US20180030136A1 - Icos binding proteins - Google Patents

Icos binding proteins Download PDF

Info

Publication number
US20180030136A1
US20180030136A1 US15/546,369 US201615546369A US2018030136A1 US 20180030136 A1 US20180030136 A1 US 20180030136A1 US 201615546369 A US201615546369 A US 201615546369A US 2018030136 A1 US2018030136 A1 US 2018030136A1
Authority
US
United States
Prior art keywords
icos
seq
binding protein
antigen binding
cell
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/546,369
Other languages
English (en)
Inventor
Yao-Bin Liu
Patrick Mayes
Daniel Olive
Radha Shah Parmar
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Aix Marseille Universite
Institut National de la Sante et de la Recherche Medicale INSERM
Institut Jean Paoli and Irene Calmettes
GlaxoSmithKline Intellectual Property Development Ltd
Original Assignee
Aix Marseille Universite
Institut National de la Sante et de la Recherche Medicale INSERM
Institut Jean Paoli and Irene Calmettes
GlaxoSmithKline Intellectual Property Development Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Aix Marseille Universite, Institut National de la Sante et de la Recherche Medicale INSERM, Institut Jean Paoli and Irene Calmettes, GlaxoSmithKline Intellectual Property Development Ltd filed Critical Aix Marseille Universite
Priority to US15/546,369 priority Critical patent/US20180030136A1/en
Assigned to GLAXOSMITHKLINE INTELLECTUAL PROPERTY DEVELOPMENT LIMITED reassignment GLAXOSMITHKLINE INTELLECTUAL PROPERTY DEVELOPMENT LIMITED ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: PARMAR, RADHA SHAH, LIU, Yao-bin, MAYES, Patrick
Publication of US20180030136A1 publication Critical patent/US20180030136A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3015Breast
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3023Lung
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3038Kidney, bladder
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3069Reproductive system, e.g. ovaria, uterus, testes, prostate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention relates generally to immunotherapy in the treatment of human disease and reduction of adverse events related thereto. More specifically, the present invention relates to the use of ICOS binding proteins including ICOS agonist antibodies and their use as immunomodulators in the treatment of cancer, infectious disease and/or sepsis.
  • Enhancing anti-tumor T cell function and inducing T cell proliferation is a powerful and new approach for cancer treatment.
  • Three immune-oncology antibodies e.g., immuno-modulators
  • Anti-CTLA-4 YERVOY/ipilimumab
  • Anti-PD-1 antibodies OPDIVO/nivolumab and KEYTRUDA/pembrolizumab
  • OPDIVO/nivolumab and KEYTRUDA/pembrolizumab are thought to act in the local tumor microenvironment, by relieving an inhibitory checkpoint in tumor specific T cells that have already been primed and activated.
  • ICOS is a co-stimulatory T cell receptor with structural and functional relation to the CD28/CTLA-4-Ig superfamily (Hutloff, et al., “ICOS is an inducible T-cell co-stimulator structurally and functionally related to CD28”, Nature, 397: 263-266 (1999)). Activation of ICOS occurs through binding by ICOS-L (B7RP-1/B7-H2). Neither B7-1 nor B7-2 (ligands for CD28 and CTLA4) bind or activate ICOS.
  • ICOS-L has been shown to bind weakly to both CD28 and CTLA-4 (Yao S et al., “B7-H2 is a costimulatory ligand for CD28 in human”, Immunity, 34(5); 729-40 (2011)). Expression of ICOS appears to be restricted to T cells. ICOS expression levels vary between different T cell subsets and on T cell activation status.
  • ICOS expression has been shown on resting TH17, T follicular helper (TFH) and regulatory T (Treg) cells; however, unlike CD28; it is not highly expressed on na ⁇ ve T H 1 and T H 2 effector T cell populations (Paulos C M et al., “The inducible costimulator (ICOS) is critical for the development of human Th17 cells”, Sci Transl Med, 2(55); 55ra78 (2010)).
  • ICOS expression is highly induced on CD4+ and CD8+ effector T cells following activation through TCR engagement (Wakamatsu E, et al., “Convergent and divergent effects of costimulatory molecules in conventional and regulatory CD4+ T cells”, Proc Natal Acad Sci USA, 110(3); 1023-8 (2013)).
  • Co-stimulatory signalling through ICOS receptor only occurs in T cells receiving a concurrent TCR activation signal (Sharpe A H and Freeman G J. “The B7-CD28 Superfamily”, Nat. Rev Immunol, 2(2); 116-26 (2002)).
  • ICOS In activated antigen specific T cells, ICOS regulates the production of both T H 1 and T H 2 cytokines including IFN- ⁇ , TNF- ⁇ , IL-10, IL-4, IL-13 and others. ICOS also stimulates effector T cell proliferation, albeit to a lesser extent than CD28 (Sharpe A H and Freeman G J. “The B7-CD28 Superfamily”, Nat. Rev Immunol, 2(2); 116-26 (2002))
  • ICOS-L-Fc fusion protein caused tumor growth delay and complete tumor eradication in mice with SA-1 (sarcoma), Meth A (fibrosarcoma), EMT6 (breast) and P815 (mastocytoma) and EL-4 (plasmacytoma) syngeneic tumors, whereas no activity was observed in the B16-F10 (melanoma) tumor model which is known to be poorly immunogenic (Ara G et al., “Potent activity of soluble B7RP-1-Fc in therapy of murine tumors in syngeneic hosts”, Int.
  • ICOS + T effector:Tre g ratio changes the ICOS + T effector:Tre g ratio, reversing an abundance of T regs pre- “CTLA-4 blockade increases IFN-gamma producing CD4+ICOShi cells to shift the ratio of effector to regulatory T cells in cancer patients”, Proc Natl Acad Sci USA. 105(39); 14987-92 (2008)) and (Vonderheide R H et al., Clin Cancer Res., 16(13); 3485-94 (2010)). Therefore, ICOS positive T effector cells are a positive predictive biomarker of ipilimumab response which points to the potential advantage of activating this population of cells with an agonist ICOS antibody.
  • ICOS binding proteins or antigen binding portions thereof comprising one or more of: CDRH1 as set forth in SEQ ID NO: 1; CDRH2 as set forth in SEQ ID NO:2; CDRH3 as set forth in SEQ ID NO:3; CDRL1 as set forth in SEQ ID NO:4; CDRL2 as set forth in SEQ ID NO:5 and/or CDRL3 as set forth in SEQ ID NO:6 or a direct equivalent of each CDR wherein a direct equivalent has no more than two amino acid substitutions in said CDR.
  • ICOS binding proteins or antigen binding portions thereof which specifically binds to human ICOS wherein said ICOS binding protein comprises a V H domain comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO:7 and/or a V L domain comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO:8.
  • humanized monoclonal antibodies or antigen binding portions thereof comprising heavy chain CDRs having the amino acid sequences set forth in SEQ ID NO: 1; SEQ ID NO:2; and SEQ ID NO:3 and light chain CDRs having the amino acid sequences set forth in SEQ ID NO:4; SEQ ID NO:5; and SEQ ID NO:6.
  • humanized monoclonal antibodies are provided which comprise a hIgG4PE scaffold; a V H domain comprising an amino acid sequence set forth in SEQ ID NO:7; and a V L domain comprising an amino acid sequence set forth in SEQ ID NO:8.
  • the antibodies of the present invention may stimulate cytokine production when contacted with a T cell.
  • ICOS binding proteins are provided that compete for binding to human ICOS with any one of the ICOS binding proteins or antigen binding portions thereof of the invention.
  • methods are provided for treating cancer, infectious disease and/or sepsis with an ICOS binding protein or a pharmaceutical composition comprising at least one ICOS binding protein of the present invention.
  • FIG. 2 Proliferation in CD4+CD25 ⁇ T cells.
  • FIG. 3 H2L5 humanized variant of anti-ICOS 422.2 shows better cytokine production in PBMC cells.
  • FIG. 4 422 H2L5 IgG1 induced decreased T cell viability which was not apparent with Fc-disabled or hIgG4PE isotypes.
  • FIG. 5 Dose response of H2L5 hIgG4PE induced proinflammatory cytokine induction in human CD4+ T cells.
  • FIG. 6 H2L5 hIgG4PE induces proliferation, cytokine production and increased cytotoxic potential in activated PBMCs from healthy human donors.
  • FIG. 7 Meso Scale Discovery (MSD) assay showing the inhibition of ICOS-L binding to ICOS by H2L5 hIgG4PE, indicating that it binds to the same epitope on ICOS as ICOS-L and competes for binding.
  • MSD Meso Scale Discovery
  • FIG. 8 Recovered antibody V H and V L genes from RNA of hybridoma clone 422.2.
  • FIG. 9 Protein sequences of heavy and light chains of H2L5 hIgG4PE with signal sequence.
  • FIG. 10 DNA sequence of coding region of H2L5 hIgG4PE heavy chain with signal sequence.
  • FIG. 11 DNA sequence of coding region of H2L5 hIgG4PE light chain with signal sequence.
  • FIG. 12 Plasma concentrations of H2L5 hIgG4PE in cynomolgus monkeys. Concentrations were determined after the (A) first or (B) second dose (day 15) of H2L5 hIgG4PE. Animals were sacrificed 48 hours post second dose for tissue sample collection and histopathology analysis.
  • FIG. 13 Detection of H2L5 hIgG4PE binding to CD4+ T cells from the spleen and axillary lymph nodes of monkeys. Tissue was collected 48 hours post-second dose (Day 17).
  • FIG. 14 Receptor Occupancy of H2L5 hIgG4PE in blood CD4+ T cells from cynomolgus monkeys.
  • ICOS “free receptor” as measured by positive binding of the anti-ICOS fluorescently labelled antibody used for flow cytometry, which binds only when H2L5 hIgG4PE is not present.
  • FIG. 15 (a) Phospho-AKT (T308) expression levels in Ba/F3-ICOS cells treated with H2L5 hIgG4PE—Intracellular signalling antibody array (b) Phospho-AKT (S473) expression levels in Ba/F3-ICOS cells treated with H2L5 hIgG4PE—Intracellular signalling antibody array.
  • FIG. 16 H2L5 hIgG4PE in combination with ipilimumab results increased proinflammatory cytokine production as compared to single antibody treatment in PBMC pre-stimulation assay.
  • FIG. 17 H2L5 hIgG4PE in combination with pembrolizumab results increased proinflammatory cytokine production as compared to single antibody treatment in PBMC pre-stimulation assay.
  • FIG. 18 H2L5 hIgG4PE plus ipilimumab combination induces increased proinflamatory cytokine production in a modified MLR assay with CEFT peptide and pre-incubation.
  • FIG. 19 H2L5 hIgG4PE plus pembrolizumab combination induces increased proinflamatory cytokine production in a modified MLR assay with CEFT peptide and pre-incubation.
  • FIG. 20 H2L5 hIgG4PE anti-ICOS agonist mAb alone and in combination with pembrolizumab results in tumor growth inhibition in a human PBMC A2058 Melanoma mouse tumor model.
  • FIG. 21 anti-ICOS murine surrogate mAb results in significant tumor growth inhibition and increased survival in combination with an anti-PD1 murine surrogate mAb in the CT26 mouse tumor model.
  • FIG. 22 anti-ICOS murine surrogate mAb results in significant tumor growth inhibition and increased survival in combination with an anti-PD1 murine surrogate mAb in the EMT6 mouse tumor model.
  • ICOS means any Inducible T-cell costimulator protein.
  • Pseudonyms for ICOS include AILIM; CD278; CVID1, JTT-1 or JTT-2, MGC39850, or 8F4.
  • ICOS is a CD28-superfamily costimulatory molecule that is expressed on activated T cells. The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation.
  • the amino acid sequence of human ICOS is shown below as SEQ ID NO:10.
  • ICOS-L and “ICOS Ligand” are used interchangeably and refer to the membrane bound natural ligand of human ICOS.
  • ICOS ligand is a protein that in humans is encoded by the ICOSLG gene.
  • ICOSLG has also been designated as CD275 (cluster of differentiation 275).
  • Pseudonyms for ICOS-L include B7RP-1 and B7-H2.
  • agonist refers to an antigen binding protein, for example an ICOS binding protein, which upon contact with ICOS causes one or more of the following (1) stimulates or activates the ICOS receptor, (2) enhances, increases or promotes, induces or prolongs an activity, function or presence of ICOS and/or (3) enhances, increases, promotes or induces the expression of the ICOS.
  • Agonist activity can be measured in vitro by various assays know in the art such as, but not limited to, measurement of cell signaling, cell proliferation, immune cell activation markers, cytokine production. Agonist activity can also be measured in vivo by various assays that measure surrogate end points such as, but not limited to the measurement of T cell proliferation or cytokine production.
  • cross competes for binding refers to any ICOS binding protein that will compete for binding to ICOS with any of the ICOS binding proteins of the present invention.
  • Competition for binding between two molecules for ICOS can be tested by various methods known in the art including Flow cytometry, Meso Scale Discovery and ELISA. Binding can be measured directly, meaning two or more binding proteins can be put in contact with ICOS and binding may be measured for one or each. Alternatively, binding of molecules or interest can be tested against the binding or natural ligand and quantitatively compared with each other.
  • ICOS binding protein refers to antibodies and other protein constructs, such as domains, which are capable of binding to ICOS. In some instances, the ICOS is human ICOS.
  • the term “ICOS binding protein” can be used interchangeably with “ICOS antigen binding protein.” Thus, as is understood in the art, anti-ICOS antibodies and/or ICOS antigen binding proteins would be considered ICOS binding proteins.
  • antigen binding protein is any protein, including but not limited to antibodies, domains and other constructs described herein, that binds to an antigen, such as ICOS.
  • antigen binding portion of an ICOS binding protein would include any portion of the ICOS binding protein capable of binding to ICOS, including but not limited to, an antigen binding antibody fragment.
  • antibody is used herein in the broadest sense to refer to molecules with an immunoglobulin-like domain (for example IgG, IgM, IgA, IgD or IgE) and includes monoclonal, recombinant, polyclonal, chimeric, human, humanized, multispecific antibodies, including bispecific antibodies, and heteroconjugate antibodies; a single variable domain (e.g., V H , V HH , VL, domain antibody (dAbTM)), antigen binding antibody fragments, Fab, F(ab′) 2 , Fv, disulphide linked Fv, single chain Fv, disulphide-linked scFv, diabodies, TANDABSTM, etc. and modified versions of any of the foregoing.
  • immunoglobulin-like domain for example IgG, IgM, IgA, IgD or IgE
  • a single variable domain e.g., V H , V HH , VL, domain antibody (dAbTM)
  • Fab
  • Alternative antibody formats include alternative scaffolds in which the one or more CDRs of skeleton, such as an affibody, a SpA scaffold, an LDL receptor class A domain, an avimer or an EGF domain.
  • domain refers to a folded protein structure which retains its tertiary structure independent of the rest of the protein. Generally domains are responsible for discrete functional properties of proteins and in many cases may be added, removed or transferred to other proteins without loss of function of the remainder of the protein and/or of the domain.
  • single variable domain refers to a folded polypeptide domain comprising sequences characteristic of antibody variable domains. It therefore includes complete antibody variable domains such as V H , V HH and V L and modified antibody variable domains, for example, in which one or more loops have been replaced by sequences which are not characteristic of antibody variable domains, or antibody variable domains which have been truncated or comprise N- or C-terminal extensions, as well as folded fragments of variable domains which retain at least the binding activity and specificity of the full-length domain.
  • a single variable domain is capable of binding an antigen or epitope independently of a different variable region or domain.
  • a “domain antibody” or “dAbTM” may be considered the same as a “single variable domain”.
  • a single variable domain may be a human single variable domain, but also includes single variable domains from other species such as rodent nurse shark and Camelid V HH dAbsTM.
  • Camelid V HH are immunoglobulin single variable domain polypeptides that are derived from species including camel, llama, alpaca, dromedary, and guanaco, which produce heavy chain antibodies naturally devoid of light chains.
  • Such V HH domains may be humanized according to standard techniques available in the art, and such domains are considered to be “single variable domains”.
  • V H includes camelid V HH domains.
  • An antigen binding fragment may be provided by means of arrangement of one or more CDRs on non-antibody protein scaffolds.
  • Protein Scaffold as used herein includes but is not limited to an immunoglobulin (Ig) scaffold, for example an IgG scaffold, which may be a four chain or two chain antibody, or which may comprise only the Fc region of an antibody, or which may comprise one or more constant regions from an antibody, which constant regions may be of human or primate origin, or which may be an artificial chimera of human and primate constant regions.
  • Ig immunoglobulin
  • the protein scaffold may be an Ig scaffold, for example an IgG, or IgA scaffold.
  • the IgG scaffold may comprise some or all the domains of an antibody (i.e. CH1, CH2, CH3, V H , V L ).
  • the antigen binding protein may comprise an IgG scaffold selected from IgG1, IgG2, IgG3, IgG4 or IgG4PE.
  • the scaffold may be IgG1.
  • the scaffold may consist of, or comprise, the Fc region of an antibody, or is a part thereof.
  • the protein scaffold may be a derivative of a scaffold selected from the group consisting of CTLA-4, lipocalin, Protein A derived molecules such as Z-domain of Protein A (Affibody, SpA), A- ankyrin repeat protein (DARPin); peptide aptamer; C-type lectin domain (Tetranectin); human ⁇ -crystallin and human ubiquitin (affilins); PDZ domains; scorpion toxin kunitz type domains of human protease inhibitors; and fibronectin/adnectin; which has been subjected to protein engineering in order to obtain binding to an antigen, such as ICOS, other than the natural ligand.
  • Protein A derived molecules such as Z-domain of Protein A (Affibody, SpA), A- ankyrin repeat protein (DARPin); peptide aptamer; C-type lectin domain (Tetranectin); human ⁇ -crystallin and human ubiquitin (affil
  • Antigen binding site refers to a site on an antigen binding protein which is capable of specifically binding to an antigen, this may be a single variable domain, or it may be paired V H /V L domains as can be found on a standard antibody.
  • Single-chain Fv (ScFv) domains can also provide antigen-binding sites.
  • epitope-binding domain refers to a domain that specifically binds to a region of an antigen known as the epitope independently of a different domain.
  • multi-specific antigen binding protein refers to antigen binding proteins which comprise at least two different antigen binding sites. Each of these antigen-binding sites will be capable of binding to a different epitope, which may be present on the same antigen or different antigens.
  • the multi-specific antigen binding protein will have specificity for more than one antigen, for example two antigens, or for three antigens, or for four antigens.
  • multi-specific antigen binding proteins include those that consist of, or consist essentially of, an Fc region of an antibody, or a part thereof, linked at each end, directly or indirectly (for example, via a linker sequence) to a binding domain.
  • Such an antigen binding protein may comprise two binding domains separated by an Fc region, or part thereof. By separated is meant that the binding domains are not directly linked to one another, and may be located at opposite ends (C and N terminus) of an Fc region, or any other scaffold region.
  • the antigen binding protein may comprise two scaffold regions each bound to two binding domains, for example at the N and C termini of each scaffold region, either directly or indirectly via a linker. Each binding domain may bind to a different antigen.
  • mAbdAb refers to a monoclonal antibody linked to a further binding domain, in particular a single variable domain such as a domain antibody.
  • a mAbdAb has at least two antigen binding sites, at least one of which is from a domain antibody, and at least one is from a paired V H /VL domain.
  • a “dAbTM conjugate” refers to a composition comprising a dAb to which a drug is chemically conjugated by means of a covalent or noncovalent linkage.
  • the dAb and the drug are covalently bonded.
  • covalent linkage could be through a peptide bond or other means such as via a modified side chain.
  • the noncovalent bonding may be direct (e.g., electrostatic interaction, hydrophobic interaction) or indirect (e.g., through noncovalent binding of complementary binding partners (e.g., biotin and avidin), wherein one partner is covalently bonded to drug and the complementary binding partner is covalently bonded to the dAbTM).
  • complementary binding through a suitable linker moiety and the complementary binding partner can be covalently bonded to the dAbTM directly or through a suitable linker moiety.
  • dAbTM fusion refers to a fusion protein that comprises a dAbTM and a polypeptide drug (which could be a dAbTM or mAb).
  • the dAbTM and the polypeptide drug are present as discrete parts (moieties) of a single continuous polypeptide chain.
  • antigen binding proteins of the present disclosure show cross-reactivity between human ICOS and ICOS from another species, such as cynomolgus ICOS.
  • the antigen binding proteins of the invention specifically bind human and cynomolgus ICOS.
  • Competition between an ICOS binding protein and a reference ICOS binding protein may be determined by competition MSD, ELISA, FMAT or BIAcore.
  • the competition assay is carried out by comparison of an ICOS binding protein with ICOS ligand binding.
  • the two proteins may bind to the same or overlapping epitopes, there may be steric inhibition of binding, or binding of the first protein may induce a conformational change in the antigen that prevents or reduces binding of the second protein.
  • neutralizes means that the interaction between ICOS and ICOS-L is reduced in the presence of an antigen binding protein as described herein in comparison to the interaction of ICOS and ICOS-L in the absence of the ICOS binding protein, in vitro or in vivo. Neutralization may be due to one or more of blocking ICOS binding to its ligand, preventing ICOS from being activated by its ligand, down regulating ICOS or its receptor, or affecting effector functionality. For example, the ligand binding competition described in Examples 3 and 5 may be used to assess the neutralizing capability of an ICOS binding protein.
  • a neutralising ICOS binding protein may block the interaction of ICOS with ICOS-L by at least 20%, 30% 40%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 82%, 84%, 86%, 88%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99% or 100% relative to ICOS—ICOS-L interactions in the absence of the ICOS binding protein.
  • Neutralization may be determined or measured using one or more assays known to the skilled person or as described herein.
  • Affinity is the strength of binding of one molecule, e.g. an antigen binding protein of the invention, to another, e.g. its target antigen, at a single binding site.
  • the binding affinity of an antigen binding protein to its target may be determined by equilibrium methods (e.g. enzyme-linked immunoabsorbent assay (ELISA) or radioimmunoassay (RIA)), or kinetics (e.g. BIACORETM analysis).
  • ELISA enzyme-linked immunoabsorbent assay
  • RIA radioimmunoassay
  • kinetics e.g. BIACORETM analysis
  • BiacoreTM methods described in Example 5 may be used to measure binding affinity.
  • Avidity is the sum total of the strength of binding of two molecules to one another at multiple sites, e.g. taking into account the valency of the interaction.
  • the equilibrium dissociation constant (KD) of the ICOS binding protein-ICOS interaction is 100 nM or less, 10 nM or less, 2 nM or less or 1 nM or less.
  • the KD may be between 5 and 10 nM; or between 1 and 2 nM.
  • the KD may be between 1 pM and 500 pM; or between 500 pM and 1 nM.
  • the reciprocal of KD i.e. 1/KD
  • KA equilibrium association constant having units M ⁇ 1 .
  • a skilled person will appreciate that the larger the KA numerical value, the stronger the binding.
  • the dissociation rate constant (kd) or “off-rate” describes the stability of the ICOS binding protein ICOS complex, i.e. the fraction of complexes that decay per second. For example, a kd of 0.01 s ⁇ 1 equates to 1% of the complexes decaying per second.
  • the dissociation rate constant (kd) is 1 ⁇ 10 ⁇ 3 s ⁇ 1 or less, 1 ⁇ 10 ⁇ 4 s ⁇ 1 or less, 1 ⁇ 10 ⁇ 5 s ⁇ 1 or less, or 1 ⁇ 10 ⁇ 6 s ⁇ 1 or less.
  • the kd may be between 1 ⁇ 10 ⁇ 5 s ⁇ 1 and 1 ⁇ 10 ⁇ 4 s ⁇ 1 ; or between 1 ⁇ 10 ⁇ 4 s ⁇ 1 and 1 ⁇ 10 ⁇ 3 s ⁇ 1 .
  • the association rate constant (ka) or “on-rate” describes the rate of ICOS binding protein-ICOS complex formation.
  • the association rate constant (ka) is about 1.0 ⁇ 10 5 M ⁇ 1 s ⁇ 1 .
  • the molecule such as an antigen binding protein or nucleic acid
  • the molecule is removed from the environment in which it may be found in nature.
  • the molecule may be purified away from substances with which it would normally exist in nature.
  • the mass of the molecule in a sample may be 95% of the total mass.
  • expression vector means an isolated nucleic acid which can be used to introduce a nucleic acid of interest into a cell, such as a eukaryotic cell or prokaryotic cell, or a cell free expression system where the nucleic acid sequence of interest is expressed as a peptide chain such as a protein.
  • Such expression vectors may be, for example, cosmids, plasmids, viral sequences, transposons, and linear nucleic acids comprising a nucleic acid of interest.
  • Expression vectors within the scope of the disclosure may provide necessary elements for eukaryotic or prokaryotic expression and include viral promoter driven vectors, such as CMV promoter driven vectors, e.g., pcDNA3.1, pCEP4, and their derivatives, Baculovirus expression vectors, Drosophila human Ig gene promoters.
  • viral promoter driven vectors such as CMV promoter driven vectors, e.g., pcDNA3.1, pCEP4, and their derivatives, Baculovirus expression vectors, Drosophila human Ig gene promoters.
  • Other examples include prokaryotic expression vectors, such as T 7 promoter driven vectors, e.g., pET41, lactose promoter driven vectors and arabinose gene promoter driven vectors.
  • T 7 promoter driven vectors e.g., pET41
  • lactose promoter driven vectors e.g., lactose promoter driven vectors
  • recombinant host cell means a cell that comprises a nucleic acid sequence of interest that was isolated prior to its introduction into the cell.
  • the nucleic acid sequence of interest may be in an expression vector while the cell may be prokaryotic or eukaryotic.
  • exemplary eukaryotic cells are mammalian cells, such as but not limited to, COS-1, COS-7, HEK293, BHK21, CHO, BSC-1, HepG2, 653, SP2/0, NS0, 293, HeLa, myeloma, lymphoma cells or any derivative thereof.
  • the eukaryotic cell is a HEK293, NS0, SP2/0, or CHO cell.
  • a recombinant cell according to the disclosure may be generated by transfection, cell fusion, immortalization, or other procedures well known in the art.
  • a nucleic acid sequence of interest, such as an expression vector, transfected into a cell may be extrachromasomal or stably integrated into the chromosome of the cell.
  • a “chimeric antibody” refers to a type of engineered antibody which contains a naturally-occurring variable region (light chain and heavy chains) derived from a donor antibody in association with light and heavy chain constant regions derived from an acceptor antibody.
  • a “humanized antibody” refers to a type of engineered antibody having its CDRs derived from a non-human donor immunoglobulin, the remaining immunoglobulin-derived parts of the molecule being derived from one or more human immunoglobulin(s).
  • framework support residues may be altered to preserve binding affinity (see, e.g., Queen et al. Proc. Natl Acad Sci USA, 86:10029-10032 (1989), Hodgson, et al., Bio/Technology, 9:421 (1991)).
  • a suitable human acceptor antibody may be one selected from a conventional database, e.g., the KABATTM database, Los Alamos database, and Swiss Protein database, by homology to the nucleotide and amino acid sequences of the donor antibody.
  • a human antibody characterized by a homology to the framework regions of the donor antibody (on an amino acid basis) may be suitable to provide a heavy chain constant region and/or a heavy chain variable framework region for insertion of the donor CDRs.
  • a suitable acceptor antibody capable of donating light chain constant or variable framework regions may be selected in a similar manner. It should be noted that the acceptor antibody heavy and light chains are not required to originate from the same acceptor antibody.
  • the prior art describes several ways of producing such humanized antibodies—see, for example, EP-A-0239400 and EP-A-054951.
  • Fully human antibody includes antibodies having variable and constant regions (if present) derived from human germline immunoglobulin sequences.
  • the human sequence antibodies of the invention may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
  • Fully human antibodies comprise amino acid sequences encoded only by polynucleotides that are ultimately of human origin or amino acid sequences that are identical to such sequences.
  • antibodies encoded by human immunoglobulin-encoding DNA inserted into a mouse genome produced in a transgenic mouse are fully human antibodies since they are encoded by DNA that is ultimately of human origin.
  • human immunoglobulin-encoding DNA can be rearranged (to encode an antibody) within the mouse, and somatic mutations may also occur.
  • Antibodies encoded by originally human DNA that has undergone such changes in a mouse are fully human antibodies as meant herein.
  • the use of such transgenic mice makes it possible to select fully human antibodies against a human antigen.
  • fully human antibodies can be made using phage display technology wherein a human DNA library is inserted in phage for generation of antibodies comprising human germline DNA sequence.
  • donor antibody refers to an antibody that contributes the amino acid sequences of its variable regions, CDRs, or other functional fragments or analogs thereof to a first immunoglobulin partner.
  • the donor therefore, provides the altered immunoglobulin coding region and resulting expressed altered antibody with the antigenic specificity and neutralising activity characteristic of the donor antibody.
  • acceptor antibody refers to an antibody that is heterologous to the donor antibody, which contributes all (or any portion) of the amino acid sequences encoding its heavy and/or light chain framework regions and/or its heavy and/or light chain constant regions to the first immunoglobulin partner.
  • a human antibody may be the acceptor antibody.
  • V H and V L are used herein to refer to the heavy chain variable region and light chain variable region respectively of an antigen binding protein.
  • CDRs are defined as the complementarity determining region amino acid sequences of an antigen binding protein. These are the hypervariable regions of immunoglobulin heavy and light chains. There are three heavy chain and three light chain CDRs (or CDR regions) in the variable portion of an immunoglobulin. Thus, “CDRs” as used herein refers to all three heavy chain CDRs, all three light chain CDRs, all heavy and light chain CDRs, or at least two CDRs.
  • the minimum overlapping region using at least two of the Kabat, Chothia, AbM and contact methods can be determined to provide the “minimum binding unit”.
  • the minimum binding unit may be a sub-portion of a CDR.
  • Table 1 represents one definition using each numbering convention for each CDR or binding unit.
  • the Kabat numbering scheme is used in Table 1 to number the variable domain amino acid sequence. It should be noted that some of the CDR definitions may vary depending on the individual publication used.
  • ICOS binding proteins which comprises any one or a combination of the following CDRs:
  • CDRH1 DYAMH (SEQ ID NO: 2)
  • CDRH2 LISIYSDHTNYNQKFQG (SEQ ID NO: 3)
  • CDRH3 NNYGNYGWYFDV (SEQ ID NO: 4)
  • CDRL1 SASSSVSYMH (SEQ ID NO: 5)
  • CDRL2 DTSKLAS (SEQ ID NO: 6)
  • CDRL3 FQGSGYPYT
  • the ICOS binding protein comprises CDRH1 (SEQ ID NO:), CDRH2 (SEQ ID NO:2), and CDRH3 (SEQ ID NO:3) in the heavy chain variable region having the amino acid sequence set forth in SEQ ID NO:7.
  • ICOS binding proteins of the are designated as “H2.”
  • the ICOS binding proteins of the present invention comprise a heavy chain variable region having at least 90% sequence identity to SEQ ID NO:7.
  • the ICOS binding proteins of the present invention may comprise a heavy chain variable region having about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:7.
  • V H Humanized Heavy Chain
  • H2 Variable Region (H2): (SEQ ID NO: 7) QVQLVQSGAE VKKPGSSVKV SCKASGYTFT DYAMH WVRQA PGQGLEWMG L ISIYSDHTNY NQKFQG RVTI TADKSTSTAY MELSSLRSED TAVYYCGR NN YGNYGWYFDV WGQGTTVTVS SEQ ID NO: 7
  • the ICOS binding protein comprises CDRL1 (SEQ ID NO:4), CDRL2 (SEQ ID NO:5), and CDRL3 (SEQ ID NO:6) in the light chain variable region having the amino acid sequence set forth in SEQ ID NO:8.
  • ICOS binding proteins of the present invention comprising the humanized light chain variable region set forth in SEQ ID NO:8 are designated as “L5.”
  • an ICOS binding protein of the present invention comprising the heavy chain variable region of SEQ ID NO:7 and the light chain variable region of SEQ ID NO:8 can be designated as H2L5 herein.
  • a leader sequence for the variable heavy chain and light chain constructs is show in FIG. 9 and includes, but is not limited to: MGWSCIILFLVATATGVHS (SEQ ID NO: 11)
  • the ICOS binding proteins of the present invention comprise a light chain variable region having at least 90% sequence identity to the amino acid sequence set forth in SEQ ID NO:8.
  • the ICOS binding proteins of the present invention may comprise a light chain variable region having about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO:8.
  • V L Humanized Light Chain
  • L5 Variable Region (L5) (SEQ ID NO: 8)
  • EIVLTQSPAT LSLSPGERAT LSC SASSSVS YMH WYQQKPG QAPRLLIY DT SKLAS
  • GIPAR FSGSGSGTDY TLTISSLEPE
  • CDRs or minimum binding units may be modified by at least one amino acid substitution, deletion or addition, wherein the variant antigen binding protein substantially retains the biological characteristics of the unmodified protein, such as a murine antibody produced from clone 422.2 or an antibody comprising SEQ ID NO:7 and SEQ ID NO:8.
  • CDR H1, H2, H3, L1, L2, L3 may be modified alone or in combination with any other CDR, in any permutation or combination.
  • a CDR is modified by the substitution, deletion or addition of up to 3 amino acids, for example 1 or 2 amino acids, for example 1 amino acid.
  • the modification is a substitution, particularly a conservative substitution, for example as shown in Table 2 below.
  • the amino acid residues of the minimum binding unit may remain the same, but the flanking residues that comprise the CDR as part of the Kabat or Chothia definition(s) may be substituted with a conservative amino acid residue.
  • ICOS binding proteins comprising one or more CDRs having the amino acid sequences set forth in SEQ ID NOs:1, 2, 3, 4, 5, and/or 6 and/or a function CDR variant thereof.
  • epitope refers to that portion of the antigen that makes contact with a particular binding domain of the antigen binding protein.
  • An epitope may be linear or conformational/discontinuous.
  • a conformational or discontinuous epitope comprises amino acid residues that are separated by other sequences, i.e. not in a continuous sequence in the antigen's primary sequence. Although the residues may be from different regions of the peptide chain, they are in close proximity in the three dimensional structure of the antigen.
  • a conformational or discontinuous epitope may include residues from different peptide chains. Particular residues comprised within an epitope can be determined through computer modelling programs or via three-dimensional structures obtained through methods known in the art, such as X-ray crystallography.
  • the CDRs L1, L2, L3, H1 and H2 tend to structurally exhibit one of a finite number of main chain conformations.
  • the particular canonical structure class of a CDR is defined by both the length of the CDR and by the loop packing, determined by residues located at key positions in both the CDRs and the framework regions (structurally determining residues or SDRs). Martin and Thornton (1996; J Mol Biol 263:800-815) have generated an automatic method to define the “key residue” canonical templates.
  • Cluster analysis is used to define the canonical classes for sets of CDRs, and canonical templates are then identified by analysing buried hydrophobics, hydrogen-bonding residues, classes by comparing the sequences to the key residue templates and scoring each template using identity or similarity matrices.
  • the particular canonical structure class of a CDR is defined by both the length of the CDR and by the loop packing, determined by residues located at key positions in both the CDRs and the framework regions.
  • Percent identity between a query nucleic acid sequence and a subject nucleic acid sequence is the “Identities” value, expressed as a percentage, that is calculated by the BLASTN algorithm when a subject nucleic acid sequence has 100% query coverage with a query nucleic acid sequence after a pair-wise BLASTN alignment is performed.
  • Such pair-wise BLASTN alignments between a query nucleic acid sequence and a subject nucleic acid sequence are performed by using the default settings of the BLASTN algorithm available on the National Center for Biotechnology Institute's website with the filter for low complexity regions turned off.
  • a query nucleic acid sequence may be described by a nucleic acid sequence identified in one or more claims herein.
  • Percent identity between a query amino acid sequence and a subject amino acid sequence is the “Identities” value, expressed as a percentage, that is calculated by the BLASTP algorithm when a subject amino acid sequence has 100% query coverage with a query amino acid sequence after a pair-wise BLASTP alignment is performed.
