced, multi-stud hold-down
US7157418B1 (en) * 1998-07-22 2007-01-02 Osprey Pharmaceuticals, Ltd. Methods and compositions for treating secondary tissue damage and other inflammatory conditions and disorders
US7169901B2 (en) * 1997-04-07 2007-01-30 Genentech, Inc. Anti-VEGF antibodies
US20070041904A1 (en) * 2003-10-31 2007-02-22 Tao Jiang Peptides whose uptake by cells is controllable
US20070061916A1 (en) * 2001-05-07 2007-03-15 Kovalic David K Nucleic acid molecules and other molecules associated with plants and uses thereof for plant improvement
US20070065878A1 (en) * 2005-08-31 2007-03-22 Daugherty Patrick S Cellular libraries of peptide sequences (CLiPS) and methods of using the same
US20070065158A1 (en) * 2005-09-22 2007-03-22 Fujitsu Limited Mobile terminal apparatus
US20070083334A1 (en) * 2001-09-14 2007-04-12 Compugen Ltd. Methods and systems for annotating biomolecular sequences
US7226596B2 (en) * 1999-07-28 2007-06-05 Genentech, Inc. Compositions and methods for the treatment of tumors
US7256038B2 (en) * 2003-08-18 2007-08-14 Regents Of The University Of California Polypeptide display libraries and methods of making and using thereof
US7365166B2 (en) * 1997-04-07 2008-04-29 Genentech, Inc. Anti-VEGF antibodies
US20080107660A1 (en) * 2004-02-25 2008-05-08 Colin Self Binding Agents
US7452535B2 (en) * 2002-04-12 2008-11-18 Medarex, Inc. Methods of treatment using CTLA-4 antibodies
US20090023602A1 (en) * 2003-08-01 2009-01-22 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US20090123467A1 (en) * 2007-07-31 2009-05-14 The Johns Hopkins University Polypeptide-Nucleic Acid Conjugate for Immunoprophylaxis or Immunotherapy for Neoplastic or Infectious Disorders
US7608591B2 (en) * 2003-05-29 2009-10-27 The Scripps Research Institute Targeted delivery to legumain-expressing cells
US20100189727A1 (en) * 2008-12-08 2010-07-29 Tegopharm Corporation Masking Ligands For Reversible Inhibition Of Multivalent Compounds
US20100221212A1 (en) * 2009-02-23 2010-09-02 Cytomx Therapeutics, Llc Proproteins and methods of use thereof

