Classifications

• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K38/00—Medicinal preparations containing peptides
  • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
  • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
  • A61K38/22—Hormones
  • A61K38/26—Glucagons
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K31/00—Medicinal preparations containing organic active ingredients
  • A61K31/185—Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
  • A61K31/19—Carboxylic acids, e.g. valproic acid
  • A61K31/20—Carboxylic acids, e.g. valproic acid having a carboxyl group bound to a chain of seven or more carbon atoms, e.g. stearic, palmitic, arachidic acids
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
  • A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
  • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K9/00—Medicinal preparations characterised by special physical form
  • A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
  • A61K9/16—Agglomerates; Granulates; Microbeadlets ; Microspheres; Pellets; Solid products obtained by spray drying, spray freeze drying, spray congealing,(multiple) emulsion solvent evaporation or extraction
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K9/00—Medicinal preparations characterised by special physical form
  • A61K9/20—Pills, tablets, discs, rods
  • A61K9/2004—Excipients; Inactive ingredients
  • A61K9/2013—Organic compounds, e.g. phospholipids, fats
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
  • A61K9/00—Medicinal preparations characterised by special physical form
  • A61K9/20—Pills, tablets, discs, rods
  • A61K9/2072—Pills, tablets, discs, rods characterised by shape, structure or size; Tablets with holes, special break lines or identification marks; Partially coated tablets; Disintegrating flat shaped forms
  • A61K9/2077—Tablets comprising drug-containing microparticles in a substantial amount of supporting matrix; Multiparticulate tablets
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P3/00—Drugs for disorders of the metabolism
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P3/00—Drugs for disorders of the metabolism
  • A61P3/04—Anorexiants; Antiobesity agents
• • A—HUMAN NECESSITIES
  • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
  • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
  • A61P3/00—Drugs for disorders of the metabolism
  • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
  • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics

Definitions

• the present invention is directed to compositions comprising pharmacologically active agents, such as GLP-1 , and a delivery agent as well as processes for their preparation and use thereof in medicine.
• the delivery agent SNAC has previously been shown to improve the bioavailability of orally administered peptides.
• the present invention relates to further improvements of the bioavailability by oral administration of compositions of such peptides, in particular of GLP-1 peptides.
• the invention relates to a pharmaceutical composition
• a pharmaceutical composition comprising a first type and a second type of granules, wherein said first type of granules comprises a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and no GLP-1 peptide, and wherein said second type of granules comprises a GLP-1 peptide and no salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid.
• the term "granule” refers to small particles gathered into a large mass.
• the invention relates to a process of producing a pharmaceutical composition comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the process comprises the steps: a) mixing a GLP-1 peptide with a filler and/or a binder; b) dry granulation of the mixture of step a; c) mixing the granules obtained in step b with a composition comprising a salt of N-(8-(2-hydroxybenzoyl)amino) caprylic acid; and d) optionally adding further lubricant, wherein the mixture of step a does not comprise a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid.
• the invention relates to a process of producing a pharmaceutical composition comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the process comprises the steps: a) mixing a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid with a lubricant and/or a filler; b) dry granulation of the mixture of step a; c) mixing the granules obtained in step b with a composition comprising a GLP-1 peptide; and d) optionally adding further lubricant, wherein the mixture of step a does not comprise a GLP-1 peptide.
• the invention relates to a process of producing a pharmaceutical composition comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the process comprises the steps: a) mixing a GLP-1 peptide with a filler and/or a binder; b) dry granulation of the mixture of step a; c)mixing a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid, optionally a lubricant and/or a filler; d) dry granulation of the mixture of step c; e) mixing the granules obtained in step b with the granules obtained in step d; and f) optionally adding further lubricant, wherein the mixture of step a does not comprise a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and wherein the mixture of step c does not comprise
• the invention relates to a granule comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid, a lubricant, optionally a filler, and no GLP-1 peptide.
• the invention relates to a process of producing a granule comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid, wherein the process comprises the steps: a) mixing a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid (such as SNAC) with a lubricant and/or a filler; and b) dry granulation of the mixture of step a, wherein the mixture of step a does not comprise a GLP-1 peptide.
• a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid such as SNAC
• the invention relates to a granule comprising a GLP-1 peptide, a filler, a binder, and no salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid.
• the invention relates to a process of producing a granule comprising a GLP-1 peptide, wherein the process comprises the steps: a) mixing a GLP-1 peptide, optionally a filler and/or a binder; and b) roller compacting the mixture of step a, wherein the mixture of step a does not comprise a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid.
• the invention relates to a pharmaceutical composition or a granule obtained by the process as defined herein.
• the invention relates to a composition or a granule as defined herein for use in medicine, such as for treatment of diabetes or obesity, wherein said composition is administered orally.
• the invention relates to a method for treatment of diabetes or obesity comprising administering the composition as defined herein to a patient in need thereof, wherein said composition is administered orally.
• the present inventors surprisingly found that the dissolution properties of tablets manufactured from the same composition (i.e. same type and the same amounts of excipients and delivery agent) was determined by the design of the granules from which the tablets were formed.
• the present inventors found that the dissolution behaviour surprisingly had a marked effect on the bioavailability of GLP-1 peptide from the composition, such as the tablet.
• the present inventors have shown that the bioavailability of solid tablets manufactured from various granule designs can be predicted from in vitro data, i.e.
• this invention provides compositions, granules and methods for their preparation with improved bioavailability of the GLP-1 peptide.
• bioavailability refers to the fraction of an administered dose of an active pharmaceutical ingredient (API) and/or active moieties, such as a GLP-1 peptide as defined herein, which reaches the systemic circulation un-changed or in another active form.
• API active pharmaceutical ingredient
• active moieties such as a GLP-1 peptide as defined herein
• bioavailability is 100%.
• other routes such as orally
• bioavailability decreases (due to incomplete absorption and/or first-pass metabolism).
• Knowledge about bioavailability is important when calculating dosages for non- intravenous routes of administration.
• Absolute oral bioavailability is calculated as the relative exposure of the API and/or active moieties in systemic circulation following oral administration (estimated as the area under the plasma concentration versus time curve) compared to the exposure of the API following intravenous administration.
• the invention relates to a pharmaceutical composition
• a pharmaceutical composition comprising a first type and a second type of granules, wherein said first type of granules comprises a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and said second type of granules comprises a GLP-1 peptide.
• the first type of granules further comprises a lubricant, such as magnesium stearate.
• the first type of granules further comprises a filler, such as microcrystalline cellulose. Accordingly, the first type of granules may further comprise a lubricant and optionally a filler.
• the second type of granules further comprises a filler, such as microcrystalline cellulose.
• the second type of granules further comprises a binder, such as povidone. Accordingly, the second type of granules may further comprise a filler and optionally a binder.
• the composition further comprises an
• N-(8-(2-hydroxybenzoyl)amino)caprylic acid is referred to as
• the first type of granules comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid does not contain a GLP-1 peptide.
• the second type of granules comprising a GLP-1 peptide does not contain a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid.
• the pharmaceutical composition comprises a first type and a second type of granules, wherein said first type of granules comprises a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and no GLP-1 peptide, and wherein said second type of granules comprises a GLP-1 peptide and no salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid.
• the term "granule” refers to particles gathered into larger particles.
• the invention relates to a pharmaceutical composition
• a pharmaceutical composition comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the release of said salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is
• the invention relates to a pharmaceutical composition
• a pharmaceutical composition comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the release of said salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid is simultaneous with or faster than the release of said GLP-1 peptide.
• the term "release" when used with reference to N-(8-(2- hydroxybenzoyl)amino)caprylic acid and optionally compared to release of GLP-1 peptide is determined within 30 minutes, such as within 25, 20, 15 minutes, or such as within 10 or 5 minutes, as determined by dissolution testing using Assay (I). Accordingly, the release may be determined within 30 minutes of dissolution testing using Assay (I).
• the release of said salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid when referred to as "faster than" the release of said GLP-1 peptide is determined within 30 minutes, such as within 25, 20, 15 minutes, or such as within 10 or 5 minutes, as determined by dissolution testing using Assay (I).
• the release of said salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid when referred to as "faster than" the release of said GLP-1 peptide is determined within 30 minutes, such as within 25, 20, 15 minutes, or such as within 10 or 5 minutes, as determined by dissolution testing using Assay (I) at pH 2.5.
• the release of said salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid when referred to as “simultaneous with” the release of said GLP-1 peptide is determined within 30 minutes, such as within 25, 20, 15 minutes, or such as within 10 or 5 minutes, as determined by dissolution testing using Assay (I). In some embodiments the release of said salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid when referred to as “simultaneous with” the release of said GLP-1 peptide is determined within 30 minutes, such as within 25, 20, 15 minutes, or such as within 10 or 5 minutes, as determined by dissolution testing using Assay (I) at pH 2.5.
• the invention relates to a pharmaceutical composition according to any one of the preceding claims, wherein the amount of dissolved salt of N-(8- (2-hydroxybenzoyl)amino)caprylic acid peaks within the first 60 minutesas determined by dissolution testing using Assay (I) at pH 2.5. In some embodiments the invention relates to a pharmaceutical composition, wherein the amount of dissolved salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid peaks within the first 30 minutes as determined by dissolution testing using Assay (I) at pH 2.5.
• the amount of dissolved salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid peaks within55 minutes, such as within 50, 45 or 40 minutes, as determined by dissolution testing using Assay (I) at pH 2.5. In some embodiments the amount of dissolved salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid peaks within 39 or 38 minutes, such as within 37, 36, or 35minut.es, as determined by dissolution testing using Assay (I) at pH 2.5.
• the amount of dissolved salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid peaks within 34 minutes, such as within 33, 32, or 31 minutes, as determined by dissolution testing using Assay (I) at pH 2.5. In some embodiments the amount of dissolved salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid peaks within 31 minutes, such as within 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 55, or 60 minutes as determined by dissolution testing using Assay (I) at pH 2.5.
• composition comprises granules which have been manufactured by dry granulation. In some embodiments the composition comprises granules which have been manufactured by roller compaction. In some embodiments the moldings from the roller compactions process are comminuted into granules.As used herein the term "composition" refers to a pharmaceutical composition.
• the composition is in the form of a solid dosage form. In some embodiments the composition is in the form of a tablet. In some embodiments the composition is in the form of a capsule. In some embodiments the composition is in the form of a sachet.
• the composition or granule comprises at least one pharmaceutically acceptable excipient.