  • Such pair-wise BLASTP alignments between a query amino acid sequence and a subject amino acid sequence are performed by using the default settings of the BLASTP algorithm available on the National Center for Biotechnology Institute's website with the filter for low complexity regions turned off.
  • a query amino acid sequence may be described by an amino acid sequence identified in one or more claims herein.
  • the query sequence may be 100% identical to the subject sequence, or it may include up to a certain integer number of amino acid or nucleotide alterations as compared to the subject sequence such that the % identity is less than 100%.
  • the query sequence is at least 50, 60, 70, 75, 80, 85, 90, 95, 96, 97, 98, or 99% identical to the subject sequence.
  • Such alterations include at least one amino acid deletion, substitution (including conservative and non-conservative substitution), or insertion, and wherein said alterations may occur at the amino- or carboxy-terminal positions of the query sequence or anywhere between those terminal positions, interspersed either individually among the amino acids or nucleotides in the query sequence or in one or more contiguous groups within the
  • the % identity may be determined across the entire length of the query sequence, including the CDR(s). Alternatively, the % identity may exclude the CDR(s), for example the CDR(s) is 100% identical to the subject sequence and the % identity variation is in the remaining portion of the query sequence, so that the CDR sequence is fixed/intact.
  • the variant sequence substantially retains the biological characteristics of the unmodified protein, such as SEQ ID NO:7 or SEQ ID NO:8.
  • the V H or V L sequence may be a variant sequence with up to 15 amino acid substitutions, additions or deletions.
  • the variant sequence may have up to 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid substitution(s), addition(s) or deletion(s).
  • the sequence variation may exclude the CDR(s), for example the CDR(s) is the same as the V H or V L (or HC or LC) sequence and the variation is in the remaining portion of the V H or V L (or HC or LC) sequence, so that the CDR sequence is fixed/intact.
  • an antigen binding protein such as an antibody
  • post-translational modifications may occur upon production of an antigen binding protein such as an antibody, in particular depending on the cell line used and particular amino acid sequence of the antigen binding protein. For example, this may include the cleavage of certain leader sequences, the addition of various sugar moieties in various glycosylation and phosphorylation patterns, deamidation, oxidation, disulfide bond scrambling, isomerisation, C-terminal lysine clipping, and N-terminal glutamine cyclisation.
  • the present invention encompasses the use of antigen binding proteins which have been subjected to, or have undergone, one or more post-translational modifications.
  • an “antigen binding protein” or “antibody” of the invention includes an “antigen binding protein” or “antibody”, respectively, as defined earlier which has undergone a post-translational modification such as described herein.
  • Deamidation is an enzymatic reaction primarily converting asparagine (N) to iso-aspartic acid and aspartic acid (D) at approximately 3:1 ratio. To a much lesser degree, deamidation can occur with glutamine residues in a similar manner. Deamidation in a CDR results in a change in charge of the molecule, but typically does not result in a change in antigen binding, nor does it impact on PK/PD.
  • Oxidation can occur during production and storage (i.e. in the presence of oxidizing conditions) and results in a covalent modification of a protein, induced either directly by reactive oxygen species or indirectly by reaction with secondary by-products of oxidative stress. Oxidation happens primarily with methionine residues, but occasionally can occur at tryptophan and free cysteine residues.
  • Disulfide bond scrambling can occur during production and basic storage conditions. Under certain circumstances, disulfide bonds can break or form incorrectly, resulting in unpaired cysteine residues (—SH). These free (unpaired) sulfhydryls (—SH) can promote shuffling.
  • Isomerization typically occurs during production, purification, and storage (at acidic pH) and usually occurs when aspartic acid is converted to isoaspartic acid through a chemical process.
  • pGlu N-terminal glutamine in the heavy chain and/or light chain is likely to form pyroglutamate (pGlu).
  • C-terminal lysine clipping is an enzymatic reaction catalyzed by carboxypeptidases, and is commonly observed in recombinant mAbs. Variants of this process include removal of lysine from one or both heavy chains. Lysine clipping does not appear to impact bioactivity and has no effect on mAb effector function.
  • Naturally occurring autoantibodies exist in humans that can bind to proteins. Autoantibodies can thus bind to endogenous proteins (present in na ⁇ ve subjects) as well as to proteins or peptides which are administered to a subject for treatment.
  • Therapeutic protein-binding autoantibodies and antibodies that are newly formed in response to drug treatment are collectively termed anti-drug antibodies (ADAs).
  • ADAs anti-drug antibodies
  • Pre-existing antibodies against molecules such as therapeutic proteins and peptides, administered to a subject can affect their efficacy and could result in administration reactions, hypersensitivity, altered clinical response in treated patients and altered bioavailability by sustaining, eliminating or neutralizing the molecule.
  • molecules for therapy which comprise human immunoglobulin (antibody) single variable domains or dAbsTM which have reduced immunogenicity (i.e. reduced ability to bind to pre-existing ADAs when administered to a subject, in particular a human subject.
  • a modified dAbTM which has reduced ability to bind to pre-existing antibodies (ADAs) as compared to the equivalent unmodified molecule.
  • reduced ability to bind it is meant that the modified molecule binds with a reduced affinity or reduced avidity to a pre-existing ADA.
  • Said modified dAbTM comprise one or more modifications selected from: (a) a C-terminal addition, extension, deletion or tag, and/or (b) one or more amino acid framework substitutions.
  • Polypeptides and dAbsTM of the disclosure and agonists comprising these can be formatted to have a larger hydrodynamic size, for example, by attachment of a PEG group, serum albumin, transferrin, transferrin receptor or at least the transferrin-binding portion thereof, an antibody Fc region, or by conjugation to an antibody domain.
  • polypeptides dAbsTM and agonists may be formatted as a larger antigen-binding fragment of an antibody or as an antibody (e.g., formatted as a Fab, Fab′, F(ab) 2 , F(ab′) 2 , IgG, scFv).
  • hydrodynamic size refers to the apparent size of a molecule (e.g., an diffusion or motion of a protein through solution can be processed to derive an apparent size of the protein, where the size is given by the “Stokes radius” or “hydrodynamic radius” of the protein particle.
  • the “hydrodynamic size” of a protein depends on both mass and shape (conformation), such that two proteins having the same molecular mass may have differing hydrodynamic sizes based on the overall conformation and charge of the protein. An increase in hydrodynamic size can give an associated decrease in renal clearance leading to an observed increase in half life (t 1/2 ).
  • Hydrodynamic size of the antigen binding proteins (e.g., domain antibody monomers and multimers) of the disclosure may be determined using methods which are well known in the art. For example, gel filtration chromatography may be used to determine the hydrodynamic size of an antigen binding protein. Suitable gel filtration matrices for determining the hydrodynamic sizes of antigen binding proteins, such as cross-linked agarose matrices, are well known and readily available.
  • an antigen binding protein format e.g., the size of a PEG moiety attached to a domain antibody monomer
  • size of a PEG moiety attached to a domain antibody monomer can be varied depending on the desired application. For example, where antigen binding protein is intended to leave the circulation and enter into peripheral tissues, it is desirable to keep the hydrodynamic size of the ICOS binding protein low to facilitate extravazation from the blood stream. Alternatively, where it is desired to have the antigen binding protein remain in the systemic circulation for a longer period of time the size of the antigen binding protein can be increased, for example by formatting as an Ig like protein.
  • Antigen binding protein as described herein may be incorporated into pharmaceutical compositions for use in the treatment of the human diseases described herein.
  • the pharmaceutical composition comprises an antigen binding protein optionally in combination with one or more pharmaceutically acceptable carriers and/or excipients.
  • compositions comprise a pharmaceutically acceptable carrier as known and called for by acceptable pharmaceutical practice.
  • compositions may be administered by injection or continuous infusion (examples include, but are not limited to, intravenous, intraperitoneal, intradermal, subcutaneous, intramuscular and intraportal).
  • the composition is suitable for intravenous administration.
  • Pharmaceutical compositions may be suitable for topical administration (which includes, but is not limited to, epicutaneous, inhaled, intranasal or ocular administration) or enteral administration (which includes, but is not limited to, oral or rectal administration).
  • compositions may comprise between 0.5 mg to 10 g of ICOS binding protein, for example between 5 mg and 1 g of antigen binding protein.
  • the composition may comprise between 5 mg and 500 mg, for example between 5 mg and 50 mg.
  • Effective doses and treatment regimes for administering the antigen binding protein may be dependent on factors such as the age, weight and health status of the patient and disease to be treated. Such factors are within the purview of the attending physician. Guidance in selecting appropriate doses may be found in e.g Bai et al., (2012).
  • the pharmaceutical composition may comprise a kit of parts of the antigen binding protein together with other medicaments, optionally with instructions for use.
  • the kit may comprise the reagents in predetermined amounts with instructions for use.
  • the terms “individual”, “subject” and “patient” are used herein interchangeably.
  • the subject is a mammal, such as a primate, for example a marmoset or monkey.
  • the subject is a human.
  • the antigen binding protein described herein may also be used in methods of treatment.
  • Treatment can be therapeutic, prophylactic or preventative. Treatment encompasses alleviation, reduction, or prevention of at least one aspect or symptom of a disease and encompasses prevention or cure of the diseases described herein.
  • the ICOS binding protein or antigen binding portion thereof described herein is used in an effective amount for therapeutic, prophylactic or preventative treatment.
  • a therapeutically effective amount of the ICOS binding protein or antigen binding portion thereof described herein is an amount effective to ameliorate or reduce one or more symptoms of, or to prevent or cure, the disease.
  • ICOS binding proteins or antigen binding portions thereof of the present invention are provided for use in therapy.
  • ICOS binding proteins or antigen binding portions thereof of the present invention are provided for use in the treatment of cancer, infectious disease and/or sepsis.
  • the present invention also provides the use of an ICOS binding protein or antigen binding portion thereof of the present invention in the manufacture of a medicament for the treatment of cancer, infectious disease and/or sepsis.
  • Antigen binding proteins may be prepared by any of a number of conventional techniques. antibody can be purified from a hybridoma that produces it), or produced in recombinant expression systems.
  • a number of different expression systems and purification regimes can be used to generate the antigen binding protein of the invention.
  • host cells are transformed with a recombinant expression vector encoding the desired antigen binding protein.
  • a wide range of host cells can be employed, including Prokaryotes (including Gram negative or Gram positive bacteria, for example Escherichia coli, Bacilli sp., Pseudomonas sp., Corynebacterium sp.), Eukaryotes including yeast (for example Saccharomyces cerevisiae, Pichia pastoris ), fungi (for example Aspergillus sp.), or higher Eukaryotes including insect cells and cell lines of mammalian origin (for example, CHO, Perc6, HEK293, HeLa).
  • the host cell may be an isolated host cell.
  • the host cell is usually not part of a multicellular organism (e.g., plant or animal).
  • the host cell may be a non-human host cell.
  • the cells can be cultured under conditions that promote expression of the antigen binding protein, and the polypeptide recovered by conventional protein purification procedures.
  • the antigen binding proteins contemplated for use herein include substantially homogeneous antigen binding proteins substantially free of contaminating materials.
  • post-translational modifications may occur upon production of the antigen binding protein, in particular depending on the cell line used and particular amino acid sequence of the antigen binding protein. This may include the cleavage of certain leader sequences, the addition of various sugar moieties in various glycosylation patterns, deamidation (for example at an asparagine or glutamine residue), oxidation (for example at a methionine, tryptophan or free cysteine residue), disulfide bond scrambling, isomerisation (for example at an aspartic acid residue), C-terminal lysine clipping (for example from one or both heavy chains), and N-terminal glutamine cyclisation (for example in the heavy and/or light chain).
  • the present invention encompasses the use of antibodies which have been subjected to, or have undergone, one or more post-translational modifications.
  • the modification may occur in a CDR, the variable framework region, or the constant region.
  • the modification may result in a change in charge of the molecule.
  • the modification typically does not result in a change in antigen binding, function, bioactivity, nor does it impact the pharmacokinetic (PK) or pharmacodynamic (PD) characteristics of the ICOS binding protein.
  • ADCC Antibody dependant cell mediated cytotoxic activity
  • CDC Complement-dependant cytotoxic activity
  • ADCP antibody dependant cellular phagocytosis
  • FcR Fc receptors
  • FcR Fc receptors
  • CD64 Fc ⁇ RI
  • Fc ⁇ RII CD32
  • Fc ⁇ RIII CD16
  • Effector function can be measured in a number of ways including for example via binding of the Fc ⁇ RIII on Natural Killer cells or via Fc ⁇ RI on monocytes/macrophages to measure for ADCC/ADCP effector function.
  • an antigen binding protein of the present invention can be assessed for ADCC effector function in a Natural Killer cell assay.
  • Practical approaches to evaluate ADCC and/or CDC function can be found in (Kellner C et al., “Boosting ADCC and CDC activity by Fc engineering and evaluation of antibody effector functions”, Methods, 1; 65(1):105-13 (2014))
  • IgG4 and IgG2 isotypes have reduced function of a) activation of complement by the classical pathway; and b) antibody-dependent cellular cytotoxicity.
  • Various modifications to the heavy chain constant region of antigen binding proteins may be carried out depending on the desired effector property.
  • IgG1 constant regions containing specific mutations have separately been described to reduce binding to Fc receptors and therefore reduce ADCC and CDC.
  • an antigen binding protein comprising a constant region such that the antigen binding protein has reduced ADCC and/or complement activation or effector functionality.
  • the heavy chain constant region may comprise a naturally disabled constant region of IgG2 or IgG4 isotype or a mutated IgG1 constant region.
  • One example comprises the substitutions of alanine residues at positions 235 and 237 (EU index numbering).
  • the subclass of an antibody determines secondary effector functions, such as complement activation or Fc receptor (FcR) binding and antibody dependent cell cytotoxicity (ADCC) (Huber, et al., Nature 229(5284): 419-20 (1971); Brunhouse, et al., Mol Immunol 16(11): 907-17 (1979)).
  • FcR complement activation or Fc receptor
  • ADCC antibody dependent cell cytotoxicity
  • the effector functions of the antibodies can be taken into account.
  • hIgG1 antibodies have a relatively long half life, are very effective at fixing complement, and they bind to both Fc ⁇ RI and lower affinity for the FcRs.
  • ICOS antigen binding proteins comprising an IgG4 Fc region comprising the replacement S228P and L235E may have the designation IgG4PE.
  • an ICOS binding protein having the heavy chain variable region H2 and the light chain variable region L5 and an IgG4PE Fc region will be designated as H2L5 IgG4PE or synonymously as H2L5 hIgG4PE.
  • ADCC/CDC enhancing techniques may be applied to the ICOS binding proteins of the present invention.
  • such mutations are in one or more of positions selected from 239, 332 and 330 (IgG1), or the equivalent positions in other IgG isotypes.
  • suitable mutations are S239D and I332E and A330L.
  • the antigen binding protein of the invention herein described is mutated at positions 239 and 332, for example S239D and I332E or in a further embodiment it is mutated at three or more positions selected from 239 and 332 and 330, for example S239D and I332E and A330L (EU index numbering).
  • an antigen binding protein comprising a chimeric heavy chain constant region for example an antigen binding protein comprising a chimeric heavy chain constant region with at least one CH2 domain from IgG3 such that the antigen binding protein has enhanced effector function, for example wherein it has enhanced ADCC or enhanced CDC, or enhanced ADCC and CDC functions.
  • the antigen binding protein may comprise one CH2 domain from IgG3 or both CH2 domains may be from IgG3.
  • Such methods for the production of antigen binding proteins can be performed, for example, using the COMPLEGENTTM technology system available from BioWa, Inc. (Princeton, N.J.) and Kyowa Hakko Kogyo (now, Kyowa Hakko Kirin Co., Ltd.) Co., Ltd.
  • a recombinant host cell comprising an expression vector in which a nucleic acid sequence encoding a chimeric Fc domain having both IgG1 and IgG3 Fc domain amino acid residues is expressed to produce an antigen binding protein having enhanced complement dependent cytotoxicity (CDC) activity that is increased relative to an otherwise identical antigen binding protein lacking such a chimeric Fc domain.
  • CDC complement dependent cytotoxicity
  • CDC activity may be increased by introducing sequence specific mutations into the Fc region of an IgG chain.
  • the present invention also provides a method for the production of an antigen binding protein according to the invention comprising the steps of:
  • Such methods for the production of antigen binding proteins can be performed, for example, using the POTELLIGENTTM technology system available from BioWa, Inc. (Princeton, N.J.) in which CHOK1SV cells lacking a functional copy of the FUT8 gene produce monoclonal antibodies having enhanced antibody dependent cell mediated cytotoxicity (ADCC) activity that is increased relative to an identical monoclonal antibody produced in a cell with a functional FUT8 gene.
  • ADCC antibody dependent cell mediated cytotoxicity
  • an antigen binding protein comprising a heavy chain constant region which comprises a mutated and chimaeric heavy chain constant region for example wherein an antigen binding protein comprising at least one CH2 domain from IgG3 and one CH2 domain from IgG1, wherein the IgG1 CH2 domain has one or more mutations at positions selected from 239 and 332 and 330 (for example the mutations may be selected from S239D and I332E and A330L) such that the antigen binding protein has enhanced effector function, for example wherein it has one or more of the following functions, enhanced ADCC or enhanced CDC, for example wherein it has enhanced ADCC and enhanced CDC.
  • the IgG1 CH2 domain has the mutations S239D and I332E.
  • an antigen binding protein comprising a chimaeric heavy chain constant region and which has an altered glycosylation profile.
  • the heavy chain constant region comprises at least one CH2 domain from IgG3 and one CH2 domain from IgG1 and has an altered glycosylation profile such that the ratio of fucose to mannose is 0.8:3 or less, for example wherein the antigen binding protein is defucosylated so that said antigen binding protein has an enhanced effector function in comparison with an equivalent antigen binding protein with an immunoglobulin heavy chain constant region lacking said mutations and altered glycosylation profile, for example wherein it has one or more of the following functions, enhanced ADCC or enhanced CDC, for example wherein it has enhanced ADCC and enhanced CDC
  • the antigen binding protein has at least one IgG3 CH2 domain and at least one heavy chain constant domain from IgG1 wherein both IgG CH2 domains are mutated in accordance with the limitations described herein.
  • Such methods for the production of antigen binding proteins can be performed, for example, using the ACCRETAMABTM technology system available from BioWa, Inc. (Princeton, N.J.) which combines the POTELLIGENTTM and COMPLEGENTTM technology systems to produce an antigen binding protein having both ADCC and CDC enhanced activity that is increased relative to an otherwise identical monoclonal antibody lacking a chimeric Fc domain and which has fucose on the oligosaccharide
  • an antigen binding protein comprising a mutated and chimeric heavy chain constant region wherein said antigen binding protein has an altered glycosylation profile such that the antigen binding protein has enhanced effector function, for example wherein it has one or more of the following functions, enhanced ADCC or enhanced CDC.
  • the mutations are selected from positions 239 and 332 and 330, for example the mutations are selected from S239D and I332E and A330L.
  • the heavy chain constant region comprises at least one CH2 domain from IgG3 and one Ch2 domain from IgG1.
  • the heavy chain constant region has an altered glycosylation profile such that the ratio of fucose to mannose is 0.8:3 or less for example the antigen binding protein is defucosylated, so that said antigen binding protein has an enhanced effector function in comparison with an equivalent non-chimaeric antigen binding protein or with an immunoglobulin heavy chain constant region lacking said mutations and altered glycosylation profile.
  • Another means of modifying antigen binding proteins of the present invention involves increasing the in-vivo half life of such proteins by modification of the immunoglobulin constant domain or FcRn (Fc receptor neonate) binding domain.
  • FcRn also known as the neonatal Fc receptor
  • IgG molecules are endocytosed by endothelial cells, and if they bind to FcRn, are recycled out into circulation.
  • IgG molecules that do not bind to FcRn enter the cells and are targeted to the lysosomal pathway where they are degraded.
  • the neonatal FcRn receptor is believed to be involved in both antibody clearance and the transcytosis across tissues, Kuo and Aveson, (2011).
  • Human IgG1 residues determined to interact directly with human FcRn includes Ile253, Ser254, Lys288, Thr307, Gln311, Asn434 and His435. Switches at any of these positions described in this section may enable increased serum half-life and/or altered effector properties of antigen binding proteins of the invention.
  • Antigen binding proteins of the present invention may have one or more amino acid modifications that increase the affinity of the constant domain or fragment thereof for FcRn. These may result in increased half-life of these proteins Kuo and Aveson (2011) Increasing the half-life of therapeutic and diagnostic IgG's and other bioactive molecules has many benefits including reducing the amount and/or frequency of dosing of these molecules.
  • an antigen binding according to the invention provided herein or a fusion protein comprising all or a portion (an FcRn binding portion) of an IgG constant domain having one or more of these amino acid modifications and a non-IgG protein or non-protein molecule conjugated to such a modified IgG constant domain, wherein the presence of the modified IgG constant domain increases the in vivo half life of the antigen binding protein.
  • amino acid modifications may be generated through techniques including alanine scanning mutagenesis, random mutagenesis and screening to assess the binding to FcRn and/or the in vivo behaviour. Computational strategies followed by mutagenesis may also be used to select one of amino acid mutations to mutate.
  • the present invention therefore provides a variant of an antigen binding protein with optimized binding to FcRn.
  • the said variant of an antigen binding protein comprises at least one amino acid modification in the Fc region of said antigen binding protein, wherein said modification is selected from the group consisting of 226, 227, 228, 230, 231, 233, 234, 239, 241, 243, 246, 250, 252, 256, 259, 264, 265, 267, 269, 270, 276, 284, 285, 288, 289, 290, 291, 292, 294, 297, 298, 299, 301, 302, 303, 305, 307, 308, 309, 311, 315, 317, 320, 322, 325, 327, 330, 332, 334, 335, 338, 340, 342, 343, 345, 347, 350, 352, 354, 355, 356, 359, 360, 361, 362, 369, 370, 371, 375, 378, 380, 382, 384, 3
  • the modifications are M252Y/S254T/T256E.
  • substitutions in the constant region are able to significantly improve the functions of therapeutic IgG antibodies, substitutions in the strictly conserved constant region have the risk of immunogenicity in human and substitution in the highly diverse variable region sequence might be less immunogenic.
  • Reports concerned with the variable region include engineering the CDR residues to improve binding affinity to the antigen and engineering, the CDR and framework residues to improve stability and decrease immunogenicity risk.
  • improved affinity to the antigen can be achieved by affinity maturation using the phage or ribosome display of a randomized library.
  • Improved stability can be rationally obtained from sequence- and structure-based rational design.
  • Decreased immunogenicity risk can be accomplished by various humanization methodologies and the removal of T-cell epitopes, which can be predicted using in silico technologies or determined by in vitro assays. Additionally, variable regions have been engineered to lower pi. A longer half life was observed for these antibodies as compared to wild type antibodies despite comparable FcRn binding.
  • Engineering or selecting antibodies with pH dependent antigen binding to modify antibody and/or antigen half life eg IgG2 antibody half life can be shortened if antigen-mediated clearance mechanisms normally degrade the antibody when bound to the antigen.
  • the antigen:antibody complex can impact the half-life of the antigen, either extending half-life by protecting the antigen from the typical degradation processes, or shortening the half-life via antibody-mediated degradation.
  • One embodiment relates to antibodies with higher affinity for antigen at pH 7.4 as compared to endosomal pH (i.e., pH 5.5-6.0) such that the KD ratio at pH5.5/pH 7.4 or at pH 6.0/pH 7.4 is 2 or more.
  • PK pharmacokinetic
  • PD pharmacodynamic
  • a variant IgG in which His435 is mutated to alanine results in the selective loss of FcRn binding and a significantly reduced serum half-life
  • U.S. Pat. No. 6,165,745 discloses a method of producing an antigen binding protein with a decreased biological half-life by introducing a mutation into the DNA segment encoding the antigen binding protein.
  • the mutation includes an amino acid substitution at position 253, 310, 311, 433, or 434 of the Fc-hinge domain.
  • Protein scaffolds may be the same as naturally occurring sequences, such as Ig sequences, or be fragments of naturally occurring sequences, and may contain additional sequences which may be naturally occurring, from a difference source or synthetic, and which may be added at the N or C terminus of the scaffold. Such additional sequences may be considered to be linkers when they link an epitope binding domain and protein scaffold, such as those defined herein.
  • the antigen binding construct consists of, or consists essentially of, an Fc region of an antibody, or a part thereof, linked at each end, directly or indirectly (for example, via a linker sequence) to an epitope binding domain.
  • an antigen binding construct may comprise 2 epitope-binding domains separated by an Fc region, or part thereof. By separated is meant that the epitope-binding domains are not directly linked to one another, and in one aspect are located at opposite ends (C and N terminus) of an Fc region, or any other scaffold region.
  • the antigen binding construct comprises 2 scaffold regions each bound to 2 epitope binding domains, for example at the N and C termini of each scaffold region, either directly or indirectly via a linker.
  • Protein scaffolds of the present invention may be linked to epitope-binding domains by the use of linkers.
  • suitable linkers include amino acid sequences which may be from 1 amino acid to 150 amino acids in length, or from 1 amino acid to 140 amino acids, for example, from 1 amino acid to 130 amino acids, or from 1 to 120 amino acids, or from 1 to 80 amino acids, or from 1 to 50 amino acids, or from 1 to 20 amino acids, or from 1 to 10 amino acids, or from 5 to 18 amino acids.
  • Such sequences may have their own tertiary structure, for example, a linker of the present invention may comprise a single variable domain. The size of a linker in one embodiment is equivalent to a single variable domain.
  • Suitable linkers may be of a size from 1 to 100 angstroms, for example may be of a size from 20 to 80 angstroms or for example may be of a size from 20 to 60 angstroms or for example less than 40 angstroms, or less than 20 angstroms, or less than 5 angstroms in length.
  • ICOS binding proteins comprising one or more of: CDRH1 as set forth in SEQ ID NO:1; CDRH2 as set forth in SEQ ID NO:2; CDRH3 as set forth in SEQ ID NO:3; CDRL1 as set forth in SEQ ID NO:4; CDRL2 as set forth in SEQ ID NO:5 and/or CDRL3 as set forth in SEQ ID NO:6 or a direct equivalent of each CDR wherein a direct equivalent has no more than two amino acid substitutions in said CDR.
  • ICOS binding proteins are provided which specifically binds to human ICOS comprising a V H domain comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO:7 and/or a V L domain comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO:8.
  • the ICOS binding proteins of the present invention also bind to cynomolgus ICOS. In one aspect, they do not bind to murine ICOS.
  • the ICOS binding proteins of the invention are ICOS agonists. In one aspect, the ICOS binding proteins increase IFN-gamma production in the presence of Tcells. In another aspect, the ICOS binding proteins of the present invention stimulate Tcell proliferation.
  • the ICOS binding protein of the invention bind to human ICOS with
  • the ICOS binding protein comprises CDRH3 (SEQ ID NO:3) or a variant of SEQ ID NO. 3.
  • the ICOS binding proteins comprise one or more of: CDRH1 (SEQ ID NO:1); CDRH2 (SEQ ID NO:2); CDRH3 (SEQ ID NO:3); CDRL1 (SEQ ID NO:4); CDRL2 (SEQ ID NO:5); and/or CDRL3 (SEQ ID NO:6).
  • the ICOS binding proteins comprise heavy chain CDRs as set forth in SEQ ID NO: 1; SEQ ID NO:2; and SEQ ID NO:3 and light chain CDRs as set forth in SEQ ID NO:4; SEQ ID NO:5; and SEQ ID NO:6.
  • the ICOS binding proteins comprise a V H domain having 90% sequence identity to the amino acid sequence set forth in SEQ ID NO:7; and a V L domain having 90% sequence identity to the amino acid sequence shown in the amino acid sequence set forth in SEQ ID NO:8.
  • the ICOS binding proteins comprise a V H domain having the amino acid sequence set forth in SEQ ID NO.7 and the V L domain comprising the amino acid sequence as set forth in SEQ ID NO:8.
  • the ICOS binding proteins comprise a heavy chain variable domain consisting of SEQ ID NO:7.
  • the ICOS binding protein comprises a light chain variable domain consisting of SEQ ID NO:8.
  • the invention provides an ICOS binding protein or antigen binding portion thereof comprising a V H domain comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO:7; and a V L domain comprising an amino acid sequence at least 90% identical to the amino acid sequence as set forth in SEQ ID NO:8 wherein said ICOS binding protein or antigen binding portion thereof specifically binds to human ICOS.
  • the ICOS binding protein or antigen binding portion thereof comprising a V H domain comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO:7; and a V L domain comprising an amino acid sequence at least 90% identical to the amino acid sequence as set forth in SEQ ID NO:8 wherein said ICOS binding protein or antigen binding portion thereof specifically binds to human ICOS further comprises heavy chain CDRs having the amino acid sequences set forth in SEQ ID NO:1; SEQ ID NO:2; and SEQ ID NO:3 and light chain CDRs having the amino acid sequences set forth in SEQ ID NO:4; SEQ ID NO:5; and SEQ ID NO:6.
  • the ICOS binding protein or antigen binding portion thereof comprises a V H domain comprising an amino acid sequence set forth in SEQ ID NO:7; and a V L domain comprises the amino acid sequence set forth in SEQ ID NO:8.
  • the ICOS binding protein or antigen binding portion thereof is an agonist to human ICOS.
  • the ICOS binding protein or antigen binding portion thereof further comprising an IgG4 isotype scaffold or a variant thereof.
  • the ICOS binding protein or antigen binding portion thereof comprises a hIgG4PE scaffold.
  • the ICOS binding protein of the present invention is a humanized monoclonal antibody comprising a heavy chain amino acid sequence having at least 90%, 91%, 92,%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence set forth in SEQ ID NO:23.
  • the ICOS binding protein of the present invention is a humanized monoclonal antibody comprising a light chain amino acid sequence having at least 90%, 91%, 92,%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence set forth in SEQ ID NO:24.
  • the ICOS binding protein of the present invention is a humanized monoclonal antibody comprising the heavy chain amino acid sequence set forth in SEQ ID NO:23 and the light chain amino acid sequence set forth in SEQ ID NO:24. In one embodiment, the ICOS binding protein of the present invention further comprises an hIgGPE scaffold.
  • the ICOS binding protein or antigen binding portion thereof wherein said ICOS binding protein is a humanized monoclonal antibody.
  • pharmaceutical compositions comprising the ICOS binding protein or antigen binding portion thereof of claim and a pharmaceutically acceptable carrier.
  • the present invention provides methods of treating a disease selected from cancer, infectious disease, and/or sepsis in a human in need thereof which method comprises the step of administering a pharmaceutical composition of the present invention said human.
  • the method further comprises administering at least one anti-neoplastic agent, at least one second immune-modulatory agent, and/or at least one immunostimulatory adjuvant to said human.
  • the second immuno-modulatory agent is selected from: an anti-CTLA4 antibody, and anti-PD-1 antibody, an anti-PDL1 antibody and an anti OX40 antibody.
  • the anti-CTLA4 antibody is ipilimumab.
  • the anti-PD-1 antibody is selected from pembrolizumab and/or nivolumab.
  • methods for treating cancer in a human comprising administering a therapeutically acceptable amount of the ICOS binding protein or antigen binding portion thereof to a human.
  • the cancer is selected from colorectal cancer (CRC), esophageal, cervical, bladder, breast, head and neck, ovarian, melanoma, renal cell carcinoma (RCC), EC squamous cell, non-small cell lung carcinoma, mesothelioma, and prostate cancer.
  • methods for treating infectious disease in a human comprising administering a therapeutically acceptable amount of the ICOS binding protein or antigen binding portion thereof to a human.
  • the infectious diseases is HIV.
  • methods for treating sepsis in a human comprising administering a therapeutically acceptable amount of the ICOS binding protein or antigen binding portion thereof to a human.
  • methods are provided for stimulating T cell proliferation, inducing T cell activation and/or inducing cytokine production in a human comprising administering a pharmaceutical composition of the invention to said human.
  • the present invention also provides polynucleotides encoding the ICOS binding protein or antigen binding portion thereof of the present invention.
  • host cells are provided comprising polynucleotides encoding the ICOS binding proteins or antigen binding portions thereof of the present invention.
  • the present invention also provides methods of making an ICOS binding protein or antigen binding portion thereof comprising the steps of a) culturing host cell comprising a polynucleotide encoding an ICOS binding protein or antigen binding portion thereof of the present invention under suitable conditions to express said ICOS binding protein or antigen binding portion thereof; and b) isolating said ICOS binding protein or antigen binding portion thereof.
  • the present invention provides an isolated humanized monoclonal antibody comprising a V H domain comprising an amino acid sequence set forth in SEQ ID NO:7; a V L domain comprising an amino acid sequence set forth in SEQ ID NO:8; and a hIgG4 scaffold or a variant thereof.
  • the hIgG4 scaffold is hIgG4PE.
  • ICOS binding proteins or antigen binding portions thereof are provided, wherein the ICOS binding protein or antigen binding portion thereof cross-competes for binding for human ICOS with a reference antibody or antigen binding portion thereof comprising a V H domain comprising an amino acid sequence set forth in SEQ ID NO:7; and a V L domain comprising the amino acid sequence set forth in SEQ ID NO:8.