Family Cites Families (105)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4522811A (en) 1982-07-08 1985-06-11 Syntex (U.S.A.) Inc. Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides
US4732863A (en) 1984-12-31 1988-03-22 University Of New Mexico PEG-modified antibody with reduced affinity for cell surface Fc receptors
US5849478A (en) 1986-08-14 1998-12-15 Cashman; Daniel P. Blocked-polymerase polynucleotide immunoassay method and kit
DE3853515T3 (de) 1987-05-21 2005-08-25 Micromet Ag Multifunktionelle proteine mit vorbestimmter zielsetzung.
US5322678A (en) 1988-02-17 1994-06-21 Neorx Corporation Alteration of pharmacokinetics of proteins by charge modification
JPH02100685A (ja) * 1988-10-05 1990-04-12 Res Dev Corp Of Japan ポリペプチド分泌発現ベクター,該ベクターで形質転換した微生物及び該微生物によるポリペプチドの製造
KR900701847A (ko) 1988-11-18 1990-12-04 원본미기재 복합 폴리펩티드, 그들의 제조 방법 및 사용 방법
US5459061A (en) 1990-01-26 1995-10-17 W. Alton Jones Cell Science Center, Inc. Hybridomas producing monoclonal antibodies which specifically bind to continuous epitope on the human EGF receptor and compete with EGF for binding to the EGF receptor
US5525491A (en) 1991-02-27 1996-06-11 Creative Biomolecules, Inc. Serine-rich peptide linkers
US5272253A (en) 1991-07-01 1993-12-21 Eli Lilly And Company Cluster conjugates of drugs with antibodies
US6093399A (en) 1992-03-05 2000-07-25 Board Of Regents, The University Of Texas System Methods and compositions for the specific coagulation of vasculature
CA2131528C (en) 1992-03-05 2004-07-13 Philip E. Thorpe Methods and compositions for targeting the vasculature of solid tumors
DK0586002T3 (da) 1992-08-18 2000-06-19 Centro Inmunologia Molecular Monoklonale antistoffer, som genkender epidermisvækstfaktor-receptoren, celler og fremgangsmåder heraf og præparater indeho
WO1994007921A1 (en) 1992-09-25 1994-04-14 Commonwealth Scientific And Industrial Research Organisation Target binding polypeptide
WO1994025616A1 (en) 1993-04-28 1994-11-10 Worcester Foundation For Experimental Biology Cell-targeted lytic pore-forming agents
US5777078A (en) 1993-04-28 1998-07-07 Worcester Foundation For Experimental Biology Triggered pore-forming agents
JPH09503381A (ja) * 1993-07-09 1997-04-08 ジ・インスティテュート・オブ・キャンサー・リサーチ プロテインチロシンキナーゼ及びそのリガンド
GB9322156D0 (en) 1993-10-27 1993-12-15 Univ Newcastel Upon Tyne Activation of molecules
US5686600A (en) 1994-06-28 1997-11-11 Novartis Finance Corporation Antibodies which bind to insect gut proteins and their use
DK0769967T3 (da) 1994-08-19 2008-03-31 Wallone Region Konjugater der omfatter et antitumormiddel, og anvendelse heraf
EP0706799B1 (en) 1994-09-16 2001-11-14 MERCK PATENT GmbH Immunoconjugates II
US5877155A (en) 1995-03-17 1999-03-02 The Research Foundation Of State University Of New York Mimotopes and anti-mimotopes of human platelet glycoprotein Ib/IX
DE69636015T2 (de) 1995-05-03 2007-01-04 Bioenhancementsments Ltd. Bispezifische antikörper in denen die bindungsfähigkeit durch eine mittels licht spaltbare gruppe reversibel inhibiert wird
CA2265454A1 (en) 1996-09-09 1998-03-19 Zealand Pharmaceuticals A/S Peptide prodrugs containing an alpha-hydroxyacid linker
US6368598B1 (en) 1996-09-16 2002-04-09 Jcrt Radiation Oncology Support Services, Inc. Drug complex for treatment of metastatic prostate cancer
US5994104A (en) 1996-11-08 1999-11-30 Royal Free Hospital School Of Medicine Interleukin-12 fusion protein
DE19701141C1 (de) 1997-01-16 1998-04-09 Hoechst Ag Genkonstrukte für durch Proteasen aktivierbare Wirksubstanzen
US7122636B1 (en) 1997-02-21 2006-10-17 Genentech, Inc. Antibody fragment-polymer conjugates and uses of same
WO1998049307A1 (en) * 1997-05-01 1998-11-05 Zymogenetics, Inc. Mammalian cytokine-like receptor
KR100230578B1 (ko) * 1997-07-25 1999-12-01 허영섭 포스포리불로키나제를 융합파트너로 이용하는 재조합 인간 부갑상선호르몬의 발현벡터
US20030166107A1 (en) 1997-09-18 2003-09-04 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US6551795B1 (en) * 1998-02-18 2003-04-22 Genome Therapeutics Corporation Nucleic acid and amino acid sequences relating to pseudomonas aeruginosa for diagnostics and therapeutics
CA2335324A1 (en) 1998-07-17 2000-01-27 Genetag Technology, Inc. Methods for detecting and mapping genes, mutations and variant polynucleotide sequences
US6203989B1 (en) 1998-09-30 2001-03-20 Affymetrix, Inc. Methods and compositions for amplifying detectable signals in specific binding assays
ES2265693T3 (es) 1998-10-16 2007-02-16 Biogen Idec Ma Inc. Proteinas de fusion con interferon-beta y usos.
EP2977063A1 (en) 1999-06-25 2016-01-27 Genentech, Inc. Methods of treatment using anti-ErbB antibody-maytansinoid conjugates
US7220552B1 (en) 1999-11-19 2007-05-22 The Board Of Trustees Of The Leland Stanford Junior University Bifunctional molecules and their use in the disruption of protein-protein interactions
US20110131679A2 (en) 2000-04-19 2011-06-02 Thomas La Rosa Rice Nucleic Acid Molecules and Other Molecules Associated with Plants and Uses Thereof for Plant Improvement
EP1286700A2 (en) * 2000-06-01 2003-03-05 Universite Catholique De Louvain Tumor activated prodrug compounds
JP2003534387A (ja) * 2000-06-01 2003-11-18 ユニべルシテ・カトリック・ドゥ・ルベン 腫瘍活性化プロドラッグ化合物、並びにこれらの製造方法及び使用方法
US8314060B2 (en) * 2000-09-05 2012-11-20 Biosight Ltd. Peptide conjugated anti-cancer prodrugs
EP1315840A4 (en) * 2000-09-08 2005-11-02 Univ Texas BIOPANNING AND RAPID ANALYSIS OF SELECTIVE INTERACTIVE LIGANDS (BRASIL)
US7465790B2 (en) 2000-10-09 2008-12-16 Isis Innovation, Inc. Therapeutic antibodies
AU9399501A (en) 2000-10-09 2002-04-22 Isis Innovation Therapeutic antibodies
EP1349943A2 (en) 2001-01-04 2003-10-08 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Detection of protein conformation using a split ubiquitin reporter system
US7829084B2 (en) 2001-01-17 2010-11-09 Trubion Pharmaceuticals, Inc. Binding constructs and methods for use thereof
WO2002060488A1 (en) 2001-01-30 2002-08-08 Universite Catholique De Louvain Anti-tumor compounds
JP2004519233A (ja) 2001-02-19 2004-07-02 メルク パテント ゲゼルシャフト ミット ベシュレンクテル ハフトング 免疫原性の低減された修飾された抗egfr抗体
JP4689956B2 (ja) 2001-08-01 2011-06-01 ユニバーシティ オブ ブリストル 増殖因子イソ型
US20030082191A1 (en) 2001-08-29 2003-05-01 Poduslo Joseph F. Treatment for central nervous system disorders
AU2003217415B2 (en) 2002-02-14 2009-01-08 William J Rutter Chimeric molecules for cleavage in a treated host
US7591994B2 (en) 2002-12-13 2009-09-22 Immunomedics, Inc. Camptothecin-binding moiety conjugates
US7317091B2 (en) 2002-03-01 2008-01-08 Xencor, Inc. Optimized Fc variants
