DE69721833T2 - Verwendung von sibutramine analogen zur senkung des fettspiegels - Google Patents
Verwendung von sibutramine analogen zur senkung des fettspiegelsInfo
- Publication number
- DE69721833T2 DE69721833T2 DE69721833T DE69721833T DE69721833T2 DE 69721833 T2 DE69721833 T2 DE 69721833T2 DE 69721833 T DE69721833 T DE 69721833T DE 69721833 T DE69721833 T DE 69721833T DE 69721833 T2 DE69721833 T2 DE 69721833T2
- Authority
- DE
- Germany
- Prior art keywords
- compound
- formula
- sibutramine
- enantiomers
- pharmaceutically acceptable
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Lifetime
Links
- UNAANXDKBXWMLN-UHFFFAOYSA-N sibutramine Chemical class C=1C=C(Cl)C=CC=1C1(C(N(C)C)CC(C)C)CCC1 UNAANXDKBXWMLN-UHFFFAOYSA-N 0.000 title description 15
- 150000001875 compounds Chemical class 0.000 claims abstract description 54
- 150000003839 salts Chemical class 0.000 claims abstract description 17
- 150000002632 lipids Chemical class 0.000 claims abstract description 14
- 208000031226 Hyperlipidaemia Diseases 0.000 claims abstract description 8
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims abstract description 6
- 208000035150 Hypercholesterolemia Diseases 0.000 claims abstract description 5
- 208000006575 hypertriglyceridemia Diseases 0.000 claims abstract description 5
- UWAOJIWUVCMBAZ-UHFFFAOYSA-N [1-[1-(4-chlorophenyl)cyclobutyl]-3-methylbutyl]-dimethylazanium;chloride Chemical compound Cl.C=1C=C(Cl)C=CC=1C1(C(N(C)C)CC(C)C)CCC1 UWAOJIWUVCMBAZ-UHFFFAOYSA-N 0.000 claims abstract description 3
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 claims description 11
- 208000029078 coronary artery disease Diseases 0.000 claims description 9
- 238000011282 treatment Methods 0.000 claims description 9
- 238000004519 manufacturing process Methods 0.000 claims description 8
- 239000003814 drug Substances 0.000 claims description 7
- 201000001320 Atherosclerosis Diseases 0.000 claims description 5
- 238000011321 prophylaxis Methods 0.000 claims description 4
- 241000282412 Homo Species 0.000 claims description 3
- -1 N,N-dimethyl-1-[1-(4-chlorophenyl)cyclobutyl]-3-methylbutylbutylamine hydroride monohydrate Chemical class 0.000 claims description 2
- 108010023302 HDL Cholesterol Proteins 0.000 claims 1
- 108010028554 LDL Cholesterol Proteins 0.000 claims 1
- 229940126601 medicinal product Drugs 0.000 claims 1
- 238000008214 LDL Cholesterol Methods 0.000 abstract description 6
- 150000004682 monohydrates Chemical class 0.000 abstract description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 38
- 108010010234 HDL Lipoproteins Proteins 0.000 description 14
- 102000015779 HDL Lipoproteins Human genes 0.000 description 14
- 239000000203 mixture Substances 0.000 description 14
- KFNNPQDSPLWLCX-UHFFFAOYSA-N 1-[1-(4-chlorophenyl)cyclobutyl]-n,n,3-trimethylbutan-1-amine;hydron;chloride;hydrate Chemical compound O.Cl.C=1C=C(Cl)C=CC=1C1(C(N(C)C)CC(C)C)CCC1 KFNNPQDSPLWLCX-UHFFFAOYSA-N 0.000 description 13
- 235000012000 cholesterol Nutrition 0.000 description 13
- 229940068196 placebo Drugs 0.000 description 12
- 239000000902 placebo Substances 0.000 description 12
- 229960005303 sibutramine hydrochloride monohydrate Drugs 0.000 description 12
- UFTFJSFQGQCHQW-UHFFFAOYSA-N triformin Chemical compound O=COCC(OC=O)COC=O UFTFJSFQGQCHQW-UHFFFAOYSA-N 0.000 description 10
- 108010007622 LDL Lipoproteins Proteins 0.000 description 9
- 102000007330 LDL Lipoproteins Human genes 0.000 description 9
- 238000000034 method Methods 0.000 description 7
- 229960004425 sibutramine Drugs 0.000 description 7
- 239000003826 tablet Substances 0.000 description 6
- 239000002552 dosage form Substances 0.000 description 5
- 238000010197 meta-analysis Methods 0.000 description 5