  • the ICOS binding proteins of the invention stimulate T cell proliferation when placed in contact with a T cell. In one embodiment, the ICOS binding proteins of the invention induce T cell activation when placed in contact with a T cell. T cell activation can be measured by an increase in percent expression levels of certain activation markers such as, but not limited to, CD69, CD25, and/or OX40. In one embodiment, the ICOS binding proteins of the present invention stimulate cytokine production when placed in contact with a T cell. The ICOS binding proteins bind to human Fc ⁇ RIIb but do not bind to human Fc ⁇ -RIIa or human Fc ⁇ -RIIIa.
  • the ICOS binding proteins suitably do not deplete ICOS expressing T cells when contacted with ICOS expressing T cells.
  • the ICOS binding proteins cross-link a T cell with a second cell when contacted with said T cell in the presence of a second cell. This cross-linking can occur through engagement of the ICOS binding protein with a Fc ⁇ R on the second cell.
  • Fc ⁇ R expressing cells include, but are not limited to monocytes, B lymphocytes, follicular dendritic cells, natural killer cells, macrophages, neutrophils, eosinophils, basophils, and mast cells.
  • the ICOS binding proteins can be administered to a mammal wherein the ICOS binding protein will act as an agonist to ICOS on a T cell and will also engage an Fc ⁇ R on a second cell.
  • the ICOS binding proteins comprise a scaffold selected from human IgG1 isotype or variant thereof and human IgG4 isotype or variant thereof.
  • the scaffold comprises a human IgG4 isotype scaffold or variant thereof.
  • the scaffold comprises a hIgG4PE scaffold.
  • the ICOS binding protein is a monoclonal antibody.
  • the ICOS binding protein is a humanized monoclonal antibody.
  • the monoclonal antibodies of the present invention can be fully human.
  • the ICOS binding protein is a fragment which is a Fab, Fab′, F(ab′) 2 , Fv, diabody, triabody, tetrabody, miniantibody, minibody, isolated V H or isolated V L .
  • the ICOS binding protein is an antigen binding portion thereof.
  • the ICOS binding protein binds to human ICOS with an affinity of stronger than 0.6 nM. In one aspect, the affinity is 100 nM or stronger. In one embodiment the ICOS binding protein has a KD of 100 nM for ICOS. Suitably, the KD of the ICOS binding protein for ICOS is 100 nM or less, 50 nM or less, 25 nM or less, 10 nM or less, 2 nM or less or 1 nM or less.
  • the present invention provides humanized monoclonal antibodies that are agonists to human ICOS.
  • the present invention provides humanized monoclonal antibodies comprising heavy chain variable region CDRs having the amino acid sequences set forth in SEQ ID NO:1; SEQ ID NO:2; and SEQ ID NO:3 and light chain variable region CDRS having the amino acid sequences set forth in SEQ ID NO:4; SEQ ID NO:5; and SEQ ID NO:6.
  • the humanized monoclonal antibody is able to stimulate cytokine production and/or T cell proliferation when contacted with a T cell while not inducing complement, ADCC or CDC.
  • the humanized monoclonal antibody has variant human IgG1 Fc region.
  • the humanized monoclonal antibody has a human IgG4 Fc region or variant thereof. In one embodiment, the humanized monoclonal antibody has a hIgG4PE Fc region. In one aspect, the humanized monoclonal antibody comprises a V H domain comprising an amino acid sequence at least 90% identical to the amino acid sequence as set forth in SEQ ID NO:7; and a V L domain comprising an amino acid sequence at least 90% identical to the amino acid sequence as set forth in SEQ ID NO:8. In one aspect the humanized monoclonal antibody comprises a V H domain comprising an amino acid sequence set forth in SEQ ID NO:7; and a V L domain comprising the amino acid sequence as set forth in SEQ ID NO:8.
  • humanized monoclonal antibody comprises and hIgG4PE scaffold. Furthermore, humanized monoclonal antibodies of the present invention are shown to stimulate T cell proliferation when contacted with a CD4+ or a CD8+ T cell. Humanized monoclonal antibodies of the present invention are shown to induce T cell activation and stimulate cytokine production.
  • the humanized monoclonal antibody comprises an hIgG4PE scaffold and comprises a V H domain comprising an amino acid sequence set forth in SEQ ID NO:7 and a V L domain comprising an amino acid sequence set forth in SEQ ID NO:8.
  • the antibodies of the present invention may stimulate cytokine production when contacted with a T cell.
  • an ICOS binding protein that competes for ICOS binding with any one of the ICOS binding proteins of the invention.
  • binding competition can be measured by comparing competition for ligand binding to ICOS in the presence of one or more ICOS binding proteins.
  • ICOS is expressed on CD4+ and CD8+ T cells as well as Treg cells.
  • the ICOS binding proteins of the present invention act as agonist to ICOS on T cells. They also act to block the interaction between ICOS-L and ICOS expressed on both T cells and Treg cells.
  • methods are provided to block the interaction of ICOS-L with ICOS on Treg cells.
  • ICOS expressing Treg cells can be found in various types of tumors including liquid tumors such as lymphoma.
  • methods of treating a cancer comprising administering an ICOS binding protein of the invention wherein the ICOS binding protein blocks the interaction of ICOS-L
  • compositions comprising an ICOS binding protein or a monoclonal antibody described herein.
  • the pharmaceutical composition of the present invention further comprise at least one anti-neoplastic agent.
  • the pharmaceutical composition of the present invention further comprise at least one second immunomodulatory agent.
  • the pharmaceutical composition of the present invention further comprising at least one immunostimulatory adjuvant.
  • methods are provided for treating cancer and/or infectious disease in a human in need thereof wherein said method comprises the step of administering a pharmaceutical composition of the invention to said human.
  • the human has cancer.
  • the human has an infectious disease.
  • the human has HIV.
  • the method further comprises administering at least one anti-neoplastic agent to said human.
  • the method further comprises administering at least one second immune-modulatory agent to said human.
  • the method further comprises administering an immunostimulatory adjuvant to said human.
  • the human has a solid tumor.
  • the tumor is selected from head and neck cancer, gastric cancer, melanoma, renal cell carcinoma (RCC), esophageal cancer, non-small cell lung carcinoma, prostate cancer, colorectal cancer, ovarian cancer and pancreatic cancer.
  • the human has one or more of the following: colorectal cancer (CRC), esophageal, cervical, bladder, breast, head and neck, ovarian, melanoma, renal cell carcinoma (RCC), EC squamous cell, non-small cell lung carcinoma, mesothelioma, and prostate cancer.
  • the human has a liquid tumor such as diffuse large B cell lymphoma (DLBCL), multiple myeloma, chronic lyphomblastic leukemia (CLL), follicular lymphoma, acute myeloid leukemia and chronic myelogenous leukemia.
  • DLBCL diffuse large B cell lymphoma
  • CLL chronic lyphomblastic leukemia
  • follicular lymphoma acute myeloid leukemia and chronic myelogenous leukemia.
  • the present disclosure also relates to a method for treating or lessening the severity of a cancer selected from: brain (gliomas), glioblastomas, Bannayan-Zonana syndrome, Cowden disease, Lhermitte-Duclos disease, breast, inflammatory breast cancer, Wilm's tumor, Ewing's sarcoma, Rhabdomyosarcoma, ependymoma, medulloblastoma, colon, head and neck, kidney, lung, liver, melanoma, ovarian, pancreatic, prostate, sarcoma, osteosarcoma, giant cell tumor of bone, thyroid, lymphoblastic T-cell leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, hairy-cell leukemia, acute lymphoblastic leukemia, acute myelogenous leukemia, chronic neutrophilic leukemia, acute lymphoblastic T-cell leukemia, plasmacytoma, immunoblastic large cell leuk
  • treating means: (1) to ameliorate or prevent the condition of one or more of the biological manifestations of the condition, (2) to interfere with (a) one or more points in the biological cascade that leads to or is responsible for the condition or (b) one or more of the biological manifestations of the condition, (3) to alleviate one or more of the symptoms, effects or side effects associated with the condition or treatment thereof, (4) to slow the progression of the condition or one or more of the biological manifestations of the condition and/or (5) to cure said condition or one or more of the biological manifestations of the condition by eliminating or reducing to undetectable levels one or more of the biological manifestations of the condition for a period of time considered to be a state of remission for that manifestation without additional treatment over the period of remission.
  • prevention is not an absolute term. In medicine, “prevention” is understood to refer to the prophylactic administration of a drug to substantially diminish the likelihood or severity of a condition or biological manifestation thereof, or to delay the onset of such condition or biological manifestation thereof. Prophylactic therapy is appropriate, for example, when a subject is considered at high risk for developing cancer, such as when a subject has a strong family history of cancer or when a subject has been exposed to a carcinogen.
  • cancer As used herein, the terms “cancer,” “neoplasm,” and “tumor” are used interchangeably and, in either the singular or plural form, refer to cells that have undergone a malignant transformation that makes them pathological to the host organism.
  • Primary cancer cells can be readily distinguished from non-cancerous cells by well-established techniques, particularly histological examination.
  • the definition of a cancer cell includes not only a primary cancer cell, but any cell derived from a cancer cell ancestor. This includes metastasized cancer cells, and in vitro cultures and cell lines derived from cancer cells.
  • a “clinically detectable” tumor is one that is detectable on the basis of tumor mass; e.g., by procedures such as computed tomography (CT) scan, magnetic resonance imaging (MRI), X-ray, ultrasound or palpation on physical examination, and/or which is detectable because of the expression of one or more cancer-specific antigens in a sample obtainable from a patient.
  • CT computed tomography
  • MRI magnetic resonance imaging
  • X-ray X-ray
  • ultrasound or palpation e.g., ultrasound or palpation on physical examination
  • Tumors may be a hematopoietic (or hematologic or hematological or blood-related) cancer, for example, cancers derived from blood cells or immune cells, which may be referred to as “liquid tumors.”
  • liquid tumors Specific examples of clinical conditions based on hematologic tumors include leukemias such as chronic myelocytic leukemia, acute myelocytic leukemia, chronic lymphocytic leukemia and acute Waldenstrom's macroglobulinemia; lymphomas such as non-Hodgkin's lymphoma, Hodgkin's lymphoma; and the like.
  • the cancer may be any cancer in which an abnormal number of blast cells or unwanted cell proliferation is present or that is diagnosed as a hematological cancer, including both lymphoid and myeloid malignancies.
  • Myeloid malignancies include, but are not limited to, acute myeloid (or myelocytic or myelogenous or myeloblastic) leukemia (undifferentiated or differentiated), acute promyeloid (or promyelocytic or promyelogenous or promyeloblastic) leukemia, acute myelomonocytic (or myelomonoblastic) leukemia, acute monocytic (or monoblastic) leukemia, erythroleukemia and megakaryocytic (or megakaryoblastic) leukemia.
  • leukemias may be referred together as acute myeloid (or myelocytic or myelogenous) leukemia (AML).
  • Myeloid malignancies also include myeloproliferative disorders (MPD) which include, but are not limited to, chronic myelogenous (or myeloid) leukemia (CML), chronic myelomonocytic leukemia (CMML), essential thrombocythemia (or thrombocytosis), and polcythemia vera (PCV).
  • CML chronic myelogenous leukemia
  • CMML chronic myelomonocytic leukemia
  • PCV polcythemia vera
  • Myeloid malignancies also include myelodysplasia (or myelodysplastic syndrome or MDS), which may be referred to as refractory anemia (RA), refractory anemia with excess blasts (RAEB), and refractory anemia with excess blasts in transformation (RAEBT); as well as myelofibrosis (MFS) with or without agnogenic myeloid metaplasia.
  • myelodysplasia or myelodysplastic syndrome or MDS
  • MDS myelodysplasia
  • RA refractory anemia
  • RAEB refractory anemia with excess blasts
  • RAEBT refractory anemia with excess blasts in transformation
  • MFS myelofibrosis
  • Hematopoietic cancers also include lymphoid malignancies, which may affect the lymph nodes, spleens, bone marrow, peripheral blood, and/or extranodal sites.
  • Lymphoid cancers include B-cell malignancies, which include, but are not limited to, B-cell non-Hodgkin's lymphomas (B-NHLs).
  • B-NHLs may be indolent (or low-grade), intermediate-grade (or aggressive) or high-grade (very aggressive).
  • Indolent Bcell lymphomas include follicular lymphoma (FL); small lymphocytic lymphoma (SLL); marginal zone lymphoma (MZL) including nodal MZL, extranodal MZL, splenic MZL and splenic MZL with villous lymphocytes; lymphoplasmacytic lymphoma (LPL); and mucosa-associated-lymphoid tissue (MALT or extranodal marginal zone) lymphoma.
  • FL follicular lymphoma
  • SLL small lymphocytic lymphoma
  • MZL marginal zone lymphoma
  • LPL lymphoplasmacytic lymphoma
  • MALT mucosa-associated-lymphoid tissue
  • Intermediate-grade B-NHLs include mantle cell lymphoma (MCL) with or without leukemic involvement, diffuse large cell lymphoma (DLBCL), follicular large cell (or grade 3 or grade 3B) lymphoma, and primary mediastinal lymphoma (PML).
  • MCL mantle cell lymphoma
  • DLBCL diffuse large cell lymphoma
  • follicular large cell or grade 3 or grade 3B lymphoma
  • PML primary mediastinal lymphoma
  • High-grade B-NHLs include Burkitt's lymphoma (BL), Burkitt-like lymphoma, small non-cleaved cell lymphoma (SNCCL) and lymphoblastic lymphoma.
  • B-NHLs include immunoblastic lymphoma (or immunocytoma), primary effusion lymphoma, HIV associated (or AIDS related) lymphomas, and post-transplant lymphoproliferative disorder (PTLD) or lymphoma.
  • B-cell malignancies also include, but are not limited to, chronic lymphocytic leukemia (CLL), prolymphocytic leukemia (PLL), Waldenstrom's macroglobulinemia (WM), hairy cell leukemia (HCL), large granular lymphocyte (LGL) leukemia, acute lymphoid (or lymphocytic or lymphoblastic) leukemia, and Castleman's disease.
  • CLL chronic lymphocytic leukemia
  • PLL prolymphocytic leukemia
  • WM Waldenstrom's macroglobulinemia
  • HCL hairy cell leukemia
  • LGL large granular lymphocyte
  • LAman's disease Castleman's disease.
  • NHL may also include T-cell non-Hodgkin's otherwise specified (NOS), peripheral T-cell lymphoma (PTCL), anaplastic large cell lymphoma (ALCL), angioimmunoblastic lymphoid disorder (AILD), nasal natural killer (NK) cell/T-cell lymphoma, gamma/delta lymphoma, cutaneous T cell lymphoma, mycosis fungoides, and Sezary syndrome.
  • NOS T-cell non-Hodgkin's otherwise specified
  • PTCL peripheral T-cell lymphoma
  • ALCL anaplastic large cell lymphoma
  • angioimmunoblastic lymphoid disorder IL-associated lymphoid disorder
  • NK nasal natural killer cell/T-cell lymphoma
  • gamma/delta lymphoma cutaneous T cell lymphoma
  • mycosis fungoides and Sezary syndrome.
  • Hematopoietic cancers also include Hodgkin's lymphoma (or disease) including classical Hodgkin's lymphoma, nodular sclerosing Hodgkin's lymphoma, mixed cellularity Hodgkin's lymphoma, lymphocyte predominant (LP) Hodgkin's lymphoma, nodular LP Hodgkin's lymphoma, and lymphocyte depleted Hodgkin's lymphoma.
  • Hematopoietic cancers also include plasma cell diseases or cancers such as multiple myeloma (MM) including smoldering MM, monoclonal gammopathy of undetermined (or unknown or unclear) significance (MGUS), plasmacytoma (bone, extramedullary), lymphoplasmacytic lymphoma (LPL), Waldenstrom's Macroglobulinemia, plasma cell leukemia, and primary amyloidosis (AL).
  • MM multiple myeloma
  • MGUS monoclonal gammopathy of undetermined (or unknown or unclear) significance
  • MGUS monoclonal gammopathy of undetermined (or unknown or unclear) significance
  • plasmacytoma bone, extramedullary
  • LPL lymphoplasmacytic lymphoma
  • Waldenstrom's Macroglobulinemia plasma cell leukemia
  • plasma cell leukemia and primary amyloidosis
  • AL primary amyloidosis
  • Hematopoietic cancers may also
  • Tissues which include hematopoietic cells referred herein to as “hematopoietic cell tissues” include bone marrow; peripheral blood; thymus; and peripheral lymphoid tissues, such as spleen, lymph nodes, lymphoid tissues associated with mucosa (such as the gut-associated lymphoid tissues), tonsils, Peyer's patches and appendix, and lymphoid tissues associated with other mucosa, for example, the bronchial linings.
  • the ICOS binding proteins, antibodies and antigen binding fragments of the invention can also be used to cure, prevent or treat infections and infectious disease.
  • the ICOS binding proteins can be used alone, or in combination with vaccines, to stimulate the immune response to pathogens, toxins, and self-antigens.
  • the ICOS binding proteins of the present invention can be used to stimulate immune response to viruses infectious to humans, such as, but not limited to, human immunodeficiency viruses, hepatitis viruses class A, B and C, Eppstein Barr virus, human cytomegalovirus, human papilloma viruses, herpes viruses.
  • the ICOS binding proteins of the present invention can be used to stimulate immune response to infection with bacterial or fungal parasites, and other pathogens.
  • the present invention provides methods for treating humans that have been exposed to particular toxins or pathogens. Accordingly, another aspect of the invention provides a method of treating an infectious disease in a subject comprising administering to the subject ICOS binding protein, or antigen-binding portion thereof.
  • infectious disease for which the ICOS binding proteins of the present invention may be useful include, but are not limited to, HIV, Hepatitis (A, B, & C), Influenza, Herpes, Giardia, Malaria, Leishmania, Staphylococcus aureus, Pseudomonas Aeruginosa .
  • pathogenic viruses causing infections treatable by methods of the invention include HIV, hepatitis (A, adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, cornovirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus and arboviral encephalitis virus.
  • HIV hepatitis
  • A adenovirus
  • influenza virus flaviviruses
  • echovirus rhinovirus
  • rhinovirus coxsackie virus
  • cornovirus mumps virus
  • rotavirus measles virus
  • rubella virus rubella virus
  • parvovirus vaccinia virus
  • HTLV virus dengue virus
  • papillomavirus molluscum virus
  • poliovirus rabies virus
  • pathogenic bacteria causing infections treatable by methods of the invention include chlamydia , rickettsial bacteria, mycobacteria, staphylococci, streptococci, pneumonococci, meningococci and conococci, klebsiella, proteus, serratia, pseudomonas, legionella , diphtheria, salmonella , bacilli, cholera, tetanus, botulism, anthrax, plague, leptospirosis, and Lymes disease bacteria.
  • pathogenic fungi causing infections treatable by methods of the invention include Candida ( albicans, krusei, glabrata, tropicalis , etc.), Cryptococcus neoformans, Aspergillus ( fumigatus, niger , etc.), Genus Mucorales ( mucor, absidia, rhizophus ), Sporothrix schenkii, Blastomyces dermatitidis, Paracoccidioides brasiliensis, Coccidioides immitis and Histoplasma capsulatum.
  • pathogenic parasites causing infections treatable by methods of the invention include Entamoeba histolytica, Balantidium coli, Naegleriafowleri, Acanthamoeba sp., Giardia lambia, Cryptosporidium sp., Pneumocystis carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei, Trypanosoma cruzi, Leishmania donovani, Toxoplasma gondi , and Nippostrongylus brasiliensis.
  • Sepsis is a potentially deadly medical condition that is characterized by a whole-body inflammatory state (called a systemic inflammatory response syndrome or SIRS) and the presence of a known or suspected infection.
  • SIRS systemic inflammatory response syndrome
  • the body may develop this inflammatory response by the immune system to microbes in the blood, urine, lungs, skin, or other tissues.
  • a lay term for sepsis is blood poisoning, more aptly applied to septicemia, below.
  • Severe sepsis is the systemic inflammatory response, plus infection, plus the presence of organ dysfunction.
  • Septicemia is a related medical term referring to the presence of pathogenic organisms in the bloodstream, leading to sepsis. The term has not been sharply defined.
  • Sepsis and cancer share similar immunosuppressive mechanisms including increased T regulatory cells, increased myeloid derived suppressor cells, increased expression of negative co-stimulatory molecules, decreased monocyte/macrophage HLA-DR expression.
  • Sepsis and cancer are prototypical disorders of chronic inflammation. Chronic inflammation stimulates potent and sustained immunoregulatory responses, including expansion of T regulatory cells and up - regulation of PD -1 and other negative regulators on effector cells . Barouch D. H. and Deeks S. G.; Immunologic strategies for HIV-1 remission and eradication. Science 345:169-174 2014.
  • administering a therapeutically effective amount of an ICOS antigen binding protein of the present invention to said human. Boomer, et al.
  • the ICOS binding proteins of the invention can be used in conjunction with other recombinant proteins and/or peptides (such as tumor antigens or cancer cells) in order to increase an immune response to these proteins (i.e., in a vaccination protocol).
  • other recombinant proteins and/or peptides such as tumor antigens or cancer cells
  • ICOS binding proteins thereof may be used to stimulate antigen-specific immune responses by co-administration of at least one ICOS binding protein with an antigen of interest (e.g., a vaccine).
  • an antigen of interest e.g., a vaccine
  • the invention provides a method of enhancing an immune response to an antigen in a subject, comprising administering to the subject: (i) the antigen; and (ii) an ICOS binding protein of the invention, such that an immune response to the antigen in the subject is enhanced.
  • the antigen can be, for example, a tumor antigen, a viral antigen, a bacterial antigen or an antigen from a pathogen.
  • Non-limiting examples of such antigens include, without limitation, tumor antigens, or antigens from the viruses, bacteria or other pathogens.
  • a major hurdle to HIV eradication is the maintenance of latently infected cells that do not express viral antigens, and escape immune surveillance.
  • Current strategies to eliminate the latent viral reservoir referred to as the “kick and kill” strategy, aims to reactivate HIV gene expression (“kick”) as cellular activation leads to H1V reactivation, and clear reactivated cells (“kill”).
  • kick HIV gene expression
  • kill clear reactivated cells
  • Cellular activation is governed by a balance of positive and negative regulators expressed on the surface of T cells. Altering this balance by agonising positive regulators and antagonising negative ones may facilitate HIV reactivation.
  • T cell Co-Stimulator is a positive regulator whose expression increases on CD4 T cells following stimulation. ICOS functions to promote T cell proliferation, cytokine production and differentiation.
  • Tfh T follicular helper cells
  • Tfh cells help B cells undergo differentiation, class switching, somatic hypermutation and are necessary for germinal center formation.
  • Tfh cells are significantly expanded following HIV/SIV infection and their dysregulation during chronic lentiviral infection contributes to impaired B cell immunity. Sorted Tfh cells have been shown to contain higher levels of HIV DNA than other lymphoid CD4 subsets and virus outgrowth is observed following stimulation.
  • Tfh cells reside in germinal centers and are exposed to HIV virions trapped on follicular dendritic cells that may facilitate their infection.
  • CD8 T cells have limited access to germinal centers and follicular CD8 cells often demonstrate reduced cytotoxicity, thus sparing Tfh cells from antiviral surveillance.
  • Tfh cells are an important protected HIV reservoir and strategies that target PD-1 and ICOS may selectively target Tfh cells and have utility as part of an HIV cure regimen.
  • methods are provided for treating a human infected with HIV comprising administering an ICOS binding protein or the antigen binding portion thereof of the present invention.
  • tumor antigens are proteins that are produced by tumor cells that elicit an immune response, particularly T-cell mediated immune responses.
  • the term “tumor antigen” as used herein includes both tumor-specific antigens and tumor-associated antigens. Tumor-specific antigens are unique to tumor cells and do not occur on other cells in the body. Tumor-associated antigens are not unique to a tumor cell and instead is also expressed on a normal cell under conditions that fail to induce a state of immunologic tolerance to the antigen. The expression of the antigen on the tumor may occur under conditions that enable the immune system to respond to the antigen.
  • Tumor-associated antigens may be antigens that are expressed on normal cells during fetal development when the immune system is immature and unable to respond or they may be antigens that are normally present at extremely low levels on normal cells but which are expressed at much higher levels on tumor cells.
  • tumor antigens include the following: differentiation antigens such as MART-1/MelanA (MART-I), gp100 (Pmel 17), tyrosinase, TRP-1, TRP-2 and tumor-specific multilineage antigens such, MAGE family antigens including but not limited to MAGE1, MAGE3, MAGE10, MAGE11, MAGE12, MAGEA2, MAGEA3, MAGEA4, MAGEA6, MAGEA8, MAGEA9, MAGEB18, MAGEB6, MABEC1, MAGED2, MAGEE1, MAGEH1, MAGEL2, BAGE, GAGE-1, GAGE-2, p15; MEL4, melanoma associated antigen 100+, melanoma gp100, NRIP3, NYS48, OCIAD1, OFA-iLRP, OIP5, ovarian carcinoma-associated antigen (OV632), PAGE4, PARP9, PATE, plastin L, PRAME, prostate-specific antigen, proteinase 3,
  • tumor antigens include, but are not limited to, TSP-180, MAGE-4, MAGE-5, MAGE-6, RAGE, NY-ESO, p185erbB2, p180erbB-3, c-met, nm-23H1, PSA, TAG-72, CA 19-9, CA 72-4, CAM 17.1, NuMa, K-ras, beta-Catenin, CDK4, Mum-1, p 15, p 16, 43-9F, 5T4, 791Tgp72, alphafetoprotein, beta-HCG, BCA225, BTAA, CA 125, CA 15-3CA 27.29BCAA, CA 195, CA 242, CA-50, CAM43, CD68P1, CO-029, FGF-5, G250, Ga733EpCAM, HTgp-175, M344, MA-50, MG7-Ag, associated protein, TAAL6, TAG72, TLP, TPS, glioma-associated antigen, f-human chorionic gonadotrop
  • any anti-neoplastic agent that has activity versus a susceptible tumor being treated may be co-administered in the treatment of cancer in the present invention.
  • examples of such agents can be found in Cancer Principles and Practice of Oncology by V. T. Devita and S. Hellman (editors), 6 th edition (Feb. 15, 2001), Lippincott Williams & Wilkins Publishers.
  • a person of ordinary skill in the art would be able to discern which combinations of agents would be useful based on the particular characteristics of the drugs and the cancer involved.
  • Typical anti-neoplastic agents useful in the present invention include, but are not limited to, anti-microtubule agents such as diterpenoids and vinca alkaloids; platinum coordination complexes; alkylating agents such as nitrogen mustards, oxazaphosphorines, alkylsulfonates, nitrosoureas, and triazenes; antibiotic agents such as anthracyclins, actinomycins and bleomycins; topoisomerase II inhibitors such as epipodophyllotoxins; antimetabolites such as purine and pyrimidine analogues and anti-folate compounds; topoisomerase I inhibitors such as camptothecins; hormones and hormonal analogues; signal transduction pathway inhibitors; non-receptor tyrosine kinase angiogenesis inhibitors; immunotherapeutic agents; proapoptotic agents; and cell cycle signalling inhibitors.
  • anti-microtubule agents such as diterpenoids and vinca alkaloids
  • Examples of a further active ingredient or ingredients for use in combination or co-administered with the present ICOS binding protein are anti-neoplastic agents including any chemotherapeutic agents, immuno-modulatory agents or immune-modulators and immunostimulatory adjuvants.
  • Anti-microtubule or anti-mitotic agents are phase specific agents active against the microtubules of tumor cells during M or the mitosis phase of the cell cycle.
  • anti-microtubule agents include, but are not limited to, diterpenoids and vinca alkaloids.
  • Diterpenoids which are derived from natural sources, are phase specific anti-cancer agents that operate at the G 2 /M phases of the cell cycle. It is believed that the diterpenoids stabilize the ⁇ -tubulin subunit of the microtubules, by binding with this protein. Disassembly of the protein appears then to be inhibited with mitosis being arrested and cell death following. Examples of diterpenoids include, but are not limited to, paclitaxel and its analog docetaxel.
  • Paclitaxel 5 ⁇ ,20-epoxy-1,2 ⁇ ,4,7 ⁇ ,10 ⁇ ,13 ⁇ -hexa-hydroxytax-11-en-9-one 4,10-diacetate 2- from the Pacific yew tree Taxus brevifolia and is commercially available as an injectable solution TAXOL®. It is a member of the taxane family of terpenes. It was first isolated in 1971 by Wani et al. J. Am. Chem, Soc., 93:2325. 1971), who characterized its structure by chemical and X-ray crystallographic methods. One mechanism for its activity relates to paclitaxel's capacity to bind tubulin, thereby inhibiting cancer cell growth. Schiff et al., Proc.
  • Paclitaxel has been approved for clinical use in the treatment of refractory ovarian cancer in the United States (Markman et al., Yale Journal of Biology and Medicine, 64:583, 1991; McGuire et al., Ann. Intem, Med., 111:273, 1989) and for the treatment of breast cancer (Holmes et al., J. Nat. Cancer Inst., 83:1797, 1991.) It is a potential candidate for treatment of neoplasms in the skin (Einzig et. al., Proc. Am. Soc. Clin. Oncol., 20:46) and head and neck carcinomas (Forastire et. al., Sem. Oncol., 20:56, 1990).
  • the compound also shows potential for the treatment of polycystic kidney disease (Woo et. al., Nature, 368:750. 1994, lung cancer and malaria.
  • Treatment of patients with paclitaxel results in bone marrow suppression (multiple cell lineages, Ignoff, R. J. et. al, Cancer Chemotherapy Pocket Guide, 1998) related to the duration of dosing above a threshold concentration (50 nM) (Kearns, C. M. et. al., Seminars in Oncology, 3(6) p. 16-23, 1995).
  • Docetaxel (2R,3S)—N-carboxy-3-phenylisoserine,N-tert-butyl ester, 13-ester with 5 ⁇ -20-epoxy-1,2 ⁇ ,4,7 ⁇ ,10 ⁇ ,13 ⁇ -hexahydroxytax-11-en-9-one 4-acetate 2-benzoate, trihydrate; is commercially available as an injectable solution as TAXOTERE®.
  • Docetaxel is indicated for the treatment of breast cancer.
  • Docetaxel is a semisynthetic derivative of paclitaxel q.v., prepared using a natural precursor, 10-deacetyl-baccatin III, extracted from the needle of the European Yew tree. The dose limiting toxicity of docetaxel is neutropenia.
  • Vinca alkaloids are phase specific anti-neoplastic agents derived from the periwinkle plant. Vinca alkaloids act at the M phase (mitosis) of the cell cycle by binding specifically to tubulin. Consequently, the bound tubulin molecule is unable to polymerize into microtubules. Mitosis is believed to be arrested in metaphase with cell death following. Examples of vinca alkaloids include, but are not limited to, vinblastine, vincristine, and vinorelbine.
  • Vinblastine vincaleukoblastine sulfate
  • VELBAN® an injectable solution.
  • Myelosuppression is the dose
  • Vincristine vincaleukoblastine, 22-oxo-, sulfate
  • ONCOVIN® an injectable solution.
  • Vincristine is indicated for the treatment of acute leukemias and has also found use in treatment regimens for Hodgkin's and non-Hodgkin's malignant lymphomas.
  • Alopecia and neurologic effects are the most common side effect of vincristine and to a lesser extent myelosupression and gastrointestinal mucositis effects occur.
  • Vinorelbine 3′,4′-didehydro-4‘-deoxy-C’-norvincaleukoblastine [R—(R*,R*)-2,3-dihydroxybutanedioate (1:2)(salt)], commercially available as an injectable solution of vinorelbine tartrate (NAVELBINE®), is a semisynthetic vinca alkaloID Vinorelbine is indicated as a single agent or in combination with other chemotherapeutic agents, such as cisplatin, in the treatment of various solid tumors, particularly non-small cell lung, advanced breast, and hormone refractory prostate cancers. Myelosuppression is the most common dose limiting side effect of vinorelbine.
  • Platinum coordination complexes are non-phase specific anti-cancer agents, which are interactive with DNA.
  • the platinum complexes enter tumor cells, undergo, aquation and form intra- and interstrand crosslinks with DNA causing adverse biological effects to the tumor.
  • Examples of platinum coordination complexes include, but are not limited to, cisplatin and carboplatin.
  • Cisplatin cis-diamminedichloroplatinum
  • PLATINOL® an injectable solution.
  • Cisplatin is primarily indicated in the treatment of metastatic testicular and ovarian cancer and advanced bladder cancer.
  • the primary dose limiting side effects of cisplatin are nephrotoxicity, which may be controlled by hydration and diuresis, and ototoxicity.
  • Carboplatin platinum, diammine [1,1-cyclobutane-dicarboxylate(2-)-O,O′], is commercially available as PARAPLATIN® as an injectable solution.
  • Carboplatin is primarily indicated in the first and second line treatment of advanced ovarian carcinoma. Bone marrow suppression is the dose limiting toxicity of carboplatin.
  • Alkylating agents are non-phase anti-cancer specific agents and strong electrophiles. Typically, alkylating agents form covalent linkages, by alkylation, to DNA through nucleophilic moieties of the DNA molecule such as phosphate, amino, sulfhydryl, hydroxyl, carboxyl, and imidazole groups. Such alkylation disrupts nucleic acid function leading to cell death.
  • alkylating agents include, but are not limited to, nitrogen mustards such as cyclophosphamide, melphalan, and chlorambucil; alkyl sulfonates such as busulfan; nitrosoureas such as carmustine; and triazenes such as dacarbazine.
  • Cyclophosphamide 2-[bis(2-chloroethyl)amino]tetrahydro-2H-1,3,2-oxazaphosphorine 2-oxide monohydrate, is commercially available as an injectable solution or tablets as CYTOXAN®. Cyclophosphamide is indicated as a single agent or in combination with other chemotherapeutic agents, in the treatment of malignant lymphomas, multiple myeloma, and leukemias. Alopecia, nausea, vomiting and leukopenia are the most common dose limiting side effects of cyclophosphamide.
  • Melphalan 4-[bis(2-chloroethyl)amino]-L-phenylalanine, is commercially available as an injectable solution or tablets as ALKERAN®. Melphalan is indicated for the palliative treatment of multiple myeloma and non-resectable epithelial carcinoma of the ovary. Bone marrow suppression is the most common dose limiting side effect of melphalan.
  • Chlorambucil 4-[bis(2-chloroethyl)amino]benzenebutanoic acid, is commercially available as LEUKERAN® tablets. Chlorambucil is indicated for the palliative treatment of chronic lymphatic leukemia, and malignant lymphomas such as lymphosarcoma, giant follicular lymphoma, and Hodgkin's disease. Bone marrow suppression is the most common dose limiting side effect of chlorambucil.
  • Busulfan 1,4-butanediol dimethanesulfonate, is commercially available as MYLERAN® TABLETS. Busulfan is indicated for the palliative treatment of chronic myelogenous leukemia. Bone marrow suppression is the most common dose limiting side effects of busulfan.
  • Carmustine 1,3-[bis(2-chloroethyl)-1-nitrosourea, is commercially available as single vials of lyophilized material as BiCNU®.
  • Carmustine is indicated for the palliative treatment as a single agent or in combination with other agents for brain tumors, multiple myeloma, Hodgkin's disease, and non-Hodgkin's lymphomas. Delayed myelosuppression is the most common dose limiting side effects of carmustine.
  • dacarbazine 5-(3,3-dimethyl-1-triazeno)-imidazole-4-carboxamide, is commercially available as single vials of material as DTIC-Dome®.
  • dacarbazine is indicated for the treatment of metastatic malignant melanoma and in combination with other agents for the second line treatment of Hodgkin's Disease. Nausea, vomiting, and anorexia are the most common dose limiting side effects of dacarbazine.
  • Antibiotic anti-neoplastics are non-phase specific agents, which bind or intercalate with DNA. Typically, such action results in stable DNA complexes or strand breakage, which disrupts ordinary function of the nucleic acids leading to cell death.
  • antibiotic anti-neoplastic agents include, but are not limited to, actinomycins such as dactinomycin, anthrocyclins such as daunorubicin and doxorubicin; and bleomycins.
  • Dactinomycin also know as Actinomycin D, is commercially available in injectable form as COSMEGEN®. Dactinomycin is indicated for the treatment of Wilm's tumor and rhabdomyosarcoma. Nausea, vomiting, and anorexia are the most common dose limiting side effects of dactinomycin.
  • Daunorubicin (8S-cis-)-8-acetyl-10-[(3-amino-2,3,6-trideoxy- ⁇ -L-lyxo-hexopyranosyl)oxy]-7,8,9,10-tetrahydro-6,8,11-trihydroxy-1-methoxy-5,12 naphthacenedione hydrochloride, is commercially available as a liposomal injectable form as DAUNOXOME® or as an injectable as CERUBIDINE®. Daunorubicin is indicated for remission induction in the treatment of acute nonlymphocytic leukemia and advanced HIV associated Kaposi's sarcoma. Myelosuppression is the most common dose limiting side effect of daunorubicin.
  • Doxorubicin (8S,10S)-10-[(3-amino-2,3,6-trideoxy- ⁇ -L-lyxo-hexopyranosyl)oxy]-8-glycoloyl, 7,8,9,10-tetrahydro-6,8,11-trihydroxy-1-methoxy-5,12 naphthacenedione hydrochloride, is commercially available as an injectable form as RUBEX® or ADRIAMYCIN RDF®.
  • Doxorubicin is primarily indicated for the treatment of acute lymphoblastic leukemia and acute myeloblastic leukemia, but is also a useful component in the treatment of some solid tumors and lymphomas. Myelosuppression is the most common dose limiting side effect of doxorubicin.