CN1665932B (zh) * 2002-04-30 2010-12-15 株式会社载体研究所 具有修饰的蛋白酶依赖向性的载体
US20040109855A1 (en) * 2002-07-23 2004-06-10 Herman Waldmann Therapeutic antibodies with reduced side effect
WO2004021861A2 (en) 2002-09-03 2004-03-18 Vit Lauermann Targeted release
JP4351430B2 (ja) 2002-10-04 2009-10-28 財団法人癌研究会 ナノ黒鉛構造体に結合能を有するペプチド
CN1548537B (zh) 2002-12-27 2010-05-05 深圳市源兴生物医药科技有限公司 疫苗制备方法和抗肿瘤疫苗
US7276497B2 (en) 2003-05-20 2007-10-02 Immunogen Inc. Cytotoxic agents comprising new maytansinoids
US20050009110A1 (en) 2003-07-08 2005-01-13 Xiao-Jia Chang Methods of producing antibodies for diagnostics and therapeutics
US7431915B2 (en) 2003-10-31 2008-10-07 The Regents Of The University Of California Peptides whose uptake by cells is controllable
WO2005090407A1 (en) 2004-03-19 2005-09-29 Imclone Systems Incorporated Human anti-epidermal growth factor receptor antibody
EP1579873A1 (en) 2004-03-23 2005-09-28 Complex Biosystems GmbH Polymeric prodrugs
MXPA06014065A (es) 2004-06-01 2007-01-31 Genentech Inc Conjugados de droga-anticuerpo y metodos.
US7541330B2 (en) 2004-06-15 2009-06-02 Kosan Biosciences Incorporated Conjugates with reduced adverse systemic effects
ES2579805T3 (es) 2004-09-23 2016-08-16 Genentech, Inc. Anticuerpos y conjugados modificados por ingeniería genética con cisteína
WO2006055689A2 (en) * 2004-11-16 2006-05-26 Avidia Research Institute Protein scaffolds and uses thereof
EP1817059A2 (en) 2004-12-01 2007-08-15 Genentech, Inc. Conjugates of 1,8-bis-naphthalimides with an antibody
EP1862470A4 (en) 2005-02-25 2010-04-21 Univ Hokkaido Nat Univ Corp A BLOODED ELEMENT WHICH IS SELECTLY Degraded in TUMOR TISSUE
FR2888850B1 (fr) * 2005-07-22 2013-01-11 Pf Medicament Nouveaux anticorps anti-igf-ir et leurs applications
DE102005036542A1 (de) 2005-08-03 2007-02-08 Universität Stuttgart CTL-Prodrug
WO2007026972A2 (en) 2005-09-01 2007-03-08 Canon Kabushiki Kaisha Binding protein molecule
EP1770099A1 (en) 2005-09-28 2007-04-04 University of Geneva Method of producing a modified (poly)peptide
WO2007064759A2 (en) * 2005-11-29 2007-06-07 The Scripps Research Institute Inhibiting tumour cell invasion, metastasis and angiogenesis through targetting legumain
BRPI0619463A2 (pt) 2005-12-06 2013-01-08 Domantis Ltd ligando, uso do mesmo, mÉtodos para tratar cÂncer e para administrar um tratamento anti-vegf e tratamento anti-egfr a um indivÍduo, composiÇço, dispositivo de dispensaÇço de droga, Ácido nucleico isolado ou recombinante, vetor, cÉlula hospedeira, mÉtodo para produzir um ligando, polipeptÍdeo de domÍnio variÁvel simples de imunoglobulina, e, antagonista de egfr
GB0604187D0 (en) 2006-03-02 2006-04-12 Fusion Antibodies Ltd Peptide and uses thereof
CA2645347A1 (en) * 2006-03-10 2007-09-20 Diatos Anticancer drugs conjugated to antibody via an enzyme cleavable linker
WO2007106415A2 (en) 2006-03-10 2007-09-20 Massachusetts Institute Of Technology Triggered self-assembly conjugates and nanosystems
US7118159B1 (en) 2006-03-15 2006-10-10 Gary Randall Andrews Convertible tonneau cover
US7951918B2 (en) 2006-03-17 2011-05-31 Biogen Idec Ma Inc. Stabilized polypeptide compositions
JP4959226B2 (ja) * 2006-05-19 2012-06-20 独立行政法人産業技術総合研究所 スリーフィンガー様蛋白質ライブラリ
CA2658612C (en) * 2006-08-03 2015-11-17 Astrazeneca Ab Antibodies directed to .alpha.v.beta.6 and uses thereof
WO2008052322A1 (en) * 2006-10-30 2008-05-08 Viventia Biotech Inc. Immunotoxγn fusions comprising an antibody fragment and a plant toxin linked by protease cleavable linkers
EP1930342B1 (en) * 2006-12-04 2012-01-25 Institut Pasteur OB-fold used as scaffold for engineering new specific binders
WO2008131258A2 (en) * 2007-04-19 2008-10-30 State Of Oregon Acting By And Through The State Board Of Higher Education On Behalf Of Oregon State University Pactamycin biosynthetic gene cluster
US20080317677A1 (en) 2007-06-22 2008-12-25 Szymczak Christopher E Laser Marked Dosage Forms
US8317505B2 (en) * 2007-08-21 2012-11-27 Johnson & Johnson Vision Care, Inc. Apparatus for formation of an ophthalmic lens precursor and lens
EP2185188B1 (en) 2007-08-22 2014-08-06 Medarex, L.L.C. Site-specific attachment of drugs or other agents to engineered antibodies with c-terminal extensions
EP3492488A1 (en) * 2007-08-22 2019-06-05 The Regents of The University of California Activatable binding polypeptides and methods of identification and use thereof
KR101661770B1 (ko) 2007-09-21 2016-10-04 더 리전트 오브 더 유니버시티 오브 캘리포니아 표적화된 인터페론이 강력한 아폽토시스 및 항-종양 활성을 발휘함
GEP20156390B (en) 2008-01-03 2015-11-10 Scripps Research Inst Antibody targeting through a modular recognition domain
US20110178279A1 (en) 2009-08-03 2011-07-21 Williams John C Development of masked therapeutic antibodies to limit off-target effects: application to anti-egfr antibodies
WO2010081173A2 (en) * 2009-01-12 2010-07-15 Cytomx Therapeutics, Llc Modified antibody compositions, methods of making and using thereof
US20120121613A1 (en) 2009-01-19 2012-05-17 Bayer Healthcare Llc Protein conjugate having an endopeptidase- cleavable bioprotective moiety
WO2010085845A1 (en) 2009-01-28 2010-08-05 The University Of Queensland Cancer therapy and/or diagnosis
HRP20230487T1 (hr) 2009-02-13 2023-07-21 Immunomedics, Inc. Imunokonjugati s unutarstaničnom vezom koja se može rascijepiti
CN102413843A (zh) * 2009-03-05 2012-04-11 阿森迪斯药物股份有限公司 干扰素α载体前药
WO2011015921A1 (en) 2009-08-03 2011-02-10 Avesthagen Limited A highly efficient process of purification and production of recombinant cetuximab
WO2011015918A2 (en) 2009-08-03 2011-02-10 Avesthagen Limited Vectors and compounds for expression of recombinant cetuximab
WO2011101435A1 (en) 2010-02-19 2011-08-25 Novo Nordisk A/S Activatable constructs
WO2011133658A1 (en) 2010-04-22 2011-10-27 Boston Medical Center Corporation Compositions and methods for targeting and delivering therapeutics into cells
US9193791B2 (en) 2010-08-03 2015-11-24 City Of Hope Development of masked therapeutic antibodies to limit off-target effects
AU2013251310B2 (en) 2012-04-27 2018-02-15 Cytomx Therapeutics, Inc. Activatable antibodies that bind epidermal growth factor receptor and methods of use thereof
US9540440B2 (en) 2013-10-30 2017-01-10 Cytomx Therapeutics, Inc. Activatable antibodies that bind epidermal growth factor receptor and methods of use thereof
SG10201908685QA (en) * 2015-06-22 2019-10-30 Bayer Pharma AG Antibody drug conjugates (adcs) and antibody prodrug conjugates (apdcs) with enzymatically cleavable groups