• excipient as used herein broadly refers to any component other than the active therapeutic ingredient(s).
• the excipient may be an inert substance, which is inert in the sense that it substantially does not have any therapeutic and/or prophylactic effect per se.
• the excipient may serve various purposes, e.g.
• a delivery agent as a delivery agent, absorption enhancer, vehicle, filler (also known as diluents), binder, lubricant, glidant, disintegrant, crystallization retarders, acidifying agent, alkalizing agent, preservative, antioxidant, buffering agent, chelating agent, complexing agents, surfactant agent, emulsifying and/or solubilizing agents, sweetening agents, wetting agents stabilizing agent, colouring agent, flavouring agent, and/or to improve administration, and/or absorption of the active substance.
• a person skilled in the art may select one or more of the aforementioned excipients with respect to the particular desired properties of the solid oral dosage form by routine experimentation and without any undue burden.
• the amount of each excipient used may vary within ranges conventional in the art. Techniques and excipients which may be used to formulate oral dosage forms are described in Handbook of Pharmaceutical
• the composition or granule comprises a filler, such as lactose (e.g. spray-dried lactose, a-lactose, ⁇ -lactose, Tabletose®, various grades of Pharmatose®, Microtose® or Fast-FloC®), microcrystalline cellulose (various grades of Avicel®, Elcema®, Vivacel®, Ming Tai® or Solka-Floc®), other cellulose derivatives, sucrose, sorbitol, mannitol, dextrins, dextrans, maltodextrins, dextrose, fructose, kaolin, mannitol, sorbitol, sucrose, sugar, starches or modified starches (including potato starch, maize starch and rice starch), calcium phosphate (e.g. basic calcium phosphate, calcium hydrogen phosphate, dicalcium phosphate hydrate), calcium sulphate, calcium carbonate, or sodium alginate.
• the composition or granule comprises a binder, such as lactose (e.g. spray-dried lactose, a-lactose, ⁇ -lactose, Tabletose®, various grades of Pharmatose®, Microtose® or Fast-FloC®), microcrystalline cellulose (various grades of Avicel®, Elcema®, Vivacel®, Ming Tai® or Solka-Floc®), hydroxypropylcellulose, L- hydroxypropylcellulose (low-substituted), hypromellose (HPMC) (e.g.
• lactose e.g. spray-dried lactose, a-lactose, ⁇ -lactose, Tabletose®, various grades of Pharmatose®, Microtose® or Fast-FloC®
• microcrystalline cellulose variant grades of Avicel®, Elcema®, Vivacel®, Ming Tai® or Solka-Floc®
• Methocel E, F and K Metolose SH of Shin-Etsu, Ltd, such as, e.g., the 4,000 cps grades of Methocel E and Metolose 60 SH, the 4,000 cps grades of Methocel F and Metolose 65 SH, the 4,000, 15,000 and 100,000 cps grades of Methocel K; and the 4,000, 15,000, 39,000 and 100,000 grades of Metolose 90 SH), methylcellulose polymers (such as, e.g., Methocel A, Methocel A4C, Methocel A15C, Methocel A4M), hydroxyethylcellulose, ethylcellulose, sodium
• carboxymethylcellulose other cellulose derivatives, sucrose, dextrins, maltodextrins, starches or modified starches (including potato starch, maize starch and rice starch), calcium lactate, calcium carbonate, acacia, sodium alginate, agar, carrageenan, gelatin, guar gum, pectin, PEG, or povidone.
• the binder is povidone, such as povidone K 90.
• the composition or granule comprises a disintegrant, such as alginic acid, alginates, microcrystalline cellulose, hydroxypropyl cellulose, other cellulose derivatives, croscarmellose sodium, crospovidone, polacrillin potassium, sodium starch glycolate, starch, pregelatinized starch, or carboxymethyl starch (e.g. PrimogelO and
• the composition or granule comprises a lubricant, such as magnesium silicate, talc, or colloidal silica.
• a lubricant such as magnesium silicate, talc, or colloidal silica.
• the lubricant is magnesium stearate.
• composition or granule comprises one or more excipients selected from crystallization retarders, such as Povidone, etc.; solubilizing agents (also known as surfactants), such as anionic surfactants (e.g. Pluronic or Povidone), cationic surfactants, nonionic surfactants, and/or zwitterionic surfactants; colouring agents,
• dyes and pigments such as Iron Oxide Red or Yellow, titanium dioxide, and/or talc
• pH control agents such as citric acid, tartaric acid, fumaric acid, sodium citrate, dibasic calcium phosphate, and/or dibasic sodium phosphate.
• the composition comprises at least 60% (w/w) delivery agent, less than 10% (w/w) binder, 5-40% (w/w) filler, and less than 10% (w/w) lubricant.
• the composition comprises at least 60% (w/w), such as 65-75 % (w/w), 60-80 % (w/w), or 50-90 % (w/w), delivery agent. In some embodiments the composition comprises at least 70% (w/w), such as 70-80 % (w/w), delivery agent.
• the composition comprises 0.1 -10% (w/w), such as 0.2-4% (w/w) or 0.5-3% (w/w), binder. In some embodiments the composition comprises 1.5-2.5 %(w/w), such as 1.7-2.3 % (w/w), 1.8-2.2 % (w/w), or 1.9-2.1 % (w/w), binder.ln some embodiments the composition comprises 1 % (w/w) or 2% (w/w) binder. In some embodiments the composition comprises 5-40% (w/w), such as 10-30% (w/w) or 5-25% (w/w), filler.
• the composition comprises 10-25 % (w/w), such as 17-23 % (w/w), 18-22 % (w/w), or 19-21 % (w/w), filler.ln some embodiments the composition comprises 10.9% (w/w) or 18% (w/w) filler, or comprises 19.5% (w/w) or 20.5 (w/w) filler.
• the composition comprises 0.1 -10% (w/w) or 0.5-5% (w/w), such as 1 -3.5% (w/w) or 1 % (w/w), lubricant. In some embodiments the composition comprises 1.5-3 % (w/w), such as 2.1 -2.7 % (w/w), 2.2-2.6 % (w/w) or 2.3-2.5 % (w/w), lubricant.
• composition or granule of the invention may be formulated as is known in the art of oral formulations of insulinotropic compounds.
• composition or granule may be administered in several dosage forms, for example as a tablet; a capsule such as hard capsules, sachet or a powder.
• the composition or granule may further be compounded in a drug carrier or drug delivery system, e.g. in order to improve stability and/or solubility or further improve bioavailability.
• the weight of the tablet is in the range of 150 mg to 1000 mg, such as in the range of 300-600 mg or 350-450 mg.
• the invention relates to a first granule comprising at least 75 % (w/w) delivery agent, less than 10% (w/w) lubricant, and optionally less than 20 % filler and no GLP-1 peptide. In some embodiments the invention relates to a first granule comprising at least 80% (w/w) delivery agent, less than 10% (w/w) lubricant, and optionally less than 20 % filler and no GLP-1 peptide. In some embodiments the first granule comprises 75-90 % (w/w), such as 78-88 % (w/w), 80-86 % (w/w) or 82-84 % (w/w), delivery agent.
• the first granule comprises less than 10% (w/w), such as 1 -3 % (w/w), 1 .5-2.5 % (w/w) or 1.9-2.3 % (w/w), lubricant, In some embodiments the first granule comprises less than 20 %, such as 10-20 % (w/w), 12-18 % (w/w) or 14-17 % (w/w),filler. In some embodiments the first granule comprises no GLP-1 peptide. In some embodiments the granule comprises at least 80% (w/w) delivery agent, less than 10% (w/w) lubricant, and optionally less than 20% filler.
• the invention relates to a second granule comprising a GLP-1 peptide, at least 15 % (w/w) filler and less than 40% (w/w) binder and no salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid.
• the second granule comprises at least 1 %, such as 1 -70 % (w/w), 2-40% (w/w) or 4-30% (w/w),GLP-1 peptide.ln some embodiments the second granule comprises at least 20 %, such as 40-80% (w/w) or 50-75% (w/w),filler.
• the second granule comprises less than 30 %, such as 5- 30% (w/w), 10-28% (w/w) or 15-25% (w/w), binder. In some embodiments the second granule comprises no salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid. In some embodiments the granule comprises a GLP-1 peptide, at least 15 % (w/w) filler and less than 40% (w/w) binder.ln some embodiments the granule comprises a GLP-1 peptide, at least 50% (w/w) filler and less than 40% (w/w) binder.
• the invention relates to a composition
• a composition comprising a first and a second type of granules, wherein the first type of granule comprises at least 75 % (w/w) delivery agent, less than 10% (w/w) lubricant, optionally less than 20 % filler and no GLP-1 peptide, and wherein the second type of granule comprisesa GLP-1 peptide, at least 15 % (w/w) filler, less than 40% (w/w) binder and no salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid.
• the invention relates to a composition
• a composition comprising a first and a second type of granules, wherein the first type of granule comprises at least 75 % (w/w) delivery agent, less than 10% (w/w) lubricant, less than 20 % filler and no GLP-1 peptide, and wherein the second type of granule comprises a GLP-1 peptide, at least 15 % (w/w) filler, less than 40% (w/w) binder and no salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid.
• the invention relates to a composition
• a composition comprising a first and a second type of granules, wherein the first type of granule comprises at least 75 % (w/w) delivery agent, less than 10% (w/w) lubricant, and no GLP-1 peptide, and wherein the second type of granule comprises a GLP-1 peptide, at least 15 % (w/w) filler, less than 40% (w/w) binder and no salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid.
• composition of the invention may be prepared as is known in the art. In some embodiments the composition or the granule may be prepared as described in the examples herein. In some embodiments the composition may be granulated prior to being compressed into tablets. In some embodiments the granules of the invention are manufactured by dry granulation, such as by roller compactioncompaction. In some embodiments the moldings from the roller compactions process are comminuted into granules.
• the composition may comprise one or more intragranular parts and an extragranular part, wherein the
• a first intragranular part may comprise the GLP-1 peptide and one or more excipients, and a second intragranular part may comprise the delivery agent and optionally one or more excipients.
• a first intragranular part may comprise the GLP-1 peptide, filler and/or a binder and a second intragranular part may comprise the delivery agent, lubricant and filler.
• the first intragranular part may comprise the GLP-1 peptide, filler and/or binder and a second intragranular part may comprise the delivery agent, lubricant and/or filler.
• the firstintragranular part comprises the GLP-1 agonist (i.e.
• the GLP-1 peptide), microcrystalline cellulose and/or povidone and the secondintragranular part comprises the delivery agent, magnesium stearate and microcrystalline cellulose.
• the firstintragranular part comprises the GLP-1 agonist (i.e. the GLP-1 peptide), microcrystalline cellulose and/or povidone and the secondintragranular part comprises the delivery agent, magnesium stearate and/or microcrystalline cellulose.
• the extragranular part may comprise a lubricant.
• the extragranular part comprises magnesium stearate.
• lubricant and filler refers to a lubricant andoptionally a filler.
• the various components are weighed, optionally delumped and then combined.
• the mixing of the components may be carried out until a homogeneous blend is obtained.
• granules may be produced in a manner known to a person skilled in the art, for example by dry granulation techniques in which the pharmaceutically active agent and/or delivery agents are compacted with the excipients to form relatively large moldings, for example slugs or ribbons, which are comminuted by grinding, and the ground material serves as the tabletting material to be later compressed into tablets.
• Suitable equipment for dry granulation includes but is not limited to roller compaction equipment from Gerteis, such as Gerteis MINI-PACTOR.
• a tablet press may be used to compress the tabletting material into a solid oral dosage form, for example a tablet.