  • Bleomycin a mixture of cytotoxic glycopeptide antibiotics isolated from a strain of Streptomyces verticillus , is commercially available as BLENOXANE®. Bleomycin is indicated as a palliative treatment, as a single agent or in combination with other agents, of squamous cell carcinoma, lymphomas, and testicular carcinomas. Pulmonary and cutaneous toxicities are the most common dose limiting side effects of bleomycin.
  • Topoisomerase II inhibitors include, but are not limited to, epipodophyllotoxins.
  • Epipodophyllotoxins are phase specific anti-neoplastic agents derived from the mandrake plant. Epipodophyllotoxins typically affect cells in the S and G 2 phases of the cell cycle by forming a ternary complex with topoisomerase II and DNA causing DNA strand breaks. The strand breaks accumulate and cell death follows. Examples of epipodophyllotoxins include, but are not limited to, etoposide and teniposide.
  • Etoposide 4′-demethyl-epipodophyllotoxin 9[4,6-0-(R)-ethylidene- ⁇ -D-glucopyranoside]
  • VePESID® an injectable solution or capsules
  • VP-16 an injectable solution or capsules
  • Etoposide is indicated as a single agent or in combination with other chemotherapy agents in the treatment of testicular and non-small cell lung cancers. Myelosuppression is the most common side effect of etoposide. The incidence of leucopenia tends to be more severe than thrombocytopenia.
  • Teniposide 4′-demethyl-epipodophyllotoxin 9[4,6-0-(R)-thenylidene- ⁇ -D-glucopyranoside], is commercially available as an injectable solution as VUMON® and is commonly known as VM-26.
  • Teniposide is indicated as a single agent or in combination with other chemotherapy agents in the treatment of acute leukemia in children. Myelosuppression is the most common dose limiting side effect of teniposide. Teniposide can induce both leucopenia and thrombocytopenia.
  • Antimetabolite neoplastic agents are phase specific anti-neoplastic agents that act at S phase (DNA synthesis) of the cell cycle by inhibiting DNA synthesis or by inhibiting purine or pyrimidine base synthesis and thereby limiting DNA synthesis. Consequently, S phase does not proceed and cell death follows.
  • Examples of antimetabolite anti-neoplastic agents include, but are not limited to, fluorouracil, methotrexate, cytarabine, mecaptopurine, thioguanine, and gemcitabine.
  • 5-fluorouracil 5-fluoro-2,4-(1H,3H) pyrimidinedione
  • fluorouracil is commercially available as fluorouracil.
  • Administration of 5-fluorouracil leads to inhibition of thymidylate synthesis and is also incorporated into both RNA and DNA. The result typically is cell death.
  • 5-fluorouracil is indicated as a single agent or in combination with other chemotherapy agents in the treatment of carcinomas of the breast, colon, rectum, stomach and pancreas. Myelosuppression and mucositis are dose limiting side effects of 5-fluorouracil.
  • Other fluoropyrimidine analogs include 5-fluoro deoxyuridine (floxuridine) and 5-fluorodeoxyuridine monophosphate.
  • Cytarabine 4-amino-1- ⁇ -D-arabinofuranosyl-2 (1H)-pyrimidinone, is commercially available as CYTOSAR-U® and is commonly known as Ara-C. It is believed that cytarabine exhibits cell phase specificity at S-phase by inhibiting DNA chain elongation by terminal incorporation of cytarabine into the growing DNA chain. Cytarabine is indicated as a single agent or in combination with other chemotherapy agents in the treatment of acute leukemia. Other cytidine analogs include 5-azacytidine and 2′,2′-difluorodeoxycytidine (gemcitabine). Cytarabine induces leucopenia, thrombocytopenia, and mucositis.
  • Mercaptopurine 1,7-dihydro-6H-purine-6-thione monohydrate, is commercially available as PURINETHOL®.
  • Mercaptopurine exhibits cell phase specificity at S-phase by inhibiting DNA synthesis by an as of yet unspecified mechanism.
  • Mercaptopurine is indicated as a single agent or in combination with other chemotherapy agents in the treatment of acute leukemia. Myelosuppression and gastrointestinal mucositis are expected side effects of mercaptopurine at high doses.
  • a useful mercaptopurine analog is azathioprine.
  • Thioguanine 2-amino-1,7-dihydro-6H-purine-6-thione, is commercially available as TABLOID®.
  • Thioguanine exhibits cell phase specificity at S-phase by inhibiting DNA synthesis by an as of yet unspecified mechanism.
  • Thioguanine is indicated as a single agent or in combination with other chemotherapy agents in the treatment of acute leukemia.
  • Myelosuppression including leucopenia, thrombocytopenia, and anemia, is the most common dose limiting side effect of thioguanine administration. However, gastrointestinal side effects occur and can be dose limiting.
  • Other purine analogs include pentostatin, erythrohydroxynonyladenine, fludarabine phosphate, and cladribine.
  • Gemcitabine 2′-deoxy-2′,2′-difluorocytidine monohydrochloride (1-isomer), is blocking progression of cells through the G1/S boundary.
  • Gemcitabine is indicated in combination with cisplatin in the treatment of locally advanced non-small cell lung cancer and alone in the treatment of locally advanced pancreatic cancer.
  • Myelosuppression including leucopenia, thrombocytopenia, and anemia, is the most common dose limiting side effect of gemcitabine administration.
  • Methotrexate N-[4[[(2,4-diamino-6-pteridinyl) methyl]methylamino] benzoyl]-L-glutamic acid, is commercially available as methotrexate sodium. Methotrexate exhibits cell phase effects specifically at S-phase by inhibiting DNA synthesis, repair and/or replication through the inhibition of dyhydrofolic acid reductase which is required for synthesis of purine nucleotides and thymidylate.
  • Methotrexate is indicated as a single agent or in combination with other chemotherapy agents in the treatment of choriocarcinoma, meningeal leukemia, non-Hodgkin's lymphoma, and carcinomas of the breast, head, neck, ovary and bladder.
  • Myelosuppression (leucopenia, thrombocytopenia, and anemia) and mucositis are expected side effect of methotrexate administration.
  • Camptothecins including, camptothecin and camptothecin derivatives are available or under development as Topoisomerase I inhibitors. Camptothecins cytotoxic activity is believed to be related to its Topoisomerase I inhibitory activity. Examples of camptothecins include, but are not limited to irinotecan, topotecan, and the various optical forms of 7-(4-methylpiperazino-methylene)-10,11-ethylenedioxy-20-camptothecin described below.
  • Irinotecan HCl (4S)-4,11-diethyl-4-hydroxy-9-[(4-piperidinopiperidino) carbonyloxy]-1H-pyrano[3′,4′,6,7]indolizino[1,2-b]quinoline-3,14(4H,12H)-dione hydrochloride, is commercially available as the injectable solution CAMPTOSAR®.
  • Irinotecan is a derivative of camptothecin which binds, along with its active metabolite SN-38, to the topoisomerase I—DNA complex. It is believed that cytotoxicity occurs as a result of irreparable double strand breaks caused by interaction of the topoisomerase I:DNA:irintecan or SN-38 ternary complex with replication enzymes. Irinotecan is indicated for treatment of metastatic cancer of the colon or rectum. The dose limiting side effects of irinotecan HCl are myelosuppression, including neutropenia, and GI effects, including diarrhea.
  • Topotecan HCl (S)-10-[(dimethylamino)methyl]-4-ethyl-4,9-dihydroxy-1H-pyrano[3′,4′,6,7]indolizino[1,2-b]quinoline-3,14-(4H,12H)-dione monohydrochloride, is commercially available as the injectable solution HYCAMTIN®.
  • Topotecan is a derivative of camptothecin which binds to the topoisomerase I—DNA complex and prevents religation of singles strand breaks caused by Topoisomerase I in response to torsional strain of the DNA molecule.
  • Topotecan is indicated for second line treatment of metastatic carcinoma of the ovary and small cell lung cancer.
  • the dose limiting side effect of topotecan HCl is myelosuppression, primarily
  • Rituximab is a chimeric monoclonal antibody which is sold as RITUXAN® and MABTHERA®.
  • Rituximab binds to CD20 on B cells and causes cell apoptosis.
  • Rituximab is administered intravenously and is approved for treatment of rheumatoid arthritis and B-cell non-Hodgkin's lymphoma.
  • Ofatumumab is a fully human monoclonal antibody which is sold as ARZERRA®.
  • Ofatumumab binds to CD20 on B cells and is used to treat chronic lymphocytic leukemia CLL; a type of cancer of the white blood cells) in adults who are refractory to treatment with fludarabine (Fludara) and alemtuzumab Campath).
  • Trastuzumab (HEREPTIN®) is a humanized monoclonal antibody that binds to the HER2 receptor. It original indication is HER2 positive breast cancer.
  • Cetuximab (ERBITUX®) is a chimeric mouse human antibody that inhibits epidermal growth factor receptor (EGFR).
  • mTOR inhibitors include but are not limited to rapamycin (FK506) and rapalogs, RAD001 or everolimus (Afinitor), CCI-779 or temsirolimus, AP23573, AZD8055, WYE-354, WYE-600, WYE-687 and Ppl21.
  • Bexarotene is sold as Targretin® and is a member of a subclass of retinoids that selectively activate retinoid X receptors (RXRs). These retinoid receptors have biologic activity distinct from that of retinoic acid receptors (RARs).
  • RXRs retinoid X receptors
  • RARs retinoic acid receptors
  • the chemical name is 4-[1-(5,6,7,8-tetrahydro-3,5,5,8,8-pentamethyl-2-naphthalenyl) ethenyl] benzoic acID Bexarotene is used to treat cutaneous T-cell lymphoma CTCL, a type of skin cancer) in people whose disease could not be treated successfully with at least one other medication.
  • Sorafenib marketed as Nexavar® is in a class of medications called multikinase inhibitors. Its chemical name is 4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino] phenoxy]-N-methyl-pyridine-2-carboxamide. Sorafenib is used to treat advanced renal cell carcinoma (a type of cancer that begins in the kidneys). Sorafenib is also used to treat unresectable hepatocellular carcinoma (a type of liver cancer that cannot be treated with surgery).
  • erbB inhibitors examples include lapatinib, erlotinib, and gefitinib.
  • Lapatinib, N-(3-chloro-4- ⁇ [(3-fluorophenyl)methyl]oxy ⁇ phenyl)-6-[5-( ⁇ [2-(methylsulfonyl)ethyl] amino ⁇ methyl)-2-furanyl]-4-quinazolinamine (represented by formula II, as illustrated), is a potent, oral, small-molecule, dual inhibitor of erbB-1 and erbB-2 (EGFR and HER2) tyrosine kinases that is approved in combination with capecitabine for the treatment of HER2-positive metastatic breast cancer.
  • the free base, HCl salts, and ditosylate salts of the compound of formula (II) may be prepared according to the procedures disclosed in WO 99/35146, published Jul. 15, 1999; and WO 02/02552 published Jan. 10, 2002.
  • the free base and HCl salt of erlotinib may be prepared, for example, according to U.S. Pat. No. 5,747,498, Example 20.
  • Gefitinib which is commercially available under the trade name IRESSA® (Astra-Zenenca) is an erbB-1 inhibitor that is indicated as monotherapy for the treatment of patients with locally advanced or metastatic non-small-cell lung cancer after failure of both platinum-based and docetaxel the procedures of International Patent Application No. PCT/GB96/00961, filed Apr. 23, 1996, and published as WO 96/33980 on Oct. 31, 1996.
  • camptothecin derivative of formula A following, currently under development, including the racemic mixture (R,S) form as well as the R and S enantiomers:
  • Hormones and hormonal analogues are useful compounds for treating cancers in which there is a relationship between the hormone(s) and growth and/or lack of growth of the cancer.
  • hormones and hormonal analogues useful in cancer treatment include, but are not limited to, adrenocorticosteroids such as prednisone and prednisolone which are useful in the treatment of malignant lymphoma and acute leukemia in children; aminoglutethimide and other aromatase inhibitors such as anastrozole, letrazole, vorazole, and exemestane useful in the treatment of adrenocortical carcinoma and hormone dependent breast carcinoma containing estrogen receptors; progestrins such as megestrol acetate useful in the treatment of hormone dependent breast cancer and endometrial carcinoma; estrogens, androgens, and anti-androgens such as flutamide, nilutamide, bicalutamide, cyproterone acetate and 5 ⁇ -reductases
  • Signal transduction pathway inhibitors are those inhibitors, which block or inhibit a chemical process which evokes an intracellular change. As used herein this change is cell proliferation or differentiation.
  • Signal tranduction inhibitors useful in the present invention include inhibitors of receptor tyrosine kinases, non-receptor tyrosine kinases, SH2/SH3domain blockers, serine/threonine kinases, phosphotidyl inositol-3 kinases, myo-inositol signalling, and Ras oncogenes.
  • protein tyrosine kinases catalyse the phosphorylation of specific tyrosyl residues in various proteins involved in the regulation of cell growth.
  • protein tyrosine kinases can be broadly classified as receptor or non-receptor kinases.
  • Receptor tyrosine kinases are transmembrane proteins having an extracellular ligand binding domain, a transmembrane domain, and a tyrosine kinase domain. Receptor tyrosine kinases are involved in the regulation of cell growth and are generally termed growth factor receptors. Inappropriate or uncontrolled activation of many of these kinases, i.e. aberrant kinase growth factor receptor activity, for example by over-expression or mutation, has been shown to result in uncontrolled cell growth. Accordingly, the aberrant activity of such kinases has been linked to malignant tissue growth. Consequently, inhibitors of such kinases could provide cancer treatment methods.
  • Growth factor receptors include, for example, epidermal growth factor receptor (EGFr), platelet derived growth factor receptor (PDGFr), erbB2, erbB4, vascular endothelial growth factor receptor (VEGFr), tyrosine kinase with immunoglobulin-like and epidermal growth factor homology domains (TIE-2), insulin growth factor-I (IGFI) receptor, macrophage colony stimulating factor Cfms), BTK, ckit, cmet, fibroblast growth factor (FGF) receptors, Trk receptors (TrkA, TrkB, and TrkC), ephrin (eph) receptors, and the RET protooncogene.
  • EGFr epidermal growth factor receptor
  • PDGFr platelet derived growth factor receptor
  • erbB2 erbB4
  • VEGFr vascular endothelial growth factor receptor
  • TIE-2 vascular endothelial growth factor receptor
  • IGFI insulin growth factor-
  • inhibitors of growth receptors include ligand antagonists, antibodies, tyrosine kinase inhibitors and anti-sense oligonucleotides.
  • Growth factor receptors and agents that inhibit growth factor receptor function are described, for instance, in Kath, John C., Exp. Opin. Ther. Patents (2000) 10(6):803-818; Shawver et al DDT Vol 2, No. 2 Feb. 1997; and Lofts, F. J. et al, “Growth factor receptors as targets”, New Molecular Targets for Cancer Chemotherapy, ed. Workman, Paul and Kerr, David, CRC press 1994, London.
  • Non-receptor tyrosine kinases which are not growth factor receptor kinases are termed non-receptor tyrosine kinases.
  • Non-receptor tyrosine kinases useful in the present invention include cSrc, Lck, Fyn, Yes, Jak, cAbl, FAK (Focal adhesion kinase), Brutons tyrosine kinase, and Bcr-Abl.
  • Such non-receptor kinases and agents which inhibit non-receptor tyrosine kinase function are described in Sinh, S. and Corey, S. J., (1999) Journal of Hematotherapy and Stem Cell Research 8 (5): 465-80; and Bolen, J. B., Brugge, J. S., (1997) Annual review of Immunology. 15: 371-404.
  • SH2/SH3 domain blockers are agents that disrupt SH2 or SH3 domain binding in a variety of enzymes or adaptor proteins including, PI3-K p85 subunit, Src family kinases, adaptor molecules (Shc, Crk, Nck, Grb2) and Ras-GAP.
  • SH2/SH3 domains as targets for anti-cancer drugs are discussed in Smithgall, T. E. (1995), Journal of Pharmacological and Toxicological Methods. 34(3) 125-32.
  • Inhibitors of Serine/Threonine Kinases including MAP kinase cascade blockers which include blockers of Raf kinases (rafk), Mitogen or Extracellular Regulated Kinase (MEKs), and Extracellular Regulated Kinases (ERKs); and Protein kinase C family member blockers including blockers of PKCs (alpha, beta, gamma, epsilon, mu, lambda, iota, zeta).
  • IkB kinase family IKKa, IKKb
  • PKB family kinases AKT kinase family members
  • TGF beta receptor kinases TGF beta receptor kinases.
  • Serine/Threonine kinases and inhibitors thereof are described in Yamamoto, T., Taya, S., Kaibuchi, K., (1999), Journal of Biochemistry. 126 (5) 799-803; Brodt, P, Samani, A., and Navab, R. (2000), Biochemical Pharmacology, 60. 1101-1107; Massague, J., Weis-Garcia, F. (1996) Cancer Surveys. 27:41-64; Philip, P. A., and Harris, A. L. (1995), Cancer Treatment and Research. 78: 3-27, Lackey, K. et al Bioorganic and Medicinal Chemistry Letters, (10), 2000, 223-226; U.S. Pat. No. 6,268,391; and Martinez-Iacaci, L., et al, Int. J. Cancer (2000), 88(1), 44-52.
  • Inhibitors of Phosphotidyl inositol-3 Kinase family members including blockers of PI3-kinase, ATM, DNA-PK, and Ku are also useful in the present invention.
  • Such kinases are discussed in Abraham, R. T. (1996), Current Opinion in Immunology. 8 (3) 412-8; Canman, C. E., Lim, D. S. (1998), Oncogene 17 (25) 3301-3308; Jackson, S. P. (1997), International Journal of Biochemistry and Cell Biology. 29 (7):935-8; and Zhong, H. et al, Cancer res, (2000) 60(6), 1541-1545.
  • Myo-inositol signalling inhibitors such as phospholipase C blockers and Myoinositol analogues.
  • signal inhibitors are described in Powis, G., and Kozikowski A., (1994 New Molecular Targets for Cancer Chemotherapy ed., Paul Workman and David Kerr, CRC press 1994, London.
  • Ras Oncogene inhibitors include inhibitors of farnesyltransferase, geranyl-geranyl transferase, and CAAX proteases as well as anti-sense oligonucleotides, ribozymes and immunotherapy. Such inhibitors have been shown to block ras activation in cells containing wild type mutant ras, thereby acting as antiproliferation agents.
  • Ras oncogene inhibition is discussed in Scharovsky, O. G., Rozados, V. R., Gervasoni, S. I. Matar, P. (2000), Journal of Biomedical Science. 7(4 292-8; Ashby, M. N. (1998), Current Opinion in Lipidology. 9 (2) 99-102; and Bennett, C. F. and Cowsert, L. M. BioChim. Biophys. Acta, (1999) 1489(1):19-30.
  • antibody antagonists to receptor kinase ligand binding may also serve as signal transduction inhibitors.
  • This group of signal transduction pathway inhibitors includes the use example Imclone C225 EGFR specific antibody (see Green, M. C. et al, Monoclonal Antibody Therapy for Solid Tumors, Cancer Treat. Rev., (2000), 26(4, 269-286); Herceptin® erbB2 antibody (see Tyrosine Kinase Signalling in Breast cancer:erbB Family Receptor Tyrosine Kniases, Breast cancer Res., 2000, 2(3), 176-183); and 2CB VEGFR2 specific antibody (see Brekken, R. A. et al, Selective Inhibition of VEGFR2 Activity by a monoclonal Anti-VEGF antibody blocks tumor growth in mice, Cancer Res. (2000) 60, 5117-5124.
  • Non-receptor kinase angiogenesis inhibitors may also find use in the present invention.
  • Inhibitors of angiogenesis related VEGFR and TIE2 are discussed above in regard to signal transduction inhibitors (both receptors are receptor tyrosine kinases).
  • Angiogenesis in general is linked to erbB2/EGFR signaling since inhibitors of erbB2 and EGFR have been shown to inhibit angiogenesis, primarily VEGF expression.
  • the combination of an erbB2/EGFR inhibitor with an inhibitor of angiogenesis makes sense.
  • non-receptor tyrosine kinase inhibitors may be used in combination with the EGFR/erbB2 inhibitors of the present invention.
  • anti-VEGF antibodies which do not recognize VEGFR (the receptor tyrosine kinase), but bind to the ligand; small molecule inhibitors of integrin (alpha v beta 3 ) that will inhibit angiogenesis; endostatin and angiostatin (non-RTK) may also prove useful in combination with the disclosed erb family inhibitors.
  • VEGFR the receptor tyrosine kinase
  • small molecule inhibitors of integrin alpha v beta 3
  • endostatin and angiostatin non-RTK
  • Agents used in immunotherapeutic regimens may also be useful in combination with the compounds of formula (I).
  • immunologic strategies to generate an immune response against erbB2 or EGFR. These strategies are generally in the realm of tumor vaccinations.
  • the efficacy of immunologic approaches may be greatly enhanced through combined inhibition of erbB2/EGFR signaling pathways using a small molecule inhibitor. Discussion of the immunologic/tumor vaccine approach against erbB2/EGFR are found in Reilly R T et al. (2000), Cancer Res. 60: 3569-3576; and Chen Y, Hu D, Eling D J, Robbins J, and Kipps T J. (1998), Cancer Res. 58: 1965-1971.
  • Agents used in proapoptotic regimens may also be used in the combination of the present invention.
  • Members of the Bcl-2 family of proteins block apoptosis. Upregulation of bcl-2 has therefore been linked to chemoresistance.
  • EGF epidermal growth factor
  • mel-1 the epidermal growth factor
  • strategies designed to downregulate the expression of bcl-2 in tumors have demonstrated clinical benefit and are now in Phase II/III trials, namely Genta's G3139 bcl-2 antisense oligonucleotide.
  • Trastuzumab (HEREPTIN®) is a humanized monoclonal antibody that binds to the HER2 receptor. It original indication is HER2 positive breast cancer.
  • Trastuzumab emtansine (trade name Kadcyla) is anantibody-drug conjugate consisting of the monoclonal antibody trastuzumab (Herceptin) linked to the cytotoxic agent mertansine (DM1).
  • T-DM1 Trastuzumab alone stops growth of cancer cells by binding to the HER2/neu receptor, whereas mertansine enters cells and destroys them by binding to tubulin. Because the monoclonal antibody targets HER2, and HER2 is only over-expressed in cancer cells, the conjugate delivers the toxin specifically to tumor cells.
  • the conjugate is abbreviated T-DM1.
  • Cetuximab (ERBITUX®) is a chimeric mouse human antibody that inhibits epidermal growth factor receptor (EGFR).
  • Pertuzumab (also called 2C4, trade name Omnitarg) is a monoclonal antibody. The first of its class in a line of agents called “HER dimerization inhibitors”. By binding to HER2, it inhibits the dimerization of HER2 with other HER receptors, which is hypothesized to result in slowed tumor growth. Pertuzumab is described in WO01/00245 published Jan. 4, 2001.
  • Rituximab is a chimeric monoclonal antibody which is sold as RITUXAN® and MABTHERA®.
  • Rituximab binds to CD20 on B cells and causes cell apoptosis.
  • Rituximab is administered intravenously and is approved for treatment of rheumatoid arthritis and B-cell non-Hodgkin's lymphoma.
  • Ofatumumab is a fully human monoclonal antibody which is sold as ARZERRA®.
  • Ofatumumab binds to CD20 on B cells and is used to treat chronic lymphocytic leukemia (CLL; a type of cancer of the white blood cells) in adults who are refractory to treatment with fludarabine (Fludara) and alemtuzumab (Campath).
  • CLL chronic lymphocytic leukemia
  • Fludara fludarabine
  • alemtuzumab Campath
  • Cell cycle signalling inhibitors inhibit molecules involved in the control of the cell cycle.
  • a family of protein kinases called cyclin dependent kinases CDKs
  • CDKs cyclin dependent kinases
  • the coordinate activation and inactivation of different cyclin/CDK complexes is necessary for normal progression through the cell cycle.
  • cyclin dependent kinases including CDK2, CDK4, and CDK6 and inhibitors for the same are described in, for instance, Rosania et al, Exp. Opin. Ther. Patents (2000) 10(2):215-230.
  • immuno-modulators refer to any substance including monoclonal antibodies that effects the immune system.
  • the ICOS binding proteins of the present invention can be considered immune-modulators.
  • Immuno-modulators can be used as anti-neoplastic agents for the antibodies such as ipilimumab (YERVOY) and anti-PD-1 antibodies (Opdivo/nivolumab and Keytruda/pembrolizumab).
  • Other immuno-modulators include, but are not limited to, OX-40 antibodies, PD-L1 antibodies, LAG3 antibodies, TIM-3 antibodies, 41BB antibodies and GITR antibodies.
  • Yervoy is a fully human CTLA-4 antibody marketed by Bristol Myers Squibb.
  • the protein structure of ipilimumab and methods are using are described in U.S. Pat. Nos. 6,984,720 and 7,605,238.
  • Opdivo/nivolumab is a fully human monoclonal antibody marketed by Bristol Myers Squibb directed against the negative immunoregulatory human cell surface receptor PD-1 (programmed death-1 or programmed cell death-1/PCD-1) with immunopotentiation activity.
  • Nivolumab binds to and blocks the activation of PD-1, an Ig superfamily transmembrane protein, by its ligands PD-L1 and PD-L2, resulting in the activation of T-cells and cell-mediated immune responses against tumor cells or pathogens.
  • Activated PD-1 negatively regulates T-cell activation and effector function through the suppression of P13k/Akt pathway activation.
  • nivolumab Other names for nivolumab include: BMS-936558, MDX-1106, and ONO-4538.
  • the amino acid sequence for nivolumab and methods of using and making are disclosed in U.S. Pat. No. 8,008,449.
  • KEYTRUDA/pembrolizumab is an anti-PD-1 antibodies marketed for the treatment of lung cancer by Merck.
  • the amino acid sequence of pembrolizumab and methods of using are disclosed in U.S. Pat. No. 8,168,757.
  • CD134 also known as OX40
  • OX40 is a member of the TNFR-superfamily of receptors which is not constitutively expressed on resting na ⁇ ve T cells, unlike CD28.
  • OX40 is a secondary costimulatory molecule, expressed after 24 to 72 hours following activation; its ligand, OX40L, is also not expressed on resting antigen presenting cells, but is following their activation. Expression of OX40 is dependent on full activation of the T cell; without CD28, expression of OX40 is delayed and of fourfold lower levels.
  • OX-40 antibodies, OX-40 fusion proteins and methods of using them are disclosed in US Patent Nos: U.S. Pat. No. 7,504,101; U.S. Pat. No. 7,758,852; U.S. Pat. No. 7,858,765; U.S. Pat. No. 7,550,140; U.S. Pat. No. 7,960,515; WO2012027328; WO2013028231.
  • Antibodies to PD-L1 also referred to as CD274 or B7-H1 and methods for use are disclosed in U.S. Pat. No. 7,943,743; U.S. Pat. No. 8,383,796; US20130034559, WO2014055897, U.S. Pat. No. 8,168,179; and U.S. Pat. No. 7,595,048.
  • PD-L1 antibodies are in development as immuno-modulatory agents for the treatment of cancer.
  • immunostimulatory agent refers to any agent that can stimulate the immune system.
  • immunostimulatory agents include, but are not limited to, vaccine adjuvants.
  • Aminoalkyl glucosaminide phosphates are known to be useful as vaccine adjuvants and immunostimulatory agents for stimulating cytokine production, activating macrophages, promoting innate immune response, and augmenting antibody production in immunized animals.
  • Aminoalkyl glucosaminide phosphates are synthetic ligands of the Toll-like Receptor 4 (TLR4).
  • TLR4 Toll-like Receptor 4
  • Additional AGP derivatives are disclosed in U.S. Pat. No. 7,129,219, U.S. Pat. No. 6,525,028 and U.S. Pat. No. 6,911,434. Certain AGPs act as agonists of TLR4, while others are recognized as TLR4 antagonists.
  • Aminoalkyl glucosaminide phosphate compounds employed in the present invention have the structure set forth in Formula 1 as follows:
  • the configuration of the 3′ stereogenic centers to which the normal fatty acyl residues (that is, the secondary acyloxy or alkoxy residues, e.g., R 1 O, R 2 O, and R 3 O) are attached is R or S, preferably R (as designated by Cahn-Ingold-Prelog priority rules).
  • Configuration of aglycon stereogenic centers to which R 4 and R 5 are attached can be R or S. All stereoisomers, both enantiomers and diastereomers, and mixtures thereof, are considered to fall within the scope of the present invention.
  • n The number of carbon atoms between heteroatom X and the aglycon nitrogen atom is determined by the variable “n”, which can be an integer from 0 to 4, preferably an integer from 0 to 2.
  • the chain length of normal fatty acids R 1 , R 2 , and R 3 can be from about 6 to about 16 carbons, preferably from about 9 to about 14 carbons.
  • the chain lengths can be the same or different. Some preferred embodiments include chain lengths where R1, R2 and R3 are 6 or 10 or 12 or 14.
  • n is 0, R 5 is CO 2 H, R 6 is PO 3 H2, and R 7 is H.
  • This preferred AGP compound is set forth as the structure in Formula 1a as follows:
  • X is O or S; Y is O or NH; Z is O or H; each R 1 , R 2 , R 3 is selected independently from the group consisting of a C 1-20 acyl and a C 1-20 alkyl; and R 4 is H or methyl.
  • Formula 1a encompasses L/D-seryl, -threonyl, -cysteinyl ether or ester lipid AGPs, both agonists and antagonists.
  • Z is O attached by a double bond or two hydrogen atoms which are each attached by a single bond. That is, the compound is ester-linked when Z ⁇ Y ⁇ O; amide-linked when Z ⁇ O and Y ⁇ NH; and ether-linked when Z ⁇ H/H and Y ⁇ O.
  • CRX-601 Especially preferred compounds of Formula 1 are referred to as CRX-601 and CRX-527. Their structures are set forth as follows:
  • Another preferred embodiment employs CRX 547 having the structure shown.
  • Still other embodiments include AGPs such as CRX 602 or CRX 526 providing increased stability to AGPs having shorter secondary acyl or alkyl chains.
  • methods for treating cancer in a mammal in need thereof, which comprises: administering to such mammal a therapeutically effective amount of:
  • methods for treating cancer in a mammal in need thereof, which comprises: administering to such mammal a therapeutically effective amount of:
  • said second immune-modulatory agent is selected from the group of: an anti-CTLA4 antibody, an anti-PD-1 antibody, an anti-PD-L1 antibody, an anti-OX40 antibody, an anti-GITR antibody, and anti-41BB antibody, an anti-LAG3 antibody and an anti-TIM3 antibody.
  • methods for treating cancer in a mammal in need thereof, which comprises: administering to such mammal a therapeutically effective amount of:
  • the immune-stimulatory agent is a TLR4 agonist. In one embodiment the immune-stimulatory agent is an AGP. In one aspect, the immune-stimulatory agent is a compound of Formula I. In one aspect, it is a compound of Formula 1a. In one aspect, the immune-stimulatory agent is selected from the group consisting of: CRX-601, CRX-547, CRX-602, CRX-527, and CRX-526.
  • ICOS expression analyses across various tumor histologies was generated using publically available mRNA expression datasets from The Cancer Genome Atlas (TCGA) and other databases. Table 3 shows the relative percentage of tumors from each histology that showed some detectable level of ICOS mRNA expression.
  • tumor histologies known to be sensitive to other cancer immunotherapy approaches (melanoma, RCC, NSCLC) as having a relatively higher percentage of tumors (>10%) which have detectable ICOS + tumor infiltrating lymphocytes (TILs), whereas tumor types known to be poorly immunogenic (prostate, ovarian, and pancreatic) having relatively lower percentage of tumors which have ICOS + TILs ( ⁇ 10%) (Table 3).
  • tumor types known to be associated with viral infection and/or chronic inflammation were among the tumor types showing the highest percentage of ICOS + TILs.
  • TILs which express ICOS in each respective tumor type.
  • ICOS may be predominantly expressed on tumor infiltrating T regs , while in others it may indicate level of ICOS + T effector cell infiltration.
  • ICOS expression by immunohistochemistry (IHC) in primary human non-small cell lung carcinoma (NSCLC), triple-negative breast cancer (TNBC), colo-rectal cancer (CRC), prostate, pancreatic, ovarian, renal cell cancer (RCC) and melanoma was performed to better understand which subsets of TILs are associated with ICOS expression in different tumor types (Table 4). Similar to what was observed in the mRNA expression analysis, the abundance of ICOS + TILs were relatively low, even in individual tumors where large numbers of CD4 + , CD8 + and/or FoxP3 + TILs were otherwise present.
  • Fresh blood was obtained from blood donors and was diluted 1:1 with Phenol red free-10% RPMI1640 media. Diluted blood was layered on top of the density medium in a Uni-Sep Max 50 ml conical tube and centrifuge at 400 ⁇ g for 20 minutes at room temperature with BREAK OFF. The resulted white mononuclear layer (buffy coat) was carefully extracted into a new 50 mL conical tube through a 100 ⁇ M cell strainer. An equal volume of Phenol red free-10% RPMI1640 media was added to the buffy coat and centrifuged at 300 ⁇ g for 10 minutes at room temperature.
  • the cell pellet was resuspended in 10 ml of red blood cell lysis solution (Sigma Aldrich) and incubated for 5 minutes at room temperature. Cells were washed once with media and centrifuged as previously described. Volume was brought to 40 ml with Phenol red free-10% RPMI1640 media and cells were counted using Vicell cell counter and viability analyzer (Beckman Coulter).
  • Human CD4+CD25 cells were further purified from PBMC via two-step magnetic beads based isolation procedure using human CD4+CD25+ Regulatory T Cell Isolation kit (Miltenyi Biotec).
  • PBMC cells were incubated with biotin-antibody cocktail at 4° C. for 5 minutes and subsequently incubated anti-Biotin microbeads for 10 minutes. This step was to label the non-CD4+ T cells.
  • Cells were then passed through a LD column in the magnetic field of a MidiMACS separator.
  • the effluent which is the unlabeled pre-enriched CD4+ cell fraction was collected and incubated with CD25 MicroBeads at 4° C. for 15 minutes.
  • the labelled cells were passed through a MS column in the magnetic field of a MiniMACS Separator.
  • the flow-through containing the unlabeled CD4 ⁇ CD25 ⁇ T effector cells was collected for downstream activation assays.
  • Human CD4+ T cells were isolated directly from fresh human blood using Human CD4+ T cells Enrichment Cocktail (Stem Cell Technologies). RosetteSep Human CD4+ T Cell Enrichment Cocktail (50 ⁇ L/mL) was added to whole blood and mixed well. After 20 minutes of incubation at room temperature, an equal volume of PBS+2% FBS was added with gentle mixing. The diluted sample was layered on top of the density medium and centrifuged for 20 minutes at 1200 ⁇ g at room temperature with the brake off. The enriched cells from the density medium:plasma interface were carefully poured into a new conical tube. Next the red blood cells were lysed with Red Blood Cell Lying Buffer (Sigma Aldrich) and the enriched cells were washed with PBS+2% FBS twice. The CD4+ T cells were resuspended in 40 ml of with PBS+2% FBS and counted with Vi-Cell cell counter.
  • Human CD4+ T cells were isolated directly from fresh human blood using Human CD4+ T cells Enrichment Cocktail
  • Non tissue culture treated 96 well flat bottom plates were coated with 100 ⁇ l/well of coating buffer (Biolegend) containing 1 ⁇ g/ml anti human CD3 antibody (eBioscience) and various testing antibodies overnight. On the next day, the pre-coated plates were washed three times with 10% FBS containing RPMI-1640 medium. Human CD4+CD25 ⁇ T effectors cells were isolated and labelled with CFSE as described and seeded onto the plates. After incubating at 37° C. for 2.5 days, cells were harvested and analyzed by flow cytometry for proliferation and activation marker expression. Cell culture supernatants were also collected for multiplex cytokines measurement by Meso Scale Discovery (MSD).
  • MSD Meso Scale Discovery
  • Cells to be labelled were resuspended in 1 ml of pre-warmed PBS at a final concentration of up to 1E7 cells/mL in a 15 ml of conical tube.
  • One microliter of 2 mM stock CFSE solution (Life Technologies) was added directly into the cells followed by immediately vortexing to ensure uniform labelling. After incubating at room temperature for 5 minutes, the staining was quenched by adding 14 ml of ice-cold cell culture media. The labeled cells were washed three times with ice-cold media.
  • Activated T cells were harvested and washed with PBS. Cells were first stained with LIVE/DEAD Fixable Far Red cell viability dye (Life Technologies) following vendor's protocol. After washing the dye off, detection antibodies conjugated with different colors were incubated with cells at 4° C. for 30 minutes. Stained cells were washed once with ice cold FACS staining buffer (PBS +0.5% BSA) before running on FACS Canto or FACS Canto II flow cytometer. Cytometer performance was checked daily using Cytometer Setup & Tracking beads (BD Biosciences) and PMT voltages and area scaling were set based on unstained cells. Compensations were performed using OneComp or UltraComp beads (eBioscience) that were individually stained with detection antibodies conjugated with each fluorochrome.
  • LIVE/DEAD Fixable Far Red cell viability dye Life Technologies
  • IFN- ⁇ , IL-10, IL-2 and TNF- ⁇ cytokine levels in the tissue culture supernatant were determined using MSD human V-Plex customized kit. Samples were first diluted 1:200 in Diluent2. Calibrators were also prepared in Diluent2 following kit manual. Diluted samples and calibrators were added to black MSD plate which was subsequently sealed with an adhesive plate seal and incubated at room temperature with shaking for 2 hours. After adding 25 ⁇ L of detection antibody solution which was freshly prepared in Diluent2 to each well, the plate was re-sealed and incubated at room temperature with shaking for another 2 hours.
  • the plates were washed 3 times with 150 ⁇ L/well of PBS plus 0.05% Tween-20 before adding 150 ⁇ l/well of freshly diluted 2 ⁇ read buffer and immediately read on MESO QuickPlex reader. Data were analyzed using MSD Workbench software.
  • Freshly isolated human CD4+ T cells were pre-stimulated on 24 well plates coated with anti-CD3 (1 ⁇ g/ml) and anti-CD28 (3 ⁇ g/ml) for 48 hours.
  • Cells were harvested, washed and mixed with anti-CD3 DynaBeads (Life Technologies) at 1:1 ratio in AIM-V medium supplemented with 100 IU/ml of IL-2 (PeproTech).
  • Cells/beads mixture were then seeded at 100 k per well onto 96 well flat bottom plates either non-coated (for soluble format) or coated with H2L5 hIgG4PE (for bound format).
  • H2L5 hIgG4PE was added to the wells at the time of cell seeding. After incubating at 37° C. for 3.5 days, cell culture supernatants were collected for multiplex cytokines measurement by MSD.
  • Freshly isolated human PBMCs were pre-stimulated on 24 well plates coated with anti-CD3 (1 ⁇ g/ml) and anti-CD28 (5 ⁇ g/ml) for 48 hours.