Patent Citations (99)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) * 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4379145A (en) * 1979-12-14 1983-04-05 Teijin Limited Antitumor protein hybrid and process for the preparation thereof
US4671958A (en) * 1982-03-09 1987-06-09 Cytogen Corporation Antibody conjugates for the delivery of compounds to target sites
US4816567A (en) * 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4867973A (en) * 1984-08-31 1989-09-19 Cytogen Corporation Antibody-therapeutic agent conjugates
US5306731A (en) * 1985-06-14 1994-04-26 Massachusetts Eye And Ear Infirmary Method and products for treating the eye
US4952394A (en) * 1987-11-23 1990-08-28 Bristol-Myers Company Drug-monoclonal antibody conjugates
US5725856A (en) * 1988-01-12 1998-03-10 Genentech, Inc. Monoclonal antibodies directed to the HER2 receptor
US5770195A (en) * 1988-01-12 1998-06-23 Genentech, Inc. Monoclonal antibodies directed to the her2 receptor
US5772997A (en) * 1988-01-12 1998-06-30 Genentech, Inc. Monoclonal antibodies directed to the HER2 receptor
US6399063B1 (en) * 1988-01-12 2002-06-04 Genentech, Inc. Monoclonal antibodies directed to the HER2 receptor
US4975278A (en) * 1988-02-26 1990-12-04 Bristol-Myers Company Antibody-enzyme conjugates in combination with prodrugs for the delivery of cytotoxic agents to tumor cells
US5144012A (en) * 1988-08-08 1992-09-01 Eli Lilly And Company Cytotoxic drug conjugates
US5223409A (en) * 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5403484A (en) * 1988-09-02 1995-04-04 Protein Engineering Corporation Viruses expressing chimeric binding proteins
US5571698A (en) * 1988-09-02 1996-11-05 Protein Engineering Corporation Directed evolution of novel binding proteins
US7118879B2 (en) * 1988-09-02 2006-10-10 Dyax Corp. Method of recovering a nucleic acid encoding a proteinaceous binding domain which binds a target material
US5837500A (en) * 1988-09-02 1998-11-17 Dyax, Corp. Directed evolution of novel binding proteins
US7208293B2 (en) * 1988-09-02 2007-04-24 Dyax Corp. Directed evolution of novel binding proteins
US6217866B1 (en) * 1988-09-15 2001-04-17 Rhone-Poulenc Rorer International (Holdings), Inc. Monoclonal antibodies specific to human epidermal growth factor receptor and therapeutic methods employing same
US5010176A (en) * 1988-11-10 1991-04-23 Eli Lilly And Company Antibody-drug conjugates
US5162218A (en) * 1988-11-18 1992-11-10 The Regents Of The University Of California Conjugated polypeptides and methods for their preparation
US5637288A (en) * 1989-12-05 1997-06-10 Immunomedics, Inc. Chimeric antibody for detection and therapy of infectious and inflammatory lesions
US6407213B1 (en) * 1991-06-14 2002-06-18 Genentech, Inc. Method for making humanized antibodies
US6054297A (en) * 1991-06-14 2000-04-25 Genentech, Inc. Humanized antibodies and methods for making them
US6107059A (en) * 1992-04-29 2000-08-22 Affymax Technologies N.V. Peptide library and screening method
US5834247A (en) * 1992-12-09 1998-11-10 New England Biolabs, Inc. Modified proteins comprising controllable intervening protein sequences or their elements methods of producing same and methods for purification of a target protein comprised by a modified protein
US20060121570A1 (en) * 1993-02-02 2006-06-08 The Scripps Research Institute Methods for producing polypeptide binding sites, monoclonal antibodies and compositions thereof
US6955900B1 (en) * 1993-02-02 2005-10-18 The Scripps Research Institute Methods for producing polypeptide binding sites, monoclonal antibodies and compositions thereof
US5679548A (en) * 1993-02-02 1997-10-21 The Scripps Research Institute Methods for producing polypeptide metal binding sites and compositions thereof
US5665358A (en) * 1993-03-30 1997-09-09 Eli Lilly And Company Antibody drug-conjugates
US5985626A (en) * 1994-03-10 1999-11-16 The Scripps Research Institute Catalytic antibody/substrate intermediates
US5468785A (en) * 1994-04-15 1995-11-21 University Of Akron Cobaloxime photoinitiated free radical polymerizations
US6066719A (en) * 1995-04-20 2000-05-23 Genetech, Inc. Antibody fragments
US7060808B1 (en) * 1995-06-07 2006-06-13 Imclone Systems Incorporated Humanized anti-EGF receptor monoclonal antibody
US6258562B1 (en) * 1996-02-09 2001-07-10 Basf Aktiengesellschaft Human antibodies that bind human TNFα
US20020048578A1 (en) * 1996-02-20 2002-04-25 Herman Waldmann Antibody variants
US5866341A (en) * 1996-04-03 1999-02-02 Chugai Pharmaceutical Co., Ltd. Compositions and methods for screening drug libraries
US5922845A (en) * 1996-07-11 1999-07-13 Medarex, Inc. Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies
US5990286A (en) * 1996-12-18 1999-11-23 Techniclone, Inc. Antibodies with reduced net positive charge
US7297334B2 (en) * 1997-04-07 2007-11-20 Genentech, Inc. Anti-vegf antibodies
US7365166B2 (en) * 1997-04-07 2008-04-29 Genentech, Inc. Anti-VEGF antibodies
US7169901B2 (en) * 1997-04-07 2007-01-30 Genentech, Inc. Anti-VEGF antibodies
US7375193B2 (en) * 1997-04-07 2008-05-20 Genentech, Inc. Anti-VEGF antibodies
US7060269B1 (en) * 1997-04-07 2006-06-13 Genentech, Inc. Anti-VEGF antibodies
US6884879B1 (en) * 1997-04-07 2005-04-26 Genentech, Inc. Anti-VEGF antibodies
US20050042680A1 (en) * 1997-04-30 2005-02-24 Filpula David Ray Single chain antigen-binding polypeptides for polymer conjugation
US6235883B1 (en) * 1997-05-05 2001-05-22 Abgenix, Inc. Human monoclonal antibodies to epidermal growth factor receptor
US6265540B1 (en) * 1997-05-19 2001-07-24 The Johns Hopkins University School Of Medicine Tissue specific prodrug
US20020168690A1 (en) * 1997-07-25 2002-11-14 Miller Jeffrey A. Assays and peptide substrate for determining aggrecan degrading metallo protease activity
US7087409B2 (en) * 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
US7029874B2 (en) * 1998-03-17 2006-04-18 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US7157418B1 (en) * 1998-07-22 2007-01-02 Osprey Pharmaceuticals, Ltd. Methods and compositions for treating secondary tissue damage and other inflammatory conditions and disorders
US6548249B1 (en) * 1998-10-08 2003-04-15 Rigel Pharmaceuticals, Inc. Fusions of scaffold proteins with random peptide libraries
US6682736B1 (en) * 1998-12-23 2004-01-27 Abgenix, Inc. Human monoclonal antibodies to CTLA-4
US6015557A (en) * 1999-02-24 2000-01-18 Tobinick; Edward L. Tumor necrosis factor antagonists for the treatment of neurological disorders
US6534061B1 (en) * 1999-04-12 2003-03-18 Genentech, Inc. Tumor necrosis factor receptor homologs and nucleic acids encoding the same
US7098002B1 (en) * 1999-04-13 2006-08-29 Yeda Research And Development Co. Ltd. Preparation of biologically active molecules
US6342219B1 (en) * 1999-04-28 2002-01-29 Board Of Regents, The University Of Texas System Antibody compositions for selectively inhibiting VEGF
US6342221B1 (en) * 1999-04-28 2002-01-29 Board Of Regents, The University Of Texas System Antibody conjugate compositions for selectively inhibiting VEGF
US6268488B1 (en) * 1999-05-25 2001-07-31 Barbas, Iii Carlos F. Prodrug activation using catalytic antibodies
US20040146516A1 (en) * 1999-06-17 2004-07-29 Utah Ventures Ii L.P. Lumen-exposed molecules and methods for targeted delivery
US6903196B1 (en) * 1999-06-17 2005-06-07 Utah Ventures Ii, L.P. Methods for identifying and isolating tissue-specific lumen-exposed molecules
US7226596B2 (en) * 1999-07-28 2007-06-05 Genentech, Inc. Compositions and methods for the treatment of tumors
US6984720B1 (en) * 1999-08-24 2006-01-10 Medarex, Inc. Human CTLA-4 antibodies
US20050208558A1 (en) * 1999-10-19 2005-09-22 Applera Corporation Detection kits, such as nucleic acid arrays, for detecting the expression or 10,000 or more Drosophila genes and uses thereof
US20060252130A1 (en) * 1999-11-03 2006-11-09 Acgt Pregenomics Ag Method for linking molecular substances
US20050196754A1 (en) * 2000-03-31 2005-09-08 Drmanac Radoje T. Novel nucleic acids and polypeptides
US20060078901A1 (en) * 2000-04-11 2006-04-13 Carmen Buchrieser Listeria monocytogenes genome, polypeptides and uses
US20030021791A1 (en) * 2000-04-25 2003-01-30 Kassis Amin I. Methods for tumor diagnosis and therapy
US20040014652A1 (en) * 2000-06-01 2004-01-22 Andre Trouet Tumor activated prodrug compounds and methods of making and using the same
US20060265274A1 (en) * 2000-08-08 2006-11-23 Commins Alfred D Balanced, multi-stud hold-down
US20040053829A1 (en) * 2000-09-15 2004-03-18 Klaus Pfizenmaier Fusion protein from antibody cytokine-cytokine inhibitor (selectokine) for use as target-specific prodrug
US20040147444A1 (en) * 2001-01-09 2004-07-29 Yuti Chernajovsky Latent fusion protein
US20040082039A1 (en) * 2001-02-19 2004-04-29 Stephen Gillies Artificial proteins with reduced immunogenicity
US6992174B2 (en) * 2001-03-30 2006-01-31 Emd Lexigen Research Center Corp. Reducing the immunogenicity of fusion proteins
US20070061916A1 (en) * 2001-05-07 2007-03-15 Kovalic David K Nucleic acid molecules and other molecules associated with plants and uses thereof for plant improvement
US20040213797A1 (en) * 2001-07-25 2004-10-28 Bodmer Mark William Conjugates for the modulation of immune responses
US20070083334A1 (en) * 2001-09-14 2007-04-12 Compugen Ltd. Methods and systems for annotating biomolecular sequences
US20030134824A1 (en) * 2001-11-12 2003-07-17 Ronald Breslow Beta-cyclodextrin dimers and phthalocyanines and uses thereof
US20060246066A1 (en) * 2001-12-17 2006-11-02 Morgan Bryan P Cleavable reagents for specific delivery to disease sites
US7452535B2 (en) * 2002-04-12 2008-11-18 Medarex, Inc. Methods of treatment using CTLA-4 antibodies
US20040185053A1 (en) * 2002-12-13 2004-09-23 Immunomedics, Inc. Immunoconjugates with an intracellularly-cleavable linkage
US7608591B2 (en) * 2003-05-29 2009-10-27 The Scripps Research Institute Targeted delivery to legumain-expressing cells
US20090023602A1 (en) * 2003-08-01 2009-01-22 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US7256038B2 (en) * 2003-08-18 2007-08-14 Regents Of The University Of California Polypeptide display libraries and methods of making and using thereof
US20050106100A1 (en) * 2003-09-03 2005-05-19 Harris Thomas D. Compounds containing matrix metalloproteinase substrates and methods of their use
US20070041904A1 (en) * 2003-10-31 2007-02-22 Tao Jiang Peptides whose uptake by cells is controllable
US20050255042A1 (en) * 2003-11-24 2005-11-17 The Regents Of The University Of California Office Of Technology Transfer, University Of California On-demand cleavable linkers for radioconjugates for cancer imaging and therapy
US20060018911A1 (en) * 2004-01-12 2006-01-26 Dana Ault-Riche Design of therapeutics and therapeutics
US20050255555A1 (en) * 2004-02-20 2005-11-17 Johns Terrance G EGF receptor epitope peptides and uses thereof
US20080107660A1 (en) * 2004-02-25 2008-05-08 Colin Self Binding Agents
US7341720B2 (en) * 2005-04-06 2008-03-11 Genzyme Corporation Targeting of glycoprotein therapeutics
US20060228348A1 (en) * 2005-04-06 2006-10-12 Genzyme Corporation Targeting of glycoprotein therapeutics
US20070065878A1 (en) * 2005-08-31 2007-03-22 Daugherty Patrick S Cellular libraries of peptide sequences (CLiPS) and methods of using the same
US20070065158A1 (en) * 2005-09-22 2007-03-22 Fujitsu Limited Mobile terminal apparatus
US20090123467A1 (en) * 2007-07-31 2009-05-14 The Johns Hopkins University Polypeptide-Nucleic Acid Conjugate for Immunoprophylaxis or Immunotherapy for Neoplastic or Infectious Disorders
US20100189727A1 (en) * 2008-12-08 2010-07-29 Tegopharm Corporation Masking Ligands For Reversible Inhibition Of Multivalent Compounds
US20100221212A1 (en) * 2009-02-23 2010-09-02 Cytomx Therapeutics, Llc Proproteins and methods of use thereof