• a tabletting press the tabletting material is filled (e.g. force fed or gravity fed) into a die cavity.
• the tabletting material is then compressed by a punch with pressure. Subsequently, the resulting compact, or tablet is ejected from the tabletting press.
• compression process is subsequently referred to herein as the "compression process”.
• Suitable tablet presses include, but are not limited to, rotary tablet presses and eccentric tablet presses.
• tablet presses include, but are not limited to, the Fette 102i (Fette GmbH), the Korsch XL100, the Korsch PH 106 rotary tablet press (Korsch AG, Germany), the Korsch EK-0 eccentric tabletting press (Korsch AG, Germany) and the Manesty F-Press (Manesty Machines Ltd., United Kingdom).
• the method of preparation of the tablet comprises i) dry granulation of a mixture comprising the GLP-1 agonist (i.e. the GLP-1 peptide), filler and a binder; ii) dry granulation of a mixture comprising the delivery agent, lubricant and filler; iii) mixing of the granules with a lubricant; and then iv) compression of the blend into tablets.
• the method of preparation of the tablet comprises i) dry granulation of a mixture comprising the GLP-1 agonist (i.e.
• the GLP-1 peptide filler and a binder; ii) dry granulation of a mixture comprising the delivery agent, lubricant and/or filler; iii) mixing of the granules with a lubricant; and then iv) compression of the blend into tablets.
• composition comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide
• the process comprises the steps: a) mixing a GLP-1 peptide with a filler and/or a binder; b) dry granulation of the mixture of step a; c) mixing the granules obtained in step b with a composition comprising a salt of N-(8-(2-hydroxybenzoyl)amino) caprylic acid; and d) optionally adding further lubricant.
• the invention relates to a process of producing a pharmaceutical composition comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the process comprises the steps: a) mixing a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid with a lubricant and/or a filler; b) dry granulation of the mixture of step a; c) mixing the granules obtained in step b with a composition comprising a GLP-1 peptide; and d) optionally adding further lubricant.
• the invention relates to a process of producing a
• composition comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide
• the process comprises the steps: a) mixing a GLP-1 peptide with a filler and/or a binder; b) dry granulation of the mixture of step a; c) mixing a salt of N- (8-(2-hydroxybenzoyl)amino)caprylic acid, optionally a lubricant and/or a filler; d) dry granulation of the mixture of step c; e) mixing the granules obtained in step b with the granules obtained in step d; and f)optionally adding further lubricant.
• the invention relates to a process of producing a pharmaceutical composition comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the process comprises the steps: a) mixing a GLP-1 peptide with a filler and/or a binder; b) dry granulation of the mixture of step a; c) mixing a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid, optionally a lubricant and/or a filler; d) dry granulation of the mixture of step c; e) mixing the granules obtained in step b with the granules obtained in step d; and f) optionally adding further lubricant, wherein the mixture of step a does not comprise a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and wherein the mixture of step c does not comprise a
• the invention relates to a granule comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid, a lubricant, optionally a filler, and no GLP-1 peptide.
• the invention relates to a process of producing a granule comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid, wherein the process comprises the steps: a) mixing a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid (such as SNAC) with a lubricant and/or a filler; and b) dry granulation of the mixture of step a, wherein the mixture of step a does not comprise a GLP-1 peptide.
• a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid such as SNAC
• the invention relates to a granule comprising a GLP-1 peptide, a filler, a binder, and no salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid.
• the invention relates to a process of producing a granule comprising a GLP-1 peptide, wherein the process comprises the steps: a) mixing a GLP-1 peptide, optionally a filler and/or a binder; and b) roller compacting the mixture of step a, wherein the mixture of step a does not comprise a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid.
• the mixing step comprising mixing of a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid with a lubricant and/or a filler prior to dry granulation has a duration of at least 20 minutes. In some embodiments the mixing step comprising mixing of a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid with a lubricant and/or a filler prior to dry granulation has a duration of at least 30 minutes or at least 40 minutes, such as 50 minutes.
• the mixing step comprising mixing of the first type of granules comprising a GLP-1 peptide with the second type of granules comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid has a duration of at least 15 minutes or at least 20 minutes, such as at least 25 minutes or at least 30 minutes.
• the invention relates to a pharmaceutical composition obtained by the process as defined herein.
• the invention relates to a granule comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid and a lubricant.
• the granule comprises a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid, a lubricant, and a filler.
• the invention relates to a granule comprising a GLP-1 peptide, a filler and a binder.
• the granule is prepared according to the process as defined herein.
• the invention relates to a process of producing a granule comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid, wherein the process comprises the steps: a) mixing a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid (such as SNAC) with a lubricant and/or a filler; and b) dry granulation of the mixture of step a.
• the mixing step comprising mixing of a salt of N-(8-(2-hydroxybenzoyl)amino) caprylic acid with a lubricant and/or a filler prior to dry granulation has a duration of at least 20 minutes.
• the mixing step comprising mixing of a salt of N-(8-(2- hydroxybenzoyl)amino) caprylic acid with a lubricant and/or a filler prior to dry granulation has a duration of at least 30 minutes or at least 40 minutes, such as 50 minutes.
• the invention relates to a process of producing a granule comprising a GLP-1 peptide, wherein the process comprises the steps: a) mixing a GLP-1 peptide, optionally a filler and/or a binder; and b) roller compacting the mixture of step a.
• the invention relates to a granule obtained by the process as defined herein.
• the lubricant is magnesium stearate.
• the filler is microcrystalline cellulose.
• the binder is povidone.
• resistance to crushing of tablets has the meaning defined in section 2.9.8 in the European Pharmacopoeia 7.5, 7th edition 2012; resistance to crushing may be measured inter alia in Newton (N) or kilopond (kP) using a jaw speed of 20 N/s (1 kP equals 9.807 N).
• roller compaction force means the force between the rolls of the roller compactor when compacting materials into a continuous strip of compressed material as determined by a pressure transducer that converts the hydraulic pressure into electrical signal; the roller compaction force may be measured in kiloNewton (kN) or in kiloNewton per roll width (kN/cm).
• kN kiloNewton
• kN/cm kiloNewton per roll width
• Dissolution of compositions of the invention may be determined as described in Assay (I) herein.
• the dissolution testing using Assay (I) is carried out at any one of pH 1.0-8.0.
• the dissolution testing using Assay (I) is carried out at pH 1.0.
• the dissolution testing using Assay (I) is carried out at pH 2.5.
• the dissolution testing using Assay (I) is carried out at pH 6.8.
• the composition of the invention comprises a GLP-1 peptide.
• GLP-1 peptide refers to a compound, which fully or partially activates the human GLP-1 receptor.
• the "GLP-1 peptide” binds to a GLP-1 receptor, e.g., with an affinity constant (K D ) or activate the receptor with a potency (EC 50 ) of below 1 ⁇ , e.g. below 100 nM as measured by methods known in the art (see e.g. WO 98/08871 ) and exhibits insulinotropic activity, where insulinotropic activity may be measured in vivo or in vitro assays known to those of ordinary skill in the art.
• K D affinity constant
• EC 50 potency
• the GLP-1 peptide may be administered to an animal with increased blood glucose (e.g. obtained using an Intravenous Glucose Tolerance Test (IVGTT), a person skilled in the art will be able to determine a suitable glucose dosage and a suitable blood sampling regime, e.g. depending on the species of the animal, for the IVGTT) and the plasma insulin concentration measured over time.
• IVGTT Intravenous Glucose Tolerance Test
• the GLP-1 peptide is referred to as a GLP-1 agonist.
• the GLP-1 peptide is a GLP-1 analogue, optionally comprising one substituent.
• analogue as used herein referring to a GLP-1 peptide (hereafter “peptide") means a peptide wherein at least one amino acid residue of the peptide has been substituted with another amino acid residue and/or wherein at least one amino acid residue has been deleted from the peptide and/or wherein at least one amino acid residue has been added to the peptide and/or wherein at least one amino acid residue of the peptide has been modified. Such addition or deletion of amino acid residues may take place at the N- terminal of the peptide and/or at the C-terminal of the peptide.
• GLP-1 peptide designates an analogue of GLP-1 (7-37) wherein the naturally occurring Ala in position 8 has been substituted with Aib.
• the GLP-1 peptide comprises a maximum of twelve, such as a maximum of 10, 8 or 6, amino acids which have been alterered, e.g., by substitution, deletion, insertion and/or modification, compared to e.g. GLP-1 (7-37).
• the analogue comprises up to 10 substitutions, deletions, additions and/or insertions, such as up to 9 substitutions, deletions, additions and/or insertions, up to 8 substitutions, deletions, additions and/or insertions, up to 7 substitutions, deletions, additions and/or insertions, up to 6 substitutions, deletions, additions and/or insertions, up to 5 substitutions, deletions, additions and/or insertions, up to 4 substitutions, deletions, additions and/or insertions or up to 3 substitutions, deletions, additions and/or insertions, compared to e.g. GLP-1 (7-37). Unless otherwise stated the GLP-1 comprises only L-amino acids.
• GLP-1 analogue or “analogue of GLP-1" as used herein refers to a peptide, or a compound, which is a variant of the human Glucagon-Like Peptide-1 (GLP-1 (7-37)).
• GLP-1 (7-37) has the sequence HAEGTFTSDV
• variant refers to a compound which comprises one or more amino acid substitutions, deletions, additions and/or insertions.
• the GLP-1 peptide exhibits at least 60%, 65%, 70%, 80% or 90% sequence identity to GLP-1 (7-37) over the entire length of GLP-1 (7-37).
• sequence identity As an example of a method for determination of sequence identity between two analogues the two peptides [Aib8]GLP-1 (7-37) and GLP-1 (7-37) are aligned.
• the sequence identity of [Aib8]GLP-1 (7-37) relative to GLP-1 (7-37) is given by the number of aligned identical residues minus the number of different residues divided by the total number of residues in GLP-1 (7-37).
• sequence identity is (31 -1 )/31 .
• the C-terminal of the GLP-1 peptide is an amide.
• the GLP-1 peptide is GLP-1 (7-37) or GLP-1 (7-36)amide. In some embodiments the GLP-1 peptide is exendin-4, the sequence of which is
• HGEGTFITSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID No: 2).
• the GLP-1 peptide comprises one substituent which is covalently attached to the peptide.
• the substituent comprises a fatty acid or a fatty diacid.