  • CFSE stained cells were prepared and mixed with anti-CD3 DynaBeads (Life Technologies) at 1:1 ratio in AIM-V medium supplemented with 100 IU/ml of IL-2 (PeproTech). Cells/beads mixture were then seeded at 200 k per well onto 96 well plates that were pre-coated with 1 ⁇ g/ml of anti CD3 antibody.
  • H2L5 hIgG4PE and control antibody was added directly to the wells in their soluble form. After incubating at 37° C. for 3.5 days, cell culture supernatants were collected for multiplex cytokines measurement by MSD, and cells were harvested for proliferation and marker expression analysis by flow cytometry.
  • FlowJo software (FlowJo LLC). Dead cells were first gated out based on LIVE/DEAD cell viability dye staining. Doublets were gated out on FSC-H:FSC-W scatter plot. The resulted live single cells were analyzed for activation marker expression within different T cell sub-populations such as CD4+ or CD8+ T cells and reported as percentage of parent population or Median Fluorescent Intensity (MFI).
  • MFI Median Fluorescent Intensity
  • CFSE data were also analyzed by Flowjo. After excluding the dead cells and the doublets, a “proliferated cell” gate was drawn based on non activated T cells. Any cells fall in this gate in any given sample were counted as proliferated cells. Data were reported as percentage of proliferation.
  • the heavy chain variable region for clone 88.2 is presented below as SEQ ID NO:13:
  • the light chain variable region for clone 88.2 is presented below as SEQ ID NO: 14:
  • ICOS binders Eight of the best ICOS binders were tested for IFN- ⁇ production and T cell proliferation using a cell based assay in a dose escalation design against mouse IgG1 and EPR7114 controls. Based on these assays, clone designated as 422.2 was selected for humanization. See FIGS. 1 and 2 .
  • RNA was purified from the 422.2 hybridoma cell pellet, reverse transcribed to generate cDNA from which the variable gene products, approximately 400 bp, were isolated by PCR and purified by agarose gel electrophoresis.
  • variable region fragments were cloned in to pTT5 vectors containing either the human IgG1 constant region or the human Kappa constant region and transformed into DH5a competent cells. Colonies were picked and used to inoculate L-broth containing ampicillin. Plasmid DNA was isolated from the cultures using a QuickLyse mini-prep kit. Variable heavy and light chain genes were sequenced and sequence data was aligned by informatics to identify the variable heavy and light chain gene sequences.
  • the mature murine variable region protein sequences were reverse translated to DNA then codon optimised.
  • the V H and V L sequences were then modified to include the preferred five prime untranslated region and preferred cloning sites at either end.
  • the adapted V H sequence was constructed de novo using a PCR-based strategy and overlapping oligonucleotides then grafted onto human IgG1 Fc wild type or Fc disabled hIgG1 (L235A, G237A) or hinge stabilised hIgG4 (S228P, L235E) (IgG4PE) present in pTT vectors.
  • the adapted V L sequence was constructed de novo using a PCR-based strategy and overlapping oligonucleotides then grafted onto a kappa constant region present in a pTT5 vector.
  • the resulting pTT plasmids were used in HEK transfections to produce the chimeric antibodies
  • V gene templates were chosen for humanization of 422.2 by searching appropriate in-house human germline heavy and light chain databases with CDR-masked 422.2 V regions using BLASTP.
  • IGHV1-69 and IGKV3-11 were chosen from the top BLASTP hits as the V gene framework templates for 422.2 humanization.
  • IGHJ6 and IGKJ2 human germline Joining (J) genes were chosen for humanization of 422.2.
  • Residue differences between the chosen human germline genes and the 422.2 sequence were identified to aid in the selection of back-mutations (mutations made to change the specific human framework residue to the murine residue).
  • Six humanized VH variants and six humanized VL variants were designed, codon optimised and then modified to include preferred 5′ and 3′ extensions.
  • the adapted variable region sequences were constructed de novo using a PCR-based strategy and overlapping oligonucleotides then respectively cloned into pTT vectors.
  • HEK2936E suspension cells were counted and diluted to 1.5 ⁇ 10 6 cells/mL to 2 ⁇ 10 6 cells/mL using Freestyle expression medium 293 supplemented with 0.05% Geneticin and for some experiments supplemented with 1% pluronic F68.
  • DNA and transfection reagent (Gemini or 293-Fectin) were added to OptiMEM and gently homogenised prior to incubation for 20 to 30 minutes at room temperature. The DNA-lipid complexes were then combined with the cell suspensions and the transfected cells were incubated at 37° C., 5% CO2, 125 rpm.
  • a tryptone feed (Freestyle expression medium 293 supplemented with 1% pluronic F68 and 20% w/v casein tryptone) was added to each transfection 24 to 48 hours after transfection.
  • Transfected cell suspensions were incubated for 5 to 8 days until viable cells dropped below 60% then centrifuged (construct dependent). Supernatants were harvested and filtered.
  • Antibodies were purified by passing supernatants through a 1 mL HiTrap Protein A HP column to enable antibody capture, washing the column through with 10 mL of PBS and eluting with 5 mL of IgG Elute (Pierce, 21009). Purified protein was buffer exchanged into PBS using the Millipore Centricon® Centrifugal Filter Units (30K cut-off) and quantified on the Nandrop spectrophotometer.
  • the murine antibody variable gene sequences of hybridoma clone 422.2 were successfully recovered and the sequences are shown below as SEQ ID NOs: 19 and 20, respectively as well as in FIG. 8 .
  • HC (SEQ ID NO: 19) QVQLQQSGPELVRPGESVKISCMGSGYTFTDYAMHWVKQSHAKSLEWIGL ISIYSDHTNYNQKFQGKATMTVDKSSSTAYMELARLTSEDSAIYYCGRNN YGNYGWYFDVWGAGTTVTVSS 422 LC (SEQ ID NO: 20) ENVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSITSPKLWIYDT SKLASGVPGRFSGSGSGNSYSLTISSMEAEDVATYYCFQGSGYPYTFGGG TKLEIKR
  • Cloning the recovered variable regions into selected pTT5 vectors resulted in generation of plasmids encoding the chimeric light chain sequence of 422.2 and the chimeric heavy chain sequences on hIgG1 Fc wild type, hIgG1 Fc disabled (L235A/G237A, EU numbering) or a hIgG4 PE (S228P/L235E, EU numbering).
  • the chimeric antibodies were used to confirm functionality of the cloned mouse V-regions and to identify the most suitable isotype.
  • H2L5 hIgG4PE The mature protein sequences of H2L5 hIgG4PE have been included with additional labeling in FIG. 9 .
  • Humanized antibody H2L5 was modified from a human IgG1 isotype to a modified human IgG4 isotype incorporating mutations S228P, L235E (EU numbering) to prevent antigen binding fragment (Fab) arm exchange.
  • Human IgG4PE was selected over human IgG1 as it diminishes binding of the mAb to activating Fc ⁇ receptors and C1q, therefore, reducing the potential of the mAb to induce depletion of ICOS positive cells by antibody-dependent cytotoxicity (ADCC) or complement dependent cytotoxicity (CDC).
  • ADCC antibody-dependent cytotoxicity
  • CDC complement dependent cytotoxicity
  • human IgG4PE S228P, L235E
  • Interaction with Fc ⁇ RIIb may be critical for the has been shown to be critical for the agonistic activity of other immunomodulatory antibodies targeting TNF- ⁇ family receptors as well as CD28 (Bartholomaeus P et al., “Cell contact-dependent priming and Fc interaction with CD32+ immune cells contribute to the TGN1412-triggered cytokine response.” J. Immunol., 192(5); 2091-8 (2014)).
  • human IgG4PE diminishes binding of the mAb to activating Fc ⁇ receptors (Fc ⁇ RI, Fc ⁇ RIIa and Fc ⁇ RIIIa) and C1q, therefore reducing the potential of the mAb to induce depletion of ICOS positive cells by antibody-dependent cytotoxicity (ADCC) or complement dependent cytotoxicity (CDC).
  • human IgG4PE (S228P, L235E) retains binding to Fc ⁇ RIIb (inhibitory Fc ⁇ receptor) (Table 6).
  • Table 6 below displays representative binding affinities to human Fc ⁇ receptors of the lead H2L5 as either a hIgG1 or a hIgG4PE antibody.
  • mouse-human chimeras which are fusions of mouse V region and human IgG1 Fc portion, were generated. These four chimera antibodies were tested in human whole PBMC activation assay as plate bound form.
  • Anti-ICOS chimera 422.2 showed the best agonistic activity in the bound PBMC activation assay. Combined with binding data and biophysical properties, 422.2 clone was chosen for humanization.
  • Four humanized 422.2 variants were selected based on ICOS binding and biophysical characteristics (422.2 H2L0, H2L5, H5L0 and H5L5) and were tested in bound human PBMC activation assays. The H2L5 variant demonstrated comparable or better T cell activation as measured by cytokine production relative to other variants ( FIG. 3 ).
  • V H variable region
  • mature heavy chain for the H5 variant are presented below as SEQ ID NOs:15 and 16, respectively.
  • H5 VH (SEQ ID NO: 15) QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYAMHWVRQAPGQGLEWIGL ISIYSDHTNYNQKFQGRATMTVDKSTSTAYMELSSLRSEDTAVYYCGRNN YGNYGWYFDVWGQGTTVTVSS Mature H5 heavy chain (SEQ ID NO: 16) QVQLVQSGAEVKKPGSSVKVSCKASGYTFT DYAMH WVRQAPGQGLEWIG L ISIYSDHTNYNQKFQG RATMTVDKSTSTAYMELSSLRSEDTAVYYCGR NN YGNYGWYFDV WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFL
  • V L variable region
  • mature light chain for the L0 variant are presented below as SEQ ID NOs:17 and 18, respectively.
  • the 422 H2L5 IgG1 was subsequently tested in various whole PBMC activation assays in soluble form.
  • This soluble format is likely to be more relevant to the in vivo condition as the whole PBMC assays contain lymphocytes, monocytes and other immune cells in the same well.
  • 422 H2L5 IgG1 mAb consistently showed decreased viability of T cell populations which is reminiscent of T cell depletion. This result was observed to different degrees in 11 healthy donors which were tested and was more prominent in CD4+ T cells than in CD8+ T cells.
  • the 422 H2L5 antibody did not show a significant decrease in T cell viability when expressed as either an IgG4[PE] or Fc-disabled isotype, suggesting that the decreased viability may have been due to Fc ⁇ R-mediated antibody-dependent cellular cytotoxicity (ADCC) ( FIG. 4 ).
  • human primary CD4+ T cells were first pre-stimulated by plate bound anti-CD3 (1 ⁇ g/ml)/anti-CD28 (3 ⁇ g/ml) for 48 hours to induce levels of ICOS receptor on the surface of T effector cell populations, followed by re-stimulation with anti CD3 DynaBeads and H2L5 hIgG4PE.
  • a 10-point dose response curve was generated by treating the pre-simulated CD4+ T cells with serial concentrations of bound or soluble H2L5 hIgG4PE in the presence of anti-CD3 DynaBeads.
  • results showed that both bound and soluble H2L5 hIgG4PE increased IFN- ⁇ and TNF- ⁇ cytokines productions in a dose dependent manner in two separate healthy human donors ( FIG. 5 ).
  • a dose-response curve fitting analysis was performed to generate EC50 values.
  • H2L5 hIgG4PE treatment resulted in a significantly greater magnitude of cytokine induction when the antibody was plate-fixed as opposed to being added as a soluble protein to the supernatant of the T cell cultures.
  • the results from 3 donors were summarized in FIG. 6 , which provide evidence to suggest that H2L5 hIgG4PE induces proliferation, cytokine production and increased cytotoxic potential in activated PBMCs from healthy human donors ( FIG. 6 ).
  • H2L5 hIgG4PE The activity of H2L5 hIgG4PE was evaluated in a PBMC pre-stimulation assay in which the PBMC were pre-stimulated by plate bound anti-CD3 (clone OKT3, 1 ⁇ g/ml) and anti CD28 (clone CD28.2, 3 ⁇ g/ml) for 48 hours.
  • plate bound anti-CD3 clone OKT3, 1 ⁇ g/ml
  • anti CD28 clone CD28.2, 3 ⁇ g/ml
  • H2L5 hIgG4PE ICOS agonist mAb resulted in induction of IFN ⁇ as compared to isotype control in all pre-stimulation conditions tested; however, the magnitude of IFN ⁇ production inversely correlated with strength of the pre-stimulation.
  • Concentration-dependent changes in functional endpoints were assessed by treating healthy human PBMCs with immobilized H2L5 hIgG4PE at concentrations ranging from 0.1 ⁇ g/mL to 100 ⁇ g/mL concurrently with anti-CD3 antibody treatment at 0.6 ⁇ g/mL.
  • Changes in expression of T cell surface activation markers CD69, OX40 and CD25 were evaluated by flow cytometry and considered a measure of T cell activation.
  • Proliferation of T cells was measured by the changes in Ki67 nuclear staining. Change in levels of various Th1, Th2 and Th17 cytokines were evaluated on the MSD platform in response to H2L5 hIgG4PE treatment in the presence of CD3 engagement.
  • the 24- and 48-hours post treatment timepoints were selected to ensure the capture of both early cytokine changes as well as proliferation changes which are predominantly noticed at later time points.
  • PBMCs Human Peripheral Blood Mononuclear Cells
  • Anti-human CD3 antibody was diluted in coating buffer to a final concentration of 0.6 ⁇ g/mL. 100 ⁇ L diluted antibody was coated on 96-well, flat-bottom plate overnight at 4° C. Next day, stock solutions of 10.1 mg H2L5 hIgG4PE and 7.9 mg anti-RSV IgG4 PE isotype control antibody were 1:2 serially diluted in coating buffer to give final antibody concentrations ranging from 100 to 0.1 ⁇ g/mL. 100 ⁇ L diluted antibodies were coated on anti-CD3 coated plate for 4 hours at room temperature.
  • Cells were first stained with 100 ⁇ L of fixable viability dye eFluor 506 pre-diluted 1:1000 in PBS for 30 minutes in the dark at 4° C. Cells were washed and then incubated with detection antibodies to cell surface markers conjugated to different fluorophores on ice for 30 minutes. Post-staining with cell surface antibodies, samples not to be stained for internalization markers were washed once with ice cold FACS Staining Buffer before running on FACS Canto II flow cytometer.
  • fixable viability dye eFluor 506 pre-diluted 1:1000 in PBS for 30 minutes in the dark at 4° C. Cells were washed and then incubated with detection antibodies to cell surface markers conjugated to different fluorophores on ice for 30 minutes. Post-staining with cell surface antibodies, samples not to be stained for internalization markers were washed once with ice cold FACS Staining Buffer before running on FACS Canto II flow cytometer.
  • Cytometer performance was appropriately evaluated daily using the Cytometer Set-up and Tracking beads. Compensations were performed using AbC anti-mouse Bead kit that were individually stained with detection antibodies conjugated with each fluorochrome. Samples were run and data acquired after proper compensation set up was ascertained with a mix of beads mentioned above.
  • the cells were fixed and permeabilized for staining for intracellular markers.
  • the Fixation/Permeabilization Buffer was prepared by diluting this 1:3 in Diluent Buffer.
  • the Perm Wash Buffer was prepared by diluting the 5 ⁇ Perm/Wash Buffer stock in deionized water.
  • One (1) mL of Fix/Perm Buffer was added to each sample, and the plates were immediately vortexed on the shaker. The plates were incubated in the dark at 4° C. for 45 minutes. Following centrifugation, 1 mL of Perm/Wash Buffer was added, and the plates were mixed and centrifuged for a total of two washes.
  • the internalization cocktail was prepared with marker antibodies. 100 ⁇ L of the internalization antibodies were added to the appropriate samples, and the plates were incubated in the dark at 4° C. for 30 minutes. Samples were washed twice with 1 mL of Perm Wash Buffer, resuspended in 250 ⁇ L of flow buffer and run on FACS Canto II flow cytometer.
  • Cytokine levels were measured using the MSD Human Special Order 9-Plex kit. Samples and calibrators were diluted in Diluent 43. Samples were diluted 1:10 for the 9-plex assay and 1:200 for the IFN ⁇ assay described in 0.250 ⁇ L of the diluent was added to each of two calibrator panels. After vortexing, the calibrators were incubated on ice for at least 5 minutes. Two hundred (200) ⁇ L of each calibrator panel was added to 400 ⁇ L of diluent to make the top concentration of calibrator, and a 1:4 serial dilution was used to prepare the 6 additional calibrator dilutions. Diluent 43 was used as the plate background.
  • Samples and calibrators were diluted in Diluent 2. 1 mL of the diluent was added to the calibrator. After vortexing, the calibrator was incubated on ice for 5 minutes. This is Calibrator 1. A 1:4 serial dilution was used to prepare the 6 additional calibrator dilutions. Diluent 2 was used as the plate background. Fifty (50) ⁇ L of diluted samples (in tripicate) and calibrators (in duplicate) were added to the MSD plate. Plates were sealed and incubated at RT with shaking for 2 hours. Plates were washed 3 times with 150 ⁇ L of diluted MSD Wash Buffer from the kit. Detection antibody solution prepared in Diluent 3.
  • each plate 60 ⁇ L of each of the detection antibody was added to the diluent for a total of 3 mL of detection reagent. Following the addition of 25 ⁇ L of detection antibodies, the plates were sealed and incubated at room temperature, in the dark, with shaking for 2 hours. Plates were washed 3 times. Read Buffer was added to the plates and they were read on the QuickPlex.
  • MSD cytokine assay results were analyzed using MSD Discovery Workbench software, version 4.0 (Meso-Scale), Microsoft Excel, and Graphpad Prism. Flow cytometry data were analyzed by DIVA, and numbers were plotted in GraphPad Prism software.
  • Th1 cytokines such as IFN ⁇ , TNF ⁇ , the Th2 cytokines, IL-6 and IL-10, as well as the Th17 cytokine IL-17a in a concentration-dependent manner.
  • Other cytokines measured such as IL-4, IL-5 and IL-13 also showed a lesser extent of concentration-dependent response to H2L5 hIgG4PE stimulation.
  • Table 7 The results from four separate donors are summarized in Table 7.
  • H2L5 hIgG4PE treatment with concurrent CD3 stimulation in unactivated human PBMC induced significant changes in T cell activation markers (Table 7 and 8)).
  • Robust increases in CD25 and OX40 positive CD4 and CD8 T cells were observed in H2L5 hIgG4PE treated samples when compared to the human IgG4 isotope control samples.
  • the percent of CD69 positive CD4 and CD8 T cells were also increased at 24- and 48-hour time point in a concentration-dependent manner.
  • H2L5 hIgG4PE also increased CD4+CD25+Foxp3+ regulatory T cell proliferation in a concentration dependent manner but to a lesser extent than what was observed with total CD4 and CD8 T cells.
  • the enhancement of T cell proliferation by H2L5 hIgG4PE was only observed at the 48 hour time point.
  • the increased proliferation of the regulatory T cells was not significant whereas the concentration-dependent increase in proliferating CD4+ cells (p ⁇ 0.05 for concentrations greater than 0.4 ⁇ g/mL H2L5 hIgG4PE) and CD8+ T cells (p ⁇ 0.05 for concentrations between 0.2 and 1.6 ⁇ g/mL) was significant (see Table 7).
  • ICOS is important for T cell activation and induction of both Th1 and Th2 cytokines.
  • H2L5 hIgG4PE anti-ICOS agonist antibody
  • CD25 IL-2 receptor alpha-chain
  • CD69 eyely activation marker
  • OX-40 co-stimulatory marker
  • CD69 is an early activation marker and hence the effects are predominant in the 24-hour samples.
  • CD25 another important T cell activation marker, was increased upon treatment with H2L5 hIgG4PE at both time points, suggesting that H2L5 hIgG4PE plays an important role in maintaining activation of T cells.
  • Ki67 is a nuclear protein associated with cell proliferation. Flow cytometry data with Ki67 intracellular staining indicated that immobilized H2L5 hIgG4PE significantly enhanced both CD4 and CD8 T cell proliferation in the context of TCR engagement. Though proliferation of regulatory T cells was also increased by H2L5 hIgG4PE, the changes were not statistically significant.
  • Human Th17 cells are a key player in the regulation of anti-tumor immunity [Nunez, S., et al., T helper type 17 cells contribute to anti-tumour immunity and promote the recruitment of T helper type 1 cells to the tumour. Immunology 2013; 139: 61-71].
  • ICOS is involved in human Th17 development and function [Kimura, A., et al., Regulator of Treg/Th17 balance. Eur. J. Immunol. 2010; 40: 1830-1835; Paulos C M et al.
  • the inducible costimulator (ICOS) is critical for the development of human Th17 cells. Sci Transl Med . (2010) 2(55); 55ra78; Nelson, M. H., et al.
  • H2L5 hIgG4PE The inducible costimulator augments Tc17 cell responses to self and tumor tissue. J Immunol, 2015; 194: 1737-1747].
  • H2L5 hIgG4PE a majority of cytokines related to inflammatory and immune responses were measured in the supernatant of cell cultures after anti-CD3 and H2L5 hIgG4PE stimulation.
  • H2L5 hIgG4PE strongly induces secretion of Th1 cytokines, IFN- ⁇ and TNF- ⁇ and Th17 cytokine, IL-17a, in human PBMCs, suggesting that H2L5 hIgG4PE has the potential to play an important role in anti-tumor responses.
  • IL-6 is an important cytokine for induction of the Th17 cell development from naive T cells.
  • IL-6 inhibits Treg differentiation induced by TGF-3 [Kimura, A., 2010; Korn, T., et al., IL-6 controls Th17 immunity in vivo by inhibiting the conversion of conventional T cells into Foxp3 + regulatory T cells. PNAS, 2008; 105: 18460-18465].
  • H2L5 hIgG4PE was found to increase the secretion of IL-6 which may further enhance Th17 cell development.
  • Agonist antibodies of T cell receptors such as CD28 and TNF receptor family members have been shown to produce a bell shaped dose response curve [White, A.
  • H2L5 hIgG4PE also demonstrates a similar hyperbolic functional response curve. This information is an important component in ascertaining the best dose range of the antibody to be used for optimal pharmacodynamic response.
  • H2L5 hIgG4PE in conjunction with CD3 stimulation, was shown to enhance T cell activation, proliferation and proinflammatory cytokine induction in line with its role as a potent activator of a T cell co-stimulatory receptor.
  • the humanization protocol (Example 3) produced 36 heavy and light chain variants which were screened for binding to human and cynomolgus ICOS whilst also ensuring that they did not bind to human CD28 or CTLA-4.
  • the H2L5 variant was identified as the having high affinity for human and cynomolgus ICOS (1.34 and 0.95 nM respectively) whilst containing the minimum number of back mutations.
  • H2L5 hIgG4PE has an affinity of 1.3 nM to human ICOS.
  • Concentration based inhibition of ICOS/ICOS-L binding by H2L5 hIgG4PE is shown in FIG. 7 .
  • the binding kinetics affinity of the humanized H2L5 hIgG4PE antibody was determined used the BIAcore T200Anti-human IgG on Fc2 of a CM5 chip Anti-ICOS H2L5 hIgG4PE captured on the surface.
  • Anti-human IgG surface blocked with 0.1 mg/mL hIgG1 control to prevent non-specific binding of rabbit Fc.
  • Human and cyno ICOS (rabbit Fc) passed over the captured antibodies at 256 nM, 64 nM, 16 nM, 4 nM and 1 nM. Buffer alone was used to double reference binding curves.
  • MgCl 2 was used to regenerate surface. Run carried out at 25° C. Data fitted to 1:1 model using T200 evaluation software.
  • Antibody concentration 2.5 ⁇ g/mL
  • the binding kinetics affinity of the humanized H2L5 hIgG4PE antibody was determined using the BIAcore T200.
  • the ICOS binding data was fitted to a 1:1 kinetics model using the T200 data analysis software.
  • H2L5 hIgG4PE for human ICOS is 1.34 nM and cynomolgus ICOS is 0.95 nM (see Table 9). These values are comparable and show, as expected, that a change to the Fc region of the molecule has not affected the binding to the ICOS antigen.
  • Table 9 shows Ka/Kd/KD for humanized 422 (H2L5) IgG4PE to human and cynomolgus ICOS.
  • murine clone 422-2 was identified as the lead anti-human ICOS murine antibody. Humanization of this antibody produced 36 heavy and light chain variants which were screened for binding to human and cynomolgus ICOS whilst also ensuring that they did not bind to human CD28 or CTLA-4.
  • the H2L5 variant was identified as the having high affinity for human and cynomolgus ICOS (1.34 and 0.95 nM respectively) whilst containing the minimum number of back mutations.
  • CD3+ T Cells were Negatively Isolated by Stemcell Rosette Sep Human T Cell Enrichment Kit Rosette Sep Human T Cell Enrichment:
  • the pellets from each donor were then combined into a single 50 mL conical tube, re-suspending the pellets in a total volume of 50 mL PBS+2% FBS.
  • Cells were centrifuged at 400 ⁇ g for 5 minutes at RT. Supernatants were discarded and the cell pellets were re-suspended in 2 mLs of RPMI Complete Media (RPMI 1640+10% FCS+1 mM sodium pyruvate+2 mM L-glutamine+penicillin 100 U/mL+streptomycin 100 ⁇ g/mL).
  • Recovered CD3 Cells were counted on the ViCell instrument and further diluted to 1.2 ⁇ 10 6 cells/mL. 1 ⁇ 10 6 recovered cells were stained for CD3 PE-Cy7 to confirm the quality of the T cell isolation.
  • CD3+ T Cells were Negatively Isolated by Invitrogen Untouched T Cell Isolation Kit PBMC Isolation:
  • the tubes were topped off to 50 mL with PBS+2% FBS.
  • the cells were centrifuged at 400 ⁇ g for 10 minutes at RT. Supernatants were discarded.
  • the pellets from each donor were then combined into a single 50 ml conical tube and re-suspended in a total volume of 50 mL PBS+2% FBS.
  • Cells were centrifuged at 400 ⁇ g for 5 minutes at RT. Supernatants were discarded, and the cell pellets were re-suspended in an arbitrary volume of Isolation Buffer (dependent upon the size of the cell pellet) provided in the Invitrogen Untouched T cell kit.
  • Isolated PBMC's were then counted on the ViCell instrument and brought to a final concentration of 1 ⁇ 10 8 cells/mL in Isolation Buffer.
  • the tubes were placed into a magnet for 2 minutes at room temperature. Without disturbing the magnetized beads, the supernatants containing the untouched T Cells were collected. The beads were washed 1 time with 10 mLs of Isolation Buffer and placed into the magnet again for 2 minutes at room temperature, and the bead-cleared buffer collected. The collected cells were centrifuged at 400 ⁇ g for 5 minutes at RT. Supernatants were discarded, and the cell pellets were re-suspended in an arbitrary volume of RPMI Complete Media dependent upon cell pellet size (2 to 35 mLs). Recovered CD3+ cells were then counted on the ViCell and brought to a concentration of 1.2 ⁇ 10 6 cells/mL in RPMI Complete Media.
  • T75 flasks were coated with 4 mL of 1 ⁇ g/ml CD3/CD28 in PBS for 2 hours at 37° C. Flasks were washed twice with 12 mL of PBS. 30 ⁇ 10 6 cells in 25 mLs of RPMI Complete Media were added per T75 flask. Cells were incubated for 48 hours at 37° C., 5% CO 2 to allow activation to occur.
  • H2L5 hIgG4PE Binding of H2L5 hIgG4PE was assessed in both naive and activated CD3+ T cells. An 8-point titration from 0.00128 to 100 g/mL H2L5 hIgG4PE with 5 fold dilutions was employed.
  • Either naive and/or activated CD3+ T cells were re-suspended in PBS with 0.1% BSA (FACS Buffer) containing Human FcR Blocking Solution at 2 ⁇ 10 6 cells/mL (5 ⁇ l FcR Blocking Solution+950 ⁇ l FACS Buffer per 1 mL). At a concentration of 2 ⁇ 10 5 cells/well, 100 ⁇ l cells were placed into 2 mL 96 well Assay Blocks and incubated at room temperature for 15 minutes. During the incubation, a titration of the binding antibodies, anti-ICOS (H2L5 hIgG4PE) or IgG4 Isotype Control antibody was prepared as a 2 ⁇ concentration.
  • BSA FACS Buffer
  • Fc-blocked T cells were re-suspended in 80 ⁇ l of FACS Buffer following the binding incubation with H2L5 hIgG4PE or control antibodies. 20 ⁇ l per well of either the Staining or Isotype Cocktail was added per well. Cells were stained for 20 minutes at room temperature in the dark. Following the staining incubation, cells were washed twice in 1 mL of FACS Buffer, centrifuging at 400 ⁇ g for 5 minutes at room temperature.
  • Cells were re-suspended in 500 ⁇ l of 1% formaldehyde (10 mLs of 16 ⁇ concentrated Formaldehyde+150 mLs of 1 ⁇ PBS) and incubated at room temperature for 20 minutes. Cells were then washed twice with 1 mL FACS buffer, centrifuging at 400 ⁇ g for 5 minutes at room temperature. Pellets were then re-suspended in 265 ⁇ l of FACS Buffer and transferred to a 96 well round bottom plate. Cells were stored at 4° C. in the dark until analysis by flow cytometry.
  • Flow cytometry was performed on either the FACS Fortessa X20 or the FACS Canto II using FACSDiva software (Version 8.0). Compensation was performed at the time of acquisition using single stained eBioscience Ultracomp beads and the compensation software in FACSDiva.
  • Data acquisition and compensation were performed on BD FACS instruments, LSR Fortessa X-20 or FACS Canto II using BD Diva (ver. 8.0) software.
  • Data analysis employed Flow Jo software positive for human IgG kappa light chain FITC staining out of the total live cells or appropriate parent population.
  • T cell isolation kits Isolation of T cells from fresh, whole human blood, using either Rosette Sep CD3 Enrichment kit or Dynabead Untouched T cell isolation kits was confirmed by staining with anti-CD3 PeCy7. Donors ranged between 68% and 97% positive for CD3 cells.
  • Anti-CD3/anti-CD28 activated CD4+ and CD8+ cell populations generated H2L5 hIgG4PE-concentration-dependent curves when assessed for anti-human IgG1 Kappa light chain FITC staining. H2L5 hIgG4PE binding curves are presented as both percent anti-human IgG1 Kappa light chain FITC positive and FITC median fluorescence intensity (MFI).
  • T cells incubated with the IgG4 Isotype Control antibody did not produce concentration dependent curves when assessed for anti-human IgG1 Kappa light chain FITC staining.
  • Naive CD4+ or CD8+ cells did not produce full curves; however, there were concentration-dependent increases observed from 0.1 g/mL to 100 ⁇ g/mL.
  • the median (range) EC50 values were 1.04 ⁇ g/mL (0.628-1.31 ⁇ g/mL) for CD4+ FITC MFI and 0.652 ⁇ g/mL (0.27-0.74 ⁇ g/mL) for CD8+ FITC MFI, respectively.
  • the median (range) EC50 values were 0.834 ⁇ g/mL (0.45-0.965 ⁇ g/mL) for CD4+ Percent IgG Kappa Light Chain FITC Positive and 0.583 ⁇ g/mL (0.371-1.23 ⁇ g/mL) for CD8+ Percent IgG Kappa Light Chain FITC. (Table 10)
  • H2L5 hIgG4PE anti-ICOS agonist antibody
  • H2L5 hIgG4PE binding to the cell surface of T cells was detected using an antibody against human IgG kappa light chain labelled with FITC.
  • Binding EC50s were determined for H2L5 hIgG4PE in negatively isolated human T cells. Binding curves were generated when the isolated T cells were activated by 48 hours exposure to 1 ⁇ g/mL plate bound CD3/CD28 antibodies. Both percent IgG kappa light chain FITC positive cells and FITC MFI data from CD4+ and CD8+ activated T cells were considered in the statistical analyses. The median CD4+EC50 values were similar when calculated as percent FITC positive cells or FITC MFI, 1.04 and 0.834 ⁇ g/mL, respectively. The median CD8+ EC50 values were also similar when calculated as percent FITC positive cells or FITC MFI, 0.652 and 0.583 ⁇ g/mL, respectively.
  • T cells incubated with the IgG4 PE isotype control did not result in concentration-dependent increases in anti-human IgG kappa light chain FITC binding regardless of the analysis method employed, MFI or Percent Positive Cells.
  • H2L5 hIgG4PE To access the in vivo characteristics of H2L5 hIgG4PE in a target-relevant species a dose-range finding study was performed in cynomolgus monkeys. The study tested 3 dose levels (0.3, 3 and 30 mg/kg) in addition to a vehicle control cohort. It was a repeat dose with the second dose administered 14 days after the first. One male and one female were tested per cohort. H2L5 hIgG4PE exhibited a dose-dependent increase in C max (g/mL) and AUC ( ⁇ g ⁇ h/mL) across the 3 different doses which were tested. At all three dose levels, antibody was detected in the plasma for two weeks following the first dose ( FIG. 12A ).
  • Anti-H2L5 hIgG4PE antibodies were detected in 3 of the monkeys following a single dose, both of the 0.3 mg/kg dosed animals as well as the female dosed at 3 mg/kg. Anti-H2L5 hIgG4PE antibodies correlated with decreased plasma concentrations following administration of the second dose in these animals ( FIG. 12B ). Forty-eight hours after the second dose all animals were sacrificed to collect tissue for analysis of pharmacodynamic activity and histopathology analysis.
  • H2L5 hIgG4PE receptor occupancy was measured in CD4+ T cells from the spleens and axillary lymph nodes of all animals on study. A dose-dependent increase in H2L5 hIgG4PE binding was observed across the dose levels tested in both tissues ( FIG. 13 ).
  • Receptor occupancy was also measured on CD4+ T cells from the peripheral blood of monkeys on study. Blood was drawn at 5 time points (Day 1 (pre-dose), day 3, day 8, day 15 (pre-second dose) and day 17). Two different measures were used in this assay to determine RO. The first was a “free-receptor” assay format in that, binding of the anti-ICOS mAb used for flow cytometry detection was determined in the presence or absence H2L5 hIgG4PE which was shown to compete for ICOS binding.
  • FIG. 14 -A shows that ICOS free receptor decreased in a dose-dependent, and time dependent manner.
  • Two monkeys 250 and 300 demonstrated “free receptor” signals which could not be explained, and may be due to the production of anti-H2L5 hIgG4PE antibodies in these monkeys.
  • RO was also measured in peripheral blood CD4+ cells by the same assay used in spleen and lymph nodes described above.
  • Example 9 H2L5 hIgG4PE Induces Intracellular Signalling Changes in Response to Binding
  • Ba/F3-ICOS cells were obtained from INSERM (Paris, France). Cells were cultured in the appropriate culture medium supplemented with 10% fetal bovine serum (FBS) (Sigma-Aldrich, St. Louis, Mo.), 10 ng/mL recombinant murine IL-3 (R&D Systems, Minneapolis, Minn.), and 1 mg/mL Geneticin (ThermoFisher, Waltham, Mass.) at 37° C. in humidified incubators under 5% CO 2 .
  • FBS fetal bovine serum
  • R&D Systems R&D Systems, Minneapolis, Minn.
  • Geneticin ThermoFisher, Waltham, Mass.
  • Protein lysates were assayed with the PathScan® Intracellular Signaling Array Kit (Cell Signaling Technologies) according to the manufacturer's instructions. Briefly, lysates from Ba/F3-ICOS cells treated with IgG4-PE (20 ⁇ g/mL) or H2L5 hIgG4PE (0.2, 2, or 20 ⁇ g/mL) for 1, 6, 24, and 48 hours were diluted to 1 ⁇ g/ ⁇ L in Array Diluent Buffer and incubated overnight onto the antibody arrays at 4′C. Images of the arrays were captured using the Odyssey imaging software (LI-COR Biosciences, Lincoln, Nebr.).
  • Phosphorylation of AKT was measured using the Meso Scale Discovery (MSD) Phospho(Ser473)/Total Akt Whole Cell Lysate Kit and Phospho-Akt (Thr308) Whole Cell Lysate Kit according to the manufacturer's instructions.
  • MSD Meso Scale Discovery
  • Cells were seeded at a cell density of 0.25 ⁇ 10 6 cells/well into 96-well U-bottom plates (BD Falcon) in the appropriate culture media (100 ⁇ L/well).
  • Cells were treated for 1, 2, 4, 6, 24, or 48 hours with either the control antibody (IgG4 PE), anti-ICOS IgG1 Fc disabled antibody, or H2L5 hIgG4PE at 7 different concentrations using a 3-fold dilution scheme (dose range: 20.0-0.03 ⁇ g/mL) in duplicate wells.
  • the control antibody IgG4 PE
  • anti-ICOS IgG1 Fc disabled antibody H2L5 hIgG4PE
  • H2L5 hIgG4PE H2L5 hIgG4PE at 7 different concentrations using a 3-fold dilution scheme (dose range: 20.0-0.03 ⁇ g/mL) in duplicate wells.
  • Phospho-AKT Thr308) Whole Cell Lysate Kit
  • cells were treated with one concentration of all three antibodies (10 ⁇ g/mL) in triplicate wells.
  • the bottom row of each 96-well plate contained a no cells control (two blank duplicate wells) and cells that were
  • cells were lysed with 30 ⁇ L of ice cold lysis buffer containing protease and phosphatase inhibitors, incubated on ice for 30 minutes, and then 25 ⁇ L of lysate was transferred to the ELISA plate to incubate overnight at 4° C.
  • Densitometry analysis was performed to calculate the integrated intensity levels of the spots across the antibody array.
  • % Phosphoprotein ((2 ⁇ Phospho-signal)/(Phospho-signal+Total protein signal)) ⁇ 100. This value was then normalized to the untreated cells value at each time point and graphed as “% control” in Microsoft Excel 2007.
  • H2L5 hIgG4PE treatment increased phospho-AKT (S473) levels in Ba/F3-ICOS cells with the maximum response observed between 30-40 minutes after antibody exposure.
  • phospho-AKT levels were measured at later time points to see if increased phosphorylation levels persisted after several days. Additionally, the regulation of other intracellular signalling events by ICOS activation was assessed.
  • phospho-AKT (S473) levels were increased with H2L5 HIGG4PE treatment compared to IgG4-PE isotype control antibody-treated cells after one and six hours of treatment, but this effect was lost after 24 hours ( FIG. 15 ).
  • Protein lysates were also analyzed using an antibody array that measures the phosphorylation or cleavage of 18 proteins involved in intracellular signalling. Using this approach, only three proteins showed slight increases in phosphorylation upon ICOS activation: phospho-AKT (S473), phospho S6 (S235/236), and phospho-SAPK/JNK (Ti 83/Y185).
  • Ba/F3-ICOS cells were treated with a dose range of control antibody (IgG4 PE).
  • anti-ICOS IgG1 Fc disabled antibody, or H2L5 hIgG4PE over time and monitored by ELISA.
  • Increased phospho-AKT (S473) levels were both dose-dependent and time-dependent in anti-ICOS IgG1 Fc disabled antibody-treated or H2L5 hIgG4PE-treated cells.
  • maximal phospho-AKT (S473) activation occurred after 1 hour of treatment. The phospho signal slightly decreased after 2 hours and persisted up to 6 hours but was eventually lost after 24 hours.
  • An ELISA that measures phospho-AKT (T308) levels was also tested here but no reproducible activation could be observed with this ELISA kit.
  • the AKT signalling cascade can be activated by receptor tyrosine kinases, integrins, B and T cell receptors, cytokine receptors, G-protein-coupled receptors and other stimuli that induce production of phosphatidylinositol (3,4,5) trisphosphates (PIP3) by PI3K [Carnero, 2008]. These lipids serve as plasma membrane docking sites for Akt and its upstream activator PDK1. At the membrane, PDK1 phosphorylates AKT at Thr308 leading to partial activation of Akt [Alessi, 1996]. Phosphorylation of Akt at Ser473 by mTORC2 stimulates full enzymatic activity [Sarbassov, 2005].