Cited By (173)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8951737B2 (en) 1996-05-06 2015-02-10 Cornell Research Foundation, Inc. Treatment and diagnosis of cancer
US8940871B2 (en) 2006-03-20 2015-01-27 The Regents Of The University Of California Engineered anti-prostate stem cell antigen (PSCA) antibodies for cancer targeting
US20120237512A1 (en) * 2007-08-22 2012-09-20 Patrick Daugherty Activatable Binding Polypeptides and Methods of Identification and Use Thereof
US10077300B2 (en) 2007-08-22 2018-09-18 The Regents Of The University Of California Activatable binding polypeptides and methods of identification and use thereof
US20120237977A1 (en) * 2007-08-22 2012-09-20 Patrick Daugherty Activatable Binding Polypeptides and Methods of Identification and Use Thereof
US20120244154A1 (en) * 2007-08-22 2012-09-27 Patrick Daugherty Activatable Binding Polypeptides and Methods of Identification and Use Thereof
US9169321B2 (en) 2007-08-22 2015-10-27 The Regents Of The University Of California Activatable binding polypeptides and methods of identification and use thereof
US11028162B2 (en) 2007-08-22 2021-06-08 The Regents Of The University Of California Methods for manufacturing activatable binding polypeptides comprising matrix metalloprotease cleavable moieties
US8518404B2 (en) * 2007-08-22 2013-08-27 The Regents Of The University Of California Activatable binding polypeptides and methods of identification and use thereof
US8529898B2 (en) * 2007-08-22 2013-09-10 The Regents Of The University Of California Activatable binding polypeptides and methods of identification and use thereof
US8541203B2 (en) * 2007-08-22 2013-09-24 The Regents Of The University Of California Activatable binding polypeptides and methods of identification and use thereof
US20090304719A1 (en) * 2007-08-22 2009-12-10 Patrick Daugherty Activatable binding polypeptides and methods of identification and use thereof
US12209120B2 (en) 2007-08-22 2025-01-28 The Regents Of The University Of California Activatable anti-VEGF scFv
US9527919B2 (en) 2007-09-04 2016-12-27 The Regents Of The University Of California High affinity anti-prostate stem cell antigen (PSCA) antibodies for cancer targeting and detection
US8940298B2 (en) 2007-09-04 2015-01-27 The Regents Of The University Of California High affinity anti-prostate stem cell antigen (PSCA) antibodies for cancer targeting and detection
US9453078B2 (en) 2009-01-12 2016-09-27 Cytomx Therapeutics, Inc. Modified antibody compositions, methods of making and using thereof
US8513390B2 (en) * 2009-01-12 2013-08-20 Cytomx Therapeutics, Inc. Modified antibody compositions, methods of making and using thereof
US20120207756A1 (en) * 2009-01-12 2012-08-16 Stagliano Nancy E Modified Antibody Compositions, Methods of Making and Using Thereof
US10118961B2 (en) 2009-01-12 2018-11-06 Cytomx Therapeutics, Inc. Modified antibody containing the cleavable peptide with the amino acid sequence TGRGPSWV
US20120149061A1 (en) * 2009-01-12 2012-06-14 Stagliano Nancy E Modified Antibody Compositions, Methods of Making and Using Thereof
US10875913B2 (en) 2009-01-12 2020-12-29 Cytomx Therapeutics, Inc. Methods of treatment using activatable anti-EGFR antibodies
US8563269B2 (en) * 2009-01-12 2013-10-22 Cytomx Therapeutics, Inc. Modified antibody compositions, methods of making and using thereof
US10059762B2 (en) 2009-01-12 2018-08-28 Cytomx Therapeutics, Inc. Anti-EGFR activatable antibodies
US10517969B2 (en) 2009-02-17 2019-12-31 Cornell University Methods and kits for diagnosis of cancer and prediction of therapeutic value
US10513549B2 (en) 2009-02-23 2019-12-24 Cytomx Therapeutics, Inc. Cleavage-activatable interferon-alpha proprotein
US20100221212A1 (en) * 2009-02-23 2010-09-02 Cytomx Therapeutics, Llc Proproteins and methods of use thereof
US8399219B2 (en) 2009-02-23 2013-03-19 Cytomx Therapeutics, Inc. Protease activatable interferon alpha proprotein
US9644016B2 (en) 2009-02-23 2017-05-09 Cytomx Therapeutics, Inc. Soluble notch receptor proproteins and methods of use thereof
US11180570B2 (en) 2009-12-02 2021-11-23 Imaginab, Inc. J591 minibodies and cys-diabodies for targeting human prostate specific membrane antigen (PSMA) and methods for their use
US8772459B2 (en) 2009-12-02 2014-07-08 Imaginab, Inc. J591 minibodies and Cys-diabodies for targeting human prostate specific membrane antigen (PSMA) and methods for their use
US9107887B2 (en) 2011-03-10 2015-08-18 Provectus Pharmaceuticals, Inc. Combination of local and systemic immunomodulative therapies for enhanced treatment of cancer
US9808524B2 (en) 2011-03-10 2017-11-07 Provectus Pharmatech, Inc. Combination of local and systemic immunomodulative therapies for melanoma and liver cancer
CN103476943A (zh) * 2011-03-10 2013-12-25 普罗维克图斯药品公司 用于增强治疗癌症的局部和全身性免疫调节疗法的组合
US10471144B2 (en) 2011-03-10 2019-11-12 Provectus Pharmatech, Inc. Combination of local rose bengal and systemic immunomodulative therapies for enhanced treatment of cancer
US9839688B2 (en) 2011-03-10 2017-12-12 Provectus Pharmatech, Inc. Combination of rose bengal and systemic immunomodulative therapies for enhanced treatment of cancer
WO2012122444A1 (en) * 2011-03-10 2012-09-13 Provectus Pharmaceuticals, Inc. Combination of local and systemic immunomodulative therapies for enhanced treatment of cancer
US11071781B2 (en) 2011-03-10 2021-07-27 Provectus Pharmatech, Inc Combination of local and systemic immunomodulative therapies for enhanced treatment of cancer
US9650445B2 (en) 2012-02-28 2017-05-16 The University Of Birmingham Immunotherapeutic molecules and uses
US9822180B2 (en) 2012-02-28 2017-11-21 The University Of Birmingham Immunotherapeutic molecules and uses
US10106621B2 (en) 2012-02-28 2018-10-23 The University Of Birmingham Immunotherapeutic molecules and uses
KR20150035538A (ko) * 2012-04-27 2015-04-06 싸이톰스 테라퓨틱스, 인크. 표피 성장인자 수용체에 결합하는 활성화가능한 항체 및 이의 사용 방법
US9545442B2 (en) 2012-04-27 2017-01-17 Cytomx Therapeutics, Inc. Activatable antibodies that bind epidermal growth factor receptor and methods of use thereof
CN110078827A (zh) * 2012-04-27 2019-08-02 西托姆克斯治疗公司 结合表皮生长因子受体的可活化的抗体其使用方法
US11890354B2 (en) 2012-04-27 2024-02-06 Cytomx Therapeutics, Inc. Activatable antibodies that bind epidermal growth factor receptor and methods thereof
US9120853B2 (en) 2012-04-27 2015-09-01 Cytomx Therapeutics, Inc. Activatable antibodies that bind epidermal growth factor receptor and methods of use thereof
US10709799B2 (en) 2012-04-27 2020-07-14 Cytomx Therapeutics, Inc. Activatable antibodies that bind epidermal growth factor receptor and methods of use thereof
KR102138743B1 (ko) 2012-04-27 2020-07-29 싸이톰스 테라퓨틱스, 인크. 표피 성장 인자 수용체에 결합하는 활성화가능한 항체 및 이의 사용 방법
US9889211B2 (en) 2012-04-27 2018-02-13 Cytomx Therapeutics, Inc. Activatable antibodies that bind epidermal growth factor receptor and methods of use thereof
CN104540518A (zh) * 2012-04-27 2015-04-22 西托姆克斯治疗公司 结合表皮生长因子受体的可活化的抗体其使用方法
WO2013163631A3 (en) * 2012-04-27 2014-01-09 Cytomx Therapeutics, Inc. Activatable antibodies that bind epidermal growth factor receptor and methods of use thereof
CN104661677A (zh) * 2012-06-22 2015-05-27 西托姆克斯治疗公司 抗Jagged 1/Jagged 2交叉反应抗体、可活化的抗Jagged抗体及其使用方法
US10301380B2 (en) 2012-06-22 2019-05-28 Cytomx Therapeutics, Inc. Anti-jagged 1/jagged 2 cross-reactive antibodies, activatable anti-jagged antibodies and methods of use thereof
US10894821B2 (en) 2012-06-22 2021-01-19 Cytomx Therapeutics, Inc. Activatable antibodies having non-binding steric moieties and methods of using the same
US9127053B2 (en) 2012-06-22 2015-09-08 Cytomx Therapeutics, Inc. Anti-jagged 1/jagged 2 cross-reactive antibodies, activatable anti-jagged antibodies and methods of use thereof
US9688748B2 (en) 2012-06-22 2017-06-27 Cytomx Therapeutics, Inc. Anti-jagged 1/jagged 2 cross-reactive antibodies, activatable anti-jagged antibodies and methods of use thereof