• the substituent comprises a C16, C18 or C20 fatty acid.
• the substituent comprises a C16, C18 or C20 fatty diacid.
• the substituent comprises formula (X)
• n is at least 13, such as n is 13, 14, 15, 16, 17, 18 or 19.
• the substituent comprises formula (X), wherein n is in the range of 13 to 19, such as in the range of 13 to 17. In some embodiments the substituent comprises formula (X), wherein n is 13, 15 or 17. In some embodiments the substituent comprises formula (X), wherein n is 13. In some embodiments the substituent comprises formula (X), wherein n is 15. In some embodiments the substituent comprises formula (X), wherein n is 17. In some embodiments the substituent comprises one or more 8-amino-3,6-dioxaoctanoic acid (OEG), such as two OEG.
• OEG 8-amino-3,6-dioxaoctanoic acid
• the substituent is [2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-(17- carboxyheptadecanoylamino) butyrylamino]ethoxy ⁇ ethoxy)acetylamino]
• the substituent is [2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-( ⁇ trans-4- [(19-carboxynonadecanoylamino)methyl]cyclohexanecarbonyl ⁇
• the GLP-1 peptide is semaglutide, also known as N- epsilon26-[2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-(17-carboxyheptadecanoylamino)
• composition comprises the GLP-1 peptide or a pharmaceutically acceptable salt, amide, or ester thereof. In some embodiments the composition comprises the GLP-1 peptide one or more pharmaceutically acceptable counter ions.
• the dosage of GLP-1 peptide is in the range of 0.01 mg to
• composition or granule comprises an amount of a GLP-1 peptide in the range of at least 1 mg, such as at least 5 mg or at least 10 mg. In some embodiments the composition or granule comprises 10 mg GLP-1 peptide.
• the composition comprises an amount of a GLP-1 peptide in the range of 0.05 to 25 ⁇ , such as in the range of 0.5 to 20 ⁇ .
• the GLP-1 peptide is selected from one or more of the GLP-1 peptides mentioned in W093/19175, W096/29342, WO98/08871 , WO99/43707,
• the GLP-1 peptide is selected from the group consisting of N- epsilon37 ⁇ 2-[2-(2- ⁇ 2-[2-((R)-3-carboxy-3- ⁇ [1 -(19-carboxynonadecanoyl) piperidine-4- carbonyl]amino ⁇ propionylamino)ethoxy]ethoxy ⁇ acetylamino)ethoxy]ethoxy ⁇ acetyl
• N-epsilon26 [2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-( ⁇ 4-[(19-carboxy- nonadecanoylamino)methyl]cyclohexanecarbonyl ⁇ amino)butyrylamino] ethoxy ⁇ ethoxy) acetylamino]ethoxy ⁇ ethoxy)acetyl[Aib8, Lys 26]GLP-1 (7-37)amide; N-epsilon26 [2-(2-[2-(2-(2-(S)-2-[trans-4-((9-carboxynonadecanoylamino] methyl) cyclohexylcarbonylamino]-4
• propionyl [DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1 (7-37)-amide; N-epsilon37- ⁇ 2-(2- (2-(2-[2-(2-(4-(hexadecanoylamino)-4-carboxybutyryl-amino)ethoxy) ethoxy]
• the GLP-1 peptide is N-epsilon26- ⁇ 2-[2-(2- ⁇ 2-[2-(2- ⁇ (S)-4-carboxy-4-[10-(4- carboxyphenoxy) decanoylamino]butyrylamino ⁇ ethoxy)ethoxy] acetylamino ⁇ ethoxy) ethoxy]acetyl ⁇ , N-epsilon37- ⁇ 2-[2-(2- ⁇ 2-[2-(2- ⁇ (S)-4-carboxy-4-[10-(4-carboxy-phenoxy) decanoylamino] butyrylamino ⁇ ethoxy)ethoxy]acetylamino ⁇ ethoxy) ethoxy]acetyl ⁇ - [Aib8,Arg34,Lys37]GLP
• the GLP-1 peptide is N-epsilon26-[2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4- carboxy-4-(17-carboxyheptadecanoylamino) butyrylamino]ethoxy ⁇ ethoxy)acetylamino] ethoxy ⁇ ethoxy)acetyl][Aib8,Ai"g34]GLP-1 (7-37), also known as semaglutide.
• GLP-1 peptides can be produced by appropriate derivatisation of an appropriate peptide backbone which has been produced by recombinant DNA technology or by peptide synthesis (e.g., Merrifield-type solid phase synthesis) as known in the art of peptide synthesis and peptide chemistry.
• GLP-1 moiety of the GLP-1 peptide of the invention may for instance be produced by classical peptide synthesis, e.g., solid phase peptide synthesis using t-Boc or Fmoc chemistry or other well established techniques, see, e.g., Greene and Wuts, "Protective Groups in Organic Synthesis", John Wiley & Sons, 1999, Florencio Zaragoza Dorwald, Organic Synthesis on solid Phase", Wiley-VCH Verlag GmbH, 2000, and "Fmoc Solid Phase Peptide Synthesis", Edited by W.C. Chan and P.D. White, Oxford University Press, 2000.
• GLP-1 peptides may be produced by recombinant methods, viz. by culturing a host cell containing a DNA sequence encoding the GLP-1 peptide and capable of expressing the peptide in a suitable nutrient medium under conditions permitting the expression of the peptide.
• host cells suitable for expression of these peptides are: Escherichia coli, Saccharomyces cerevisiae, as well as mammalian BHK or CHO cell lines.
• GLP-1 peptides of the invention which include non-natural amino acids and/or a covalently attached N-terminal mono- or dipeptide mimetic may e.g. be produced as described in the experimental part.
• the delivery agent used in the present invention is a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid.
• the delivery agent is an absorption enhancer.
• the structural formula of N-(8-(2-hydroxybenzoyl)amino)caprylate is shown in formula (I).
• the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is in the caprylic acid form and/or the capraylate form. In some embodiments the salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid comprises one monovalent cation, two monovalent cations or one divalent cation. In some embodiments the salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid is selected from the group consisting of the sodium salt, potassium salt and calcium salt of of N-(8-(2-hydroxybenzoyl)amino)caprylic acid.
• Salts of N-(8-(2-hydroxybenzoyl)amino)caprylate may be prepared using the method described in e.g. WO96/030036, WO00/046182, WO01/092206 or WO2008/028859.
• the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid may be crystalline and/or amorphous.
• the delivery agent comprises the anhydrate
• the delivery agent is a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid as described in WO2007/121318.
• the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid may be any polymorph thereof.
• the delivery agent is sodium N-(8-(2- hydroxybenzoyl)amino)caprylate (referred to as "SNAC" herein), also known as sodium 8- (salicyloylamino) octanoate.
• SNAC sodium N-(8-(2- hydroxybenzoyl)amino)caprylate
• the amount of the salt of N-(8-(2-hydroxybenzoyl) amino)caprylic acid in the composition is in the range of 0.6-3.5mmol.ln some embodiments the amount of the salt of N-(8-(2-hydroxybenzoyl) amino)caprylic acid in the composition is at least 0.6 mmol, such as selected from the group at least 0.8 mmol or at least 0.9 mmol. In some embodiments the amount of the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid in the composition is up to 2.5mmol. In some embodiments the amount of the salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid in the composition is 0.6-2.0mmol. In some embodiments the amount of the salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid in the composition is 0.6-2.0mmol. In some embodiments the amount of the salt of N-(8-(2-hydroxybenzoyl)
• the amount of the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is 1 mmol, such as 1.08 mmol.
• the amount of SNAC in the composition is at least 150 mg or at least 250 mg. In some embodiments the amount of SNAC in the composition is up to 800 mg, such as up to 700 mg or up to 600 mg. In some embodiments the amount of
• SNAC in the composition is 300 mg.
• the molar ratio between GLP-1 agonist (i.e. GLP-1 peptide) and delivery agent in the composition is less than 10, such as less than 5 or less than 1. In some embodiments the molar ratio between GLP-1 agonist(i.e. GLP-1 peptide) and delivery agent in the composition is less than 1/10, such as less than 1/100 or less than 5/1000.
• the present invention also relates to a composition or a granule of the invention for use as a medicament.
• the composition or the granule is administered orally.
• composition or a granule of the invention may be used for the following medical treatments, all preferably relating one way or the other to diabetes:
• diabetes prevention and/or treatment of all forms of diabetes, such as hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes, non-insulin dependent diabetes,
• diabetes delaying or preventing diabetic disease progression, such as progression in type 2 diabetes, delaying the progression of impaired glucose tolerance (IGT) to insulin requiring type 2 diabetes, and/or delaying the progression of non-insulin requiring type 2 diabetes to insulin requiring type 2 diabetes;
• ITT impaired glucose tolerance
• prevention and/or treatment of cognitive disorders prevention and/or treatment of cognitive disorders;
• prevention and/or treatment of eating disorders such as obesity, e.g. by decreasing food intake, reducing body weight, suppressing appetite, inducing satiety; treating or preventing binge eating disorder, bulimia nervosa, and/or obesity induced by
• diabetes prevention and/or treatment of diabetic complications, such as neuropathy, including peripheral neuropathy; nephropathy; or retinopathy;
• lowering triglycerides lowering cholesterol; increasing HDL; lowering plasma levels of lipoprotein a (Lp(a)) in a human; inhibiting generation of apolipoprotein a (apo(a)) in vitro and/or in vivo;
• cardiovascular diseases such as syndrome X; atherosclerosis; myocardial infarction; coronary heart disease; stroke, cerebral ischemia; an early cardiac or early cardiovascular disease, such as left ventricular hypertrophy; coronary artery disease; essential hypertension; acute hypertensive emergency; cardiomyopathy; heart insufficiency; exercise tolerance; chronic heart failure; arrhythmia; cardiac dysrhythmia; syncopy; atheroschlerosis; mild chronic heart failure; angina pectoris; cardiac bypass reocclusion; intermittent claudication (atheroschlerosisoblitterens); diastolic dysfunction; and/or systolic dysfunction;
• cardiovascular diseases such as syndrome X; atherosclerosis; myocardial infarction; coronary heart disease; stroke, cerebral ischemia; an early cardiac or early cardiovascular disease, such as left ventricular hypertrophy; coronary artery disease; essential hypertension; acute hypertensive emergency; cardiomyopathy; heart insufficiency; exercise tolerance; chronic heart failure; arrhythmi
• (x) prevention and/or treatment of critical illness such as treatment of a critically ill patient, a critical illness poly-nephropathy (CIPNP) patient, and/or a potential CIPNP patient; prevention of critical illness or development of CIPNP; prevention, treatment and/or cure of systemic inflammatory response syndrome (SIRS) in a patient; and/or for the prevention or reduction of the likelihood of a patient suffering from bacteraemia, septicaemia, and/or septic shock during hospitalisation; and/or (xi) prevention and/or treatment of polycystic ovary syndrome (PCOS).
• CIPNP critical illness poly-nephropathy
• SIRS systemic inflammatory response syndrome
• the indication is selected from the group consisting of (i)-(iii) and (v)-(iix), such as indications (i), (ii), and/or (iii); or indication (v), indication (vi), indication (vii), and/or indication (iix).
• the indication is (i). In a further particular embodiment the indication is (v). In a still further particular embodiment the indication is (iix).
• the invention relates to a composition or a granule of the invention for treatment of diabetes or obesity, wherein said granule is administered orally.
• the invention relates to a method for treatment of diabetes or obesity comprising oral administration of a composition comprising a composition or a granule of the invention to a patient in need thereof.
• Type 2 diabetes and/or obesity.
• a pharmaceutical composition comprising a first type and a second type of granules, wherein said first type of granules comprises a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid, and wherein said second type of granules comprises a GLP-1 peptide.
• composition according to any one of the preceding embodiments, wherein said first type of granules does not comprise GLP-1 peptide.