  • ICOS plays a key role in the function of activated effector and regulatory CD4+ T cells by promoting T cell survival, proliferation and memory. Due to its role in sustaining T-cell activation and effector functions, targeting ICOS with an agonist antibody could be a plausible approach to enhance antitumor immunity.
  • activation of ICOS by H2L5 hIgG4PE caused changes to AKT phosphorylation in Ba/F3-ICOS cells.
  • proteins downstream of AKT such as GSK3a (a direct substrate of AKT) and ribosomal protein S6 were also phosphorylated. This data is consistent with work performed recently with this model system, and is in-line with data published externally [Fos, 2008].
  • Fresh blood was obtained from GSK Health Center blood donors and was diluted 1:1 with phenol red free-10% RPMI1640 media. Diluted blood was layered on top of the density medium in a Uni-Sep Max 50 ml conical tube and centrifuge at 400 ⁇ g for 20 minutes at room temperature with BREAK OFF. The resulted white mononuclear layer (buffy coat) was carefully extracted into a new 50 mL conical tube through a 100 ⁇ M cell strainer. An equal volume of Phenol red free-10% RPMI1640 media was added to the buffy coat and centrifuged at 300 ⁇ g for 10 minutes at room temperature.
  • the cell pellet was resuspended in 10 ml of red blood cell lysis solution (Sigma Aldrich) and incubated for 5 minutes at room temperature. Cells were washed once with media and centrifuged as previously described. Volume was brought to 40 ml with Phenol red free-10% RPMI1640 media and cells were counted using Vicell cell counter and viability analyzer (Beckman Coulter).
  • Human monocytes were isolated using the plastic adherence method. Briefly, 20 million freshly isolated PBMC were cultured in a T-75 tissue culture flask in AIM-V media (Thermo Fisher) for 3 hours. Cells that do not bind to plastic were washed off. The adherent monocytes were cultured in a 37° C. 5% CO 2 incubator in AIM-V media supplemented with 1000 U/ml of human GM-CSF (Calt#300-03, PeproTech) and 500 U/ml of human IL-4 (cat#200-04). After 7-10 days, the iDC cells were collected for co-culturing with T cells from a different donor in the allogeneic Mixed Lymphocyte Reaction assays.
  • Human T cells were isolated directly from fresh human blood using a human T cell enrichment cocktail (Stem Cell Technologies).
  • the RosetteSep Human T Cell Enrichment Cocktail (50 ⁇ L/mL) was added to whole blood and mixed well. After 20 minutes of incubation at room temperature, an equal volume of PBS+2% FBS was added with gentle mixing.
  • the diluted sample was layered on top of the density medium and centrifuged for 20 minutes at 1200 ⁇ g at room temperature with the brake off.
  • the enriched cells from the density medium: plasma interface were carefully poured into a new conical tube.
  • the red blood cells were lysed with Red Blood Cell Lying Buffer (Sigma Aldrich) and the enriched cells were washed with PBS+2% FBS twice.
  • the T cells were then resuspended in 40 ml of PBS+2% FBS and counted with a Vi-Cell cell counter.
  • Freshly isolated human PBMCs were pre-stimulated with CD3/CD28 T cell expander DynaBeads at a bead to cell ratio of 1:20 in a T-75 tissue culture flask in AIM-V medium supplemented with 100 ng/ml of MCSF and 100 IU/ml of IL-2 (PeproTech) at 37° C. After 48 hours, the pre-stimulation beads were magnetically removed and cells were washed, counted and re-stimulated with anti-CD3 DynaBeads and therapeutic antibodies in AIM-V medium supplemented with 100 IU/ml of IL-2 (PeproTech) in 96-well non-tissue culture treated round bottom plate. The seeding density was 100 k cells per 100 ⁇ l of medium per well. After incubating at 37° C. for 3.5 days, cell culture supernatants were collected for multiplex cytokine measurement by MSD.
  • Monocyte-derived iDCs from a healthy human volunteer were mixed at a 1:10 ratio (iDC:T) in the presence of 0.02 ⁇ g/ml of a CEFT peptide mixture for 24 hours.
  • Different groups of treatment antibodies were added directly to the wells, mixed and further incubated for an additional 4 days.
  • Cell culture supernatants were collected for multiplex cytokine measurement by MSD analysis.
  • IFN- ⁇ , IL-10, IL-2 and TNF- ⁇ cytokine levels in the tissue culture supernatant were determined using MSD human V-Plex customized kits. Samples were first diluted 1:200 in Diluent 2. Calibrators were also prepared in Diluent 2 following the manufacturer's recommendations. Diluted samples and calibrators were added to black MSD plates which were subsequently sealed with an adhesive plate seal and incubated at room temperature with shaking for 2 hours. After adding 25 ⁇ L of the detection antibody solution, which was freshly prepared in Diluent 2 to each well, the plate was re-sealed and incubated at room temperature with shaking for another 2 hours.
  • the plates were washed 3 times with 150 ⁇ L/well of PBS plus 0.05% Tween-20 before adding 150 ⁇ l/well of freshly diluted 2 ⁇ read buffer and immediately read on a MESO QuickPlex reader. Data were analyzed using MSD Workbench software.
  • MSD data was analyzed with Discovery Workbench software (MSD, version 4.0.9). Calibrators in the manufacturer's kit were included on each MSD plate to generate plate specific standard curves with R 2 value over 0.99 in all cases. The amounts of cytokine detected were back calculated based on the standard curve and the mean and standard deviation from three biological replicates were used to generate the graphs.
  • H2L5 hIgG4PE single agent treatment resulted in induction of IFN- ⁇ as compared to isotype control in all pre-stimulation conditions tested.
  • the magnitude of IFN- ⁇ induced by H2L5 hIgG4PE was inversely correlated with the strength of the pre-stimulation.
  • the combination of H2L5 hIgG4PE together with ipilimumab demonstrated enhanced cytokine production as compared to either H2L5 HIGG4PE or ipilimumab alone in PBMCs that were weakly pre-stimulated.
  • the combination effect was lost under plate-bound anti-CD3/anti-CD28 pre-stimulation conditions, which is considered a stronger pre-stimulation condition.
  • the pre-stimulation condition using anti-CD3/anti-CD28 beads at a bead to cell ratio of 1:20 was chosen for all future PBMC assays. Results from four individual donors are summarized for anti-CTLA-4 combination in FIG. 16 and combination with anti-PD-1 in FIG. 17 .
  • H2L5 hIgG4PE Results in Dose-Dependent Cytokine Induction in a PBMC Pre-Stimulation Assay
  • H2L5 hIgG4PE The dose-dependent activity of H2L5 hIgG4PE was evaluated in human PBMCs pre-stimulated with anti-CD3/anti-CD28 beads at a pre-determined bead to cell ratio of 1:20.
  • the anti-RSV IgG4PE and anti-ICOS 422.2 IgG1 Fc Disabled were included as controls.
  • Eight concentrations of H2L5 HIGG4PE were tested (100, 30, 10, 3, 1, 0.3, 0.1, and 0.03 ⁇ g/ml). IFN- ⁇ , IL-10 and TNF- ⁇ were evaluated by MSD in the tissue culture supernatants of PBMC samples.
  • H2L5 hIgG4PE but not isotype control IgG4 or Fc-Disabled 422.2, induced IFN- ⁇ , IL-10 and TNF- ⁇ production in a dose-dependent manner. These results were used to determine the concentration of H2L5 hIgG4PE to be used in combination studies.
  • anti-CD3 beads were also added into the wells to provide a basal TCR stimuli to help prime the cells. Results demonstrated that anti-CD3 beads greatly increased the range of IFN- ⁇ induction. Although ipilimumab alone can induce IFN- ⁇ production in the absence of anti-CD3 beads, H2L5 hIgG4PE alone or the H2L5 HIGG4PE/ipilimumab combination only showed enhanced IFN- ⁇ production over corresponding controls in the presence of anti-CD3 beads.
  • H2L5 hIgG4PE alone or in combination with ipilimumab was tested in an allogeneic human MLR assay in which T cells that were pre-incubated with monocyte-derived immature DCs from an unmatched donor in the presence of 0.02 ⁇ g/ml CEFT peptides for 1 day.
  • the H2L5 hIgG4PE/ipilimumab combination resulted in a significant enhancement in IFN- ⁇ production as compared to either agent alone. Results were consistent across three donor pairs tested; however, modest variability was observed between donors ( FIG. 18 ).
  • H2L5 hIgG4PE and pembrolizumab were also tested in the human allogeneic MLR assay described above.
  • H2L5 hIg G4PE was tested alone and in combination with pembrolizumab at 10 ⁇ g/ml.
  • the combination of H2L5 hIg G4PE and pembrolizumab resulted in increased IFN- ⁇ as compared to either agent alone.
  • statistical significance was not reached due to high donor variability and significant activity of single agent anti-PD-1 treatment in some donors ( FIG. 19 ).
  • ICOS is a costimulatory receptor that is weakly expressed on na ⁇ ve T cells and quickly upregulated in activated CD4+ and CD8+ T cells.
  • the ligand for ICOS is ICOS-L (B7h, B7RP-1, CD275), which is expressed by professional APCs and by peripheral epithelial and endothelial cells following TNF- ⁇ stimulation.
  • the ICOS:ICOS-L pathway provides a key costimulatory signal for T-cell proliferation and function. Due to its role in sustaining T-cell activation and effector functions, targeting ICOS by agonist antibodies could be a plausible approach to enhance anti-tumor immunity.
  • PD-1 Programmed cell death-1
  • B7-H1 is one of the ligands of PD-1
  • T cells T cells
  • epithelial cells endothelial cells
  • tumor cells T cells
  • Antibodies targeting the PD-1/PD-L1 axis have also shown clinical responses in multiple tumor types.
  • the FDA recently approved pembrolizumab and nivolumab as second generation of the immune checkpoint blockers for the treatment of cancer.
  • Nivolumab the anti-PD-1 antibody from BMS, also showed clinical benefit in patients with metastatic melanoma with a response rate of 40% and an overall survival rate of 72.9% at 1 year.
  • the PD-1 checkpoint blockade antibodies become the dominant cancer immune therapy in the clinic, it will be important to evaluate H2L5 hIgG4PE in combination with an anti-PD-1 antibody for their combined anti-tumor activity.
  • PBMC activation assay was developed and used to evaluate the T cell stimulation activity of a panel of anti-ICOS agonist antibodies.
  • the data generated from those studies supported the candidate selection of clone 422.2 with an IgG4PE isotype as H2L5 hIgG4PE.
  • PBMC cells were pre-stimulated with plate bound anti-CD3 antibody at 1 ⁇ g/ml and anti-CD28 antibody at 3 ⁇ g/ml for 48 hours before they were harvested and re-stimulated with anti-CD3 and soluble ICOS antibodies that were being investigated.
  • H2L5 hIgG4PE was shown to induce IFN- ⁇ production in a dose-dependent manner.
  • H2L5 hIgG4PE single agent treatment resulted in IFN- ⁇ induction relative to isotype control in all pre-stimulation conditions tested.
  • the magnitude of IFN- ⁇ induced by H2L5 hIgG4PE was inversely correlated with the strength of the pre-stimulation.
  • the combination of H2L5 hIgG4PE together with ipilimumab demonstrated enhanced cytokine production as compared to either H2L5 hIgG4PE or ipilimumab alone in PBMCs that were weakly pre-stimulated. The combination effect was lost under plate-bound anti-CD3/anti-CD28 pre-stimulation conditions, which is considered a stronger pre-stimulation condition.
  • H2L5 hIgG4PE and ipilimumab combination demonstrated a statistically significant increase in IFN- ⁇ production as compared to either antibody treatment alone.
  • this assay was used to evaluate the dose response of H2L5 hIgG4PE.
  • a total of 8 antibody concentrations were tested, which were 100, 30, 10, 3, 1, 0.3, 0.1 and 0.03 ⁇ g/ml.
  • the anti-RSV IgG4PE and anti-ICOS 422.2 that H2L5 hIgG4PE, but not isotype control IgG4 or Fc-Disabled 422.2, induced IFN- ⁇ , IL-10 and TNF- ⁇ production in a dose-dependent manner.
  • MLR assay A mixed lymphocytes reaction (MLR) assay was also developed to evaluate the combination effect of H2L5 hIg G4PE and checkpoint blocking antibodies.
  • MLR assay is an ex vivo cellular immune assay in which primary monocyte-derived immature dendritic cells (iDCs) were mixed with T cells isolated from a different donor. The mismatch of major histocompatibility complex (MHC) molecules on the surface of iDC cells can initiate T cell stimulation in an allogeneic setting. In the clinic, the MLR assay is well-known for identifying the compatibility of tissue transplants between donors and recipients.
  • MHC major histocompatibility complex
  • H2L5 hIgG4PE alone or the H2L5 hIgG4PE/ipilimumab combination showed enhanced IFN- ⁇ production over corresponding controls in the presence of anti-CD3 beads.
  • the TCR stimulus by DC cells alone may not be sufficient to induce ICOS expression on the surface of resting T cells that were freshly isolated from PBMCs.
  • a 24 hour iDC and T cells pre-incubation step was added before the addition of therapeutic antibodies.
  • the CEFT peptide mix was also added into the assay procedure to better prime the T cells and to elicit an antigen-specific response.
  • the CEFT peptide pool consists of 27 peptides selected from defined HLA class I and II-restricted T-cell epitopes from human Cytomegalovirus (HHV-5; CMV), Epstein-Barr virus (HHV-4; EBV), Influenza A and Clostridium tetani . Considering the high vaccination frequency against Influenza and Clostridium tetani and the high prevalence of CMV and EBV in the general population, recall antigen responses were expected for a majority of the human samples.
  • H2L5 hIgG4PE and pembrolizumab were also tested in the human allogeneic MLR assay described above.
  • H2L5 hIgG4PE was tested alone and in combination with pembrolizumab at 10 ⁇ g/ml.
  • the combination of H2L5 hIgG4PE and pembrolizumab resulted in increased IFN- ⁇ as compared to either agent alone.
  • statistical significance was not reached due to high donor variability and significant activity of single agent anti-PD-1 treatment in some donors.
  • H2L5 hIgG4PE demonstrated the superior combination activity of H2L5 hIgG4PE with two FDA-approved check point inhibitors, ipilimumab and pembrolizumab, when compared to mono-therapies in two human immune cell based assays.
  • H2L5 hIgG4PE was shown to promote T cell activation and T H 1 skewing (e.g. IFN- ⁇ production) that is characteristic of productive anti-tumor immune responses.
  • Example 11 Functional Activity of H2L5 hIgG4PE Alone and in Combination with Anti-PD1 and Anti-CTLA-4 Antibodies In Vivo
  • A2058 were propagated according to ATCC protocol.
  • H2L5 hIgG4PE was administered to human PBMC engrafted NSG mice implanted with A2058 melanoma tumors.
  • mice were assigned into each study.
  • a summary of the treatment regimen for dose response using human PBMC from donor #7129 is present in Table 11.
  • H2L5 hIgG4PE was dosed at 0.04, 0.4, 1.2 and 4 mg/kg.
  • Ipilimumab was dosed at 3 mg/kg and an Fc-Disabled variant of the anti-ICOS agonist was tested at 1 mg/kg.
  • Test groups were evaluated relative to the vehicle and matched isotype control groups. Survivability analysis concluded on day 49 at termination of the study.
  • H2L5 hIgG4PE monotherapy dosed at 0.04 mg/kg and 0.4 mg/kg.
  • H2L5 hIgG4PE dosed in combination with ipilimumab or pembrolizumab with matched isotype controls.
  • H2L5 hIgG4PE (0.04 or 0.4 mg/kg) and ipilimumab or IgG1 (3 mg/kg) or H2L5 hIgG4PE (0.04 or 0.4 mg/kg) and pembrolizumab or IgG4 (5 mg/kg) were dosed.
  • H2L5 hIgG4PE and ipilimumab as well as the matched isotype controls were dosed twice weekly for 6 doses, pembrolizumab and isotype control were dosed every 5 days until end of the H2L5 hIgG4PE dose.
  • H2L5 hIgG4PE was dosed at 0.004, 0.04, 0.4 and 1.2 mg/kg.
  • Treatment groups were evaluated relative to the vehicle and isotype control groups. Treatment groups for vehicle, isotypes and H2L5 hIgG4PE alone and in combination with ipilimumab and pembrolizumab using human PBMC from donor number #6711 are shown in Table 12. Analysis concluded on day 59 at termination of the study.
  • H2L5 hIgG4PE dosed at 0.01 and 0.04 mg/kg
  • ipilimumab or pembrolizumab with matched isotype controls in the human PBMC engrafted NSG mouse using A2058 melanoma tumor model.
  • a total of 13 groups with 10 mice per group were assigned into the study.
  • Group 2 was the combined isotype control of humanized IgG1 and IgG4.
  • H2L5 hIgG4PE was dosed at 0.01 mg/kg (Group 12) and 0.04 mg/kg (Group 13) as single agent.
  • H2L5 hIgG4PE (0.01 and 0.04 mg/kg) and ipilimumab or IgG1 (3 mg/kg) or H2L5 hIgG4PE (0.01 and 0.04 mg/kg) and pembrolizumab or IgG4 (5 mg/kg) was dosed.
  • H2L5 hIgG4PE and ipilimumab as well as the matched isotype controls were dosed twice weekly for 6 doses, pembrolizumab and isotype control was dosed every 5 days until end of the H2L5 hIgG4PE dose.
  • a summary of treatment groups, using human PBMC from donor #4568, is presented in Table 13. Treatment groups were evaluated relative to the vehicle and isotype control groups. Survivability analysis was concluded on day 33 at termination of the study.
  • Treatment groups of mice in A2058 melanoma tumor model # mice/ Group Treatment 1 Treatment2 group Dosing 1 Tumor + Vehicle 10 Twice a week for 6 doses huPBMC (donor #4568) 2 Tumor + Isotype control (IgG1 10 IgG1 Twice a week for 6 doses huPBMC 3 mg/kg + IgG4 5 mg/kg) IgG4 every 5 days until the end (donor #4568) of ICOS dose 3 Tumor + Ipilimumab 3 mg/kg + 10 Twice a week for 6 doses IgG4 huPBMC IgG4 5 mg/kg every 5 days until the end of (donor #4568) ICOS dose 4 Tumor + Pembrolizumab 5 mg/kg + 10 IgG1 Twice a week for 6 doses huPBMC IgG1 3 mg/kg Pembrolizumab every 5 days (donor #4568) until the end of ICOS dose 5 Tumor + H2
  • the event for survival analysis was tumor volume >2000 mm 3 , tumor ulceration, mouse body weight loss >20%, moribund or found dead, whichever came first.
  • the exact time to cut-off volume was estimated by fitting a linear line between log tumor volume and day of two observations, the first observation that exceed the cut-off volume and the one observation that immediately preceded the cut-off volume.
  • Kaplan-Meier (KM) method was carried out to estimate the survival probability of different treatment groups at a given time. The median time to endpoint and its corresponding 95% confidence interval was reported. Whether or not KM survival curves are statistically different between any two groups was then tested by log-rank test.
  • Tumor volume data from the last day in which there were 10 animals per group (i.e. before any animals were euthanized) was utilized to make tumor volume comparisons between the different treatment groups. Prior to the analysis, the tumor volume was natural log transformed due to the inequality of variance in the different treatment groups. ANOVA followed by pair-wise comparison were then carried out on the log transformed data.
  • Graphpad Prism software was used to plot the tumor growth and body weight data.
  • Control group Human PBMC (donor 7129) showed no effect on A2058 tumor growth in NSG mice.
  • Ipilimumab treatment at 3 mg/kg demonstrated significant tumor growth inhibition (p ⁇ 0.03) as compared to vehicle control Group#1, however the statistical significance was lost (p ⁇ 0.22) when compared to the isotype control Group #2. This indicated the isotype antibody may affect tumor growth.
  • H2L5 hIgG4PE treatment at 0.4 mg/kg demonstrated a trend of tumor growth inhibition and increased survivability of mice compared to other doses, although the affects were not statistically significant when compared to either vehicle or isotype control.
  • mice Most mice were removed upon tumors reaching volumes >2000 mm 3 . Three mice were euthanized due to tumor ulceration, and three mice were euthanized due to body weight loss of >20%. Nine mice were found dead randomly across the groups, including two in the vehicle, and three total in the isotype control groups. These deaths were attributed to the susceptibility of the model for a Graft-versus-Host Disease state, and not treatment related since no pattern was observed with treatment groups compared to vehicle or isotype control groups.
  • Control group A2058 tumor bearing mice with human PBMC treated with vehicle or isotype control antibodies developed tumors which grew as expected.
  • Ipilimumab treatment at 3 mg/kg combined with IgG4 resultsed in significant tumor growth inhibition (p ⁇ 0.04) as compared to vehicle control Group#1.
  • the statistical significance was lost (p ⁇ 0.23).
  • Pembrolizumab treatment alone at 2.5 or 5 mg/kg showed observable tumor growth inhibition without statistical significance when compared to vehicle or isotype control group#12.
  • Pembrolizumab combined with IgG1(Group#4) showed observable tumor growth inhibition without statistical significance, however a significant increase in survival was observed (p ⁇ 0.04) as compared to vehicle control Group#1.
  • Statistical significance was lost (p ⁇ 0.4) when compared with isotype control Group#2.
  • H2L5 hIgG4PE treatment alone at 0.4 mg/kg showed observable tumor growth inhibition without statistical significance as compared to vehicle or isotype control group#12.
  • H2L5 hIgG4PE at 0.04 or 0.4 mg/kg combined with IgG1(Group#5 and 6) showed observable delay in tumor progression and mice survival but didn't reach statistical significance.
  • H2L5 hIgG4PE 0.04 or 0.4 mg/kg
  • ipilimumab 3 mg/kg
  • Groups #8 and #9 showed no additional tumor growth inhibition as compared to Ipilimumab alone (Group#3).
  • Groups #10 and #11 demonstrated modest but insignificant tumor growth inhibition and mice survival compared to pembrolizumab monotherapy, Group#4, or H2L5 hIgG4PE monotherapy Groups #5 and #6.
  • mice A total of 100 out of 160 mice were euthanized when tumor volumes reached >2000 mm 3 . 29 mice were euthanized due to tumor ulceration, 18 mice were found dead, 12 mice were euthanized due to body weight loss >20%, and one mouse was euthanized as moribund. Mice were found dead across group #2. These deaths were attributed to the susceptibility of the model for a Graft-versus-Host Disease state, and not treatment related since no pattern was observed with treatment groups compared to the isotype control group.
  • Control group A2058 tumor bearing mice with human PBMC treated with vehicle or isotype control antibodies developed tumors which grew as expected.
  • Ipilimumab treatment at 3 mg/kg combined with IgG4 demonstrated significant tumor growth inhibition (p ⁇ 0.02) and significant increase in survival (p ⁇ 0.01) as compared to vehicle control Group#1. Compared to isotype control Group#2 however, the tumor growth inhibition did not reach significance (p ⁇ 0.13) while significant increase in mice survival remained (p ⁇ 0.04).
  • Pembrolizumab treatment at 5 mg/kg combined with IgG1(Group#4) showed tumor growth inhibition without statistical significance as compared to vehicle or isotype control Group#2.
  • H2L5 hIgG4PE treatment alone at 0.01 mg/kg or 0.04 mg/kg demonstrated significant tumor growth inhibition (p ⁇ 0.03) compared to vehicle control group #1
  • H2L5 hIgG4PE dosed at 0.04 mg/kg also showed a significant increase in mice survival (p ⁇ 0.048) as compared to vehicle control group#1.
  • tumor growth inhibition and survival did not reach statistical significance for groups #12 and #13.
  • H2L5 hIgG4PE at 0.01 mg/kg combined with IgG1(Group#5) showed significant tumor growth inhibition (p ⁇ 0.03) and mice survival (p ⁇ 0.03) as compared to vehicle control group#1.
  • H2L5 hIgG4PE with ipilimumab (0.01 mg/kg plus ipilimumab 3 mg/kg; Group#8) showed observable tumor growth inhibition and mice survival but failed to reach statistical significance.
  • H2L5 hIgG4PE combination with ipilimumab (0.04 mg/kg plus ipilimumab 3 mg/kg; Group#9) demonstrated significant tumor growth inhibition (p ⁇ 0.00) and a significant increase in mice survival (p ⁇ 0.04) as compared to vehicle control group#1 or isotype control group#2 (p ⁇ 0.02). However, as compared to isotype control survival failed to reach statistical significance.
  • Combination activity did not reach significance as compared to monotherapy ipilimumab group#3 or
  • the tumor growth inhibition significance remained in the 0.04 mg/kg H2L5 hIgG4PE combination with pembrolizumab (p ⁇ 0.03).
  • the survival benefit failed to reach statistical significance however.
  • the combination failed to reach significance as compared to either monotherapy treatment group pembrolizumab group#3 or H2L5 hIgG4PE group#5 or #6.
  • H2L5 hIgG4PE combined with pembrolizumab (0.01 or 0.04 mg/kg plus pembrolizumab 5 mg/kg) demonstrated an increase in tumor growth inhibition and mice survival but failed to reach statistical significance versus isotype control or monotherapies.
  • mice A total of 91 mice were euthanized due to tumor size >2000 mm 3 , 34 mice were euthanized due to tumor ulcerations, and 5 mice were found dead. These deaths were attributed to the susceptibility of the model for a Graft-versus-Host Disease state.
  • H2L5 hIgG4PE as a monotherapy and in combination with pembrolizumab as well as ipilimumab was evaluated in the human PBMC engrafted NSG mouse model with A2058 melanoma tumors.
  • the Hu-PBMC NSG model was implanted with human cancer cell line A2058 subcutaneously to investigate the effect of human immunotherapeutic antibodies on tumor growth.
  • the limitations of this model include onset of GvHD symptoms, loss of body weight, and frequent tumor ulcerations which prevent survival monitoring for longer period of time as is possible with syngeneic mouse tumor models.
  • H2L5 hIgG4PE initial studies evaluating H2L5 hIgG4PE at doses ranging from 0.04 mg/kg to 4 mg/kg showed that doses in the lower range demonstrated modest tumor growth inhibition. Delay in tumor progression and increased survival of mice was observed in dose groups ranging from 0.04 to 0.4 mg/kg though not statistically significant when compared to the isotype control groups. Based on these studies, H2L5 hIgG4PE doses of 0.04 to 0.4 mg/kg were selected for further evaluation alone and in combination with pembrolizumab and ipilimumab in two studies with PBMC grafts from two different donors (donor numbers 4568 and 6711).
  • Anti-PD 1 therapy did not demonstrate statistically significant activity in this model as seen with the limited change in tumor growth and survival seen with pembrolizumab treated cohort compared to isotope treated cohort.
  • Ipilimumab monotherapy showed a trend of tumor growth inhibition modestly better than pembrolizumab in both studies, and it showed statistically significant increase in survival versus isotype in the second combination study with the responsive PBMC donor 4568 (p ⁇ 0.04).
  • the H2L5 hIgG4PE 0.01 mg/kg dose in combination with ipilimumab 3 mg/kg showed a significant increase in survival versus ipilimumab (p ⁇ 0.02), but not versus H2L5 hIgG4PE monotherapy.
  • Example 12 Functional Activity of Anti-Murine ICOS Agonist Antibody Alone and in Combination with Anti-PD1 and Anti-CTLA-4 Antibodies In Vivo
  • mice Female BALB/c mice from Harlan Sprague Dawley. Mice were 6-8 weeks old at the beginning of the study when they were inoculated.
  • CT-26 cells (ATCC: CRL-2638) (3 ⁇ 10 6 cells; P-11) was thawed from ⁇ 140° C. and plated in RPMI with 10% FBS. Cells were subcultured 3 times over 10 days. Trypsin/EDTA was used to facilitate cell detachment from culture flask during subculturing. Cells were collected, washed twice, and re-suspended in RPMI without FBS at 5 ⁇ 10 5 cells/ml. Mice were inoculated subcutaneously with 0.1 ml cells (5 ⁇ 10 4 cells/mouse) on the right hind flank.
  • 15 ⁇ 10 6 cells/30 ml media 5 ⁇ 10 5 cells/ml. This equates to 5 ⁇ 10 4 cells/100 ⁇ l.
  • Antibodies were diluted from stock source vials to desired concentrations in sterile 0.9% saline on the day of dosing.
  • Anti-ICOS agonist clone C398.4 was tested at 0.05 mg/kg and 0.5 mg/kg. Each dose was also tested with both anti-PD1 10 mg/kg and anti-CTLA-4 1 mg/kg.
  • mice were inoculated on day 0. On day 11 body weight and tumor volume were measured. Mice were randomized into the 12 study groups shown in Table 14 with 10 mice/group based on tumor size. Randomization was done using Studylog Study Director software. Mice were dosed based on the study design chart twice weekly starting on randomization day and continuing for 6 total doses. Dosing was interperitoneal (IP) in 100 ⁇ l volume of 0.9% saline vehicle. Tumor volume and body weight were measured 3 times per week throughout the study.
  • IP interperitoneal
  • mice were removed from study when tumors developed open ulcerations. Ulcerations were observed throughout the experiment, however scabbed over ulcerations alone were not an endpoint unless they formed open holes.
  • the event for survival analysis is tumor volume of 2000 mm 3 or tumor ulceration, whichever came first.
  • the exact time to cut-off volume was estimated by fitting a linear line between log tumor volume and day of two observations, the first observation that exceed the cut-off volume and the one observation that immediately preceded the cut-off volume.
  • the Kaplan-Meier (KM) method was carried out to estimate the survival probability of different treatment groups at a given time. The median time to endpoint and its corresponding 95% confidence interval was reported. Whether or not KM survival curves are statistically different between any two groups was then tested by the log-rank test.
  • Tumor volumes at 17 days after initial dosing between the different treatment groups were compared. Prior to the analysis, the tumor volume was natural log transformed due to the inequality of variance in the different treatment groups. ANOVA followed by pair-wise comparison were then carried out on the log transformed data.
  • the raw p-value, as well as the false discovery rate (FDR) adjusted p-values, from the comparisons of days to events by survival analysis and the comparisons of log transformed tumor volume at day 10 between treatment groups are shown in the above table. Comparisons, using FDR adjusted p-values ⁇ 0.05, are declared to be statistically significant.
  • mice were tumor free at study day 61 except 1 mouse in G7 which has a tumor volume of 579.16 mm 3 .
  • the combination therapy groups particularly the high dose anti-ICOS and anti-PD 1 combination (Group 12), demonstrated tumor growth inhibition and increased survival over monotherapy and isotype control groups, although statistical significance was not reached at Day 61.
  • the isotype control for group 12 was the Rat IgG2a+Hamster IgG group 3.
  • the monotherapy groups for comparison are; ICOS 10 ⁇ g (group 6) and PD1 200 ⁇ g (group 8).
  • a total of 5 mice remained as tumor free in group 12 compared to 1 in group 3, 1 in group 6 and 1 in group 8.
  • the survival benefit was quantified by taking the day each mouse reached any of the pre-determined study endpoints. A number of mice were removed from study for open tumor ulcerations and not due to
  • mice were removed due to tumor ulceration by day 31 which likely masked the survival and anti-tumor benefit that this combination provided.
  • group 10 an increased number of mice were removed due to tumor ulceration by day 31 which likely masked the survival and anti-tumor benefit that this combination provided.
  • 5 mice were removed for tumor ulcerations and only 2 for tumor burden reaching 2000 mm 3 . All tumors removed due to tumor ulceration where still at modest size when taken off study, and it is expected that tumor ulceration may have been the result of a therapy-induced anti-tumor immune response in these mice.
  • Three mice remained tumor free in this group out to day 61.
  • the 2 mice removed for tumor burden were the lowest number of mice removed for tumor burden of all groups.
  • mice All procedures and euthanization criteria described in this document are in accordance with IACUC protocol AUP0606.
  • tumor growth and total body weight were measured 3 times a week with a Fowler “ProMax” digital caliper for 4 weeks or longer.
  • Antibodies were acquired from a commercial vendor and diluted to desired concentration in 0.9% saline.
  • Dosing occurred biweekly, for a total of 6 doses and initiated on the day of randomization, designated as Day 0, when average tumor volume approximated 100 mm 3 , approximately 7 to 8 days after inoculation.
  • mice were inoculated with EMT6 cells in order to generate enough mice with tumors in the desired size range for 13 groups of 10 mice each as shown in Table 15.
  • Saline vehicle injected mice and isotype control groups served as controls for ICOS, PD1 and CTLA-4 mAb treated mice.
  • the isotype control for ICOS (Hamster IgG) was dosed at 10 ⁇ g alone and in combination with the isotype for CTLA-4 (mouse IgG2b) or PD-1 (rat IgG2a).
  • Monotherapy treatment groups for anti-CTLA-4 (9D9) and anti-PD-1 (RMP1-14) were dosed at 20 and 200 ⁇ g per mouse, respectively, and evaluated in combination with the ICOS isotype control.
  • the C398.4 clone of ICOS agonist was dosed at 10 and 1 ⁇ g per mouse.
  • Efficacy of the ICOS agonist was also evaluated at 10 and 1 ⁇ g per mouse dosed in combination with anti-CTLA-4 or anti-PD-1.
  • An additional group of PD-1 and CTLA-4 at predescribed concentrations was included as a positive control comparator group.
  • Statistical analysis of tumor volume was performed on day 13 post randomization. Survivability analysis included mice on study through day 60.
  • mice Female Balb/c mice from 6 to 8 weeks of age were received from Harlan Sprague Dawley and housed in accordance with IACUC standards.
  • EMT6 cells were thawed and cultured in cell culture flasks for eight days prior to inoculation. Cells were passed 3 times in this time. On the day of inoculation, the cells are harvested from the flask in complete medium. Cells are centrifuged and resuspended in Weymouth's (with 15% FBS). This step is repeated 3 times in Weymouth's media without FBS. Cell density and viability are checked via trypan blue exclusion. Cells are then diluted to desired density (1 ⁇ 10 6 cells per mL).
  • the event for survival analysis was tumor volume of 2000 mm 3 or tumor ulceration, whichever came first.
  • the exact time to cut-off volume was estimated by fitting a linear line between log tumor volume and day of two observations, the first observation that exceed the cut-off volume and the one observation that immediately preceded the cut-off volume.
  • the Kaplan-Meier (KM) method was carried out to estimate the survival probability of different treatment groups at a given time. The median time to endpoint and its corresponding 95% confidence interval was reported. Whether or not KM survival curves were statistically different between any two groups was then tested by the log-rank test.
  • Tumor volumes at 13 days after initial dosing between the different treatment groups were compared. Prior to the analysis, the tumor volume was natural log transformed due to the inequality of variance in the different treatment groups. ANOVA followed by pair-wise comparison were then carried out on the log transformed data. SAS 9.3 and R 3.0.2 Analysis Software was utilized.
  • mice were inoculated and randomized into groups of ten based on treatment regimen 8 days later. Administration of therapeutics or controls began on randomization day (Day 0) and continued twice a week for 3 weeks.
  • the saline treated group grew tumors at the expected rate relative to previous EMT-6 studies. All mice in the saline vehicle group were euthanized due to tumor size or ulceration by day 30. Treatment with hamster IgG alone or in combination with rat IgG2a or mouse IgG2b, resulted in no statistically significant change in average tumor growth or survival when compared to the saline vehicle group.
  • the ICOS monotherapy groups demonstrated little observable change in average tumor growth as compared to isotype controls. However, the high dose ICOS treatment group (10 ⁇ g) demonstrated an apparent trend towards more tumor growth inhibition than the low dose group. An effect that was comparable to the CTLA-4 monotherapy activity was observed. Monotherapy treatment with PD-1 mAb also resulted in some observable, but statistically insignificant reduction in average tumor volume at day 13. However, as with ICOS and CTLA-4 monotherapy, this did not result in increased survival when compared to that of the appropriate isotype groups.
  • the ICOS antibody at both doses in combination with anti-CTLA-4 demonstrated little observable benefit in tumor growth inhibition or survival as compared to monotherapy treatment with either antibody.
  • the dosing regimen of anti-PD-1 with 10 ⁇ g of anti-ICOS agonist led to an observable inhibition of tumor growth resulting in a decrease in tumor volume at day 13 when compared to isotype controls, although this difference was less obvious when compared to anti-PD-1 monotherapy.
  • monotherapy group with three mice experiencing complete tumor regression as compared to none in the anti-PD-1 monotherapy group.
  • the survival benefit observed with the ICOS+PD1 combination group was not found to reach statistical significance relative to controls by day 60.
  • the tumor growth inhibition and survival benefit of the ICOS+PD1 combination treatment groups was comparable to the activity observed with the PD1+CTLA-4 combination group, which was considered a positive control for anti-tumor activity in this study. This suggests that a combination of ICOS and PD1 antibodies may have benefit similar to CTLA-4 and PD1 combinations, which have demonstrated significant clinical activity in some tumor types.
  • mice enrolled in this study 12 remained alive at day 60 with 11 having achieved complete tumor regression.
  • 111 were removed due to reaching a tumor size of 2000 mm 3 .
  • the remaining seven mice were euthanized due to ulceration on the tumor. Occurrences of ulceration were spread out among the groups.
  • Groups 1 Saline
  • 3 hamster IgG & rat IgG2a
  • 4 hamster IgG
  • CTL-4 with 1 ⁇ g ICOS 10
  • Group 13 (CTLA-4+PD-1) showed two animals sacrificed due to ulceration.
  • the remaining groups had no animals removed due to ulceration.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Reproductive Health (AREA)
  • Pregnancy & Childbirth (AREA)
  • Gynecology & Obstetrics (AREA)
  • Urology & Nephrology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Endocrinology (AREA)
  • Biomedical Technology (AREA)
  • Oncology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
US15/546,369 2015-01-28 2016-01-26 Icos binding proteins Abandoned US20180030136A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US15/546,369 US20180030136A1 (en) 2015-01-28 2016-01-26 Icos binding proteins