EP2863948A4 (en) * 2012-06-22 2016-03-09 Cytomx Therapeutics Inc ANTI-JAGGED-1 / JAGGED-2 CROSS-REACTIVE ANTIBODIES, ACTUATABLE ANTI-JAGGED ANTIBODIES AND METHOD OF USE THEREOF
WO2013192550A3 (en) * 2012-06-22 2014-04-24 Cytomx Therapeutics, Inc. Anti-jagged 1/jagged 2 cross-reactive antibodies, activatable anti-jagged antibodies and methods of use thereof
US9856314B2 (en) * 2012-06-22 2018-01-02 Cytomx Therapeutics, Inc. Activatable antibodies having non-binding steric moieties and methods of using the same
US10611845B2 (en) * 2012-09-25 2020-04-07 Cytomx Therapeutics, Inc. Activatable antibodies that bind interleukin-6 receptor and methods of use thereof
US9487590B2 (en) * 2012-09-25 2016-11-08 Cytomx Therapeutics, Inc. Activatable antibodies that bind interleukin-6 receptor and methods of use thereof
US20170002082A1 (en) * 2012-09-25 2017-01-05 Cytomx Therapeutics, Inc. Activatable antibodies that bind interleukin-6 receptor and methods of use thereof
US20140363430A1 (en) * 2012-09-25 2014-12-11 Cytomx Therapeutics, Inc. Activatable Antibodies that Bind Interleukin-6 Receptor and Methods of Use Thereof
US11035859B2 (en) 2013-01-04 2021-06-15 Cytomx Therapeutics, Inc. Compositions and methods for detecting protease activity in biological systems
US10261083B2 (en) 2013-01-04 2019-04-16 Cytomx Therapeutics, Inc. Compositions and methods for detecting protease activity in biological systems
US11867695B2 (en) 2013-01-04 2024-01-09 Cytomx Therapeutics, Inc. Compositions and methods for detecting protease activity in biological systems
US9944700B2 (en) 2013-03-13 2018-04-17 Novartis Ag Notch2 binding molecules for treating respiratory diseases
US20150079088A1 (en) * 2013-07-25 2015-03-19 Cytomx Therapeutics, Inc. Multispecific antibodies, multispecific activatable antibodies and methods of using the same
US11161906B2 (en) * 2013-07-25 2021-11-02 Cytomx Therapeutics, Inc. Multispecific antibodies, multispecific activatable antibodies and methods of using the same
US20150087810A1 (en) * 2013-09-25 2015-03-26 Cytomx Therapeutics, Inc. Matrix Metalloproteinase Substrates And Other Cleavable Moieties And Methods Of Use Thereof
US20190284283A1 (en) * 2013-09-25 2019-09-19 Cytomx Therapeutics, Inc Matrix metalloproteinase substrates and other cleavable moieties and methods of use thereof
US11814410B2 (en) 2013-09-25 2023-11-14 Cytomx Therapeutics, Inc. Matrix metalloproteinase substrates and other cleavable moieties and methods of use thereof
US10533053B2 (en) 2013-10-30 2020-01-14 Cytomx Therapeutics, Inc. Nucleic acids encoding activatable antibodies that bind epidermal growth factor receptor
US9540440B2 (en) 2013-10-30 2017-01-10 Cytomx Therapeutics, Inc. Activatable antibodies that bind epidermal growth factor receptor and methods of use thereof
US11180562B2 (en) 2013-10-30 2021-11-23 Cytomx Therapeutics, Inc. Method of treating or delaying progression of an epidermal growth factor receptor (EGFR)-related disorder by administering activatable EGFR-binding antibodies
US12139543B2 (en) 2013-10-30 2024-11-12 Cytomx Therapeutics, Inc. Method of using an anti-epidermal growth factor receptor (EGFR) activatable antibody to detect the presence or absence of a cleaving agent and EGFR
US10568977B2 (en) 2013-12-11 2020-02-25 Cytomx Therapeutics, Inc. Antibodies that bind activatable antibodies and methods of use thereof
US9737623B2 (en) 2013-12-11 2017-08-22 Cytomx Therapeutics, Inc. Antibodies that bind activatable antibodies and methods of use thereof
US20150218217A1 (en) * 2014-01-31 2015-08-06 Cytomx Therapeutics, Inc. Matriptase and u-plasminogen activator substrates and other cleavable moieties and methods of use thereof
US11884746B2 (en) 2014-01-31 2024-01-30 Cytomx Therapeutics, Inc. Matriptase and u-plasminogen activator substrates and other cleavable moieties and methods of use thereof
US11028126B2 (en) 2014-01-31 2021-06-08 Cytomx Therapeutics, Inc. Matriptase and u-plasminogen activator substrates and other cleavable moieties and methods of use thereof
US9562073B2 (en) * 2014-01-31 2017-02-07 Cytomx Therapeutics, Inc. Matriptase and u-plasminogen activator substrates and other cleavable moieties and methods of use thereof
US10138272B2 (en) 2014-01-31 2018-11-27 Cytomx Therapeutics, Inc. Matriptase and u-plasminogen activator substrates and other cleavable moieties and methods of use thereof
US10858440B2 (en) * 2014-02-12 2020-12-08 Genentech, Inc. Anti-Jagged1 antibodies and methods of use
US11926674B2 (en) 2014-02-12 2024-03-12 Genentech, Inc. Anti-Jagged2 antibodies and methods of use
US20160230202A1 (en) * 2014-03-11 2016-08-11 Eric William Olle Process for Generating Synthetic Engineered Recombinant Proteins for Vaccination, Diagnosis and Treatment of Disease
WO2015175375A1 (en) 2014-05-13 2015-11-19 Short Jay M Conditionally active biological proteins
US10414814B2 (en) * 2014-07-03 2019-09-17 City Of Hope Tumor-selective CTLA-4 antagonists
US11279752B2 (en) 2014-07-03 2022-03-22 City Of Hope Tumor-selective CTLA-4 antagonists
US20180215806A1 (en) * 2014-07-03 2018-08-02 City Of Hope Tumor-selective ctla-4 antagonists
US10669337B2 (en) 2014-07-25 2020-06-02 Cytomx Therapeutics, Inc. Bispecific anti-CD3 antibodies, bispecific activatable anti-CD3 antibodies, and methods of using the same
US11802158B2 (en) 2014-07-25 2023-10-31 Cytomx Therapeutics, Inc. Bispecific anti-CD3 antibodies, bispecific activatable anti-CD3 antibodies, and methods of using the same
US10689423B2 (en) 2015-01-13 2020-06-23 City Of Hope CTLA4-binding protein peptide-linker masks
US11926652B2 (en) 2015-01-13 2024-03-12 City Of Hope CTLA4-binding protein peptide-linker masks
US11548944B2 (en) 2015-01-20 2023-01-10 Cytomx Therapeutics, Inc. Matrix metalloprotease-cleavable and serine protease-cleavable substrates and methods of use thereof
CN114685661A (zh) * 2015-01-20 2022-07-01 西托姆克斯治疗公司 基质金属蛋白酶可切割且丝氨酸蛋白酶可切割底物及其使用方法
US12459999B2 (en) 2015-01-20 2025-11-04 Cytomx Therapeutics, Inc. Matrix metalloprotease-cleavable and serine protease-cleavable substrates and methods of use thereof
US11046759B2 (en) 2015-01-20 2021-06-29 Cytomx Therapeutics, Inc. Matrix metalloprotease-cleavable and serine protease-cleavable substrates and methods of use thereof
US11472875B1 (en) 2015-01-20 2022-10-18 Cytomx Therapeutics, Inc. Matrix metalloprotease-cleavable and serine protease-cleavable substrates and methods of use thereof
US11548943B2 (en) 2015-01-20 2023-01-10 Cytomx Therapeutics, Inc. Matrix metalloprotease-cleavable and serine protease-cleavable substrates and methods of use thereof
US10336824B2 (en) 2015-03-13 2019-07-02 Cytomx Therapeutics, Inc. Anti-PDL1 antibodies, activatable anti-PDL1 antibodies, and methods of thereof
US11174316B2 (en) 2015-03-13 2021-11-16 Cytomx Therapeutics, Inc. Anti-PDL1 antibodies, activatable anti-PDL1 antibodies, and methods of use thereof
US10669339B2 (en) 2015-03-13 2020-06-02 Cytomx Therapeutics, Inc. Anti-PDL1 antibodies, activatable anti-PDL1 antibodies, and methods of use thereof
US11753466B2 (en) 2015-05-04 2023-09-12 Cytomx Therapeutics, Inc. Anti-CD166 antibodies, activatable anti-CD166 antibodies, and methods of use thereof
US10745481B2 (en) 2015-05-04 2020-08-18 Cytomx Therapeutics, Inc. Anti-CD166 antibodies, activatable anti-CD166 antibodies, and methods of use thereof
US12084518B2 (en) 2015-05-21 2024-09-10 Harpoon Therapeutics, Inc. Trispecific binding proteins and methods of use
US10954311B2 (en) 2015-05-21 2021-03-23 Harpoon Therapeutics, Inc. Trispecific binding proteins and methods of use
US10513558B2 (en) 2015-07-13 2019-12-24 Cytomx Therapeutics, Inc. Anti-PD1 antibodies, activatable anti-PD1 antibodies, and methods of use thereof
US11466093B2 (en) 2015-07-27 2022-10-11 The General Hospital Corporation Antibody derivatives with conditionally enabled effector function