• a lubricant such as magnesium stearate.
• a binder such as povidone.
• the granules are manufactured by dry granulation, such as by roller compaction.
• a pharmaceutical composition comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the release of said salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is simultaneous with or faster than the release of said GLP-1 peptide as determined by dissolution testing using Assay (I).
• a pharmaceutical composition according to any one of the preceding embodiments, wherein the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is SNAC.
• composition according to any one of the preceding embodiments, wherein the GLP-1 peptide comprises an albumin binding moiety.
• GLP-1 peptide is N-epsilon26-[2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-(17- carboxyheptadecanoylamino)
• composition according to any one of the preceding embodiments, wherein said composition further comprises one or more pharmaceutically acceptable excipients.
• composition according to any one of the preceding embodiments, wherein said composition is in the form of a tablet.
• composition according to any one of the preceding embodiments, wherein said composition is in the form of a capsule.
• composition according to any one of the preceding embodiments, wherein said composition is in the form of a sachet.
• a process of producing a pharmaceutical composition comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the process comprises the steps:
• step b dry granulation of the mixture of step a;
• step b mixing the granules obtained in step b with a composition comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid;
• a process of producing a pharmaceutical composition comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the process comprises the steps:
• step b dry granulation of the mixture of step a;
• step b mixing the granules obtained in step b with a composition comprising a GLP-1 peptide;
• a process of producing a pharmaceutical composition comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the process comprises the steps:
• step b dry granulation of the mixture of step a;
• step c dry granulation of the mixture of step c;
• a process according to any one of embodiments 30-38, wherein said mixing step comprising mixing of a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid with a lubricant and/or a filler prior to dry granulation has a duration of at least 20 minutes, such asat least 30 minutes or at least 40 minutes, such as 50 minutes.
• a process according to any one of embodiments 30-39, wherein said mixing comprising mixing of the first type of granules comprising a GLP-1 peptide with the second type of granules comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid has a duration of at least 15 minutes or at least 20 minutes, such as 25 minutes or at least 30 minutes.
• a method for treatment of diabetes or obesity comprising administration of a composition comprising the pharmaceutical composition as defined in any one of embodiments 1 -29 or 41 to a patient in need thereof.
• a granule comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid, a lubricant, and a filler.
• a granule comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and a lubricant.
• a granule comprising a GLP-1 peptide, a filler and a binder.
• a process of producing a granule comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid comprises the steps: a) mixing a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid (such as SNAC) with a lubricant and/or a filler; and
• step b dry granulation of the mixture of step a.
• a process according to any one of embodiments 54-56, wherein said mixing step comprising mixing of a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid with a lubricant and/or a filler prior to dry granulation has a duration of at least 20 minutes, such asat least 30 minutes or at least 40 minutes, such as 50 minutes.
• a process of producing a granule comprising a GLP-1 peptide comprising the steps:
• step b roller compacting the mixture of step a.
• 64. A method for increasing oral bioavailability of a GLP-1 peptide comprising administration to a patient in need thereof of a composition as defined in any of embodiments 1-29 or 41.
• a pharmaceutical composition according to any one of the preceding embodiments wherein said simultaneous or faster release is determined within 30 minutes, such as within 25, 20, 15 or 10 minutes, as determined by dissolution testing using Assay (I).
• a pharmaceutical composition comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the release of said salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is simultaneous with or faster than the release of said GLP-1 peptide as determined by dissolution testing using Assay (I).
• a pharmaceutical composition according to any one of the preceding embodiments wherein the amount of dissolved salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid peaks within the first 30 minutes as determined by dissolution testing using Assay (I) at pH 2.5.
• the amount of dissolved salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid peaks within 31 minutes, such as within 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 55, or 60 minutes as determined by dissolution testing using Assay (I) at pH 2.5.
• composition according to any one of the preceding embodiments, wherein the GLP-1 peptide comprises an albumin binding moiety.
• GLP-1 peptide is N-epsilon26-[2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-(17- carboxyheptadecanoylamino)
• a pharmaceutical composition comprising a first type and a second type of granules, wherein said first type of granules comprises a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and said second type of granules comprises a GLP-1 peptide.
• a pharmaceutical composition according to embodiment 1 1 wherein said first type of granules further comprises a lubricant, such as magnesium stearate. 13. A pharmaceutical composition according to embodiment 1 1 or 12, wherein said first type of granules further comprises a filler, such as microcrystalline cellulose.
• composition according to any one of the preceding embodiments, wherein said composition further comprises one or more pharmaceutically acceptable excipients.
• composition according to any one of the preceding embodiments, wherein said composition is in the form of a solid dosage form.
• composition according to any one of the preceding embodiments, wherein said composition is in the form of a tablet.
• composition according to any one of the preceding embodiments, wherein said composition is in the form of a sachet.
• a process of producing a pharmaceutical composition comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the process comprises the steps:
• step b dry granulation of the mixture of step a;
• step b mixing the granules obtained in step b with a composition comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid;
• a process of producing a pharmaceutical composition comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the process comprises the steps:
• a process of producing a pharmaceutical composition comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid and a GLP-1 peptide, wherein the process comprises the steps:
• step b dry granulation of the mixture of step a;
• step c dry granulation of the mixture of step c;
• a process according to any one of embodiments 23-31 wherein said mixing step comprising mixing of a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid with a lubricant and/or a filler prior to dry granulation has a duration of at least 30 minutes or at least 40 minutes, such as 50 minutes.
• a process according to any one of embodiments 23-32, wherein said mixing comprising mixing of the first type of granules comprising a GLP-1 peptide with the second type of granules comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid has a duration of at least 15 minutes or at least 20 minutes, such as 25 minutes.
• a pharmaceutical composition as defined in any one of embodiments 1 -22 or 34 for use in medicine is not limited to any one of embodiments 1 -22 or 34 for use in medicine.
• a method for treatment of diabetes or obesity comprising administration of a composition comprising the pharmaceutical composition as defined in any one of embodiments 1 -22 or 34 to a patient in need thereof.
• a granule comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid, a lubricant, and a filler.
• a granule comprising a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid and a lubricant.
• a granule comprising a GLP-1 peptide, a filler and a binder.
• a process of producing a granule comprising a salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid comprising the steps:
• step b dry granulation of the mixture of step a.
• a process of producing a granule comprising a GLP-1 peptide comprising the steps:
• step b roller compacting the mixture of step a.
• a method for treatment of diabetes or obesity comprising oral administration of a pharmaceutical composition comprising the granule as defined in any one of embodiments 40-46 or 56 to a patient in need thereof.
• Dry granulation was carried out by roller compaction on a Gerteis MINI-PACTOR
• Roller compaction force i.e. the force between the rolls of the roller compactor when compacting materials into a continuous strip of compressed material, was determined by a pressure transducer that converts the hydraulic pressure into electrical signal; the roller compaction force may be measured in kiloNewton (kN) or in kiloNewton per roll width (kN/cm).
• Tablets were produced on a Korsch PH106 or a Fette 102i mounted with a gravity feeder and a single set of punches resulting in 13 mm x 7.5 mm convex oval tablets having no score.
• the press speed of the Korsch PH106 was set around 25 rpm and the counter pressure was adjusted to 40 kN.
• the press speed of the Fette 102i was set around 20 rpm.
• the fill volume was adjusted to obtain tablets having a target weight 407.7 mg.
• the compression force was set to obtain tablets with a crushing strength of around 180 ⁇ 20 Nfor the Korsch PH106 and of around 128 N for the Fette 102i. Resistance to crushing of tablets
• the dissolution test was conducted with apparatus 2 in accordance with United States Pharmacopoeia 35 using a paddle rotation speed of 50 rpm.
• the HPLC method was based on gradient elution on a C8 column.
• the solvent system was trifluoroacetic acid and acetonitrile with UV detection at 210 and 335 nm.
• the sample contents were calculated based on the peak area of the SNAC and GLP-1 (e.g. semaglutide) peaks in the
• mice Male and female beagle dogs, weighing approx. 6-22 kg during the study period, were included in the study. The dogs were dosed in fasting state and the dogs were fed approx. 4 hours post dosing. The formulations were administered by oral administration to the dogs in groups of typically 8 (such as 4 male and 4 females).
• the bioavailability studies were conducted either as single dose (SD) studies or multiple dose (MD) studies.
• MD studies the formulation was administered with five consecutive dosing occasions in each study (once a day dosing).
• An example of a SD blood sampling regimen could be the following time points: pre-dose, 0.25, 0.5, 0.75, 1 , 1 .5, 2, 2.5, 3, 4, 6, 8, 24, 48, 72, 96, 120, 144, 192 and 240 hours post dosing.
• An example of a MD blood sampling regimen could be the following time points: pre-dose, 0.5, 1 .5 and 3 hr post dosing after each dosing occasion and a blood sampling regimen equivalent to a SD blood sampling regimen following the last dosing occasion.
• the plasma was analysed for semaglutide using a Luminescence Oxygen Channeling Immunoassay (LOCI).
• LOCI Luminescence Oxygen Channeling Immunoassay
• the LOCI assay employs donor beads coated with streptavidin and acceptor beads conjugated with a monoclonal antibody binding to a mid-molecular region of GLP-1 (e.g. semaglutide).
• GLP-1 e.g. semaglutide
• the other monoclonal antibody specific for an N-terminal epitope, was biotinylated.
• the three reactants were combined with the GLP-1 (e.g. semaglutide) which form a two-sited immuno-complex.
• Illumination of the complex releases singlet oxygen atoms from the donor beads which channels into the acceptor beads and trigger chemiluminescence which was measured in the EnVision plate reader.
• the amount of light was proportional to the concentration of semaglutide and the lower limit of quantification (LLOQ) in plasma was 100 pM.
• GLP-1 e.g. semaglutide
• GLP-1 plasma concentration data were subjected to non-compartmental pharmacokinetic analysis using the PC based software WinNonlin, v. 5.2 or later (Pharsight, Mountain View, CA. 94041 , USA).
• AUC Area Under the Curve
• AUC/D dose normalized AUC
• F Bioavailability
• Sample content was determined using a RP-HPLC method for dual detection of SNAC and GLP-1 (e.g. semaglutide).
• the HPLC method was based on gradient elution on a C8 column.
• the solvent system was trifluoroacetic acid and acetonitrile with UV detection at 210 and 335 nm.
• the sample contents were calculated based on the peak area of the SNAC and GLP-1 (e.g. semaglutide) peaks in the chromatogram relative to the peak areas of the SNAC and GLP-1 (e.g. semaglutide) references, respectively.
• the content was reported as average of 10 tablets.
• Example 1 Preparation of tablet compositions comprising GLP-1 and SNAC
• Compound A is N-epsilon26- ⁇ 2-[2-(2- ⁇ 2-[2-(2- ⁇ (S)-4-carboxy-4-[10-(4- carboxyphenoxy) decanoylamino]butyrylamino ⁇ ethoxy)ethoxy] acetylamino ⁇ ethoxy) ethoxy]acetyl ⁇ , N-epsilon37- ⁇ 2-[2-(2- ⁇ 2-[2-(2- ⁇ (S)-4-carboxy-4-[10-(4-carboxy-phenoxy) decanoylamino] butyrylamino ⁇ ethoxy)ethoxy]acetylamino ⁇ ethoxy) ethoxy]acetyl ⁇ - [Aib8,Arg34,Lys37]GLP-1 (7-37)-OH.
• Tablet compositions were prepared by mixing the components listed in Table 2 in different ways.
• the tablet compositions consisted of a first type of granules, in some cases a second type of granules, as well as extragranular ingredients mixed with the first type of granules and, if present, the second type of granules.
• Preparation of granules by roller compaction and preparation of tablets from the tablet compositions were as described in the section General Methods of Preparation.
• the design of the tablet compositions is shown in Table 3.
• Tablet composition B is a mixture of ingredients. Further details of the preparation of the tablet compositions are provided below.
• Tablet composition B is a mixture of ingredients.
• Magnesium stearate for the first granule fraction was passed through a 355 ⁇ sieve. Magnesium stearate was manually mixed with SNAC in a stainless steel bowl in corresponding volumes. Two cycles of geometric dilution was applied by mixing for around 60 s until the blend was visually homogenous. The remaining quantity of SNAC was transferred to a blender and was pre-mixed for 2 min at 25 rpm. The SNAC and magnesium stearate pre-mix was added to the blender and mixing was performed for 20 min at 25 rpm. The blend was roller compacted. The granules were sieved through a 180 ⁇ mesh.
• Semaglutide, microcrystalline cellulose and povidone for the second granule fraction were weighed directly into a stainless steel bowl in the order of decreasing amounts and mixed manually for at least 3 min until visually homogenous before transferring the pre-mix to a 1000 mL Duma bottle.
• the Duma bottle was closed with a lid and tumbled manually in a Turbula-like movement for 1 min.
• the blend was roller compacted.
• the two types of granules were added to a blending container in order of decreasing content and mixed for 5 minutes at 32 rpm.
• Extragranular magnesium stearate was mixed with the granule blend by manual mixing using volume-doubling followed by 30 s mixing in the Turbula mixer at 32 rpm. Tablets were prepared from this composition.
• Magnesium stearate for the granule fraction was passed through a 355 ⁇ sieve.
• Magnesium stearate was manually mixed with SNAC in a stainless steel bowl in
• the granules and all other constituents except extragranular magnesium stearate were added to a blending container in order of decreasing content and mixed for 5 minutes at 32 rpm.
• Extragranular magnesium stearate was mixed with the granule blend by manual mixing using volume-doubling followed by 30 s mixing in the Turbula mixer at 32 rpm.
• Tablets were prepared from this composition.
• Tablet composition D
• Magnesium stearate for the granule fraction was passed through a 355 ⁇ sieve. Magnesium stearate was manually mixed with SNAC in a stainless steel bowl in
• the granules and microcrystalline cellulose were added to a blending container in order of decreasing content and mixed for 5 minutes at 32 rpm.
• Extragranular magnesium stearate was mixed with the granule blend by manual mixing using volume-doubling followed by 30 s mixing in the Turbula mixer at 32 rpm. Tablets were prepared from this composition.
• Magnesium stearate for the granule fraction was passed through a 355 ⁇ sieve.
• Magnesium stearate was manually mixed with SNAC in a stainless steel bowl in
• Extragranular magnesium stearate was mixed with the granules by manual mixing using volume-doubling followed by 30 s mixing in the Turbula mixer at 32 rpm. Tablets were prepared from this composition.
• Tablet composition F Extragranular magnesium stearate was mixed with the granules by manual mixing using volume-doubling followed by 30 s mixing in the Turbula mixer at 32 rpm. Tablets were prepared from this composition. Tablet composition F
• Magnesium stearate for granule fraction one was passed through a 355 ⁇ sieve. Magnesium stearate was manually mixed with SNAC in a stainless steel bowl in
• Semaglutide, microcrystalline cellulose (Avicel PH 101 , FMC Biopolymer) and povidone (Kollidon 90F, BASF) for granule fraction two were weighed directly into a stainless steel bowl in the order of decreasing amounts and mixed manually for at least 3 min until visually homogenous before transferring the pre-mix to a 500 mL Duma bottle.
• the Duma bottle was closed with a lid and tumbled manually in a Turbula-like movement for 1 min.
• the blend was roller compacted.
• the two types of granules were added to a blending container in order of decreasing content and mixed for 5 minutes at 32 rpm.
• Extragranular magnesium stearate was mixed with the granule blend by manual mixing using volume-doubling followed by 30 s mixing in the Turbula mixer at 32 rpm. Tablets were prepared from this composition.
• Magnesium stearate for the first granule fraction was passed through a 355 ⁇ sieve. Magnesium stearate was manually mixed with SNAC in a plastic bag in corresponding volumes. Two cycles of geometric dilution was applied by mixing for around 60 s. The SNAC and magnesium stearate pre-mix was added to the blender followed by the addition of the remaining SNAC and mixing was performed for 50 min at 25 rpm. The blend was roller compacted. The granules were sieved through a 1000 and 90 ⁇ mesh.
• Compound A, microcrystalline cellulose and povidone for the second granule fraction were weighed directly into a stainless steel bowl in the order of decreasing amounts and mixed manually for at least 3 min until visually homogenous before transferring the pre- mix to a 500 mL Duma bottle.
• the Duma bottle was closed with a lid and tumbled manually in a Turbula-like movement for 3 min.
• the blend was roller compacted.
• the two types of granules were added to a blending container and mixed for 20 minutes at 25 rpm.
• Extragranular magnesium stearate was passed through a 355 ⁇ sieve and mixed with the granule blend by manual mixing using volume-doubling followed by 2 min mixing in the Turbula mixer at 25 rpm. Tablets were prepared from this composition.
• Magnesium stearate for granule fraction one was passed through a 355 ⁇ sieve. Magnesium stearate was manually mixed with SNAC in a plastic bag in corresponding volumes. Two cycles of geometric dilution was applied by mixing for around 60 s. The SNAC and magnesium stearate pre-mix was added to the blender followed by the addition of the remaining SNAC and mixing was performed for 50 min at 25 rpm. Microcrystalline cellulose was then added to the mixed SNAC and magnesium stearate and the mixing step was finalized by mixing in the blender for 20 min at 25 rpm. The blend was roller compacted.
• Compound A microcrystalline cellulose (Avicel PH 101 , FMC Biopolymer) and povidone (Kollidon 90F, BASF) for granule fraction two were weighed directly into a stainless steel bowl in the order of decreasing amounts and mixed manually for at least 3 min until visually homogenous before transferring the pre-mix to a 500 mL Duma bottle.
• the Duma bottle was closed with a lid and tumbled manually in a Turbula-like movement for at least 3 min.
• the blend was roller compacted.
• Example 2 Dissolution of GLP-1 and SNAC from tablet composition B
• the dissolution of semaglutide and SNAC from tablet composition B was determined using Assay (I) described herein. The results are shown in Table 4. Corrected results are adjusted for the content of semaglutide or SNAC determined by analysis using Assay (III) described herein. The corrected results show that SNAC is released faster than semaglutide during the initial 20 min of dissolution. Furthermore, it shows that the difference between the faster release of SNAC compared to semaglutide is the largest in the dissolution medium with the pH-value of 2.5. Lastly, the data shows that in dissolution media with pH- values of 1 .0 and 2.5 the amount of dissolved SNAC peaks within the initial 45 and 30 min, respectively. Table 4. Dissolution of semaglutide and SNAC from tablet composition B
• Example 3 Dissolution of GLP-1 and SNAC from tablet composition C
• the dissolution of semaglutide and SNAC from tablet composition C was determined using Assay (I) described herein. The results are shown in Table 5. The results show that SNAC is released slower than semaglutide after the initial 5 min of dissolution in the dissolution media with low pH-values of 1 .0 and 2.5. Corrected results are adjusted for the content of semaglutide or SNAC determined by analysis using Assay (III) described herein. During the initial 5 min of corrected dissolution in the dissolution medium with the pH- value of 2.5 SNAC is released equally fast assemaglutide. Furthermore, the corrected dissolution values show that SNAC is released faster than semaglutide in the dissolution medium with the pH-value of 6.8. Table 5. Dissolution of semaglutide and SNAC from tablet composition C
• Example 4 Dissolution of GLP-1 and SNAC from tablet composition D
• Example 5 Dissolution of GLP-1 and SNAC from tablet composition E
• Example 6 Dissolution of GLP-1 and SNAC from tablet composition F
• the results show that tablet composition F provided a bioavailability of 1 .0%.
• the results show that tablet composition B provided a bioavailability of 0.7%.
• the results show that tablet composition C provided a bioavailability of 0.5%.
• the results show that tablet composition E provided a bioavailability of 0.4%.
• the results show that tablet composition D provided a bioavailability of 0.3%.
• Example 8 Dissolution of GLP-1 and SNAC from tablet composition G
• Example 9 Dissolution of GLP-1 and SNAC from tablet composition H
• the dissolution of Compound A and SNAC from tablet composition H was determined using Assay (I) described herein. The results are shown in Table 1 1. The results show that SNAC is released faster than Compound A during the initial 20 min of dissolution. Furthermore, it shows that the difference between the faster release of SNAC compared to Compound A is the largest in the dissolution medium with the pH-value of 2.5. Lastly, the data shows that in a dissolution medium with a pH-value of 2.5 the amount of dissolved SNAC peaks within the initial 30 min. Table 1 1 . Dissolution of Compound A and SNAC from tablet composition H

Landscapes

• Health & Medical Sciences (AREA)
• Life Sciences & Earth Sciences (AREA)
• Chemical & Material Sciences (AREA)
• Animal Behavior & Ethology (AREA)
• General Health & Medical Sciences (AREA)
• Public Health (AREA)
• Veterinary Medicine (AREA)
• Pharmacology & Pharmacy (AREA)
• Medicinal Chemistry (AREA)
• Epidemiology (AREA)
• Engineering & Computer Science (AREA)
• Bioinformatics & Cheminformatics (AREA)
• Diabetes (AREA)
• Endocrinology (AREA)
• General Chemical & Material Sciences (AREA)
• Chemical Kinetics & Catalysis (AREA)
• Organic Chemistry (AREA)
• Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
• Obesity (AREA)
• Hematology (AREA)
• Proteomics, Peptides & Aminoacids (AREA)
• Zoology (AREA)
• Gastroenterology & Hepatology (AREA)
• Immunology (AREA)
• Biophysics (AREA)
• Molecular Biology (AREA)
• Child & Adolescent Psychology (AREA)
• Emergency Medicine (AREA)
• Oil, Petroleum & Natural Gas (AREA)
• Medicinal Preparation (AREA)
• Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
• Peptides Or Proteins (AREA)

Priority Applications (32)

Applications Claiming Priority (6)

Related Child Applications (2)

Publications (1)

Family

ID=49221868

Family Applications (1)

Country Status (22)

Cited By (30)

Families Citing this family (20)

Citations (2)

Family Cites Families (190)

• 2013
  • 2013-03-15 HU HUE18188815A patent/HUE062740T2/hu unknown
  • 2013-03-15 RS RS20230691A patent/RS64460B1/sr unknown
  • 2013-03-15 RS RS20181144A patent/RS57727B1/sr unknown
  • 2013-03-15 ES ES18188815T patent/ES2952874T3/es active Active
  • 2013-03-15 HU HUE13709231A patent/HUE039406T2/hu unknown
  • 2013-03-15 HR HRP20181447TT patent/HRP20181447T1/hr unknown
  • 2013-03-15 PL PL13709231T patent/PL2827885T3/pl unknown
  • 2013-03-15 JP JP2015500853A patent/JP6001158B2/ja active Active
  • 2013-03-15 CN CN201380015554.2A patent/CN104203266B/zh active Active
  • 2013-03-15 SI SI201331172T patent/SI2827885T1/sl unknown
  • 2013-03-15 MX MX2014010685A patent/MX353067B/es active IP Right Grant
  • 2013-03-15 DK DK13709231.8T patent/DK2827885T3/en active
  • 2013-03-15 US US14/386,589 patent/US10933120B2/en active Active
  • 2013-03-15 EP EP23177173.4A patent/EP4324475A1/en active Pending
  • 2013-03-15 HR HRP20231060TT patent/HRP20231060T1/hr unknown
  • 2013-03-15 MY MYPI2014002632A patent/MY171146A/en unknown
  • 2013-03-15 EP EP18188815.7A patent/EP3488857B9/en active Active
  • 2013-03-15 RU RU2014141700A patent/RU2641198C3/ru active Protection Beyond IP Right Term
  • 2013-03-15 SM SM20180491T patent/SMT201800491T1/it unknown
  • 2013-03-15 BR BR112014023374-8A patent/BR112014023374B1/pt active IP Right Grant
  • 2013-03-15 AU AU2013234496A patent/AU2013234496B2/en active Active
  • 2013-03-15 EP EP13709231.8A patent/EP2827885B1/en not_active Revoked
  • 2013-03-15 PL PL18188815.7T patent/PL3488857T3/pl unknown
  • 2013-03-15 WO PCT/EP2013/055362 patent/WO2013139694A1/en not_active Ceased
  • 2013-03-15 KR KR1020147028164A patent/KR102072202B1/ko active Active
  • 2013-03-15 LT LTEP13709231.8T patent/LT2827885T/lt unknown
  • 2013-03-15 CA CA2868188A patent/CA2868188A1/en not_active Withdrawn
  • 2013-03-15 ES ES13709231.8T patent/ES2690553T3/es active Active
  • 2013-03-15 CN CN201711156842.6A patent/CN107812181B/zh active Active
• 2014
  • 2014-08-25 ZA ZA2014/06250A patent/ZA201406250B/en unknown
• 2017
  • 2017-10-27 AU AU2017251814A patent/AU2017251814B2/en active Active
• 2021
  • 2021-01-25 US US17/157,363 patent/US11759501B2/en active Active
• 2022
  • 2022-04-13 US US17/719,610 patent/US11759502B2/en active Active
  • 2022-04-13 US US17/719,629 patent/US11759503B2/en active Active
• 2023
  • 2023-08-01 US US18/228,706 patent/US20240016897A1/en not_active Abandoned
• 2025
  • 2025-03-05 US US19/071,109 patent/US20250195618A1/en active Pending

Patent Citations (2)

Also Published As

Similar Documents

Legal Events