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US201562108605P 2015-01-28 2015-01-28
US201562192331P 2015-07-14 2015-07-14
US201562247355P 2015-10-28 2015-10-28
US15/546,369 US20180030136A1 (en) 2015-01-28 2016-01-26 Icos binding proteins
PCT/IB2016/050383 WO2016120789A1 (en) 2015-01-28 2016-01-26 Agonistic icos binding proteins

Publications (1)

Publication Number Publication Date
US20180030136A1 true US20180030136A1 (en) 2018-02-01

Family

ID=55262868

Family Applications (9)

Application Number Title Priority Date Filing Date
US15/546,369 Abandoned US20180030136A1 (en) 2015-01-28 2016-01-26 Icos binding proteins
US15/006,560 Active US9771424B2 (en) 2015-01-28 2016-01-26 ICOS binding proteins
US15/246,662 Active 2036-11-23 US10351627B2 (en) 2015-01-28 2016-08-25 ICOS binding proteins
US15/387,161 Active US9738718B2 (en) 2015-01-28 2016-12-21 ICOS binding proteins
US15/649,791 Abandoned US20170313777A1 (en) 2015-01-28 2017-07-14 Icos binding proteins
US15/987,996 Abandoned US20180334503A1 (en) 2015-01-28 2018-05-24 Icos binding proteins
US16/440,137 Abandoned US20200140551A1 (en) 2015-01-28 2019-06-13 Icos binding proteins
US16/441,474 Active US11130811B2 (en) 2015-01-28 2019-06-14 ICOS binding proteins
US17/412,614 Abandoned US20220064299A1 (en) 2015-01-28 2021-08-26 Icos binding proteins

Family Applications After (8)

Application Number Title Priority Date Filing Date
US15/006,560 Active US9771424B2 (en) 2015-01-28 2016-01-26 ICOS binding proteins
US15/246,662 Active 2036-11-23 US10351627B2 (en) 2015-01-28 2016-08-25 ICOS binding proteins
US15/387,161 Active US9738718B2 (en) 2015-01-28 2016-12-21 ICOS binding proteins
US15/649,791 Abandoned US20170313777A1 (en) 2015-01-28 2017-07-14 Icos binding proteins
US15/987,996 Abandoned US20180334503A1 (en) 2015-01-28 2018-05-24 Icos binding proteins
US16/440,137 Abandoned US20200140551A1 (en) 2015-01-28 2019-06-13 Icos binding proteins
US16/441,474 Active US11130811B2 (en) 2015-01-28 2019-06-14 ICOS binding proteins
US17/412,614 Abandoned US20220064299A1 (en) 2015-01-28 2021-08-26 Icos binding proteins

Country Status (27)

Country Link
US (9) US20180030136A1 (https=)
EP (3) EP3572432A1 (https=)
JP (3) JP6553197B2 (https=)
KR (1) KR102315160B1 (https=)
CN (1) CN107667117B (https=)
AU (3) AU2016210867B2 (https=)
BR (1) BR112017016336A2 (https=)
CA (1) CA2974910A1 (https=)
CL (1) CL2017001921A1 (https=)
CO (1) CO2017007665A2 (https=)
CR (1) CR20170351A (https=)
DO (1) DOP2017000171A (https=)
EA (1) EA036335B1 (https=)
ES (1) ES2913871T3 (https=)
IL (1) IL253508B (https=)
JO (1) JO3745B1 (https=)
MA (3) MA41414A (https=)
MX (1) MX2017009758A (https=)
MY (1) MY185845A (https=)
PE (1) PE20180120A1 (https=)
PH (1) PH12017501347B1 (https=)
SG (1) SG11201705829TA (https=)
TW (1) TWI717332B (https=)
UA (1) UA124613C2 (https=)
UY (1) UY36539A (https=)
WO (1) WO2016120789A1 (https=)
ZA (1) ZA201704818B (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180334503A1 (en) * 2015-01-28 2018-11-22 Glaxosmithkline Intellectual Property Development Limited Icos binding proteins
US10251945B2 (en) 2017-04-07 2019-04-09 Bristol-Myers Squibb Company Anti-ICOS agonist antibodies and uses thereof
US20190315866A1 (en) * 2011-03-31 2019-10-17 Inserm (Institut National De La Sante Et De La Recherche Medicale) Antibodies Directed Against ICOS and Uses Thereof