EP3128005A1 (en) 2015-08-07 2017-02-08 Alexo Therapeutics Inc. Sirp-alpha variant constructs and uses thereof
US10259859B2 (en) 2015-08-07 2019-04-16 ALX Oncology Inc. Constructs having a SIRP-α domain or variant thereof
US11254744B2 (en) 2015-08-07 2022-02-22 Imaginab, Inc. Antigen binding constructs to target molecules
US11208459B2 (en) 2015-08-07 2021-12-28 ALX Oncology Inc. Constructs having a SIRP-alpha domain or variant thereof
US10696730B2 (en) 2015-08-07 2020-06-30 ALX Oncology Inc. Constructs having a SIRP-alpha domain or variant thereof
EP3913050A1 (en) 2015-08-07 2021-11-24 ALX Oncology Inc. Sirp-alpha variant constructs and uses thereof
US11639376B2 (en) 2015-08-07 2023-05-02 ALX Oncology Inc. Constructs having a SIRP-α domain or variant thereof
US10508143B1 (en) 2015-10-30 2019-12-17 Aleta Biotherapeutics Inc. Compositions and methods for treatment of cancer
US10669349B2 (en) 2015-10-30 2020-06-02 Aleta Biotherapeutics Inc. Compositions and methods for treatment of cancer
WO2017075537A1 (en) 2015-10-30 2017-05-04 Aleta Biotherapeutics Inc. Compositions and methods for treatment of cancer
US11807691B2 (en) 2015-10-30 2023-11-07 Aleta Biotherapeutics Inc. Compositions and methods for treatment of cancer
US11059904B2 (en) 2015-10-30 2021-07-13 Aleta Biotherapeutics Inc. Compositions and methods for tumor transduction
US10035856B2 (en) 2015-11-19 2018-07-31 Revitope Limited Functional antibody fragment complementation for a two-components system for redirected killing of unwanted cells
US11453716B2 (en) 2016-05-20 2022-09-27 Harpoon Therapeutics, Inc. Single domain serum albumin binding protein
US11623958B2 (en) 2016-05-20 2023-04-11 Harpoon Therapeutics, Inc. Single chain variable fragment CD3 binding proteins
US12441799B2 (en) 2016-11-03 2025-10-14 Bristol-Myers Squibb Company Activatable anti-CTLA-4 antibodies and uses thereof
US11117968B2 (en) 2016-11-03 2021-09-14 Bristol-Myers Squibb Company Activatable anti-CTLA-4 antibodies and uses thereof
US10844134B2 (en) 2016-11-23 2020-11-24 Harpoon Therapeutics, Inc. PSMA targeting trispecific proteins and methods of use
US11266745B2 (en) 2017-02-08 2022-03-08 Imaginab, Inc. Extension sequences for diabodies
US11535668B2 (en) 2017-02-28 2022-12-27 Harpoon Therapeutics, Inc. Inducible monovalent antigen binding protein
US11607453B2 (en) 2017-05-12 2023-03-21 Harpoon Therapeutics, Inc. Mesothelin binding proteins
US11168144B2 (en) 2017-06-01 2021-11-09 Cytomx Therapeutics, Inc. Activatable anti-PDL1 antibodies, and methods of use thereof
US12378319B2 (en) 2017-08-21 2025-08-05 Adagene Inc. Anti-CD137 molecules and use thereof
US11859003B2 (en) 2017-08-21 2024-01-02 Adagene Inc. Method for treating cancer using anti-CD137 antibody
US10927180B2 (en) 2017-10-13 2021-02-23 Harpoon Therapeutics, Inc. B cell maturation antigen binding proteins
US12371504B2 (en) 2017-10-13 2025-07-29 Harpoon Therapeutics, Inc. Trispecific proteins and methods of use
US11136403B2 (en) 2017-10-13 2021-10-05 Harpoon Therapeutics, Inc. Trispecific proteins and methods of use
US11976125B2 (en) 2017-10-13 2024-05-07 Harpoon Therapeutics, Inc. B cell maturation antigen binding proteins
US11472889B2 (en) 2017-10-14 2022-10-18 Cytomx Therapeutics, Inc. Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof
US12460017B2 (en) 2017-10-14 2025-11-04 Cytomx Therapeutics, Inc. Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof
US11859010B2 (en) 2017-10-14 2024-01-02 Cytomx Therapeutics, Inc. Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof
US12030955B2 (en) 2017-11-28 2024-07-09 Chugai Seiyaku Kabushiki Kaisha Polypeptide including antigen-binding domain and carrying section
US11359016B2 (en) * 2018-02-02 2022-06-14 Adagene Inc. Anti-CTLA4 antibodies and methods of making and using the same
US11952681B2 (en) 2018-02-02 2024-04-09 Adagene Inc. Masked activatable CD137 antibodies
US12415860B2 (en) 2018-05-14 2025-09-16 Harpoon Therapeutics, Inc. Binding moiety for conditional activation of immunoglobulin molecules
US12077577B2 (en) 2018-05-30 2024-09-03 Chugai Seiyaku Kabushiki Kaisha Polypeptide comprising aggrecan binding domain and carrying moiety
US20210155701A1 (en) * 2018-05-30 2021-05-27 Chugai Seiyaku Kabushiki Kaisha Polypeptide comprising il-1r1 binding domain and carrying moiety
US12498367B2 (en) 2018-07-20 2025-12-16 Cytomx Therapeutics, Inc. Methods of qualitatively and/or quantitatively analyzing properties of activatable antibodies and uses thereof
US12195544B2 (en) 2018-09-21 2025-01-14 Harpoon Therapeutics, Inc. EGFR binding proteins and methods of use
US11807692B2 (en) 2018-09-25 2023-11-07 Harpoon Therapeutics, Inc. DLL3 binding proteins and methods of use
WO2020086665A1 (en) * 2018-10-26 2020-04-30 Immunogen, Inc. Epcam antibodies, activatable antibodies, and immunoconjugates, and uses thereof
TWI897855B (zh) * 2018-10-26 2025-09-21 美商免疫遺傳股份有限公司 E p C A M 抗體、可活化抗體及免疫偶聯物以及其用途
CN113194985A (zh) * 2018-10-26 2021-07-30 伊缪诺金公司 EpCAM抗体、可活化抗体和免疫缀合物及其用途
US12049505B2 (en) 2018-12-06 2024-07-30 Cytomx Therapeutics, Inc. Matrix metalloprotease-cleavable and serine or cysteine protease-cleavable substrates and methods of use thereof
US20220073613A1 (en) * 2018-12-26 2022-03-10 Xilio Development, Inc. Activatable masked anti-ctla4 binding proteins
US12435142B2 (en) 2018-12-26 2025-10-07 Xilio Development, Inc. Anti-CTLA4 antibodies and methods of use thereof
US12384845B2 (en) * 2018-12-26 2025-08-12 Xilio Development, Inc. Activatable masked anti-CTLA4 binding proteins
US12162958B2 (en) 2019-04-15 2024-12-10 Nammi Therapeutics, Inc. Fusion protein composition(s) comprising masked type i interferons (IFNA and IFNB) for use in the treatment of cancer and methods thereof
US11136353B2 (en) 2019-04-15 2021-10-05 Qwixel Therapeutics Llc Fusion protein composition(s) comprising masked type I interferons (IFNA and IFNB) for use in the treatment of cancer and methods thereof
US11795198B2 (en) 2019-04-15 2023-10-24 Qwixel Therapeutics Llc Fusion protein composition(s) comprising masked type I interferons (IFNA and IFNB) for use in the treatment of cancer and methods thereof
US11613564B2 (en) 2019-05-31 2023-03-28 ALX Oncology Inc. Methods of treating cancer
US12064507B2 (en) 2019-11-19 2024-08-20 Provectus Pharmatech, Inc. Composition and method for oral treatment of leukemia
US11180563B2 (en) 2020-02-21 2021-11-23 Harpoon Therapeutics, Inc. FLT3 binding proteins and methods of use
US12428470B2 (en) 2020-04-09 2025-09-30 Cytomx Therapeutics, Inc. Compositions containing activatable antibodies
US12091442B2 (en) 2020-04-10 2024-09-17 Cytomx Therapeutics, Inc. Activatable cytokine constructs and related compositions and methods
US11365233B2 (en) 2020-04-10 2022-06-21 Cytomx Therapeutics, Inc. Activatable cytokine constructs and related compositions and methods
US20220089642A1 (en) * 2020-09-17 2022-03-24 City Of Hope Fc Receptor-ACE2 Conjugates and Use Thereof
US11667687B2 (en) 2021-03-16 2023-06-06 Cytomx Therapeutics, Inc. Masked activatable interferon constructs
WO2022220841A1 (en) * 2021-04-16 2022-10-20 Provectus Pharmatech, Inc. Composition and method for oral treatment of leukemia
US12098214B2 (en) 2021-05-13 2024-09-24 ALX Oncology Inc. Combination therapies for treating cancer
WO2023104190A1 (en) * 2021-12-09 2023-06-15 Vibrant Pharma Limited Antibody masks and uses thereof
WO2023161853A1 (en) 2022-02-23 2023-08-31 Bright Peak Therapeutics Ag Activatable il-18 polypeptides
WO2024150175A1 (en) 2023-01-11 2024-07-18 Bright Peak Therapeutics Ag Conditionally activated proteins and methods of use
WO2024150174A1 (en) 2023-01-11 2024-07-18 Bright Peak Therapeutics Ag Conditionally activated immunocytokines and methods of use
WO2025041101A1 (en) 2023-08-23 2025-02-27 Bright Peak Therapeutics Ag Activatable il-18 immunocytokines and uses thereof

Also Published As

Publication number Publication date
AU2020203143B2 (en) 2023-03-16
AU2010203353B2 (en) 2016-06-16
JP5851842B2 (ja) 2016-02-03
EP2385955A4 (en) 2013-02-13
US20240228603A1 (en) 2024-07-11
AU2010203353A2 (en) 2011-08-11
RU2011133819A (ru) 2013-02-20
AU2010203353A1 (en) 2011-08-11
AU2018214147A1 (en) 2018-08-30
US20120149061A1 (en) 2012-06-14
EP2385955B1 (en) 2020-08-12
US8563269B2 (en) 2013-10-22
EP3543256A1 (en) 2019-09-25
US10118961B2 (en) 2018-11-06
US8513390B2 (en) 2013-08-20
JP2021004250A (ja) 2021-01-14
US20120207756A1 (en) 2012-08-16
US20140024810A1 (en) 2014-01-23
BRPI1006141B1 (pt) 2020-08-04
WO2010081173A2 (en) 2010-07-15
AU2016225810B2 (en) 2018-05-24
EP2385955A2 (en) 2011-11-16
RU2636046C2 (ru) 2017-11-17
AU2016225810C1 (en) 2018-09-20
RU2017136814A (ru) 2019-02-08
US20170081397A1 (en) 2017-03-23
AU2020203143A1 (en) 2020-06-04
CN102482347B (zh) 2017-04-26
JP2015193654A (ja) 2015-11-05
US20210284721A1 (en) 2021-09-16
JP2019077731A (ja) 2019-05-23
JP7221259B2 (ja) 2023-02-13
JP6571730B2 (ja) 2019-09-04
JP6271476B2 (ja) 2018-01-31
US20160228546A1 (en) 2016-08-11
WO2010081173A3 (en) 2010-11-04
US20130309230A1 (en) 2013-11-21
AU2016225810A1 (en) 2016-09-22
BRPI1006141B8 (pt) 2021-05-25
JP2017200955A (ja) 2017-11-09
CN106995495A (zh) 2017-08-01
CN102482347A (zh) 2012-05-30
CA2749339A1 (en) 2010-07-15
US20190119370A1 (en) 2019-04-25
US10875913B2 (en) 2020-12-29
JP6860601B2 (ja) 2021-04-14
US10059762B2 (en) 2018-08-28
BRPI1006141A2 (pt) 2016-02-23
US9453078B2 (en) 2016-09-27
RU2017136814A3 (enExample) 2021-10-21
AU2018214147B2 (en) 2020-06-04
JP2012514982A (ja) 2012-07-05

Similar Documents

Publication Publication Date Title
US20240228603A1 (en) Modified antibody compositions, methods of making and using thereof
US12209120B2 (en) Activatable anti-VEGF scFv
RU2799787C2 (ru) Композиции модифицированных антител, способы их получения и применения
HK40014876A (en) Modified antibody compositions, methods of making and using thereof
HK1164341B (en) Modified antibody compositions, methods of making and using thereof

Legal Events

Date Code Title Description
AS Assignment

Owner name: CYTOMX THERAPEUTICS, LLC, CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:STAGLIANO, NANCY E.;WEST, JAMES W.;KAMATH, KATHRYN;AND OTHERS;REEL/FRAME:024309/0644

Effective date: 20100204

AS Assignment

Owner name: CYTOMX THERAPEUTICS, INC., CALIFORNIA

Free format text: CHANGE OF NAME;ASSIGNOR:CYTOMX THERAPEUTICS, LLC;REEL/FRAME:026720/0791

Effective date: 20100922

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION

AS Assignment

Owner name: CYTOMX THERAPEUTICS, INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:CYTOMX THERAPEUTICS, LLC;REEL/FRAME:030380/0457

Effective date: 20130418