- 239000002775 capsule Substances 0.000 description 4
- 239000008187 granular material Substances 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 239000000546 pharmaceutical excipient Substances 0.000 description 4
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 206010048214 Xanthoma Diseases 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 210000000214 mouth Anatomy 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 230000004580 weight loss Effects 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 2
- 108010046315 IDL Lipoproteins Proteins 0.000 description 2
- 208000008589 Obesity Diseases 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric Acid Chemical class [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 2
- 108010062497 VLDL Lipoproteins Proteins 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 239000000443 aerosol Substances 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 239000007900 aqueous suspension Substances 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000002425 crystallisation Methods 0.000 description 2
- 230000008025 crystallization Effects 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 239000007884 disintegrant Substances 0.000 description 2
- 239000002702 enteric coating Substances 0.000 description 2
- 238000009505 enteric coating Methods 0.000 description 2
- 150000003840 hydrochlorides Chemical class 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 238000004811 liquid chromatography Methods 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 235000020824 obesity Nutrition 0.000 description 2
- 235000019271 petrolatum Nutrition 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 239000012730 sustained-release form Substances 0.000 description 2
- 239000012049 topical pharmaceutical composition Substances 0.000 description 2
- WQSACWZKKZPCHN-UHFFFAOYSA-N 1-[1-(4-chlorophenyl)cyclobutyl]-3-methylbutan-1-amine Chemical compound C=1C=C(Cl)C=CC=1C1(C(N)CC(C)C)CCC1 WQSACWZKKZPCHN-UHFFFAOYSA-N 0.000 description 1
- PLXKZKLXYHLWHR-UHFFFAOYSA-N 1-[1-(4-chlorophenyl)cyclobutyl]-n,3-dimethylbutan-1-amine Chemical compound C=1C=C(Cl)C=CC=1C1(C(CC(C)C)NC)CCC1 PLXKZKLXYHLWHR-UHFFFAOYSA-N 0.000 description 1
- QCQCHGYLTSGIGX-GHXANHINSA-N 4-[[(3ar,5ar,5br,7ar,9s,11ar,11br,13as)-5a,5b,8,8,11a-pentamethyl-3a-[(5-methylpyridine-3-carbonyl)amino]-2-oxo-1-propan-2-yl-4,5,6,7,7a,9,10,11,11b,12,13,13a-dodecahydro-3h-cyclopenta[a]chrysen-9-yl]oxy]-2,2-dimethyl-4-oxobutanoic acid Chemical compound N([C@@]12CC[C@@]3(C)[C@]4(C)CC[C@H]5C(C)(C)[C@@H](OC(=O)CC(C)(C)C(O)=O)CC[C@]5(C)[C@H]4CC[C@@H]3C1=C(C(C2)=O)C(C)C)C(=O)C1=CN=CC(C)=C1 QCQCHGYLTSGIGX-GHXANHINSA-N 0.000 description 1
- 206010002383 Angina Pectoris Diseases 0.000 description 1
- 235000003911 Arachis Nutrition 0.000 description 1
- 244000105624 Arachis hypogaea Species 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 229920000623 Cellulose acetate phthalate Polymers 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 208000020401 Depressive disease Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 208000002705 Glucose Intolerance Diseases 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical class Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 206010033645 Pancreatitis Diseases 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- 208000018262 Peripheral vascular disease Diseases 0.000 description 1
- 239000004264 Petrolatum Substances 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 240000006394 Sorghum bicolor Species 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 239000012042 active reagent Substances 0.000 description 1
- 235000001014 amino acid Nutrition 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 230000000489 anti-atherogenic effect Effects 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 238000011914 asymmetric synthesis Methods 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- 235000013871 bee wax Nutrition 0.000 description 1
- 239000012166 beeswax Substances 0.000 description 1
- 150000001558 benzoic acid derivatives Chemical class 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 230000003925 brain function Effects 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-N carbonic acid Chemical class OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 239000003054 catalyst Substances 0.000 description 1
- 229940081734 cellulose acetate phthalate Drugs 0.000 description 1
- 150000005829 chemical entities Chemical class 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 150000001860 citric acid derivatives Chemical class 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 125000001995 cyclobutyl group Chemical group [H]C1([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- POULHZVOKOAJMA-UHFFFAOYSA-N dodecanoic acid Chemical class CCCCCCCCCCCC(O)=O POULHZVOKOAJMA-UHFFFAOYSA-N 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000012458 free base Substances 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-L fumarate(2-) Chemical class [O-]C(=O)\C=C\C([O-])=O VZCYOOQTPOCHFL-OWOJBTEDSA-L 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 238000001030 gas--liquid chromatography Methods 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 208000016361 genetic disease Diseases 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- DKAGJZJALZXOOV-UHFFFAOYSA-N hydrate;hydrochloride Chemical compound O.Cl DKAGJZJALZXOOV-UHFFFAOYSA-N 0.000 description 1
- 150000004677 hydrates Chemical class 0.000 description 1
- 229920003132 hydroxypropyl methylcellulose phthalate Polymers 0.000 description 1
- 229940031704 hydroxypropyl methylcellulose phthalate Drugs 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 108010022197 lipoprotein cholesterol Proteins 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 150000002688 maleic acid derivatives Chemical class 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-M methanesulfonate group Chemical class CS(=O)(=O)[O-] AFVFQIVMOAPDHO-UHFFFAOYSA-M 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 210000003928 nasal cavity Anatomy 0.000 description 1
- 150000002823 nitrates Chemical class 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 239000012053 oil suspension Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 239000003883 ointment base Substances 0.000 description 1
- 239000006186 oral dosage form Substances 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 235000019809 paraffin wax Nutrition 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 229940066842 petrolatum Drugs 0.000 description 1
- 239000002831 pharmacologic agent Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 201000009104 prediabetes syndrome Diseases 0.000 description 1
- 230000000207 pro-atherogenic effect Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 238000000611 regression analysis Methods 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000012453 solvate Substances 0.000 description 1
- 239000008174 sterile solution Substances 0.000 description 1
- 208000023516 stroke disease Diseases 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 150000003890 succinate salts Chemical class 0.000 description 1
- 150000003467 sulfuric acid derivatives Chemical class 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 229920003002 synthetic resin Polymers 0.000 description 1
- 239000000057 synthetic resin Substances 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 150000003892 tartrate salts Chemical class 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 235000020852 very low calorie diet Nutrition 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
- A61K31/135—Amines having aromatic rings, e.g. ketamine, nortriptyline
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
Landscapes
- Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Diabetes (AREA)
- General Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Epidemiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Cardiology (AREA)
- Vascular Medicine (AREA)
- Emergency Medicine (AREA)
- Endocrinology (AREA)
- Urology & Nephrology (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Materials For Medical Uses (AREA)
- Fats And Perfumes (AREA)
- Analogue/Digital Conversion (AREA)
- Oscillators With Electromechanical Resonators (AREA)
- Magnetic Resonance Imaging Apparatus (AREA)
- Heterocyclic Carbon Compounds Containing A Hetero Ring Having Nitrogen And Oxygen As The Only Ring Hetero Atoms (AREA)
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB9619961.7A GB9619961D0 (en) | 1996-09-25 | 1996-09-25 | Medical treatment |
| PCT/EP1997/005040 WO1998013034A1 (en) | 1996-09-25 | 1997-09-15 | Use of sibutramine analogues to lower lipid levels |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| DE69721833D1 DE69721833D1 (de) | 2003-06-12 |
| DE69721833T2 true DE69721833T2 (de) | 2003-12-24 |
Family
ID=10800447
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DE69721833T Expired - Lifetime DE69721833T2 (de) | 1996-09-25 | 1997-09-15 | Verwendung von sibutramine analogen zur senkung des fettspiegels |
Country Status (26)
| Country | Link |
|---|---|
| US (1) | US6187820B1 (enExample) |
| EP (1) | EP0973511B1 (enExample) |
| JP (1) | JP4143126B2 (enExample) |
| KR (1) | KR100573333B1 (enExample) |
| CN (1) | CN1173696C (enExample) |
| AT (1) | ATE239459T1 (enExample) |
| AU (1) | AU724645B2 (enExample) |
| BG (1) | BG64472B1 (enExample) |
| BR (1) | BR9711411A (enExample) |
| CA (1) | CA2266378C (enExample) |
| CZ (1) | CZ291879B6 (enExample) |
| DE (1) | DE69721833T2 (enExample) |
| DK (1) | DK0973511T3 (enExample) |
| ES (1) | ES2199354T3 (enExample) |
| GB (1) | GB9619961D0 (enExample) |
| HU (1) | HU224711B1 (enExample) |
| IL (1) | IL128820A (enExample) |
| NO (1) | NO991424L (enExample) |
| NZ (1) | NZ334550A (enExample) |
| PL (1) | PL190017B1 (enExample) |
| PT (1) | PT973511E (enExample) |
| RU (1) | RU2197959C2 (enExample) |
| SK (1) | SK284282B6 (enExample) |
| TR (1) | TR199900648T2 (enExample) |
| UA (1) | UA63916C2 (enExample) |
| WO (1) | WO1998013034A1 (enExample) |
Families Citing this family (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6974838B2 (en) | 1998-08-24 | 2005-12-13 | Sepracor Inc. | Methods of treating or preventing pain using sibutramine metabolites |
| US6331571B1 (en) * | 1998-08-24 | 2001-12-18 | Sepracor, Inc. | Methods of treating and preventing attention deficit disorders |
| AU2007200334B8 (en) * | 1998-08-24 | 2010-10-21 | Sepracor, Inc. | Methods of using and compositions comprising dopamine reuptake inhibitors |
| US6339106B1 (en) | 1999-08-11 | 2002-01-15 | Sepracor, Inc. | Methods and compositions for the treatment and prevention of sexual dysfunction |
| US6476078B2 (en) | 1999-08-11 | 2002-11-05 | Sepracor, Inc. | Methods of using sibutramine metabolites in combination with a phosphodiesterase inhibitor to treat sexual dysfunction |
| US6046242A (en) * | 1998-11-27 | 2000-04-04 | Basf Aktiengesellschaft | Use of aryl-substituted cyclobutylalkylamines for treating urinary incontinence |
| US6323242B1 (en) | 1998-12-02 | 2001-11-27 | Peter Sterling Mueller | Treatment of disorders secondary to organic impairments |
| US6696495B2 (en) | 1998-12-02 | 2004-02-24 | Snowden Pharmaceuticals, Llc | Treatment of disorders secondary to organic impairments |
| US6552087B1 (en) | 1999-03-19 | 2003-04-22 | Abbott Gmbh & Co. Kg | Therapeutic agent comprising (+)-sibutramine |
| AU3894500A (en) * | 1999-03-19 | 2000-10-09 | Knoll Pharmaceutical Company | Prevention of cardiovascular disease |
| US6399826B1 (en) | 1999-08-11 | 2002-06-04 | Sepracor Inc. | Salts of sibutramine metabolites, methods of making sibutramine metabolites and intermediates useful in the same, and methods of treating pain |
| FR2814678B1 (fr) * | 2000-10-04 | 2002-12-20 | Aventis Pharma Sa | Association d'un antagoniste du recepteur cb1 et de sibutramine, les compositions pharmaceutiques les contenant et leur utilisation pour la traitement de l'obesite |
| US6610887B2 (en) | 2001-04-13 | 2003-08-26 | Sepracor Inc. | Methods of preparing didesmethylsibutramine and other sibutramine derivatives |
| HRP20050307A2 (en) * | 2002-10-05 | 2006-12-31 | Hanmi Pharm. Co. Ltd. | Pharmaceutical composition comprising crystalline sibutramine methanesulfonate hemihydrate |
| EP1622600A1 (en) * | 2003-04-28 | 2006-02-08 | Cipla Ltd. | Pharmaceutical formulation comprising anti-obesity agent and acidulant |
| US20050032908A1 (en) * | 2003-08-04 | 2005-02-10 | Beckman Kristen M. | Methods for treating metabolic syndrome |
| US20050131074A1 (en) * | 2003-08-04 | 2005-06-16 | Beckman Kristen M. | Methods for treating metabolic syndrome |
| KR100618176B1 (ko) | 2004-12-02 | 2006-09-01 | 휴먼팜 주식회사 | 시부트라민 주석산염, 이의 제조 방법 및 이를 포함하는약학적 조성물 |
| JP2008526836A (ja) * | 2005-01-06 | 2008-07-24 | シージェー チェイルジェダン コーポレーション | シブトラミンの無機酸塩 |
| KR20060080818A (ko) | 2005-01-06 | 2006-07-11 | 씨제이 주식회사 | 시부트라민의 술폰산염 |
| KR20060080817A (ko) | 2005-01-06 | 2006-07-11 | 씨제이 주식회사 | 시부트라민의 디카복실산염 |
| KR20060093564A (ko) * | 2005-02-22 | 2006-08-25 | 종근당바이오 주식회사 | 무수 시부트라민 말산염 및 이의 제조 방법 |
| KR100627687B1 (ko) * | 2005-04-20 | 2006-09-25 | 주식회사 씨티씨바이오 | 시부트라민 유리염기 함유 조성물 및 이의 제조방법 |
| KR100814384B1 (ko) * | 2006-02-10 | 2008-03-18 | 대화제약 주식회사 | 시부트라민 염을 함유하는 약학 조성물 및 이의 제조방법 |
| WO2008034142A2 (en) | 2006-09-15 | 2008-03-20 | Reviva Pharmaceuticals, Inc. | Synthesis, methods of using, and compositions of cycloalkylmethylamines |
| BRPI0716002A2 (pt) * | 2006-11-22 | 2013-07-30 | Sk Chemicals Co Ltd | complexo de inclusço, processo de preparaÇço de um complexo de inclusço e composiÇço de tratamento e prevenÇço de hipocondria e obesidade |
| WO2010082216A2 (en) * | 2008-12-08 | 2010-07-22 | Matrix Laboratories Ltd | Novel salts of sibutramine and their crystal forms |
| WO2012003501A2 (en) | 2010-07-02 | 2012-01-05 | Reviva Pharmaceuticals, Inc. | Compositions, synthesis, and methods of using cycloalkylmethylamine derivatives |
| US9238625B2 (en) | 2011-12-30 | 2016-01-19 | Reviva Pharmaceuticals, Inc. | Compositions, synthesis, and methods of using phenylcycloalkylmethylamine derivatives |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IE52768B1 (en) | 1981-04-06 | 1988-02-17 | Boots Co Ltd | 1-arylcyclobutylalkylamine compounds useful as therapeutic agents |
| GB8531071D0 (en) * | 1985-12-17 | 1986-01-29 | Boots Co Plc | Therapeutic compound |
| GB8704777D0 (en) * | 1987-02-28 | 1987-04-01 | Boots Co Plc | Medical treatment |
| JP2675573B2 (ja) * | 1988-03-31 | 1997-11-12 | 科研製薬株式会社 | 脳機能改善剤 |
| IE61928B1 (en) * | 1988-11-29 | 1994-11-30 | Boots Co Plc | Treatment of obesity |
| US5459164A (en) * | 1994-02-03 | 1995-10-17 | Boots Pharmaceuticals, Inc. | Medical treatment |
-
1996
- 1996-09-25 GB GBGB9619961.7A patent/GB9619961D0/en active Pending
-
1997
- 1997-09-15 KR KR1019997002490A patent/KR100573333B1/ko not_active Expired - Fee Related
- 1997-09-15 EP EP97910289A patent/EP0973511B1/en not_active Expired - Lifetime
- 1997-09-15 HU HU9903823A patent/HU224711B1/hu active IP Right Grant
- 1997-09-15 US US09/269,340 patent/US6187820B1/en not_active Expired - Lifetime
- 1997-09-15 AU AU47741/97A patent/AU724645B2/en not_active Ceased
- 1997-09-15 UA UA99042290A patent/UA63916C2/uk unknown
- 1997-09-15 CA CA002266378A patent/CA2266378C/en not_active Expired - Fee Related
- 1997-09-15 DE DE69721833T patent/DE69721833T2/de not_active Expired - Lifetime
- 1997-09-15 CZ CZ1999932A patent/CZ291879B6/cs not_active IP Right Cessation
- 1997-09-15 PL PL97332367A patent/PL190017B1/pl not_active IP Right Cessation
- 1997-09-15 JP JP51521998A patent/JP4143126B2/ja not_active Expired - Fee Related
- 1997-09-15 PT PT97910289T patent/PT973511E/pt unknown
- 1997-09-15 IL IL12882097A patent/IL128820A/en not_active IP Right Cessation
- 1997-09-15 BR BR9711411A patent/BR9711411A/pt not_active IP Right Cessation
- 1997-09-15 SK SK320-99A patent/SK284282B6/sk unknown
- 1997-09-15 TR TR1999/00648T patent/TR199900648T2/xx unknown
- 1997-09-15 CN CNB971982341A patent/CN1173696C/zh not_active Expired - Fee Related
- 1997-09-15 RU RU99108731/14A patent/RU2197959C2/ru active
- 1997-09-15 WO PCT/EP1997/005040 patent/WO1998013034A1/en not_active Ceased
- 1997-09-15 DK DK97910289T patent/DK0973511T3/da active
- 1997-09-15 NZ NZ334550A patent/NZ334550A/xx not_active IP Right Cessation
- 1997-09-15 AT AT97910289T patent/ATE239459T1/de not_active IP Right Cessation
- 1997-09-15 ES ES97910289T patent/ES2199354T3/es not_active Expired - Lifetime
-
1999
- 1999-03-15 BG BG103249A patent/BG64472B1/bg unknown
- 1999-03-24 NO NO991424A patent/NO991424L/no not_active Application Discontinuation
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DE69721833T2 (de) | Verwendung von sibutramine analogen zur senkung des fettspiegels | |
| DE69522716T2 (de) | Verbesserung der glukosetoleranz | |
| DE69316660T2 (de) | Terfanadin Metaboliten und deren optisch reine Isomere zur Behandlung von allergischen Krankheiten | |
| US6174925B1 (en) | Use of sibutramine analogues to prevent the development of diabetes | |
| DE69838179T2 (de) | Chronische bolusgabe von d-threo methylphenidat | |
| DE69721838T2 (de) | 1-[1-(4-chlorphenyl)cyclobutyl]-3-methylbutyl amin derivate zur senkung von harnsäurespiegeln beim menschen | |
| DE69824313T2 (de) | Sibutramin und orlistat enthaltende pharmazeutische zusammensetzungen | |
| DE69324025T2 (de) | Transdermale Behandlung der Nesselsucht mit OPTISCH REINEM (+)-CETIRIZIN | |
| DE69908421T2 (de) | Pharmazeutische zusammensetzung enthaltend eine kombination der dextro- und laevo-isomeren von sotalol | |
| DE60019914T2 (de) | Verwendung von Sibutramin oder dessem Derivat zur Behandlung von Schlafstörungen | |
| EP0035597B1 (de) | Pharmazeutische Zubereitungen | |
| DE69023045T2 (de) | Carboxamidderivate. | |
| DE69004529T2 (de) | Verwendung von Sertralin zur Behandlung von Abhängigkeiten von chemischen Stoffen. | |
| EP0669826B1 (de) | (-)-metrifonat enthaltendes arzneimittel | |
| DE60109799T2 (de) | Verwendung von quetiapin für aufmerksamkeitsmangel-hyperaktivitätsstörungen oder verhaltensstörungen | |
| DE69516602T2 (de) | Verwendung von Bifemelan zur Herstellung eines Arzneimittels zur Behandlung der Hyperkinesie | |
| CH669524A5 (enExample) | ||
| MXPA99002633A (en) | Use of sibutramine analogues to lower lipid levels | |
| DE3631254A1 (de) | Pharmazeutische zubereitung | |
| DE2227844A1 (de) | Antidepressive verbindungen und verfahren zu deren herstellung |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 8364 | No opposition during term of opposition |