Families Citing this family (106)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2482849B1 (en) 2009-09-30 2018-06-06 Memorial Sloan-Kettering Cancer Center Combination immunotherapy for the treatment of cancer
US12466897B2 (en) 2011-10-10 2025-11-11 Xencor, Inc. Heterodimeric human IgG1 polypeptides with isoelectric point modifications
KR102211837B1 (ko) 2013-01-14 2021-02-03 젠코어 인코포레이티드 신규한 이형이량체 단백질
US10968276B2 (en) 2013-03-12 2021-04-06 Xencor, Inc. Optimized anti-CD3 variable regions
US9605084B2 (en) 2013-03-15 2017-03-28 Xencor, Inc. Heterodimeric proteins
US11053316B2 (en) 2013-01-14 2021-07-06 Xencor, Inc. Optimized antibody variable regions
WO2014151763A1 (en) 2013-03-14 2014-09-25 The Board Of Trustees Of The Leland Stanford Junior University Methods of detecting donor-specific antibodies and systems for practicing the same
US10858417B2 (en) 2013-03-15 2020-12-08 Xencor, Inc. Heterodimeric proteins
SG10201804945WA (en) 2013-12-12 2018-07-30 Shanghai hengrui pharmaceutical co ltd Pd-1 antibody, antigen-binding fragment thereof, and medical application thereof
GB201403775D0 (en) 2014-03-04 2014-04-16 Kymab Ltd Antibodies, uses & methods
EP3699195A3 (en) 2014-03-28 2020-11-04 Xencor, Inc. Bispecific antibodies that bind to cd38 and cd3
PE20171324A1 (es) 2014-11-26 2017-09-11 Xencor Inc Anticuerpos heterodimericos que se unen a cd3 y a antigenos tumorales
EP3223907A2 (en) 2014-11-26 2017-10-04 Xencor, Inc. Heterodimeric antibodies that bind cd3 and cd38
US10259887B2 (en) 2014-11-26 2019-04-16 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
SG11201705844SA (en) * 2015-02-06 2017-08-30 Heat Biologics Inc Vector co-expressing vaccine and costimulatory molecules
RS60614B1 (sr) 2015-03-23 2020-08-31 Jounce Therapeutics Inc Antitela za icos
US20180230431A1 (en) * 2015-08-07 2018-08-16 Glaxosmithkline Intellectual Property Development Limited Combination Therapy
AU2016342269A1 (en) 2015-10-22 2018-03-29 Jounce Therapeutics, Inc. Gene signatures for determining icos expression
US10527613B2 (en) * 2015-11-10 2020-01-07 The Board Of Trustees Of The Leland Stanford Junior University Biomarker detection methods and systems and kits for practicing same
CA3007030A1 (en) 2015-12-07 2017-06-15 Xencor, Inc. Heterodimeric antibodies that bind cd3 and psma
JP2019510802A (ja) 2016-04-07 2019-04-18 グラクソスミスクライン、インテレクチュアル、プロパティー、ディベロップメント、リミテッドGlaxosmithkline Intellectual Property Development Limited タンパク質調節物質として有用な複素環アミド
PT3440076T (pt) 2016-04-07 2022-07-29 Glaxosmithkline Ip Dev Ltd Amidas heterocíclicas úteis como modeladores de proteína
JP7010854B2 (ja) 2016-06-14 2022-01-26 ゼンコア インコーポレイテッド 二重特異性チェックポイント阻害剤抗体
RU2769282C2 (ru) 2016-06-20 2022-03-30 Кимаб Лимитед Анти-PD-L1 и IL-2 цитокины
WO2018029474A2 (en) 2016-08-09 2018-02-15 Kymab Limited Anti-icos antibodies
US9567399B1 (en) 2016-06-20 2017-02-14 Kymab Limited Antibodies and immunocytokines
CN109715663B (zh) 2016-06-28 2022-11-25 Xencor股份有限公司 结合生长抑素受体2的异源二聚抗体
EP3494140A1 (en) * 2016-08-04 2019-06-12 GlaxoSmithKline Intellectual Property Development Ltd Anti-icos and anti-pd-1 antibody combination therapy
US11858996B2 (en) 2016-08-09 2024-01-02 Kymab Limited Anti-ICOS antibodies
US10793632B2 (en) 2016-08-30 2020-10-06 Xencor, Inc. Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors
WO2018045110A1 (en) * 2016-08-30 2018-03-08 Xencor, Inc. Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors
CN110267990B (zh) * 2016-08-30 2023-11-07 Xencor股份有限公司 结合共刺激性和检查点受体的双特异性免疫调节抗体
EP3534947A1 (en) 2016-11-03 2019-09-11 Kymab Limited Antibodies, combinations comprising antibodies, biomarkers, uses & methods
US11672771B2 (en) 2016-11-04 2023-06-13 Aximmune, Inc. Beta-alethine, immune modulators, and uses thereof
EP3569616B1 (en) * 2017-01-13 2021-09-29 Taizhou Hanzhong Biopharmaceutics, Inc. Monoclonal antibody against pd-1 and applications thereof
WO2018140644A1 (en) * 2017-01-25 2018-08-02 Musc Foundation For Research Development Modified t cells and uses thereof
US20200062735A1 (en) 2017-02-27 2020-02-27 Glaxosmithkline Intellectual Property Development Limited Heterocyclic amides as kinase inhibitors
WO2018176144A1 (en) * 2017-03-29 2018-10-04 Sunnybrook Research Institute Engineered t-cell modulating molecules and methods of using same
US20200024351A1 (en) * 2017-04-03 2020-01-23 Jounce Therapeutics, Inc. Compositions and Methods for the Treatment of Cancer
JP2020522556A (ja) * 2017-06-09 2020-07-30 グラクソスミスクライン、インテレクチュアル、プロパティー、ディベロップメント、リミテッドGlaxosmithkline Intellectual Property Development Limited 癌を治療するためのicosアゴニストおよびox40アゴニストでの組み合わせ療法
BR112019025913A2 (pt) * 2017-06-09 2020-06-30 Glaxosmithkline Intellectual Property Development Limited métodos para tratar câncer em um paciente em necesssidade do mesmo e para produzir um anticorpo, anticorpo anti-icos ou fragmento de ligação ao antígeno do mesmo e um anticorpo anti-ox40 ou fragmento de ligação ao antígeno do mesmo, uso de um anticorpo anti-icos ou porção de ligação ao antígeno do mesmo e um anticorpo anti-ox40 ou porção de ligação ao antígeno do mesmo na fabricação de um medicamento, polinucleotídeo que codifica um anticorpo, vetor, e, célula hospedeira.
JP2020522555A (ja) * 2017-06-09 2020-07-30 グラクソスミスクライン、インテレクチュアル、プロパティー、ディベロップメント、リミテッドGlaxosmithkline Intellectual Property Development Limited 組み合わせ療法
GB201709808D0 (en) 2017-06-20 2017-08-02 Kymab Ltd Antibodies
US10363272B2 (en) 2017-08-31 2019-07-30 Io Therapeutics, Inc. RAR selective agonists in combination with immune modulators for cancer immunotherapy
EP3692066A2 (en) * 2017-09-14 2020-08-12 GlaxoSmithKline Intellectual Property Development Limited Combination treatment for cancer
CA3077337A1 (en) 2017-10-05 2019-04-11 Glaxosmithkline Intellectual Property Development Limited Modulators of stimulator of interferon genes (sting)
AU2018344902B2 (en) 2017-10-05 2021-06-03 Glaxosmithkline Intellectual Property Development Limited Modulators of stimulator of interferon genes (STING) useful in treating HIV
US10981992B2 (en) 2017-11-08 2021-04-20 Xencor, Inc. Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors
JP2021502100A (ja) 2017-11-08 2021-01-28 ゼンコア インコーポレイテッド 新規抗pd−1配列を用いた二重特異性および単一特異性抗体
IL275426B2 (en) 2017-12-19 2025-03-01 Xencor Inc Engineered il-2 fc fusion proteins
EP3728314A1 (en) 2017-12-19 2020-10-28 Kymab Limited Bispecific antibody for icos and pd-l1
GB201721338D0 (en) 2017-12-19 2018-01-31 Kymab Ltd Anti-icos Antibodies
TW202000891A (zh) * 2018-03-07 2020-01-01 英商葛蘭素史克智慧財產發展有限公司 純化抗體之方法
EP3768715A1 (en) 2018-03-23 2021-01-27 Bristol-Myers Squibb Company Antibodies against mica and/or micb and uses thereof
CA3096052A1 (en) 2018-04-04 2019-10-10 Xencor, Inc. Heterodimeric antibodies that bind fibroblast activation protein
EP3781598A1 (en) 2018-04-18 2021-02-24 Xencor, Inc. Tim-3 targeted heterodimeric fusion proteins containing il-15/il-15ra fc-fusion proteins and tim-3 antigen binding domains
SG11202010163QA (en) 2018-04-18 2020-11-27 Xencor Inc Pd-1 targeted heterodimeric fusion proteins containing il-15/il-15ra fc-fusion proteins and pd-1 antigen binding domains and uses thereof
GB201807924D0 (en) 2018-05-16 2018-06-27 Ctxt Pty Ltd Compounds
US20210267973A1 (en) * 2018-05-31 2021-09-02 Glaxosmithkline Intellectual Property Development Limited Combination of a type ii protein arginine methyltransferase inhibitor and an icos binding protein to treat cancer
JP2021525271A (ja) * 2018-05-31 2021-09-24 グラクソスミスクライン、インテレクチュアル、プロパティー、ディベロップメント、リミテッドGlaxosmithkline Intellectual Property Development Limited Icos結合タンパク質及びアルギニンメチルトランスフェラーゼ阻害剤を用いた複合療法
WO2019241315A1 (en) 2018-06-12 2019-12-19 Obsidian Therapeutics, Inc. Pde5 derived regulatory constructs and methods of use in immunotherapy
CN113861295B (zh) * 2018-07-20 2024-05-24 厦门大学 抗pd-1抗体及其用途
WO2020031087A1 (en) 2018-08-06 2020-02-13 Glaxosmithkline Intellectual Property Development Limited Combination therapy
AU2019355971B2 (en) 2018-10-03 2025-05-08 Xencor, Inc. IL-12 heterodimeric Fc-fusion proteins
BR112021007517A2 (pt) * 2018-10-22 2021-10-26 Glaxosmithkline Intellectual Property Development Limited Dosagem
CA3132185A1 (en) 2019-03-01 2020-09-10 Xencor, Inc. Heterodimeric antibodies that bind enpp3 and cd3
CA3139011A1 (en) 2019-05-08 2020-11-12 Medigene Immunotherapies Gmbh Engineered t cells
WO2020232378A1 (en) 2019-05-16 2020-11-19 Silicon Swat, Inc. Benzo[b][1,8]naphthyridine acetic acid derivatives and methods of use
US20220227761A1 (en) 2019-05-16 2022-07-21 Stingthera, Inc. Oxoacridinyl acetic acid derivatives and methods of use
US20220363760A1 (en) 2019-05-30 2022-11-17 Bristol-Myers Squibb Company Multi-tumor gene signature for suitability to immuno-oncology therapy
WO2020243570A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Cell localization signature and combination therapy
KR20220016155A (ko) 2019-05-30 2022-02-08 브리스톨-마이어스 스큅 컴퍼니 면역-종양학 (i-o) 요법에 적합한 대상체를 확인하는 방법
GB201910304D0 (en) 2019-07-18 2019-09-04 Ctxt Pty Ltd Compounds
GB201910305D0 (en) 2019-07-18 2019-09-04 Ctxt Pty Ltd Compounds
WO2021018941A1 (en) 2019-07-31 2021-02-04 Glaxosmithkline Intellectual Property Development Limited Methods of treating cancer
WO2021043961A1 (en) 2019-09-06 2021-03-11 Glaxosmithkline Intellectual Property Development Limited Dosing regimen for the treatment of cancer with an anti icos agonistic antibody and chemotherapy
WO2021046289A1 (en) 2019-09-06 2021-03-11 Glaxosmithkline Intellectual Property Development Limited Dosing regimen for the treatment of cancer with an anti icos agonistic antibody and ipilimumab
EP4077318B1 (en) 2019-12-18 2025-10-15 Ctxt Pty Ltd Benzimidazole dimers as modulators of sting
JP2023521227A (ja) * 2020-04-14 2023-05-23 グラクソスミスクライン、インテレクチュアル、プロパティー、ディベロップメント、リミテッド 癌の併用療法
CA3175490A1 (en) 2020-04-14 2021-10-21 Glaxosmithkline Intellectual Property Limited Combination treatment for cancer based upon an icos antibody and a pd-l1 antibody tgf-beta-receptor fusion protein
AU2021256652A1 (en) * 2020-04-14 2022-11-03 Glaxosmithkline Intellectual Property Development Limited Combination treatment for cancer involving anti-ICOS and anti-PD1 antibodies, optionally further involving anti-tim3 antibodies
IL297313A (en) * 2020-04-20 2022-12-01 Jounce Therapeutics Inc Compositions and methods for vaccination and treatment of infectious diseases
WO2021231976A1 (en) 2020-05-14 2021-11-18 Xencor, Inc. Heterodimeric antibodies that bind prostate specific membrane antigen (psma) and cd3
GB202007099D0 (en) 2020-05-14 2020-07-01 Kymab Ltd Tumour biomarkers for immunotherapy
CA3192204A1 (en) 2020-08-19 2022-02-24 Xencor, Inc. Anti-cd28 and/or anti-b7h3 compositions
AU2021334361A1 (en) 2020-08-31 2023-05-11 Bristol-Myers Squibb Company Cell localization signature and immunotherapy
WO2022120179A1 (en) 2020-12-03 2022-06-09 Bristol-Myers Squibb Company Multi-tumor gene signatures and uses thereof
AR124414A1 (es) 2020-12-18 2023-03-22 Century Therapeutics Inc Sistema de receptor de antígeno quimérico con especificidad de receptor adaptable
US20220233693A1 (en) 2020-12-28 2022-07-28 Bristol-Myers Squibb Company Antibody Compositions and Methods of Use Thereof
JP2024501029A (ja) 2020-12-28 2024-01-10 ブリストル-マイヤーズ スクイブ カンパニー Pd1/pd-l1抗体の皮下投与
EP4288455A1 (en) 2021-02-03 2023-12-13 Mozart Therapeutics, Inc. Binding agents and methods of using the same
US11739144B2 (en) 2021-03-09 2023-08-29 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CLDN6
EP4305065A1 (en) 2021-03-10 2024-01-17 Xencor, Inc. Heterodimeric antibodies that bind cd3 and gpc3
EP4314068A1 (en) 2021-04-02 2024-02-07 The Regents Of The University Of California Antibodies against cleaved cdcp1 and uses thereof
TW202313682A (zh) 2021-05-18 2023-04-01 英商凱麥博有限公司 抗icos抗體之用途
GB202107994D0 (en) 2021-06-04 2021-07-21 Kymab Ltd Treatment of cancer
WO2023178192A1 (en) 2022-03-15 2023-09-21 Compugen Ltd. Il-18bp antagonist antibodies and their use in monotherapy and combination therapy in the treatment of cancer
WO2023178329A1 (en) 2022-03-18 2023-09-21 Bristol-Myers Squibb Company Methods of isolating polypeptides
WO2023222854A1 (en) 2022-05-18 2023-11-23 Kymab Limited Uses of anti-icos antibodies
KR20250022071A (ko) 2022-06-02 2025-02-14 브리스톨-마이어스 스큅 컴퍼니 항체 조성물 및 이의 이용 방법
WO2024030956A2 (en) * 2022-08-03 2024-02-08 Mozart Therapeutics, Inc. Cd39-specific binding agents and methods of using the same
EP4583999A1 (en) 2022-09-09 2025-07-16 Bristol-Myers Squibb Company Methods of separating chelator
WO2024196952A1 (en) 2023-03-20 2024-09-26 Bristol-Myers Squibb Company Tumor subtype assessment for cancer therapy
TW202515608A (zh) 2023-06-26 2025-04-16 以色列商坎布根有限公司 Il—18bp拮抗抗體及其於癌症治療之單一療法及組合療法的用途
WO2025038763A1 (en) 2023-08-15 2025-02-20 Bristol-Myers Squibb Company Ceramic hydroxyapatite chromatography flow through method
WO2025145207A1 (en) 2023-12-29 2025-07-03 Bristol-Myers Squibb Company Combination therapy of kras inhibitor and treg-depleting agent

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997010354A1 (fr) * 1995-09-11 1997-03-20 Kyowa Hakko Kogyo Co., Ltd. Anticorps de la chaine alpha du recepteur de l'interleukine 5 humaine
US8242252B2 (en) * 2007-10-19 2012-08-14 Seattle Genetics, Inc. CD19 binding agents and uses thereof

Family Cites Families (87)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPS57106673A (en) 1980-12-24 1982-07-02 Chugai Pharmaceut Co Ltd Dibenzo(b,f)(1,4)oxazepin derivative
GB8607679D0 (en) 1986-03-27 1986-04-30 Winter G P Recombinant dna product
US5859205A (en) 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
US5559235A (en) 1991-10-29 1996-09-24 Glaxo Wellcome Inc. Water soluble camptothecin derivatives
CA2118508A1 (en) 1992-04-24 1993-11-11 Elizabeth S. Ward Recombinant production of immunoglobulin-like domains in prokaryotic cells
US5342947A (en) 1992-10-09 1994-08-30 Glaxo Inc. Preparation of water soluble camptothecin derivatives
US5681835A (en) 1994-04-25 1997-10-28 Glaxo Wellcome Inc. Non-steroidal ligands for the estrogen receptor
US5491237A (en) 1994-05-03 1996-02-13 Glaxo Wellcome Inc. Intermediates in pharmaceutical camptothecin preparation
GB9508538D0 (en) 1995-04-27 1995-06-14 Zeneca Ltd Quinazoline derivatives
US5747498A (en) 1996-05-28 1998-05-05 Pfizer Inc. Alkynyl and azido-substituted 4-anilinoquinazolines
JP3521382B2 (ja) 1997-02-27 2004-04-19 日本たばこ産業株式会社 細胞間接着及びシグナル伝達を媒介する細胞表面分子
US7368531B2 (en) 1997-03-07 2008-05-06 Human Genome Sciences, Inc. Human secreted proteins
US6113918A (en) 1997-05-08 2000-09-05 Ribi Immunochem Research, Inc. Aminoalkyl glucosamine phosphate compounds and their use as adjuvants and immunoeffectors
GB9716557D0 (en) 1997-08-06 1997-10-08 Glaxo Group Ltd Benzylidene-1,3-dihydro-indol-2-one derivatives having anti-cancer activity
DE19821060A1 (de) * 1997-09-23 1999-04-15 Bundesrepublik Deutschland Let Ko-stimulierendes Polypeptid von T-Zellen, monoklonale Antikörper sowie die Herstellung und deren Verwendung
CA2305350C (en) 1997-09-23 2015-04-07 Bundesrepublik Deutschland Letztvertreten Durch Den Direktor Des Robert-Koch-Instituts Costimulating polypeptide of t cells, monoclonal antibodies, and the preparation and use thereof
RS49779B (sr) 1998-01-12 2008-06-05 Glaxo Group Limited, Biciklična heteroaromatična jedinjenja kao inhibitori protein tirozin kinaze
US6312700B1 (en) 1998-02-24 2001-11-06 Andrew D. Weinberg Method for enhancing an antigen specific immune response with OX-40L
EP1119253A4 (en) 1998-10-07 2005-12-21 Millennium Pharm Inc NEW SPECIFIC MOLECULES OF Th2 AND USES THEREOF
US7708993B2 (en) 1999-02-03 2010-05-04 Amgen Inc. Polypeptides involved in immune response
CA2704600C (en) 1999-04-09 2016-10-25 Kyowa Kirin Co., Ltd. A method for producing antibodies with increased adcc activity
CN100340575C (zh) 1999-06-25 2007-10-03 杰南技术公司 人源化抗ErbB2抗体及其在制备药物中的应用
US7605238B2 (en) 1999-08-24 2009-10-20 Medarex, Inc. Human CTLA-4 antibodies and their uses
EP1212422B1 (en) 1999-08-24 2007-02-21 Medarex, Inc. Human ctla-4 antibodies and their uses
JP4210454B2 (ja) 2001-03-27 2009-01-21 日本たばこ産業株式会社 炎症性腸疾患治療剤
JP3871503B2 (ja) 1999-08-30 2007-01-24 日本たばこ産業株式会社 免疫性疾患治療剤
JP3597140B2 (ja) * 2000-05-18 2004-12-02 日本たばこ産業株式会社 副刺激伝達分子ailimに対するヒトモノクローナル抗体及びその医薬用途
HU230847B1 (en) 2000-05-19 2018-08-28 Corixa Corp Prophylactic and therapeutic treatment of infectious and other diseases with mono and disaccharide-based compounds
AU2001273071B2 (en) 2000-06-30 2005-09-08 Glaxo Group Limited Quinazoline ditosylate salt compounds
CA2417806C (en) 2000-08-04 2011-05-10 Corixa Corporation New immunoeffector compounds
US6946292B2 (en) 2000-10-06 2005-09-20 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions with increased antibody dependent cytotoxic activity
US6374470B1 (en) 2000-10-06 2002-04-23 Milliken & Company Face plate for spun-like textured yarn
WO2002074803A2 (en) 2001-01-16 2002-09-26 Bayer Aktiengesellschaft Regulation of human icos v protein
US7754208B2 (en) 2001-01-17 2010-07-13 Trubion Pharmaceuticals, Inc. Binding domain-immunoglobulin fusion proteins
JP4212278B2 (ja) 2001-03-01 2009-01-21 日本たばこ産業株式会社 移植片拒絶反応抑制剤
US20050202442A1 (en) 2003-12-15 2005-09-15 Morris David W. Novel therapeutic targets in cancer
DK1451224T3 (da) 2001-12-04 2012-11-19 Theramab Llc Peptid eller protein, der indeholder en C´-D-sløjfe fra CD28-receptorfamilien
US6525028B1 (en) 2002-02-04 2003-02-25 Corixa Corporation Immunoeffector compounds
US6911434B2 (en) 2002-02-04 2005-06-28 Corixa Corporation Prophylactic and therapeutic treatment of infectious and other diseases with immunoeffector compounds
US20040029226A1 (en) 2002-03-06 2004-02-12 John Alsobrook Therapeutic polypeptides, nucleic acids encoding same, and methods of use
IL164376A0 (en) 2002-04-03 2005-12-18 Applied Research Systems Ox4or binding agents, their preparation and pharmaceutical compositions containing them
DE60317677T2 (de) 2002-06-13 2008-10-30 Crucell Holland B.V. Ox40 (=cd134) rezeptor agonisten und therapeutische verwendung
US20040001831A1 (en) 2002-06-26 2004-01-01 Millennium Pharmaceuticals, Inc. Methods and compositions for the diagnosis and treatment of demyelinating inflammatory disorders
AU2003281200A1 (en) 2002-07-03 2004-01-23 Tasuku Honjo Immunopotentiating compositions
EP2322200A3 (en) 2002-10-29 2011-07-27 Genentech, Inc. Compositions and methods for the treatment of immune related diseases
JP2011516026A (ja) 2002-11-26 2011-05-26 ジェネンテック・インコーポレーテッド 免疫関連疾患の治療のための組成物と方法
WO2004060911A2 (en) 2002-12-30 2004-07-22 Amgen Inc. Combination therapy with co-stimulatory factors
US7960522B2 (en) 2003-01-06 2011-06-14 Corixa Corporation Certain aminoalkyl glucosaminide phosphate compounds and their use
WO2005019258A2 (en) 2003-08-11 2005-03-03 Genentech, Inc. Compositions and methods for the treatment of immune related diseases
DK2439273T3 (da) 2005-05-09 2019-06-03 Ono Pharmaceutical Co Humane monoklonale antistoffer til programmeret død-1(pd-1) og fremgangsmåder til behandling af cancer ved anvendelse af anti-pd-1- antistoffer alene eller i kombination med andre immunterapeutika
PT1907424E (pt) 2005-07-01 2015-10-09 Squibb & Sons Llc Anticorpos monoclonais humanos para o ligando 1 de morte programada (pd-l1)
WO2007011041A1 (ja) 2005-07-22 2007-01-25 Kyowa Hakko Kogyo Co., Ltd. 遺伝子組換え抗体組成物
US7923538B2 (en) 2005-07-22 2011-04-12 Kyowa Hakko Kirin Co., Ltd Recombinant antibody composition
EP1938104A2 (en) 2005-10-17 2008-07-02 Institute for Systems Biology Tissue-and serum-derived glycoproteins and methods of their use
AU2007290570C1 (en) * 2006-08-28 2013-08-15 Kyowa Kirin Co., Ltd. Antagonistic human LIGHT-specific human monoclonal antibodies
AU2008247382B2 (en) * 2007-05-07 2014-06-05 Medimmune, Llc Anti-ICOS antibodies and their use in treatment of oncology, transplantation and autoimmune disease
EP2050764A1 (en) 2007-10-15 2009-04-22 sanofi-aventis Novel polyvalent bispecific antibody format and uses thereof
PT2594590E (pt) 2007-12-14 2015-01-14 Bristol Myers Squibb Co Moléculas de ligação ao recetor humano ox40
EP2262837A4 (en) 2008-03-12 2011-04-06 Merck Sharp & Dohme PD-1 BINDING PROTEINS
US9931386B2 (en) 2008-06-16 2018-04-03 Atsuo Ochi Recombinant multiple domain fusion protein mitogens and use thereof for inducing enhancement or repression of antigen-specific immunity
JP5933975B2 (ja) 2008-11-12 2016-06-15 メディミューン,エルエルシー 抗体製剤
CA2769822C (en) 2009-08-13 2019-02-19 The Johns Hopkins University Methods of modulating immune function
EP2482849B1 (en) * 2009-09-30 2018-06-06 Memorial Sloan-Kettering Cancer Center Combination immunotherapy for the treatment of cancer
PL2504364T3 (pl) 2009-11-24 2017-12-29 Medimmune Limited Ukierunkowane środki wiążące przeciwko B7-H1
SG181533A1 (en) * 2009-12-07 2012-07-30 Univ Leland Stanford Junior Methods for enhancing anti-tumor antibody therapy
ES2724451T3 (es) 2010-02-04 2019-09-11 Univ Pennsylvania ICOS regula fundamentalmente la expansión y la función de linfocitos Th17 humanos inflamatorios
US8536672B2 (en) 2010-03-19 2013-09-17 Xintec, Inc. Image sensor package and fabrication method thereof
WO2012009709A1 (en) 2010-07-16 2012-01-19 Sudhir Paul Hiv cd4 binding site based covalent immunogen compositions
CA2809089C (en) 2010-08-23 2018-12-18 Board Of Regents, The University Of Texas System Anti-ox40 antibodies and methods of using the same
EP3147297B1 (en) * 2011-03-31 2018-12-12 INSERM (Institut National de la Santé et de la Recherche Médicale) Antibodies directed against icos and uses thereof
CA2845810C (en) 2011-08-23 2017-03-28 Board Of Regents, The University Of Texas System Anti-ox40 antibodies and methods of using the same
WO2013151665A2 (en) 2012-04-02 2013-10-10 modeRNA Therapeutics Modified polynucleotides for the production of proteins associated with human disease
US9695247B2 (en) 2012-09-03 2017-07-04 Inserm (Institut National De La Sante Et De La Recherche Medicale) Antibodies directed against ICOS for treating graft-versus-host disease
BR112015007672A2 (pt) 2012-10-04 2017-08-08 Dana Farber Cancer Inst Inc anticorpos anti-pd-l1 monoclonais humanos e métodos de uso
EP3508215A3 (en) * 2012-12-03 2019-10-02 Bristol-Myers Squibb Company Enhancing anti-cancer activity of immunomodulatory fc fusion proteins
PE20170255A1 (es) * 2014-01-24 2017-03-22 Dana Farber Cancer Inst Inc Moleculas de anticuerpo que se unen a pd-1 y usos de las mismas
SG10201807625PA (en) * 2014-11-17 2018-10-30 Genentech Inc Combination therapy comprising ox40 binding agonists and pd-1 axis binding antagonists
TWI595006B (zh) * 2014-12-09 2017-08-11 禮納特神經系統科學公司 抗pd-1抗體類和使用彼等之方法
MA41414A (fr) * 2015-01-28 2017-12-05 Centre Nat Rech Scient Protéines de liaison agonistes d' icos
US20180230431A1 (en) 2015-08-07 2018-08-16 Glaxosmithkline Intellectual Property Development Limited Combination Therapy
EP3494140A1 (en) * 2016-08-04 2019-06-12 GlaxoSmithKline Intellectual Property Development Ltd Anti-icos and anti-pd-1 antibody combination therapy
EP3692066A2 (en) * 2017-09-14 2020-08-12 GlaxoSmithKline Intellectual Property Development Limited Combination treatment for cancer
US20210395367A1 (en) * 2018-10-22 2021-12-23 Glaxosmithkline Intellectual Property Development Limited Dosing
BR112021007517A2 (pt) * 2018-10-22 2021-10-26 Glaxosmithkline Intellectual Property Development Limited Dosagem
AU2021256652A1 (en) * 2020-04-14 2022-11-03 Glaxosmithkline Intellectual Property Development Limited Combination treatment for cancer involving anti-ICOS and anti-PD1 antibodies, optionally further involving anti-tim3 antibodies
CA3175490A1 (en) * 2020-04-14 2021-10-21 Glaxosmithkline Intellectual Property Limited Combination treatment for cancer based upon an icos antibody and a pd-l1 antibody tgf-beta-receptor fusion protein
JP2023521227A (ja) * 2020-04-14 2023-05-23 グラクソスミスクライン、インテレクチュアル、プロパティー、ディベロップメント、リミテッド 癌の併用療法

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997010354A1 (fr) * 1995-09-11 1997-03-20 Kyowa Hakko Kogyo Co., Ltd. Anticorps de la chaine alpha du recepteur de l'interleukine 5 humaine
US8242252B2 (en) * 2007-10-19 2012-08-14 Seattle Genetics, Inc. CD19 binding agents and uses thereof

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20190315866A1 (en) * 2011-03-31 2019-10-17 Inserm (Institut National De La Sante Et De La Recherche Medicale) Antibodies Directed Against ICOS and Uses Thereof
US10633446B2 (en) * 2011-03-31 2020-04-28 INSERM (Institut National de la Santéet de la Recherche Medicale) Antibodies directed against ICOS and uses thereof
US20180334503A1 (en) * 2015-01-28 2018-11-22 Glaxosmithkline Intellectual Property Development Limited Icos binding proteins
US10351627B2 (en) * 2015-01-28 2019-07-16 Glaxosmithkline Intellectual Property Development Limited ICOS binding proteins
US20200140551A1 (en) * 2015-01-28 2020-05-07 Glaxosmithkline Intellectual Property Development Limited Icos binding proteins
US11130811B2 (en) 2015-01-28 2021-09-28 Glaxosmithkline Intellectual Property Development Limited ICOS binding proteins
US10251945B2 (en) 2017-04-07 2019-04-09 Bristol-Myers Squibb Company Anti-ICOS agonist antibodies and uses thereof
US10493140B2 (en) 2017-04-07 2019-12-03 Bristol-Myers Squibb Company Anti-ICOS agonist antibodies and uses thereof
US10898556B2 (en) 2017-04-07 2021-01-26 Bristol-Myers Squibb Company Anti-ICOS agonist antibodies and uses thereof
US11207391B2 (en) 2017-04-07 2021-12-28 Bristol-Myers Squibb Company Anti-ICOS agonist antibodies and uses thereof
US11529399B2 (en) 2017-04-07 2022-12-20 Bristol-Myers Squibb Company Anti-ICOS agonist antibodies and uses thereof

Also Published As

Publication number Publication date
JP6553197B2 (ja) 2019-07-31
US20200123257A1 (en) 2020-04-23
CR20170351A (es) 2018-01-22
US20160362494A1 (en) 2016-12-15
PE20180120A1 (es) 2018-01-18
EA036335B1 (ru) 2020-10-28
AU2016210867A1 (en) 2017-08-03
JP2019167355A (ja) 2019-10-03
DOP2017000171A (es) 2017-10-31
CO2017007665A2 (es) 2017-10-20
JP2018505177A (ja) 2018-02-22
BR112017016336A2 (pt) 2018-03-27
US20170174767A1 (en) 2017-06-22
ZA201704818B (en) 2019-01-30
TWI717332B (zh) 2021-02-01
MY185845A (en) 2021-06-13
AU2019200751A1 (en) 2019-02-21
US20160215059A1 (en) 2016-07-28
WO2016120789A1 (en) 2016-08-04
KR102315160B1 (ko) 2021-10-19
EA201791706A1 (ru) 2018-04-30
SG11201705829TA (en) 2017-08-30
PH12017501347B1 (en) 2022-03-25
US9771424B2 (en) 2017-09-26
US10351627B2 (en) 2019-07-16
JO3745B1 (ar) 2021-01-31
EP3575324A1 (en) 2019-12-04
JP2020079252A (ja) 2020-05-28
IL253508B (en) 2021-12-01
JP7062704B2 (ja) 2022-05-17
ES2913871T3 (es) 2022-06-06
EP3572432A1 (en) 2019-11-27
EP3250603A1 (en) 2017-12-06
CN107667117B (zh) 2021-12-28
EP3250603B1 (en) 2022-03-30
US20170313777A1 (en) 2017-11-02
CA2974910A1 (en) 2016-08-04
AU2016210867B2 (en) 2018-11-08
UA124613C2 (uk) 2021-10-20
JP6653782B2 (ja) 2020-02-26
US9738718B2 (en) 2017-08-22
AU2020294301A1 (en) 2021-02-25
US11130811B2 (en) 2021-09-28
UY36539A (es) 2016-08-31
KR20180002593A (ko) 2018-01-08
MA47386A (fr) 2019-12-04
PH12017501347A1 (en) 2017-12-11
CN107667117A (zh) 2018-02-06
CL2017001921A1 (es) 2018-03-16
MX2017009758A (es) 2018-03-07
MA47323A (fr) 2019-11-27
AU2019200751B2 (en) 2020-12-03
MA41414A (fr) 2017-12-05
US20200140551A1 (en) 2020-05-07
US20180334503A1 (en) 2018-11-22
TW201702267A (zh) 2017-01-16
US20220064299A1 (en) 2022-03-03
IL253508A0 (en) 2017-09-28

Similar Documents

Publication Publication Date Title
US11130811B2 (en) ICOS binding proteins
US20210155903A1 (en) Combination Therapy
US11649289B2 (en) Anti-ICOS and anti-PD-1 antibody combination therapy
JP2022539178A (ja) Il1rap結合タンパク質
HK40016303A (en) Icos binding proteins
HK40014509A (en) Icos binding proteins
HK1240235B (en) Agonistic icos binding proteins

Legal Events

Date Code Title Description
AS Assignment

Owner name: GLAXOSMITHKLINE INTELLECTUAL PROPERTY DEVELOPMENT

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:LIU, YAO-BIN;PARMAR, RADHA SHAH;MAYES, PATRICK;SIGNING DATES FROM 20160217 TO 20160302;REEL/FRAME:043100/0916

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION