US20140186919A1 - Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation - Google Patents
Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation Download PDFInfo
- Publication number
- US20140186919A1 US20140186919A1 US14/104,977 US201314104977A US2014186919A1 US 20140186919 A1 US20140186919 A1 US 20140186919A1 US 201314104977 A US201314104977 A US 201314104977A US 2014186919 A1 US2014186919 A1 US 2014186919A1
- Authority
- US
- United States
- Prior art keywords
- sequence
- crispr enzyme
- cas9
- crispr
- enzyme
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 102000004190 Enzymes Human genes 0.000 title claims abstract description 209
- 108090000790 Enzymes Proteins 0.000 title claims abstract description 209
- 239000000203 mixture Substances 0.000 title claims abstract description 52
- 238000000034 method Methods 0.000 title abstract description 127
- 238000005457 optimization Methods 0.000 title abstract description 12
- 230000001976 improved effect Effects 0.000 title description 6
- 108091033409 CRISPR Proteins 0.000 claims abstract description 218
- 238000010354 CRISPR gene editing Methods 0.000 claims abstract 5
- 239000013598 vector Substances 0.000 claims description 136
- 102000040430 polynucleotide Human genes 0.000 claims description 126
- 108091033319 polynucleotide Proteins 0.000 claims description 126
- 239000002157 polynucleotide Substances 0.000 claims description 126
- 230000014509 gene expression Effects 0.000 claims description 109
- 150000001413 amino acids Chemical class 0.000 claims description 77
- 230000035772 mutation Effects 0.000 claims description 50
- 125000003729 nucleotide group Chemical group 0.000 claims description 49
- 239000002773 nucleotide Substances 0.000 claims description 44
- 230000001105 regulatory effect Effects 0.000 claims description 39
- 238000003776 cleavage reaction Methods 0.000 claims description 36
- 230000007017 scission Effects 0.000 claims description 36
- 210000003527 eukaryotic cell Anatomy 0.000 claims description 28
- 108091092236 Chimeric RNA Proteins 0.000 claims description 21
- 241000204031 Mycoplasma Species 0.000 claims description 21
- 108010008532 Deoxyribonuclease I Proteins 0.000 claims description 20
- 102000007260 Deoxyribonuclease I Human genes 0.000 claims description 20
- 230000003197 catalytic effect Effects 0.000 claims description 18
- 101710163270 Nuclease Proteins 0.000 claims description 15
- 230000009870 specific binding Effects 0.000 claims description 12
- 241000589876 Campylobacter Species 0.000 claims description 11
- 241000589248 Legionella Species 0.000 claims description 11
- 208000007764 Legionnaires' Disease Diseases 0.000 claims description 11
- 241000588653 Neisseria Species 0.000 claims description 11
- 241000191940 Staphylococcus Species 0.000 claims description 11
- 241000589886 Treponema Species 0.000 claims description 11
- 241000589941 Azospirillum Species 0.000 claims description 10
- 241000606125 Bacteroides Species 0.000 claims description 10
- 241000186394 Eubacterium Species 0.000 claims description 10
- 241000178967 Filifactor Species 0.000 claims description 10
- 241000589565 Flavobacterium Species 0.000 claims description 10
- 241000032681 Gluconacetobacter Species 0.000 claims description 10
- 241000186660 Lactobacillus Species 0.000 claims description 10
- 241000135938 Nitratifractor Species 0.000 claims description 10
- 241001386753 Parvibaculum Species 0.000 claims description 10
- 241000605947 Roseburia Species 0.000 claims description 10
- 241000949716 Sphaerochaeta Species 0.000 claims description 10
- 241000194017 Streptococcus Species 0.000 claims description 10
- 241000123710 Sutterella Species 0.000 claims description 10
- 229940039696 lactobacillus Drugs 0.000 claims description 10
- 230000030648 nucleus localization Effects 0.000 claims description 9
- 241000191967 Staphylococcus aureus Species 0.000 claims description 6
- 241000589986 Campylobacter lari Species 0.000 claims description 2
- 241001282092 Filifactor alocis Species 0.000 claims description 2
- 241001468157 Lactobacillus johnsonii Species 0.000 claims description 2
- 241001193656 Legionella pneumophila str. Paris Species 0.000 claims description 2
- 241000204022 Mycoplasma gallisepticum Species 0.000 claims description 2
- 241000588654 Neisseria cinerea Species 0.000 claims description 2
- 241001386755 Parvibaculum lavamentivorans Species 0.000 claims description 2
- 241000794282 Staphylococcus pseudintermedius Species 0.000 claims description 2
- 241000123713 Sutterella wadsworthensis Species 0.000 claims description 2
- 241000589892 Treponema denticola Species 0.000 claims description 2
- 229910052740 iodine Inorganic materials 0.000 claims description 2
- 230000000694 effects Effects 0.000 abstract description 42
- 229940088598 enzyme Drugs 0.000 description 202
- 210000004027 cell Anatomy 0.000 description 167
- 108090000623 proteins and genes Proteins 0.000 description 161
- 150000007523 nucleic acids Chemical class 0.000 description 75
- 102000004169 proteins and genes Human genes 0.000 description 68
- 235000001014 amino acid Nutrition 0.000 description 66
- 229940024606 amino acid Drugs 0.000 description 65
- 102000039446 nucleic acids Human genes 0.000 description 64
- 108020004707 nucleic acids Proteins 0.000 description 64
- 235000018102 proteins Nutrition 0.000 description 64
- 108020004414 DNA Proteins 0.000 description 63
- 108020005004 Guide RNA Proteins 0.000 description 63
- -1 St1Cas9 Proteins 0.000 description 45
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 42
- 239000000047 product Substances 0.000 description 39
- 230000011664 signaling Effects 0.000 description 38
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 34
- 108020004999 messenger RNA Proteins 0.000 description 31
- 201000010099 disease Diseases 0.000 description 29
- 241000282414 Homo sapiens Species 0.000 description 27
- 238000003556 assay Methods 0.000 description 27
- 230000008238 biochemical pathway Effects 0.000 description 26
- 230000001939 inductive effect Effects 0.000 description 24
- 239000013612 plasmid Substances 0.000 description 24
- 210000001519 tissue Anatomy 0.000 description 24
- 238000009396 hybridization Methods 0.000 description 23
- 238000010362 genome editing Methods 0.000 description 22
- 238000012986 modification Methods 0.000 description 21
- 239000002245 particle Substances 0.000 description 21
- 239000013603 viral vector Substances 0.000 description 21
- 108020004705 Codon Proteins 0.000 description 20
- 230000004048 modification Effects 0.000 description 20
- 108090000765 processed proteins & peptides Proteins 0.000 description 20
- 239000000523 sample Substances 0.000 description 20
- 239000003795 chemical substances by application Substances 0.000 description 19
- 239000013604 expression vector Substances 0.000 description 19
- 230000008569 process Effects 0.000 description 19
- 102000004196 processed proteins & peptides Human genes 0.000 description 18
- 238000013518 transcription Methods 0.000 description 18
- 230000035897 transcription Effects 0.000 description 18
- 241000700605 Viruses Species 0.000 description 17
- 238000011144 upstream manufacturing Methods 0.000 description 17
- 230000003612 virological effect Effects 0.000 description 17
- 108091028043 Nucleic acid sequence Proteins 0.000 description 16
- 230000006870 function Effects 0.000 description 16
- 238000003780 insertion Methods 0.000 description 16
- 230000037431 insertion Effects 0.000 description 16
- 238000004806 packaging method and process Methods 0.000 description 16
- 230000008685 targeting Effects 0.000 description 16
- 238000000338 in vitro Methods 0.000 description 15
- 238000001727 in vivo Methods 0.000 description 15
- 239000004055 small Interfering RNA Substances 0.000 description 15
- 241000701161 unidentified adenovirus Species 0.000 description 15
- 101000798015 Homo sapiens RAC-beta serine/threonine-protein kinase Proteins 0.000 description 14
- 102100032315 RAC-beta serine/threonine-protein kinase Human genes 0.000 description 14
- 102100030708 GTPase KRas Human genes 0.000 description 13
- 102100024193 Mitogen-activated protein kinase 1 Human genes 0.000 description 13
- 108020004459 Small interfering RNA Proteins 0.000 description 13
- 238000009739 binding Methods 0.000 description 13
- 230000000295 complement effect Effects 0.000 description 13
- 208000035475 disorder Diseases 0.000 description 13
- 230000010076 replication Effects 0.000 description 13
- 238000006467 substitution reaction Methods 0.000 description 13
- 238000001890 transfection Methods 0.000 description 13
- 102100023266 Dual specificity mitogen-activated protein kinase kinase 2 Human genes 0.000 description 12
- 101000584612 Homo sapiens GTPase KRas Proteins 0.000 description 12
- 101001052493 Homo sapiens Mitogen-activated protein kinase 1 Proteins 0.000 description 12
- 101001052490 Homo sapiens Mitogen-activated protein kinase 3 Proteins 0.000 description 12
- 101000605639 Homo sapiens Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Proteins 0.000 description 12
- 108010068353 MAP Kinase Kinase 2 Proteins 0.000 description 12
- 102100039124 Methyl-CpG-binding protein 2 Human genes 0.000 description 12
- 102100024192 Mitogen-activated protein kinase 3 Human genes 0.000 description 12
- 102100038332 Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Human genes 0.000 description 12
- 230000027455 binding Effects 0.000 description 12
- 230000015572 biosynthetic process Effects 0.000 description 12
- 238000004422 calculation algorithm Methods 0.000 description 12
- 229920001184 polypeptide Polymers 0.000 description 12
- 125000006850 spacer group Chemical group 0.000 description 12
- 238000012360 testing method Methods 0.000 description 12
- 102100031480 Dual specificity mitogen-activated protein kinase kinase 1 Human genes 0.000 description 11
- 101000967216 Homo sapiens Eosinophil cationic protein Proteins 0.000 description 11
- 101000950695 Homo sapiens Mitogen-activated protein kinase 8 Proteins 0.000 description 11
- 101001120056 Homo sapiens Phosphatidylinositol 3-kinase regulatory subunit alpha Proteins 0.000 description 11
- 101000595741 Homo sapiens Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform Proteins 0.000 description 11
- 101000712530 Homo sapiens RAF proto-oncogene serine/threonine-protein kinase Proteins 0.000 description 11
- 108010068342 MAP Kinase Kinase 1 Proteins 0.000 description 11
- 102100037808 Mitogen-activated protein kinase 8 Human genes 0.000 description 11
- 102100026169 Phosphatidylinositol 3-kinase regulatory subunit alpha Human genes 0.000 description 11
- 102100036061 Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform Human genes 0.000 description 11
- 102100033479 RAF proto-oncogene serine/threonine-protein kinase Human genes 0.000 description 11
- 241000193996 Streptococcus pyogenes Species 0.000 description 11
- 239000012634 fragment Substances 0.000 description 11
- 230000004927 fusion Effects 0.000 description 11
- 230000010354 integration Effects 0.000 description 11
- 210000004940 nucleus Anatomy 0.000 description 11
- 101000950669 Homo sapiens Mitogen-activated protein kinase 9 Proteins 0.000 description 10
- 101000798007 Homo sapiens RAC-gamma serine/threonine-protein kinase Proteins 0.000 description 10
- 101000927796 Homo sapiens Rho guanine nucleotide exchange factor 7 Proteins 0.000 description 10
- 102100037809 Mitogen-activated protein kinase 9 Human genes 0.000 description 10
- 102100033810 RAC-alpha serine/threonine-protein kinase Human genes 0.000 description 10
- 102100032314 RAC-gamma serine/threonine-protein kinase Human genes 0.000 description 10
- 102100033200 Rho guanine nucleotide exchange factor 7 Human genes 0.000 description 10
- 239000003814 drug Substances 0.000 description 10
- 102000037865 fusion proteins Human genes 0.000 description 10
- 108020001507 fusion proteins Proteins 0.000 description 10
- 102100032187 Androgen receptor Human genes 0.000 description 9
- 108091026890 Coding region Proteins 0.000 description 9
- 101001033726 Homo sapiens Methyl-CpG-binding protein 2 Proteins 0.000 description 9
- 101001003584 Homo sapiens Prelamin-A/C Proteins 0.000 description 9
- 101000779418 Homo sapiens RAC-alpha serine/threonine-protein kinase Proteins 0.000 description 9
- 102100026531 Prelamin-A/C Human genes 0.000 description 9
- 102100022122 Ras-related C3 botulinum toxin substrate 1 Human genes 0.000 description 9
- 102100033019 Tyrosine-protein phosphatase non-receptor type 11 Human genes 0.000 description 9
- 210000004556 brain Anatomy 0.000 description 9
- 238000006243 chemical reaction Methods 0.000 description 9
- 238000005516 engineering process Methods 0.000 description 9
- 238000001415 gene therapy Methods 0.000 description 9
- 239000002502 liposome Substances 0.000 description 9
- 108010062302 rac1 GTP Binding Protein Proteins 0.000 description 9
- 102100026882 Alpha-synuclein Human genes 0.000 description 8
- 241000894006 Bacteria Species 0.000 description 8
- 108010017009 CD11b Antigen Proteins 0.000 description 8
- 101001110283 Canis lupus familiaris Ras-related C3 botulinum toxin substrate 1 Proteins 0.000 description 8
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 8
- 241000196324 Embryophyta Species 0.000 description 8
- 108010033040 Histones Proteins 0.000 description 8
- 101000935043 Homo sapiens Integrin beta-1 Proteins 0.000 description 8
- 101000605630 Homo sapiens Phosphatidylinositol 3-kinase catalytic subunit type 3 Proteins 0.000 description 8
- 101000721642 Homo sapiens Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha Proteins 0.000 description 8
- 101001026854 Homo sapiens Protein kinase C delta type Proteins 0.000 description 8
- 101001026852 Homo sapiens Protein kinase C epsilon type Proteins 0.000 description 8
- 101001110313 Homo sapiens Ras-related C3 botulinum toxin substrate 2 Proteins 0.000 description 8
- 102100022338 Integrin alpha-M Human genes 0.000 description 8
- 102100025304 Integrin beta-1 Human genes 0.000 description 8
- 241001465754 Metazoa Species 0.000 description 8
- 102100038329 Phosphatidylinositol 3-kinase catalytic subunit type 3 Human genes 0.000 description 8
- 102100025058 Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha Human genes 0.000 description 8
- 102100037340 Protein kinase C delta type Human genes 0.000 description 8
- 102100037339 Protein kinase C epsilon type Human genes 0.000 description 8
- 102100022129 Ras-related C3 botulinum toxin substrate 2 Human genes 0.000 description 8
- 230000003321 amplification Effects 0.000 description 8
- 239000000872 buffer Substances 0.000 description 8
- 238000004519 manufacturing process Methods 0.000 description 8
- 238000003199 nucleic acid amplification method Methods 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 7
- 102100026008 Breakpoint cluster region protein Human genes 0.000 description 7
- 101710172824 CRISPR-associated endonuclease Cas9 Proteins 0.000 description 7
- 102000011068 Cdc42 Human genes 0.000 description 7
- 102220605874 Cytosolic arginine sensor for mTORC1 subunit 2_D10A_mutation Human genes 0.000 description 7
- 230000007018 DNA scission Effects 0.000 description 7
- 230000004568 DNA-binding Effects 0.000 description 7
- 108091029865 Exogenous DNA Proteins 0.000 description 7
- 101000933320 Homo sapiens Breakpoint cluster region protein Proteins 0.000 description 7
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 7
- 101001078158 Homo sapiens Integrin alpha-1 Proteins 0.000 description 7
- 101001078133 Homo sapiens Integrin alpha-2 Proteins 0.000 description 7
- 101000994369 Homo sapiens Integrin alpha-5 Proteins 0.000 description 7
- 101001015004 Homo sapiens Integrin beta-3 Proteins 0.000 description 7
- 101001015037 Homo sapiens Integrin beta-7 Proteins 0.000 description 7
- 101000987315 Homo sapiens Serine/threonine-protein kinase PAK 3 Proteins 0.000 description 7
- 101001087416 Homo sapiens Tyrosine-protein phosphatase non-receptor type 11 Proteins 0.000 description 7
- 102100025323 Integrin alpha-1 Human genes 0.000 description 7
- 102100025305 Integrin alpha-2 Human genes 0.000 description 7
- 102100032817 Integrin alpha-5 Human genes 0.000 description 7
- 102100032999 Integrin beta-3 Human genes 0.000 description 7
- 102100033016 Integrin beta-7 Human genes 0.000 description 7
- 102100025169 Max-binding protein MNT Human genes 0.000 description 7
- 108010011536 PTEN Phosphohydrolase Proteins 0.000 description 7
- 102100032543 Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN Human genes 0.000 description 7
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 7
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 7
- 125000003275 alpha amino acid group Chemical group 0.000 description 7
- 238000004458 analytical method Methods 0.000 description 7
- 108010051348 cdc42 GTP-Binding Protein Proteins 0.000 description 7
- 238000013461 design Methods 0.000 description 7
- 238000001514 detection method Methods 0.000 description 7
- 239000003623 enhancer Substances 0.000 description 7
- 210000001808 exosome Anatomy 0.000 description 7
- 230000002068 genetic effect Effects 0.000 description 7
- 210000004185 liver Anatomy 0.000 description 7
- 239000002105 nanoparticle Substances 0.000 description 7
- 210000002569 neuron Anatomy 0.000 description 7
- 108091006106 transcriptional activators Proteins 0.000 description 7
- 230000002103 transcriptional effect Effects 0.000 description 7
- 108091006107 transcriptional repressors Proteins 0.000 description 7
- 102100032197 Alpha-crystallin A chain Human genes 0.000 description 6
- 102100026596 Bcl-2-like protein 1 Human genes 0.000 description 6
- 101150008012 Bcl2l1 gene Proteins 0.000 description 6
- 102100029375 Crk-like protein Human genes 0.000 description 6
- 102100026234 Cytokine receptor common subunit gamma Human genes 0.000 description 6
- 241000701022 Cytomegalovirus Species 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- 241000238631 Hexapoda Species 0.000 description 6
- 101000920937 Homo sapiens Alpha-crystallin A chain Proteins 0.000 description 6
- 101000834898 Homo sapiens Alpha-synuclein Proteins 0.000 description 6
- 101000919315 Homo sapiens Crk-like protein Proteins 0.000 description 6
- 101001055227 Homo sapiens Cytokine receptor common subunit gamma Proteins 0.000 description 6
- 101001043764 Homo sapiens Inhibitor of nuclear factor kappa-B kinase subunit alpha Proteins 0.000 description 6
- 101000852483 Homo sapiens Interleukin-1 receptor-associated kinase 1 Proteins 0.000 description 6
- 101001043594 Homo sapiens Low-density lipoprotein receptor-related protein 5 Proteins 0.000 description 6
- 101000973618 Homo sapiens NF-kappa-B essential modulator Proteins 0.000 description 6
- 101000979338 Homo sapiens Nuclear factor NF-kappa-B p100 subunit Proteins 0.000 description 6
- 101000979342 Homo sapiens Nuclear factor NF-kappa-B p105 subunit Proteins 0.000 description 6
- 101000669917 Homo sapiens Rho-associated protein kinase 1 Proteins 0.000 description 6
- 101000846198 Homo sapiens Ribitol 5-phosphate transferase FKRP Proteins 0.000 description 6
- 101000984753 Homo sapiens Serine/threonine-protein kinase B-raf Proteins 0.000 description 6
- 101000823316 Homo sapiens Tyrosine-protein kinase ABL1 Proteins 0.000 description 6
- 102000001284 I-kappa-B kinase Human genes 0.000 description 6
- 108060006678 I-kappa-B kinase Proteins 0.000 description 6
- 102100021892 Inhibitor of nuclear factor kappa-B kinase subunit alpha Human genes 0.000 description 6
- 102100036342 Interleukin-1 receptor-associated kinase 1 Human genes 0.000 description 6
- 102100021926 Low-density lipoprotein receptor-related protein 5 Human genes 0.000 description 6
- 102100022219 NF-kappa-B essential modulator Human genes 0.000 description 6
- 102100023059 Nuclear factor NF-kappa-B p100 subunit Human genes 0.000 description 6
- 102100023050 Nuclear factor NF-kappa-B p105 subunit Human genes 0.000 description 6
- 102100033819 Nuclear pore complex protein Nup214 Human genes 0.000 description 6
- 102100035832 Phakinin Human genes 0.000 description 6
- 102100039313 Rho-associated protein kinase 1 Human genes 0.000 description 6
- 102100031774 Ribitol 5-phosphate transferase FKRP Human genes 0.000 description 6
- 102100027103 Serine/threonine-protein kinase B-raf Human genes 0.000 description 6
- 102100022596 Tyrosine-protein kinase ABL1 Human genes 0.000 description 6
- 230000002159 abnormal effect Effects 0.000 description 6
- 125000000539 amino acid group Chemical group 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 108700000711 bcl-X Proteins 0.000 description 6
- 150000001875 compounds Chemical class 0.000 description 6
- 230000001419 dependent effect Effects 0.000 description 6
- 230000034431 double-strand break repair via homologous recombination Effects 0.000 description 6
- 238000001638 lipofection Methods 0.000 description 6
- 230000001404 mediated effect Effects 0.000 description 6
- 229920000642 polymer Polymers 0.000 description 6
- 230000001177 retroviral effect Effects 0.000 description 6
- 231100000419 toxicity Toxicity 0.000 description 6
- 230000001988 toxicity Effects 0.000 description 6
- 238000012546 transfer Methods 0.000 description 6
- 230000009261 transgenic effect Effects 0.000 description 6
- 238000013519 translation Methods 0.000 description 6
- 241000701447 unidentified baculovirus Species 0.000 description 6
- KCYOZNARADAZIZ-CWBQGUJCSA-N 2-[(2e,4e,6e,8e,10e,12e,14e)-15-(4,4,7a-trimethyl-2,5,6,7-tetrahydro-1-benzofuran-2-yl)-6,11-dimethylhexadeca-2,4,6,8,10,12,14-heptaen-2-yl]-4,4,7a-trimethyl-2,5,6,7-tetrahydro-1-benzofuran-6-ol Chemical compound O1C2(C)CC(O)CC(C)(C)C2=CC1C(\C)=C\C=C\C(\C)=C\C=C\C=C(/C)\C=C\C=C(/C)C1C=C2C(C)(C)CCCC2(C)O1 KCYOZNARADAZIZ-CWBQGUJCSA-N 0.000 description 5
- 102100022528 5'-AMP-activated protein kinase catalytic subunit alpha-1 Human genes 0.000 description 5
- 102100036009 5'-AMP-activated protein kinase catalytic subunit alpha-2 Human genes 0.000 description 5
- 239000013607 AAV vector Substances 0.000 description 5
- 241001634120 Adeno-associated virus - 5 Species 0.000 description 5
- 102100030685 Alpha-sarcoglycan Human genes 0.000 description 5
- 108091012583 BCL2 Proteins 0.000 description 5
- 102100025399 Breast cancer type 2 susceptibility protein Human genes 0.000 description 5
- 102100034357 Casein kinase I isoform alpha Human genes 0.000 description 5
- 108700010070 Codon Usage Proteins 0.000 description 5
- KCYOZNARADAZIZ-PPBBKLJYSA-N Cryptochrome Natural products O[C@@H]1CC(C)(C)C=2[C@@](C)(O[C@H](/C(=C\C=C\C(=C/C=C/C=C(\C=C\C=C(\C)/[C@H]3O[C@@]4(C)C(C(C)(C)CCC4)=C3)/C)\C)/C)C=2)C1 KCYOZNARADAZIZ-PPBBKLJYSA-N 0.000 description 5
- 108010037139 Cryptochromes Proteins 0.000 description 5
- 102100026359 Cyclic AMP-responsive element-binding protein 1 Human genes 0.000 description 5
- 108010024986 Cyclin-Dependent Kinase 2 Proteins 0.000 description 5
- 102100036239 Cyclin-dependent kinase 2 Human genes 0.000 description 5
- 102100024456 Cyclin-dependent kinase 8 Human genes 0.000 description 5
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 5
- 241000702421 Dependoparvovirus Species 0.000 description 5
- 102100028554 Dual specificity tyrosine-phosphorylation-regulated kinase 1A Human genes 0.000 description 5
- 241000588724 Escherichia coli Species 0.000 description 5
- 102100027581 Forkhead box protein P3 Human genes 0.000 description 5
- 102100023686 G protein-coupled receptor kinase 6 Human genes 0.000 description 5
- 102100024165 G1/S-specific cyclin-D1 Human genes 0.000 description 5
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 5
- 108010051975 Glycogen Synthase Kinase 3 beta Proteins 0.000 description 5
- 102100038104 Glycogen synthase kinase-3 beta Human genes 0.000 description 5
- 101000677993 Homo sapiens 5'-AMP-activated protein kinase catalytic subunit alpha-1 Proteins 0.000 description 5
- 101000783681 Homo sapiens 5'-AMP-activated protein kinase catalytic subunit alpha-2 Proteins 0.000 description 5
- 101000994700 Homo sapiens Casein kinase I isoform alpha Proteins 0.000 description 5
- 101000855516 Homo sapiens Cyclic AMP-responsive element-binding protein 1 Proteins 0.000 description 5
- 101000980937 Homo sapiens Cyclin-dependent kinase 8 Proteins 0.000 description 5
- 101000838016 Homo sapiens Dual specificity tyrosine-phosphorylation-regulated kinase 1A Proteins 0.000 description 5
- 101000861452 Homo sapiens Forkhead box protein P3 Proteins 0.000 description 5
- 101000829473 Homo sapiens G protein-coupled receptor kinase 6 Proteins 0.000 description 5
- 101000926535 Homo sapiens Interferon-induced, double-stranded RNA-activated protein kinase Proteins 0.000 description 5
- 101001064870 Homo sapiens Lon protease homolog, mitochondrial Proteins 0.000 description 5
- 101001005550 Homo sapiens Mitogen-activated protein kinase kinase kinase 14 Proteins 0.000 description 5
- 101000992283 Homo sapiens Optineurin Proteins 0.000 description 5
- 101001051777 Homo sapiens Protein kinase C alpha type Proteins 0.000 description 5
- 101000971468 Homo sapiens Protein kinase C zeta type Proteins 0.000 description 5
- 101000899806 Homo sapiens Retinal guanylyl cyclase 1 Proteins 0.000 description 5
- 101000987297 Homo sapiens Serine/threonine-protein kinase PAK 4 Proteins 0.000 description 5
- 101000595531 Homo sapiens Serine/threonine-protein kinase pim-1 Proteins 0.000 description 5
- 101000617130 Homo sapiens Stromal cell-derived factor 1 Proteins 0.000 description 5
- 102100021244 Integral membrane protein GPR180 Human genes 0.000 description 5
- 102100034170 Interferon-induced, double-stranded RNA-activated protein kinase Human genes 0.000 description 5
- 102100031955 Lon protease homolog, mitochondrial Human genes 0.000 description 5
- 101150083522 MECP2 gene Proteins 0.000 description 5
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 5
- 102100025211 Mitogen-activated protein kinase kinase kinase 14 Human genes 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- 102100031822 Optineurin Human genes 0.000 description 5
- 102100031014 Phosphatidylinositol-binding clathrin assembly protein Human genes 0.000 description 5
- 108700040121 Protein Methyltransferases Proteins 0.000 description 5
- 102000055027 Protein Methyltransferases Human genes 0.000 description 5
- 102100024924 Protein kinase C alpha type Human genes 0.000 description 5
- 102100021538 Protein kinase C zeta type Human genes 0.000 description 5
- 101150111584 RHOA gene Proteins 0.000 description 5
- 102100030706 Ras-related protein Rap-1A Human genes 0.000 description 5
- 102000018120 Recombinases Human genes 0.000 description 5
- 108010091086 Recombinases Proteins 0.000 description 5
- 102100022663 Retinal guanylyl cyclase 1 Human genes 0.000 description 5
- 102100027940 Serine/threonine-protein kinase PAK 4 Human genes 0.000 description 5
- 102100031463 Serine/threonine-protein kinase PLK1 Human genes 0.000 description 5
- 102100021669 Stromal cell-derived factor 1 Human genes 0.000 description 5
- 108020004566 Transfer RNA Proteins 0.000 description 5
- 102100022387 Transforming protein RhoA Human genes 0.000 description 5
- 102000008579 Transposases Human genes 0.000 description 5
- 108010020764 Transposases Proteins 0.000 description 5
- 102100040403 Tumor necrosis factor receptor superfamily member 6 Human genes 0.000 description 5
- 239000002671 adjuvant Substances 0.000 description 5
- 108010080146 androgen receptors Proteins 0.000 description 5
- 230000001580 bacterial effect Effects 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- KCYOZNARADAZIZ-XZOHMNSDSA-N beta-cryptochrome Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C1OC2(C)CC(O)CC(C)(C)C2=C1)C=CC=C(/C)C3OC4(C)CCCC(C)(C)C4=C3 KCYOZNARADAZIZ-XZOHMNSDSA-N 0.000 description 5
- 230000008859 change Effects 0.000 description 5
- 238000012217 deletion Methods 0.000 description 5
- 230000037430 deletion Effects 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 229910052739 hydrogen Inorganic materials 0.000 description 5
- 239000001257 hydrogen Substances 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 150000002632 lipids Chemical class 0.000 description 5
- 210000004962 mammalian cell Anatomy 0.000 description 5
- 239000011159 matrix material Substances 0.000 description 5
- 108010056274 polo-like kinase 1 Proteins 0.000 description 5
- 210000001236 prokaryotic cell Anatomy 0.000 description 5
- 108010036805 rap1 GTP-Binding Proteins Proteins 0.000 description 5
- 230000006798 recombination Effects 0.000 description 5
- 238000005215 recombination Methods 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 241001430294 unidentified retrovirus Species 0.000 description 5
- 102100037263 3-phosphoinositide-dependent protein kinase 1 Human genes 0.000 description 4
- 102100024378 AF4/FMR2 family member 2 Human genes 0.000 description 4
- 241001655883 Adeno-associated virus - 1 Species 0.000 description 4
- 241000702423 Adeno-associated virus - 2 Species 0.000 description 4
- 102100027211 Albumin Human genes 0.000 description 4
- 108010088751 Albumins Proteins 0.000 description 4
- 102100022704 Amyloid-beta precursor protein Human genes 0.000 description 4
- 102100030343 Antigen peptide transporter 2 Human genes 0.000 description 4
- 102100029388 Beta-crystallin B2 Human genes 0.000 description 4
- 102100032367 C-C motif chemokine 5 Human genes 0.000 description 4
- 102100026548 Caspase-8 Human genes 0.000 description 4
- 102100028914 Catenin beta-1 Human genes 0.000 description 4
- 102100040496 Collagen alpha-2(VIII) chain Human genes 0.000 description 4
- 102100023580 Cyclic AMP-dependent transcription factor ATF-4 Human genes 0.000 description 4
- 108010058546 Cyclin D1 Proteins 0.000 description 4
- 102100027417 Cytochrome P450 1B1 Human genes 0.000 description 4
- 101150046567 DAO gene Proteins 0.000 description 4
- 101710096438 DNA-binding protein Proteins 0.000 description 4
- 102100038694 DNA-binding protein SMUBP-2 Human genes 0.000 description 4
- 101100457345 Danio rerio mapk14a gene Proteins 0.000 description 4
- 101100457347 Danio rerio mapk14b gene Proteins 0.000 description 4
- 102100032057 ETS domain-containing protein Elk-1 Human genes 0.000 description 4
- 102100031690 Erythroid transcription factor Human genes 0.000 description 4
- 102100027813 Gamma-crystallin C Human genes 0.000 description 4
- 102100027812 Gamma-crystallin D Human genes 0.000 description 4
- 102100021792 Gamma-sarcoglycan Human genes 0.000 description 4
- 102000005720 Glutathione transferase Human genes 0.000 description 4
- 108010070675 Glutathione transferase Proteins 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 102100034047 Heat shock factor protein 4 Human genes 0.000 description 4
- 101000600756 Homo sapiens 3-phosphoinositide-dependent protein kinase 1 Proteins 0.000 description 4
- 101000703500 Homo sapiens Alpha-sarcoglycan Proteins 0.000 description 4
- 101000823051 Homo sapiens Amyloid-beta precursor protein Proteins 0.000 description 4
- 101000919250 Homo sapiens Beta-crystallin B2 Proteins 0.000 description 4
- 101000797762 Homo sapiens C-C motif chemokine 5 Proteins 0.000 description 4
- 101000983528 Homo sapiens Caspase-8 Proteins 0.000 description 4
- 101000916173 Homo sapiens Catenin beta-1 Proteins 0.000 description 4
- 101000749886 Homo sapiens Collagen alpha-2(VIII) chain Proteins 0.000 description 4
- 101000905743 Homo sapiens Cyclic AMP-dependent transcription factor ATF-4 Proteins 0.000 description 4
- 101000725164 Homo sapiens Cytochrome P450 1B1 Proteins 0.000 description 4
- 101000619542 Homo sapiens E3 ubiquitin-protein ligase parkin Proteins 0.000 description 4
- 101000859938 Homo sapiens Gamma-crystallin C Proteins 0.000 description 4
- 101000859943 Homo sapiens Gamma-crystallin D Proteins 0.000 description 4
- 101000616435 Homo sapiens Gamma-sarcoglycan Proteins 0.000 description 4
- 101001016879 Homo sapiens Heat shock factor protein 4 Proteins 0.000 description 4
- 101001048956 Homo sapiens Homeobox protein EMX1 Proteins 0.000 description 4
- 101000852815 Homo sapiens Insulin receptor Proteins 0.000 description 4
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 description 4
- 101000945351 Homo sapiens Killer cell immunoglobulin-like receptor 3DL1 Proteins 0.000 description 4
- 101000628968 Homo sapiens Mitogen-activated protein kinase 13 Proteins 0.000 description 4
- 101000996563 Homo sapiens Nuclear pore complex protein Nup214 Proteins 0.000 description 4
- 101000617536 Homo sapiens Presenilin-1 Proteins 0.000 description 4
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 4
- 101000669921 Homo sapiens Rho-associated protein kinase 2 Proteins 0.000 description 4
- 101000623857 Homo sapiens Serine/threonine-protein kinase mTOR Proteins 0.000 description 4
- 101000617738 Homo sapiens Survival motor neuron protein Proteins 0.000 description 4
- 101000645320 Homo sapiens Titin Proteins 0.000 description 4
- 101000708741 Homo sapiens Transcription factor RelB Proteins 0.000 description 4
- 101000894525 Homo sapiens Transforming growth factor-beta-induced protein ig-h3 Proteins 0.000 description 4
- 101000611023 Homo sapiens Tumor necrosis factor receptor superfamily member 6 Proteins 0.000 description 4
- 101000997832 Homo sapiens Tyrosine-protein kinase JAK2 Proteins 0.000 description 4
- 101000671676 Homo sapiens U3 small nucleolar RNA-associated protein 4 homolog Proteins 0.000 description 4
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 4
- 108090000174 Interleukin-10 Proteins 0.000 description 4
- 102000013691 Interleukin-17 Human genes 0.000 description 4
- 108050003558 Interleukin-17 Proteins 0.000 description 4
- 108090001005 Interleukin-6 Proteins 0.000 description 4
- 208000027747 Kennedy disease Diseases 0.000 description 4
- 102100033627 Killer cell immunoglobulin-like receptor 3DL1 Human genes 0.000 description 4
- 108700012928 MAPK14 Proteins 0.000 description 4
- 101150003941 Mapk14 gene Proteins 0.000 description 4
- 102100026930 Mitogen-activated protein kinase 13 Human genes 0.000 description 4
- 102000054819 Mitogen-activated protein kinase 14 Human genes 0.000 description 4
- 101710203761 Neurexin-1 Proteins 0.000 description 4
- 102100021582 Neurexin-1-beta Human genes 0.000 description 4
- 102100029441 Nucleotide-binding oligomerization domain-containing protein 2 Human genes 0.000 description 4
- 102100037499 Parkinson disease protein 7 Human genes 0.000 description 4
- 102100040375 Peripherin-2 Human genes 0.000 description 4
- 108090000709 Phakinin Proteins 0.000 description 4
- 101710163352 Potassium voltage-gated channel subfamily H member 4 Proteins 0.000 description 4
- 102100022033 Presenilin-1 Human genes 0.000 description 4
- 108010032428 Protein Deglycase DJ-1 Proteins 0.000 description 4
- 102100039314 Rho-associated protein kinase 2 Human genes 0.000 description 4
- 108010017324 STAT3 Transcription Factor Proteins 0.000 description 4
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 4
- 102100037310 Serine/threonine-protein kinase D1 Human genes 0.000 description 4
- 102100023085 Serine/threonine-protein kinase mTOR Human genes 0.000 description 4
- 102100024040 Signal transducer and activator of transcription 3 Human genes 0.000 description 4
- 241000194020 Streptococcus thermophilus Species 0.000 description 4
- 102100021947 Survival motor neuron protein Human genes 0.000 description 4
- 102100040296 TATA-box-binding protein Human genes 0.000 description 4
- 102100026260 Titin Human genes 0.000 description 4
- 102100032727 Transcription factor RelB Human genes 0.000 description 4
- 102100021398 Transforming growth factor-beta-induced protein ig-h3 Human genes 0.000 description 4
- 102100033444 Tyrosine-protein kinase JAK2 Human genes 0.000 description 4
- 102100040072 U3 small nucleolar RNA-associated protein 4 homolog Human genes 0.000 description 4
- 241000700618 Vaccinia virus Species 0.000 description 4
- 208000023940 X-Linked Combined Immunodeficiency disease Diseases 0.000 description 4
- 239000000427 antigen Substances 0.000 description 4
- 108091007433 antigens Proteins 0.000 description 4
- 102000036639 antigens Human genes 0.000 description 4
- 229960002685 biotin Drugs 0.000 description 4
- 239000011616 biotin Substances 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 238000004590 computer program Methods 0.000 description 4
- 230000001973 epigenetic effect Effects 0.000 description 4
- 239000000499 gel Substances 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 210000001161 mammalian embryo Anatomy 0.000 description 4
- 230000011987 methylation Effects 0.000 description 4
- 238000007069 methylation reaction Methods 0.000 description 4
- 239000002679 microRNA Substances 0.000 description 4
- 230000006780 non-homologous end joining Effects 0.000 description 4
- 108091008581 nuclear androgen receptors Proteins 0.000 description 4
- 230000003287 optical effect Effects 0.000 description 4
- 230000037361 pathway Effects 0.000 description 4
- 229920002401 polyacrylamide Polymers 0.000 description 4
- 108020001580 protein domains Proteins 0.000 description 4
- 102000005962 receptors Human genes 0.000 description 4
- 108020003175 receptors Proteins 0.000 description 4
- 238000003259 recombinant expression Methods 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 239000000758 substrate Substances 0.000 description 4
- 241001529453 unidentified herpesvirus Species 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- 238000001262 western blot Methods 0.000 description 4
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 3
- 241000580270 Adeno-associated virus - 4 Species 0.000 description 3
- 102100032959 Alpha-actinin-4 Human genes 0.000 description 3
- 102100030988 Angiotensin-converting enzyme Human genes 0.000 description 3
- 108700020462 BRCA2 Proteins 0.000 description 3
- 201000006935 Becker muscular dystrophy Diseases 0.000 description 3
- 101150008921 Brca2 gene Proteins 0.000 description 3
- 102100031650 C-X-C chemokine receptor type 4 Human genes 0.000 description 3
- 102100032937 CD40 ligand Human genes 0.000 description 3
- 102100029398 Calpain small subunit 1 Human genes 0.000 description 3
- 102100025172 Calpain-1 catalytic subunit Human genes 0.000 description 3
- 102100032537 Calpain-2 catalytic subunit Human genes 0.000 description 3
- 108090000397 Caspase 3 Proteins 0.000 description 3
- 102100029855 Caspase-3 Human genes 0.000 description 3
- 102100026550 Caspase-9 Human genes 0.000 description 3
- 102100026735 Coagulation factor VIII Human genes 0.000 description 3
- 102000004360 Cofilin 1 Human genes 0.000 description 3
- 108090000996 Cofilin 1 Proteins 0.000 description 3
- 102100029362 Cone-rod homeobox protein Human genes 0.000 description 3
- 108010016788 Cyclin-Dependent Kinase Inhibitor p21 Proteins 0.000 description 3
- 102100033270 Cyclin-dependent kinase inhibitor 1 Human genes 0.000 description 3
- 102000053602 DNA Human genes 0.000 description 3
- 101710177611 DNA polymerase II large subunit Proteins 0.000 description 3
- 101710184669 DNA polymerase II small subunit Proteins 0.000 description 3
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 3
- 102100021790 Delta-sarcoglycan Human genes 0.000 description 3
- 206010013801 Duchenne Muscular Dystrophy Diseases 0.000 description 3
- 102100029503 E3 ubiquitin-protein ligase TRIM32 Human genes 0.000 description 3
- 102100022207 E3 ubiquitin-protein ligase parkin Human genes 0.000 description 3
- 102000001301 EGF receptor Human genes 0.000 description 3
- 108060006698 EGF receptor Proteins 0.000 description 3
- 102100032053 Elongation of very long chain fatty acids protein 4 Human genes 0.000 description 3
- 102000005233 Eukaryotic Initiation Factor-4E Human genes 0.000 description 3
- 108060002636 Eukaryotic Initiation Factor-4E Proteins 0.000 description 3
- 102100027280 Fanconi anemia group A protein Human genes 0.000 description 3
- 102100027285 Fanconi anemia group B protein Human genes 0.000 description 3
- 102100034553 Fanconi anemia group J protein Human genes 0.000 description 3
- 102100036334 Fragile X mental retardation syndrome-related protein 1 Human genes 0.000 description 3
- 102100036336 Fragile X mental retardation syndrome-related protein 2 Human genes 0.000 description 3
- 208000036357 GUCY2D-related recessive retinopathy Diseases 0.000 description 3
- 102100030526 Gap junction alpha-3 protein Human genes 0.000 description 3
- 102100025283 Gap junction alpha-8 protein Human genes 0.000 description 3
- 102100033417 Glucocorticoid receptor Human genes 0.000 description 3
- 102100021223 Glucosidase 2 subunit beta Human genes 0.000 description 3
- 102100022975 Glycogen synthase kinase-3 alpha Human genes 0.000 description 3
- 102100032191 Guanine nucleotide exchange factor VAV3 Human genes 0.000 description 3
- 102100025334 Guanine nucleotide-binding protein G(q) subunit alpha Human genes 0.000 description 3
- 102100028685 H(+)/Cl(-) exchange transporter 7 Human genes 0.000 description 3
- 102100021519 Hemoglobin subunit beta Human genes 0.000 description 3
- 102100022057 Hepatocyte nuclear factor 1-alpha Human genes 0.000 description 3
- 102100038885 Histone acetyltransferase p300 Human genes 0.000 description 3
- 102100023823 Homeobox protein EMX1 Human genes 0.000 description 3
- 101000833172 Homo sapiens AF4/FMR2 family member 2 Proteins 0.000 description 3
- 101000824278 Homo sapiens Acyl-[acyl-carrier-protein] hydrolase Proteins 0.000 description 3
- 101000797282 Homo sapiens Alpha-actinin-4 Proteins 0.000 description 3
- 101000934858 Homo sapiens Breast cancer type 2 susceptibility protein Proteins 0.000 description 3
- 101000922348 Homo sapiens C-X-C chemokine receptor type 4 Proteins 0.000 description 3
- 101000868215 Homo sapiens CD40 ligand Proteins 0.000 description 3
- 101000919194 Homo sapiens Calpain small subunit 1 Proteins 0.000 description 3
- 101000934069 Homo sapiens Calpain-1 catalytic subunit Proteins 0.000 description 3
- 101000867692 Homo sapiens Calpain-2 catalytic subunit Proteins 0.000 description 3
- 101000983523 Homo sapiens Caspase-9 Proteins 0.000 description 3
- 101000911390 Homo sapiens Coagulation factor VIII Proteins 0.000 description 3
- 101000919370 Homo sapiens Cone-rod homeobox protein Proteins 0.000 description 3
- 101000665135 Homo sapiens DNA-binding protein SMUBP-2 Proteins 0.000 description 3
- 101000616408 Homo sapiens Delta-sarcoglycan Proteins 0.000 description 3
- 101000722054 Homo sapiens Dynamin-like 120 kDa protein, mitochondrial Proteins 0.000 description 3
- 101000634982 Homo sapiens E3 ubiquitin-protein ligase TRIM32 Proteins 0.000 description 3
- 101000921354 Homo sapiens Elongation of very long chain fatty acids protein 4 Proteins 0.000 description 3
- 101001066268 Homo sapiens Erythroid transcription factor Proteins 0.000 description 3
- 101000914679 Homo sapiens Fanconi anemia group B protein Proteins 0.000 description 3
- 101000891683 Homo sapiens Fanconi anemia group D2 protein Proteins 0.000 description 3
- 101000848171 Homo sapiens Fanconi anemia group J protein Proteins 0.000 description 3
- 101000930945 Homo sapiens Fragile X mental retardation syndrome-related protein 1 Proteins 0.000 description 3
- 101000930952 Homo sapiens Fragile X mental retardation syndrome-related protein 2 Proteins 0.000 description 3
- 101001040875 Homo sapiens Glucosidase 2 subunit beta Proteins 0.000 description 3
- 101000903717 Homo sapiens Glycogen synthase kinase-3 alpha Proteins 0.000 description 3
- 101000775742 Homo sapiens Guanine nucleotide exchange factor VAV3 Proteins 0.000 description 3
- 101000857888 Homo sapiens Guanine nucleotide-binding protein G(q) subunit alpha Proteins 0.000 description 3
- 101000766971 Homo sapiens H(+)/Cl(-) exchange transporter 7 Proteins 0.000 description 3
- 101001045751 Homo sapiens Hepatocyte nuclear factor 1-alpha Proteins 0.000 description 3
- 101000677891 Homo sapiens Iron-sulfur clusters transporter ABCB7, mitochondrial Proteins 0.000 description 3
- 101000614618 Homo sapiens Junctophilin-3 Proteins 0.000 description 3
- 101001055092 Homo sapiens Mitogen-activated protein kinase kinase kinase 7 Proteins 0.000 description 3
- 101000585663 Homo sapiens Myocilin Proteins 0.000 description 3
- 101000973778 Homo sapiens NAD(P)H dehydrogenase [quinone] 1 Proteins 0.000 description 3
- 101001109698 Homo sapiens Nuclear receptor subfamily 4 group A member 2 Proteins 0.000 description 3
- 101000610652 Homo sapiens Peripherin-2 Proteins 0.000 description 3
- 101000583474 Homo sapiens Phosphatidylinositol-binding clathrin assembly protein Proteins 0.000 description 3
- 101000617546 Homo sapiens Presenilin-2 Proteins 0.000 description 3
- 101000720958 Homo sapiens Protein artemis Proteins 0.000 description 3
- 101000971404 Homo sapiens Protein kinase C iota type Proteins 0.000 description 3
- 101000932478 Homo sapiens Receptor-type tyrosine-protein kinase FLT3 Proteins 0.000 description 3
- 101000927774 Homo sapiens Rho guanine nucleotide exchange factor 12 Proteins 0.000 description 3
- 101001051706 Homo sapiens Ribosomal protein S6 kinase beta-1 Proteins 0.000 description 3
- 101001026870 Homo sapiens Serine/threonine-protein kinase D1 Proteins 0.000 description 3
- 101000605835 Homo sapiens Serine/threonine-protein kinase PINK1, mitochondrial Proteins 0.000 description 3
- 101001095368 Homo sapiens Serine/threonine-protein phosphatase PP1-gamma catalytic subunit Proteins 0.000 description 3
- 101000597193 Homo sapiens Telethonin Proteins 0.000 description 3
- 101000854875 Homo sapiens V-type proton ATPase 116 kDa subunit a 3 Proteins 0.000 description 3
- 101000854936 Homo sapiens Visual system homeobox 1 Proteins 0.000 description 3
- 241000725303 Human immunodeficiency virus Species 0.000 description 3
- 208000023105 Huntington disease Diseases 0.000 description 3
- 206010061218 Inflammation Diseases 0.000 description 3
- 102000003814 Interleukin-10 Human genes 0.000 description 3
- 108091092195 Intron Proteins 0.000 description 3
- 102100021504 Iron-sulfur clusters transporter ABCB7, mitochondrial Human genes 0.000 description 3
- 102100040488 Junctophilin-3 Human genes 0.000 description 3
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 3
- 241000713666 Lentivirus Species 0.000 description 3
- 108010020246 Leucine-Rich Repeat Serine-Threonine Protein Kinase-2 Proteins 0.000 description 3
- 102100032693 Leucine-rich repeat serine/threonine-protein kinase 2 Human genes 0.000 description 3
- 108060001084 Luciferase Proteins 0.000 description 3
- 239000005089 Luciferase Substances 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 102100026888 Mitogen-activated protein kinase kinase kinase 7 Human genes 0.000 description 3
- 102100029839 Myocilin Human genes 0.000 description 3
- 102100022365 NAD(P)H dehydrogenase [quinone] 1 Human genes 0.000 description 3
- 206010028980 Neoplasm Diseases 0.000 description 3
- 102100022676 Nuclear receptor subfamily 4 group A member 2 Human genes 0.000 description 3
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 3
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- 108010043958 Peptoids Proteins 0.000 description 3
- 102100030477 Plectin Human genes 0.000 description 3
- 102100022036 Presenilin-2 Human genes 0.000 description 3
- 102100025918 Protein artemis Human genes 0.000 description 3
- 102100021557 Protein kinase C iota type Human genes 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- 102100025234 Receptor of activated protein C kinase 1 Human genes 0.000 description 3
- 102100020718 Receptor-type tyrosine-protein kinase FLT3 Human genes 0.000 description 3
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 3
- 108010044157 Receptors for Activated C Kinase Proteins 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- 102100033193 Rho guanine nucleotide exchange factor 12 Human genes 0.000 description 3
- 102100024908 Ribosomal protein S6 kinase beta-1 Human genes 0.000 description 3
- 241000714474 Rous sarcoma virus Species 0.000 description 3
- 102100025373 Runt-related transcription factor 1 Human genes 0.000 description 3
- 102100023781 Selenoprotein N Human genes 0.000 description 3
- 102100038376 Serine/threonine-protein kinase PINK1, mitochondrial Human genes 0.000 description 3
- 102100037761 Serine/threonine-protein phosphatase PP1-gamma catalytic subunit Human genes 0.000 description 3
- 241000700584 Simplexvirus Species 0.000 description 3
- 101000910045 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) CRISPR-associated endonuclease Cas9 2 Proteins 0.000 description 3
- 102100040365 T-cell acute lymphocytic leukemia protein 1 Human genes 0.000 description 3
- 102100035155 Telethonin Human genes 0.000 description 3
- 102100027212 Tumor-associated calcium signal transducer 2 Human genes 0.000 description 3
- 102100037111 Uracil-DNA glycosylase Human genes 0.000 description 3
- 102100020738 V-type proton ATPase 116 kDa subunit a 3 Human genes 0.000 description 3
- 102100021164 Vasodilator-stimulated phosphoprotein Human genes 0.000 description 3
- 102100020673 Visual system homeobox 1 Human genes 0.000 description 3
- 101150115477 Vldlr gene Proteins 0.000 description 3
- 238000009825 accumulation Methods 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 230000000692 anti-sense effect Effects 0.000 description 3
- 108010005774 beta-Galactosidase Proteins 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 230000008499 blood brain barrier function Effects 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 210000000234 capsid Anatomy 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 208000037765 diseases and disorders Diseases 0.000 description 3
- 230000005782 double-strand break Effects 0.000 description 3
- 239000000975 dye Substances 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 210000002950 fibroblast Anatomy 0.000 description 3
- ZXQYGBMAQZUVMI-GCMPRSNUSA-N gamma-cyhalothrin Chemical compound CC1(C)[C@@H](\C=C(/Cl)C(F)(F)F)[C@H]1C(=O)O[C@H](C#N)C1=CC=CC(OC=2C=CC=CC=2)=C1 ZXQYGBMAQZUVMI-GCMPRSNUSA-N 0.000 description 3
- 230000007614 genetic variation Effects 0.000 description 3
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 3
- 238000002744 homologous recombination Methods 0.000 description 3
- 230000006801 homologous recombination Effects 0.000 description 3
- 102000047882 human INSR Human genes 0.000 description 3
- 230000003308 immunostimulating effect Effects 0.000 description 3
- 230000004054 inflammatory process Effects 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 210000004779 membrane envelope Anatomy 0.000 description 3
- 238000000520 microinjection Methods 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 230000001537 neural effect Effects 0.000 description 3
- 108091027963 non-coding RNA Proteins 0.000 description 3
- 102000042567 non-coding RNA Human genes 0.000 description 3
- 239000002853 nucleic acid probe Substances 0.000 description 3
- 229960003104 ornithine Drugs 0.000 description 3
- 108010079892 phosphoglycerol kinase Proteins 0.000 description 3
- 230000004481 post-translational protein modification Effects 0.000 description 3
- 230000008439 repair process Effects 0.000 description 3
- 230000003252 repetitive effect Effects 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 208000002491 severe combined immunodeficiency Diseases 0.000 description 3
- 210000004895 subcellular structure Anatomy 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 108010054220 vasodilator-stimulated phosphoprotein Proteins 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 102100040685 14-3-3 protein zeta/delta Human genes 0.000 description 2
- WRMNZCZEMHIOCP-UHFFFAOYSA-N 2-phenylethanol Chemical compound OCCC1=CC=CC=C1 WRMNZCZEMHIOCP-UHFFFAOYSA-N 0.000 description 2
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 2
- 102100033051 40S ribosomal protein S19 Human genes 0.000 description 2
- 102100031020 5-aminolevulinate synthase, erythroid-specific, mitochondrial Human genes 0.000 description 2
- 108091007504 ADAM10 Proteins 0.000 description 2
- 102100028446 ADP-ribosylation factor-like protein 11 Human genes 0.000 description 2
- 108010085238 Actins Proteins 0.000 description 2
- 241001164825 Adeno-associated virus - 8 Species 0.000 description 2
- 102100040743 Alpha-crystallin B chain Human genes 0.000 description 2
- 102100034452 Alternative prion protein Human genes 0.000 description 2
- 208000024827 Alzheimer disease Diseases 0.000 description 2
- 102100020895 Ammonium transporter Rh type A Human genes 0.000 description 2
- 108091093088 Amplicon Proteins 0.000 description 2
- 102100040894 Amylo-alpha-1,6-glucosidase Human genes 0.000 description 2
- 102000002659 Amyloid Precursor Protein Secretases Human genes 0.000 description 2
- 108010043324 Amyloid Precursor Protein Secretases Proteins 0.000 description 2
- 102100036438 Amyloid beta precursor protein binding family B member 2 Human genes 0.000 description 2
- 102100033715 Apolipoprotein A-I Human genes 0.000 description 2
- 102100029470 Apolipoprotein E Human genes 0.000 description 2
- 102100034524 Apoptotic protease-activating factor 1 Human genes 0.000 description 2
- 102000004888 Aquaporin 1 Human genes 0.000 description 2
- 108090001004 Aquaporin 1 Proteins 0.000 description 2
- 102100024081 Aryl-hydrocarbon-interacting protein-like 1 Human genes 0.000 description 2
- 206010003591 Ataxia Diseases 0.000 description 2
- 102000007372 Ataxin-1 Human genes 0.000 description 2
- 108010032963 Ataxin-1 Proteins 0.000 description 2
- 102000002785 Ataxin-10 Human genes 0.000 description 2
- 102100021321 Ataxin-3 Human genes 0.000 description 2
- 102000007368 Ataxin-7 Human genes 0.000 description 2
- 108010032953 Ataxin-7 Proteins 0.000 description 2
- 102000007370 Ataxin2 Human genes 0.000 description 2
- 108010032951 Ataxin2 Proteins 0.000 description 2
- 101150025446 Atn1 gene Proteins 0.000 description 2
- 102100020741 Atrophin-1 Human genes 0.000 description 2
- 108090000806 Atrophin-1 Proteins 0.000 description 2
- 101150070808 Atxn10 gene Proteins 0.000 description 2
- 206010003805 Autism Diseases 0.000 description 2
- 208000020706 Autistic disease Diseases 0.000 description 2
- 102100035682 Axin-1 Human genes 0.000 description 2
- 102100021630 B-cell CLL/lymphoma 7 protein family member A Human genes 0.000 description 2
- 102000036365 BRCA1 Human genes 0.000 description 2
- 108700020463 BRCA1 Proteins 0.000 description 2
- 101150072950 BRCA1 gene Proteins 0.000 description 2
- 101150017888 Bcl2 gene Proteins 0.000 description 2
- 208000037663 Best vitelliform macular dystrophy Diseases 0.000 description 2
- 102100029334 Beta-crystallin A3 Human genes 0.000 description 2
- 102100026189 Beta-galactosidase Human genes 0.000 description 2
- 102100030686 Beta-sarcoglycan Human genes 0.000 description 2
- 102100027058 Bleomycin hydrolase Human genes 0.000 description 2
- 208000029402 Bulbospinal muscular atrophy Diseases 0.000 description 2
- 102100031151 C-C chemokine receptor type 2 Human genes 0.000 description 2
- 102100034808 CCAAT/enhancer-binding protein alpha Human genes 0.000 description 2
- 102100034798 CCAAT/enhancer-binding protein beta Human genes 0.000 description 2
- 101150052909 CCL2 gene Proteins 0.000 description 2
- 101150083327 CCR2 gene Proteins 0.000 description 2
- 208000032325 CEBPE-associated autoinflammation-immunodeficiency-neutrophil dysfunction syndrome Diseases 0.000 description 2
- 102100021975 CREB-binding protein Human genes 0.000 description 2
- 238000010356 CRISPR-Cas9 genome editing Methods 0.000 description 2
- 101150062345 CX3CR1 gene Proteins 0.000 description 2
- 102100033093 Calcium/calmodulin-dependent protein kinase type II subunit alpha Human genes 0.000 description 2
- 101000909256 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) DNA polymerase I Proteins 0.000 description 2
- 102100032539 Calpain-3 Human genes 0.000 description 2
- 102100032616 Caspase-2 Human genes 0.000 description 2
- 108020002739 Catechol O-methyltransferase Proteins 0.000 description 2
- 102100040999 Catechol O-methyltransferase Human genes 0.000 description 2
- 102100037182 Cation-independent mannose-6-phosphate receptor Human genes 0.000 description 2
- 102100032212 Caveolin-3 Human genes 0.000 description 2
- 108010075016 Ceruloplasmin Proteins 0.000 description 2
- 102100023321 Ceruloplasmin Human genes 0.000 description 2
- 108010035563 Chloramphenicol O-acetyltransferase Proteins 0.000 description 2
- 108010077544 Chromatin Proteins 0.000 description 2
- 102100029057 Coagulation factor XIII A chain Human genes 0.000 description 2
- 101710137249 Complexin-1 Proteins 0.000 description 2
- 102100027826 Complexin-1 Human genes 0.000 description 2
- 108091028732 Concatemer Proteins 0.000 description 2
- 101150092474 Cplx1 gene Proteins 0.000 description 2
- 101150030419 Cx3cl1 gene Proteins 0.000 description 2
- 102000000577 Cyclin-Dependent Kinase Inhibitor p27 Human genes 0.000 description 2
- 108010016777 Cyclin-Dependent Kinase Inhibitor p27 Proteins 0.000 description 2
- 102100034746 Cyclin-dependent kinase-like 5 Human genes 0.000 description 2
- 102100030299 Cysteine-rich hydrophobic domain-containing protein 2 Human genes 0.000 description 2
- 102100023419 Cystic fibrosis transmembrane conductance regulator Human genes 0.000 description 2
- 102100028717 Cytosolic 5'-nucleotidase 3A Human genes 0.000 description 2
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 2
- 102100039693 D-amino acid oxidase activator Human genes 0.000 description 2
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 2
- 102100037799 DNA-binding protein Ikaros Human genes 0.000 description 2
- 102100020986 DNA-binding protein RFX5 Human genes 0.000 description 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 2
- 101150110160 DRD1 gene Proteins 0.000 description 2
- 201000008163 Dentatorubral pallidoluysian atrophy Diseases 0.000 description 2
- 102100022317 Dihydropteridine reductase Human genes 0.000 description 2
- 102100039673 Disintegrin and metalloproteinase domain-containing protein 10 Human genes 0.000 description 2
- 108010044266 Dopamine Plasma Membrane Transport Proteins Proteins 0.000 description 2
- 102100025327 Dynamin-like 120 kDa protein, mitochondrial Human genes 0.000 description 2
- 108010045061 Dysbindin Proteins 0.000 description 2
- 102000005611 Dysbindin Human genes 0.000 description 2
- 102100032248 Dysferlin Human genes 0.000 description 2
- 102100034546 E3 ubiquitin-protein ligase FANCL Human genes 0.000 description 2
- 108700041152 Endoplasmic Reticulum Chaperone BiP Proteins 0.000 description 2
- 102100021451 Endoplasmic reticulum chaperone BiP Human genes 0.000 description 2
- 102100021601 Ephrin type-A receptor 8 Human genes 0.000 description 2
- 102100038595 Estrogen receptor Human genes 0.000 description 2
- 102100022466 Eukaryotic translation initiation factor 4E-binding protein 1 Human genes 0.000 description 2
- 108700024394 Exon Proteins 0.000 description 2
- 102100020903 Ezrin Human genes 0.000 description 2
- 108010033305 Fanconi Anemia Complementation Group G protein Proteins 0.000 description 2
- 102100034555 Fanconi anemia group G protein Human genes 0.000 description 2
- 102100034552 Fanconi anemia group M protein Human genes 0.000 description 2
- 102100032596 Fibrocystin Human genes 0.000 description 2
- 108010009306 Forkhead Box Protein O1 Proteins 0.000 description 2
- 102100035427 Forkhead box protein O1 Human genes 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- 208000001914 Fragile X syndrome Diseases 0.000 description 2
- 102000003869 Frataxin Human genes 0.000 description 2
- 108090000217 Frataxin Proteins 0.000 description 2
- 101150106478 GPS1 gene Proteins 0.000 description 2
- 102000001267 GSK3 Human genes 0.000 description 2
- 108060006662 GSK3 Proteins 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 241000713813 Gibbon ape leukemia virus Species 0.000 description 2
- 102100036264 Glucose-6-phosphatase catalytic subunit 1 Human genes 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 102100036589 Glycine-tRNA ligase Human genes 0.000 description 2
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 2
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 2
- 101150087728 Grm5 gene Proteins 0.000 description 2
- 102100032610 Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas Human genes 0.000 description 2
- 101150112743 HSPA5 gene Proteins 0.000 description 2
- 102100034051 Heat shock protein HSP 90-alpha Human genes 0.000 description 2
- 101710154606 Hemagglutinin Proteins 0.000 description 2
- 102100027685 Hemoglobin subunit alpha Human genes 0.000 description 2
- 102100022846 Histone acetyltransferase KAT2B Human genes 0.000 description 2
- 102100029235 Histone-lysine N-methyltransferase NSD3 Human genes 0.000 description 2
- 102100021086 Homeobox protein Hox-D4 Human genes 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000964898 Homo sapiens 14-3-3 protein zeta/delta Proteins 0.000 description 2
- 101000733040 Homo sapiens 40S ribosomal protein S19 Proteins 0.000 description 2
- 101000769457 Homo sapiens ADP-ribosylation factor-like protein 11 Proteins 0.000 description 2
- 101000891982 Homo sapiens Alpha-crystallin B chain Proteins 0.000 description 2
- 101001075525 Homo sapiens Ammonium transporter Rh type A Proteins 0.000 description 2
- 101000893559 Homo sapiens Amylo-alpha-1,6-glucosidase Proteins 0.000 description 2
- 101000928680 Homo sapiens Amyloid beta precursor protein binding family B member 2 Proteins 0.000 description 2
- 101000652582 Homo sapiens Antigen peptide transporter 2 Proteins 0.000 description 2
- 101000733802 Homo sapiens Apolipoprotein A-I Proteins 0.000 description 2
- 101000924629 Homo sapiens Apoptotic protease-activating factor 1 Proteins 0.000 description 2
- 101000833576 Homo sapiens Aryl-hydrocarbon-interacting protein-like 1 Proteins 0.000 description 2
- 101000895100 Homo sapiens Ataxin-3 Proteins 0.000 description 2
- 101000971230 Homo sapiens B-cell CLL/lymphoma 7 protein family member A Proteins 0.000 description 2
- 101000919139 Homo sapiens Beta-crystallin A3 Proteins 0.000 description 2
- 101000703495 Homo sapiens Beta-sarcoglycan Proteins 0.000 description 2
- 101000945515 Homo sapiens CCAAT/enhancer-binding protein alpha Proteins 0.000 description 2
- 101000945963 Homo sapiens CCAAT/enhancer-binding protein beta Proteins 0.000 description 2
- 101000896987 Homo sapiens CREB-binding protein Proteins 0.000 description 2
- 101000944249 Homo sapiens Calcium/calmodulin-dependent protein kinase type II subunit alpha Proteins 0.000 description 2
- 101000867715 Homo sapiens Calpain-3 Proteins 0.000 description 2
- 101000867612 Homo sapiens Caspase-2 Proteins 0.000 description 2
- 101001028831 Homo sapiens Cation-independent mannose-6-phosphate receptor Proteins 0.000 description 2
- 101000869042 Homo sapiens Caveolin-3 Proteins 0.000 description 2
- 101000918352 Homo sapiens Coagulation factor XIII A chain Proteins 0.000 description 2
- 101000945692 Homo sapiens Cyclin-dependent kinase-like 5 Proteins 0.000 description 2
- 101000991100 Homo sapiens Cysteine-rich hydrophobic domain-containing protein 2 Proteins 0.000 description 2
- 101000907783 Homo sapiens Cystic fibrosis transmembrane conductance regulator Proteins 0.000 description 2
- 101000915170 Homo sapiens Cytosolic 5'-nucleotidase 3A Proteins 0.000 description 2
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 2
- 101000886242 Homo sapiens D-amino acid oxidase activator Proteins 0.000 description 2
- 101001075432 Homo sapiens DNA-binding protein RFX5 Proteins 0.000 description 2
- 101001016184 Homo sapiens Dysferlin Proteins 0.000 description 2
- 101000898676 Homo sapiens Ephrin type-A receptor 8 Proteins 0.000 description 2
- 101000882584 Homo sapiens Estrogen receptor Proteins 0.000 description 2
- 101000678280 Homo sapiens Eukaryotic translation initiation factor 4E-binding protein 1 Proteins 0.000 description 2
- 101000854648 Homo sapiens Ezrin Proteins 0.000 description 2
- 101000848187 Homo sapiens Fanconi anemia group M protein Proteins 0.000 description 2
- 101000730595 Homo sapiens Fibrocystin Proteins 0.000 description 2
- 101000726577 Homo sapiens Gap junction alpha-3 protein Proteins 0.000 description 2
- 101000858024 Homo sapiens Gap junction alpha-8 protein Proteins 0.000 description 2
- 101000926939 Homo sapiens Glucocorticoid receptor Proteins 0.000 description 2
- 101000930910 Homo sapiens Glucose-6-phosphatase catalytic subunit 1 Proteins 0.000 description 2
- 101001014590 Homo sapiens Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas Proteins 0.000 description 2
- 101001014594 Homo sapiens Guanine nucleotide-binding protein G(s) subunit alpha isoforms short Proteins 0.000 description 2
- 101001016865 Homo sapiens Heat shock protein HSP 90-alpha Proteins 0.000 description 2
- 101001009007 Homo sapiens Hemoglobin subunit alpha Proteins 0.000 description 2
- 101001047006 Homo sapiens Histone acetyltransferase KAT2B Proteins 0.000 description 2
- 101000634046 Homo sapiens Histone-lysine N-methyltransferase NSD3 Proteins 0.000 description 2
- 101001041136 Homo sapiens Homeobox protein Hox-D4 Proteins 0.000 description 2
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 2
- 101001013150 Homo sapiens Interstitial collagenase Proteins 0.000 description 2
- 101000972491 Homo sapiens Laminin subunit alpha-2 Proteins 0.000 description 2
- 101000615657 Homo sapiens MAM domain-containing glycosylphosphatidylinositol anchor protein 2 Proteins 0.000 description 2
- 101000983747 Homo sapiens MHC class II transactivator Proteins 0.000 description 2
- 101000628949 Homo sapiens Mitogen-activated protein kinase 10 Proteins 0.000 description 2
- 101001030184 Homo sapiens Myotilin Proteins 0.000 description 2
- 101001128156 Homo sapiens Nanos homolog 3 Proteins 0.000 description 2
- 101001014610 Homo sapiens Neuroendocrine secretory protein 55 Proteins 0.000 description 2
- 101000996111 Homo sapiens Neuroligin-4, X-linked Proteins 0.000 description 2
- 101001124309 Homo sapiens Nitric oxide synthase, endothelial Proteins 0.000 description 2
- 101000582254 Homo sapiens Nuclear receptor corepressor 2 Proteins 0.000 description 2
- 101001109719 Homo sapiens Nucleophosmin Proteins 0.000 description 2
- 101001125026 Homo sapiens Nucleotide-binding oligomerization domain-containing protein 2 Proteins 0.000 description 2
- 101001098523 Homo sapiens PAX-interacting protein 1 Proteins 0.000 description 2
- 101000987581 Homo sapiens Perforin-1 Proteins 0.000 description 2
- 101000873719 Homo sapiens Phakinin Proteins 0.000 description 2
- 101000692464 Homo sapiens Platelet-derived growth factor receptor-like protein Proteins 0.000 description 2
- 101001126471 Homo sapiens Plectin Proteins 0.000 description 2
- 101001074439 Homo sapiens Polycystin-2 Proteins 0.000 description 2
- 101000836337 Homo sapiens Probable helicase senataxin Proteins 0.000 description 2
- 101000718497 Homo sapiens Protein AF-10 Proteins 0.000 description 2
- 101000797903 Homo sapiens Protein ALEX Proteins 0.000 description 2
- 101000876829 Homo sapiens Protein C-ets-1 Proteins 0.000 description 2
- 101000573199 Homo sapiens Protein PML Proteins 0.000 description 2
- 101000716803 Homo sapiens Protein SCO1 homolog, mitochondrial Proteins 0.000 description 2
- 101000726148 Homo sapiens Protein crumbs homolog 1 Proteins 0.000 description 2
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 2
- 101000729271 Homo sapiens Retinoid isomerohydrolase Proteins 0.000 description 2
- 101000857677 Homo sapiens Runt-related transcription factor 1 Proteins 0.000 description 2
- 101000898985 Homo sapiens Seipin Proteins 0.000 description 2
- 101000683839 Homo sapiens Selenoprotein N Proteins 0.000 description 2
- 101000783373 Homo sapiens Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform Proteins 0.000 description 2
- 101000783404 Homo sapiens Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform Proteins 0.000 description 2
- 101001068027 Homo sapiens Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform Proteins 0.000 description 2
- 101000631929 Homo sapiens Sodium-dependent serotonin transporter Proteins 0.000 description 2
- 101000891113 Homo sapiens T-cell acute lymphocytic leukemia protein 1 Proteins 0.000 description 2
- 101000946863 Homo sapiens T-cell surface glycoprotein CD3 delta chain Proteins 0.000 description 2
- 101000891092 Homo sapiens TAR DNA-binding protein 43 Proteins 0.000 description 2
- 101000891654 Homo sapiens TATA-box-binding protein Proteins 0.000 description 2
- 101000598025 Homo sapiens Talin-1 Proteins 0.000 description 2
- 101000772194 Homo sapiens Transthyretin Proteins 0.000 description 2
- 101000851865 Homo sapiens Tryptophan 5-hydroxylase 2 Proteins 0.000 description 2
- 101000997835 Homo sapiens Tyrosine-protein kinase JAK1 Proteins 0.000 description 2
- 101000934996 Homo sapiens Tyrosine-protein kinase JAK3 Proteins 0.000 description 2
- 101000807668 Homo sapiens Uracil-DNA glycosylase Proteins 0.000 description 2
- 101000638886 Homo sapiens Urokinase-type plasminogen activator Proteins 0.000 description 2
- 101000808011 Homo sapiens Vascular endothelial growth factor A Proteins 0.000 description 2
- 101000775932 Homo sapiens Vesicle-associated membrane protein-associated protein B/C Proteins 0.000 description 2
- 101001104110 Homo sapiens X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 201000004029 Immune dysregulation-polyendocrinopathy-enteropathy-X-linked syndrome Diseases 0.000 description 2
- 102100025390 Integrin beta-2 Human genes 0.000 description 2
- 102000004310 Ion Channels Human genes 0.000 description 2
- 108090000862 Ion Channels Proteins 0.000 description 2
- 102100035878 Krev interaction trapped protein 1 Human genes 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- 102100022745 Laminin subunit alpha-2 Human genes 0.000 description 2
- 201000003533 Leber congenital amaurosis Diseases 0.000 description 2
- 102100023487 Lens fiber major intrinsic protein Human genes 0.000 description 2
- 102100026038 Lens fiber membrane intrinsic protein Human genes 0.000 description 2
- 102100021319 MAM domain-containing glycosylphosphatidylinositol anchor protein 2 Human genes 0.000 description 2
- 102100026371 MHC class II transactivator Human genes 0.000 description 2
- 241000282560 Macaca mulatta Species 0.000 description 2
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 2
- 102000000380 Matrix Metalloproteinase 1 Human genes 0.000 description 2
- 108700011259 MicroRNAs Proteins 0.000 description 2
- 102100026931 Mitogen-activated protein kinase 10 Human genes 0.000 description 2
- 241000714177 Murine leukemia virus Species 0.000 description 2
- 101100219625 Mus musculus Casd1 gene Proteins 0.000 description 2
- 101100293261 Mus musculus Naa15 gene Proteins 0.000 description 2
- 208000021642 Muscular disease Diseases 0.000 description 2
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 2
- 102100038894 Myotilin Human genes 0.000 description 2
- 206010068871 Myotonic dystrophy Diseases 0.000 description 2
- 108010052185 Myotonin-Protein Kinase Proteins 0.000 description 2
- 102100022437 Myotonin-protein kinase Human genes 0.000 description 2
- 101150082943 NAT1 gene Proteins 0.000 description 2
- 101150019103 NAT2 gene Proteins 0.000 description 2
- 101150043994 NOS1 gene Proteins 0.000 description 2
- 102100031893 Nanos homolog 3 Human genes 0.000 description 2
- 102000014413 Neuregulin Human genes 0.000 description 2
- 108050003475 Neuregulin Proteins 0.000 description 2
- 102000048238 Neuregulin-1 Human genes 0.000 description 2
- 108090000556 Neuregulin-1 Proteins 0.000 description 2
- 102100034441 Neuroligin-4, X-linked Human genes 0.000 description 2
- 108700002045 Nod2 Signaling Adaptor Proteins 0.000 description 2
- 101150083031 Nod2 gene Proteins 0.000 description 2
- 108091092724 Noncoding DNA Proteins 0.000 description 2
- 102100030569 Nuclear receptor corepressor 2 Human genes 0.000 description 2
- 102100022678 Nucleophosmin Human genes 0.000 description 2
- 102000002488 Nucleoplasmin Human genes 0.000 description 2
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 2
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 2
- 102100040444 P2X purinoceptor 1 Human genes 0.000 description 2
- 102100037602 P2X purinoceptor 7 Human genes 0.000 description 2
- 102100037141 PAX-interacting protein 1 Human genes 0.000 description 2
- 101150035190 PSEN1 gene Proteins 0.000 description 2
- 102100037506 Paired box protein Pax-6 Human genes 0.000 description 2
- 208000018737 Parkinson disease Diseases 0.000 description 2
- 101000579647 Penaeus vannamei Penaeidin-2a Proteins 0.000 description 2
- 102100028467 Perforin-1 Human genes 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 101710169596 Phosphatidylinositol-binding clathrin assembly protein Proteins 0.000 description 2
- 108010022233 Plasminogen Activator Inhibitor 1 Proteins 0.000 description 2
- 102100039418 Plasminogen activator inhibitor 1 Human genes 0.000 description 2
- 102100026554 Platelet-derived growth factor receptor-like protein Human genes 0.000 description 2
- 102100036142 Polycystin-2 Human genes 0.000 description 2
- 108010050254 Presenilins Proteins 0.000 description 2
- 102000015499 Presenilins Human genes 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- 102100027178 Probable helicase senataxin Human genes 0.000 description 2
- ZTHYODDOHIVTJV-UHFFFAOYSA-N Propyl gallate Chemical compound CCCOC(=O)C1=CC(O)=C(O)C(O)=C1 ZTHYODDOHIVTJV-UHFFFAOYSA-N 0.000 description 2
- 101710176177 Protein A56 Proteins 0.000 description 2
- 102100026286 Protein AF-10 Human genes 0.000 description 2
- 102100035251 Protein C-ets-1 Human genes 0.000 description 2
- 102100026375 Protein PML Human genes 0.000 description 2
- 102100020866 Protein SCO1 homolog, mitochondrial Human genes 0.000 description 2
- 102100027331 Protein crumbs homolog 1 Human genes 0.000 description 2
- 101710156592 Putative TATA-binding protein pB263R Proteins 0.000 description 2
- 101000902592 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) DNA polymerase Proteins 0.000 description 2
- 101100148573 Rattus norvegicus S1pr5 gene Proteins 0.000 description 2
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 2
- 108700008625 Reporter Genes Proteins 0.000 description 2
- 102100031176 Retinoid isomerohydrolase Human genes 0.000 description 2
- 108091006299 SLC2A2 Proteins 0.000 description 2
- 102000005029 SLC6A3 Human genes 0.000 description 2
- 108010044012 STAT1 Transcription Factor Proteins 0.000 description 2
- 101150063267 STAT5B gene Proteins 0.000 description 2
- 102100021463 Seipin Human genes 0.000 description 2
- 102100036140 Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform Human genes 0.000 description 2
- 102100036122 Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform Human genes 0.000 description 2
- 102100034464 Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform Human genes 0.000 description 2
- 102100029904 Signal transducer and activator of transcription 1-alpha/beta Human genes 0.000 description 2
- 102100024474 Signal transducer and activator of transcription 5B Human genes 0.000 description 2
- 241000713311 Simian immunodeficiency virus Species 0.000 description 2
- 102100022433 Single-stranded DNA cytosine deaminase Human genes 0.000 description 2
- 101150028423 Slc6a4 gene Proteins 0.000 description 2
- 108091027967 Small hairpin RNA Proteins 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 102100028874 Sodium-dependent serotonin transporter Human genes 0.000 description 2
- 102100023537 Solute carrier family 2, facilitated glucose transporter member 2 Human genes 0.000 description 2
- 208000009415 Spinocerebellar Ataxias Diseases 0.000 description 2
- RAHZWNYVWXNFOC-UHFFFAOYSA-N Sulphur dioxide Chemical compound O=S=O RAHZWNYVWXNFOC-UHFFFAOYSA-N 0.000 description 2
- 108010021188 Superoxide Dismutase-1 Proteins 0.000 description 2
- 102100038836 Superoxide dismutase [Cu-Zn] Human genes 0.000 description 2
- 208000012827 T-B+ severe combined immunodeficiency due to gamma chain deficiency Diseases 0.000 description 2
- 102100035891 T-cell surface glycoprotein CD3 delta chain Human genes 0.000 description 2
- 102100040347 TAR DNA-binding protein 43 Human genes 0.000 description 2
- 101710145783 TATA-box-binding protein Proteins 0.000 description 2
- 108700012920 TNF Proteins 0.000 description 2
- 108090000925 TNF receptor-associated factor 2 Proteins 0.000 description 2
- 102000003714 TNF receptor-associated factor 6 Human genes 0.000 description 2
- 108090000009 TNF receptor-associated factor 6 Proteins 0.000 description 2
- 101150115335 TPH2 gene Proteins 0.000 description 2
- 102100034779 TRAF family member-associated NF-kappa-B activator Human genes 0.000 description 2
- 102100036977 Talin-1 Human genes 0.000 description 2
- 102100028082 Tapasin Human genes 0.000 description 2
- 102100036407 Thioredoxin Human genes 0.000 description 2
- 101150079992 Timp3 gene Proteins 0.000 description 2
- 102000005406 Tissue Inhibitor of Metalloproteinase-3 Human genes 0.000 description 2
- 101150058700 Tph1 gene Proteins 0.000 description 2
- 108091028113 Trans-activating crRNA Proteins 0.000 description 2
- 108010073062 Transcription Activator-Like Effectors Proteins 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- 102100027059 Translation initiation factor eIF-2B subunit alpha Human genes 0.000 description 2
- 102100029290 Transthyretin Human genes 0.000 description 2
- 102100036474 Tryptophan 5-hydroxylase 2 Human genes 0.000 description 2
- 108010031944 Tryptophan Hydroxylase Proteins 0.000 description 2
- 102000005506 Tryptophan Hydroxylase Human genes 0.000 description 2
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 2
- 102100033438 Tyrosine-protein kinase JAK1 Human genes 0.000 description 2
- 102100025387 Tyrosine-protein kinase JAK3 Human genes 0.000 description 2
- 108010005656 Ubiquitin Thiolesterase Proteins 0.000 description 2
- 102100025038 Ubiquitin carboxyl-terminal hydrolase isozyme L1 Human genes 0.000 description 2
- 102100031358 Urokinase-type plasminogen activator Human genes 0.000 description 2
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 2
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 2
- 102100039037 Vascular endothelial growth factor A Human genes 0.000 description 2
- 102100039066 Very low-density lipoprotein receptor Human genes 0.000 description 2
- 102100032026 Vesicle-associated membrane protein-associated protein B/C Human genes 0.000 description 2
- 208000008383 Wilms tumor Diseases 0.000 description 2
- 102100040089 X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 Human genes 0.000 description 2
- 102100040314 Zinc finger and BTB domain-containing protein 16 Human genes 0.000 description 2
- 102100035558 Zinc finger protein GLI2 Human genes 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 230000021736 acetylation Effects 0.000 description 2
- 238000006640 acetylation reaction Methods 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 238000001994 activation Methods 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- 208000025531 adult-onset foveomacular vitelliform dystrophy Diseases 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 2
- 108090000185 alpha-Synuclein Proteins 0.000 description 2
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 2
- 201000008266 amyotrophic lateral sclerosis type 2 Diseases 0.000 description 2
- 210000004102 animal cell Anatomy 0.000 description 2
- 101150089041 aph-1 gene Proteins 0.000 description 2
- 210000004436 artificial bacterial chromosome Anatomy 0.000 description 2
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 2
- 201000009562 autosomal recessive limb-girdle muscular dystrophy type 2C Diseases 0.000 description 2
- 201000009561 autosomal recessive limb-girdle muscular dystrophy type 2D Diseases 0.000 description 2
- 208000033651 b subunit deficiency of factor XIII Diseases 0.000 description 2
- 230000004888 barrier function Effects 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- 239000012472 biological sample Substances 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 210000001218 blood-brain barrier Anatomy 0.000 description 2
- 108091005948 blue fluorescent proteins Proteins 0.000 description 2
- 210000004958 brain cell Anatomy 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 101150055766 cat gene Proteins 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 108020001778 catalytic domains Proteins 0.000 description 2
- 125000002091 cationic group Chemical group 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 210000003483 chromatin Anatomy 0.000 description 2
- 230000002759 chromosomal effect Effects 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- 230000004186 co-expression Effects 0.000 description 2
- 230000009918 complex formation Effects 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 108010082025 cyan fluorescent protein Proteins 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- 238000012350 deep sequencing Methods 0.000 description 2
- 230000007812 deficiency Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 238000002716 delivery method Methods 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 238000007877 drug screening Methods 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- CTSPAMFJBXKSOY-UHFFFAOYSA-N ellipticine Chemical compound N1=CC=C2C(C)=C(NC=3C4=CC=CC=3)C4=C(C)C2=C1 CTSPAMFJBXKSOY-UHFFFAOYSA-N 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- CBOQJANXLMLOSS-UHFFFAOYSA-N ethyl vanillin Chemical compound CCOC1=CC(C=O)=CC=C1O CBOQJANXLMLOSS-UHFFFAOYSA-N 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 238000012268 genome sequencing Methods 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 229910052737 gold Inorganic materials 0.000 description 2
- 239000010931 gold Substances 0.000 description 2
- 239000005090 green fluorescent protein Substances 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 210000005003 heart tissue Anatomy 0.000 description 2
- 238000010438 heat treatment Methods 0.000 description 2
- 239000000185 hemagglutinin Substances 0.000 description 2
- 208000031169 hemorrhagic disease Diseases 0.000 description 2
- 238000001114 immunoprecipitation Methods 0.000 description 2
- 230000000415 inactivating effect Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 229910052500 inorganic mineral Inorganic materials 0.000 description 2
- CDAISMWEOUEBRE-UHFFFAOYSA-N inositol Chemical compound OC1C(O)C(O)C(O)C(O)C1O CDAISMWEOUEBRE-UHFFFAOYSA-N 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 208000032799 juvenile amyotrophic lateral sclerosis type 2 Diseases 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 230000029226 lipidation Effects 0.000 description 2
- 208000002780 macular degeneration Diseases 0.000 description 2
- 108091070501 miRNA Proteins 0.000 description 2
- 239000011707 mineral Substances 0.000 description 2
- 235000010755 mineral Nutrition 0.000 description 2
- 238000002887 multiple sequence alignment Methods 0.000 description 2
- NFVJNJQRWPQVOA-UHFFFAOYSA-N n-[2-chloro-5-(trifluoromethyl)phenyl]-2-[3-(4-ethyl-5-ethylsulfanyl-1,2,4-triazol-3-yl)piperidin-1-yl]acetamide Chemical compound CCN1C(SCC)=NN=C1C1CN(CC(=O)NC=2C(=CC=C(C=2)C(F)(F)F)Cl)CCC1 NFVJNJQRWPQVOA-UHFFFAOYSA-N 0.000 description 2
- 101150036168 ncstn gene Proteins 0.000 description 2
- 201000008026 nephroblastoma Diseases 0.000 description 2
- 102000046701 nicastrin Human genes 0.000 description 2
- 108700022821 nicastrin Proteins 0.000 description 2
- 108060005597 nucleoplasmin Proteins 0.000 description 2
- 230000009437 off-target effect Effects 0.000 description 2
- 210000000496 pancreas Anatomy 0.000 description 2
- 101150063226 parp-1 gene Proteins 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 238000013081 phylogenetic analysis Methods 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 238000004393 prognosis Methods 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 230000001603 reducing effect Effects 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 238000005070 sampling Methods 0.000 description 2
- 201000000980 schizophrenia Diseases 0.000 description 2
- 238000002864 sequence alignment Methods 0.000 description 2
- 238000004904 shortening Methods 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 239000000344 soap Substances 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 108060008226 thioredoxin Proteins 0.000 description 2
- 230000002463 transducing effect Effects 0.000 description 2
- 238000010361 transduction Methods 0.000 description 2
- 230000026683 transduction Effects 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 210000002845 virion Anatomy 0.000 description 2
- 239000000277 virosome Substances 0.000 description 2
- 208000020938 vitelliform macular dystrophy 2 Diseases 0.000 description 2
- 108091005957 yellow fluorescent proteins Proteins 0.000 description 2
- IYKLZBIWFXPUCS-VIFPVBQESA-N (2s)-2-(naphthalen-1-ylamino)propanoic acid Chemical compound C1=CC=C2C(N[C@@H](C)C(O)=O)=CC=CC2=C1 IYKLZBIWFXPUCS-VIFPVBQESA-N 0.000 description 1
- CNMAQBJBWQQZFZ-LURJTMIESA-N (2s)-2-(pyridin-2-ylamino)propanoic acid Chemical compound OC(=O)[C@H](C)NC1=CC=CC=N1 CNMAQBJBWQQZFZ-LURJTMIESA-N 0.000 description 1
- QYAPHLRPFNSDNH-MRFRVZCGSA-N (4s,4as,5as,6s,12ar)-7-chloro-4-(dimethylamino)-1,6,10,11,12a-pentahydroxy-6-methyl-3,12-dioxo-4,4a,5,5a-tetrahydrotetracene-2-carboxamide;hydrochloride Chemical compound Cl.C1=CC(Cl)=C2[C@](O)(C)[C@H]3C[C@H]4[C@H](N(C)C)C(=O)C(C(N)=O)=C(O)[C@@]4(O)C(=O)C3=C(O)C2=C1O QYAPHLRPFNSDNH-MRFRVZCGSA-N 0.000 description 1
- WHTVZRBIWZFKQO-AWEZNQCLSA-N (S)-chloroquine Chemical compound ClC1=CC=C2C(N[C@@H](C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-AWEZNQCLSA-N 0.000 description 1
- 102100028734 1,4-alpha-glucan-branching enzyme Human genes 0.000 description 1
- CDKIEBFIMCSCBB-UHFFFAOYSA-N 1-(6,7-dimethoxy-3,4-dihydro-1h-isoquinolin-2-yl)-3-(1-methyl-2-phenylpyrrolo[2,3-b]pyridin-3-yl)prop-2-en-1-one;hydrochloride Chemical compound Cl.C1C=2C=C(OC)C(OC)=CC=2CCN1C(=O)C=CC(C1=CC=CN=C1N1C)=C1C1=CC=CC=C1 CDKIEBFIMCSCBB-UHFFFAOYSA-N 0.000 description 1
- 102100038028 1-phosphatidylinositol 3-phosphate 5-kinase Human genes 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- BLCJBICVQSYOIF-UHFFFAOYSA-N 2,2-diaminobutanoic acid Chemical compound CCC(N)(N)C(O)=O BLCJBICVQSYOIF-UHFFFAOYSA-N 0.000 description 1
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- CHHHXKFHOYLYRE-UHFFFAOYSA-M 2,4-Hexadienoic acid, potassium salt (1:1), (2E,4E)- Chemical compound [K+].CC=CC=CC([O-])=O CHHHXKFHOYLYRE-UHFFFAOYSA-M 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- DIDGPCDGNMIUNX-UUOKFMHZSA-N 2-amino-9-[(2r,3r,4s,5r)-5-(dihydroxyphosphinothioyloxymethyl)-3,4-dihydroxyoxolan-2-yl]-3h-purin-6-one Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@@H]1O[C@H](COP(O)(O)=S)[C@@H](O)[C@H]1O DIDGPCDGNMIUNX-UUOKFMHZSA-N 0.000 description 1
- WTOFYLAWDLQMBZ-UHFFFAOYSA-N 2-azaniumyl-3-thiophen-2-ylpropanoate Chemical compound OC(=O)C(N)CC1=CC=CS1 WTOFYLAWDLQMBZ-UHFFFAOYSA-N 0.000 description 1
- MZZYGYNZAOVRTG-UHFFFAOYSA-N 2-hydroxy-n-(1h-1,2,4-triazol-5-yl)benzamide Chemical compound OC1=CC=CC=C1C(=O)NC1=NC=NN1 MZZYGYNZAOVRTG-UHFFFAOYSA-N 0.000 description 1
- KKAJSJJFBSOMGS-UHFFFAOYSA-N 3,6-diamino-10-methylacridinium chloride Chemical compound [Cl-].C1=C(N)C=C2[N+](C)=C(C=C(N)C=C3)C3=CC2=C1 KKAJSJJFBSOMGS-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 102100035923 4-aminobutyrate aminotransferase, mitochondrial Human genes 0.000 description 1
- WXNZTHHGJRFXKQ-UHFFFAOYSA-N 4-chlorophenol Chemical compound OC1=CC=C(Cl)C=C1 WXNZTHHGJRFXKQ-UHFFFAOYSA-N 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- 208000033598 A subunit deficiency of factor XIII Diseases 0.000 description 1
- 108091007507 ADAM12 Proteins 0.000 description 1
- 108091007505 ADAM17 Proteins 0.000 description 1
- 108010029988 AICDA (activation-induced cytidine deaminase) Proteins 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 101150111620 AQP1 gene Proteins 0.000 description 1
- 102000000872 ATM Human genes 0.000 description 1
- 102100032922 ATP-dependent 6-phosphofructokinase, muscle type Human genes 0.000 description 1
- 101150030271 AXIN1 gene Proteins 0.000 description 1
- 241000589291 Acinetobacter Species 0.000 description 1
- 241001502050 Acis Species 0.000 description 1
- 102100022900 Actin, cytoplasmic 1 Human genes 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 102100036409 Activated CDC42 kinase 1 Human genes 0.000 description 1
- 206010048998 Acute phase reaction Diseases 0.000 description 1
- 102100022089 Acyl-[acyl-carrier-protein] hydrolase Human genes 0.000 description 1
- 102100036664 Adenosine deaminase Human genes 0.000 description 1
- 102100032157 Adenylate cyclase type 10 Human genes 0.000 description 1
- 241000567147 Aeropyrum Species 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 230000007730 Akt signaling Effects 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102100033312 Alpha-2-macroglobulin Human genes 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 102100023635 Alpha-fetoprotein Human genes 0.000 description 1
- 208000033337 Alpha-sarcoglycan-related limb-girdle muscular dystrophy R3 Diseases 0.000 description 1
- 208000003808 Amyloid Neuropathies Diseases 0.000 description 1
- 241000192542 Anabaena Species 0.000 description 1
- 101710185050 Angiotensin-converting enzyme Proteins 0.000 description 1
- 108050009514 Antigen peptide transporter 1 Proteins 0.000 description 1
- 101100510324 Aplysia californica PRKC1 gene Proteins 0.000 description 1
- 241000207208 Aquifex Species 0.000 description 1
- 241000219195 Arabidopsis thaliana Species 0.000 description 1
- 101100224343 Arabidopsis thaliana DOF2.5 gene Proteins 0.000 description 1
- 101100288434 Arabidopsis thaliana LACS2 gene Proteins 0.000 description 1
- 101100345345 Arabidopsis thaliana MGD1 gene Proteins 0.000 description 1
- 101100243447 Arabidopsis thaliana PER53 gene Proteins 0.000 description 1
- 101000719121 Arabidopsis thaliana Protein MEI2-like 1 Proteins 0.000 description 1
- 241000203069 Archaea Species 0.000 description 1
- 241000205046 Archaeoglobus Species 0.000 description 1
- 102100030907 Aryl hydrocarbon receptor nuclear translocator Human genes 0.000 description 1
- 101000690509 Aspergillus oryzae (strain ATCC 42149 / RIB 40) Alpha-glucosidase Proteins 0.000 description 1
- 208000000659 Autoimmune lymphoproliferative syndrome Diseases 0.000 description 1
- 208000002814 Autosomal Recessive Polycystic Kidney Diseases 0.000 description 1
- 208000035665 Autosomal dominant Charcot-Marie-Tooth disease type 2D Diseases 0.000 description 1
- 208000036075 Autosomal dominant tubulointerstitial kidney disease Diseases 0.000 description 1
- 208000017354 Autosomal recessive polycystic kidney disease Diseases 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 108091008875 B cell receptors Proteins 0.000 description 1
- 108700024832 B-Cell CLL-Lymphoma 10 Proteins 0.000 description 1
- 102100021631 B-cell lymphoma 6 protein Human genes 0.000 description 1
- 102100037598 B-cell lymphoma/leukemia 10 Human genes 0.000 description 1
- 208000028564 B-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 101150074953 BCL10 gene Proteins 0.000 description 1
- 102100035080 BDNF/NT-3 growth factors receptor Human genes 0.000 description 1
- 108091007065 BIRCs Proteins 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 108700003785 Baculoviral IAP Repeat-Containing 3 Proteins 0.000 description 1
- 102100021677 Baculoviral IAP repeat-containing protein 2 Human genes 0.000 description 1
- 102100021662 Baculoviral IAP repeat-containing protein 3 Human genes 0.000 description 1
- 102100021663 Baculoviral IAP repeat-containing protein 5 Human genes 0.000 description 1
- 102100032305 Bcl-2 homologous antagonist/killer Human genes 0.000 description 1
- 108010040168 Bcl-2-Like Protein 11 Proteins 0.000 description 1
- 102000001765 Bcl-2-Like Protein 11 Human genes 0.000 description 1
- 102100021573 Bcl-2-binding component 3, isoforms 3/4 Human genes 0.000 description 1
- 206010061692 Benign muscle neoplasm Diseases 0.000 description 1
- 102100022794 Bestrophin-1 Human genes 0.000 description 1
- 102100034732 Beta-1,3-glucuronyltransferase LARGE1 Human genes 0.000 description 1
- 102100030516 Beta-crystallin B1 Human genes 0.000 description 1
- 102100022549 Beta-hexosaminidase subunit beta Human genes 0.000 description 1
- 101150104237 Birc3 gene Proteins 0.000 description 1
- 108010025544 Bleomycin hydrolase Proteins 0.000 description 1
- BTBUEUYNUDRHOZ-UHFFFAOYSA-N Borate Chemical compound [O-]B([O-])[O-] BTBUEUYNUDRHOZ-UHFFFAOYSA-N 0.000 description 1
- 101000964894 Bos taurus 14-3-3 protein zeta/delta Proteins 0.000 description 1
- 101710149815 C-C chemokine receptor type 2 Proteins 0.000 description 1
- 102100035875 C-C chemokine receptor type 5 Human genes 0.000 description 1
- 102100021943 C-C motif chemokine 2 Human genes 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 102100032912 CD44 antigen Human genes 0.000 description 1
- 101150018129 CSF2 gene Proteins 0.000 description 1
- 101150069031 CSN2 gene Proteins 0.000 description 1
- 101150023944 CXCR5 gene Proteins 0.000 description 1
- 101000690445 Caenorhabditis elegans Aryl hydrocarbon receptor nuclear translocator homolog Proteins 0.000 description 1
- 101100017502 Caenorhabditis elegans hlh-3 gene Proteins 0.000 description 1
- 101710192106 Calcineurin-binding protein cabin-1 Proteins 0.000 description 1
- 240000001432 Calendula officinalis Species 0.000 description 1
- 235000005881 Calendula officinalis Nutrition 0.000 description 1
- 101000809436 Candida albicans Sterol O-acyltransferase 2 Proteins 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 102100035904 Caspase-1 Human genes 0.000 description 1
- 102000011727 Caspases Human genes 0.000 description 1
- 108010076667 Caspases Proteins 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 208000002177 Cataract Diseases 0.000 description 1
- 102100028906 Catenin delta-1 Human genes 0.000 description 1
- 102100035888 Caveolin-1 Human genes 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 208000010693 Charcot-Marie-Tooth Disease Diseases 0.000 description 1
- 201000008958 Charcot-Marie-Tooth disease type 2D Diseases 0.000 description 1
- 241000191366 Chlorobium Species 0.000 description 1
- 241000588881 Chromobacterium Species 0.000 description 1
- 208000029448 Chylomicron retention disease Diseases 0.000 description 1
- 102100026127 Clathrin heavy chain 1 Human genes 0.000 description 1
- 102100040836 Claudin-1 Human genes 0.000 description 1
- 241000193403 Clostridium Species 0.000 description 1
- 102100032887 Clusterin Human genes 0.000 description 1
- 108090000197 Clusterin Proteins 0.000 description 1
- 102100022641 Coagulation factor IX Human genes 0.000 description 1
- 101100007328 Cocos nucifera COS-1 gene Proteins 0.000 description 1
- 102100024484 Codanin-1 Human genes 0.000 description 1
- 206010010099 Combined immunodeficiency Diseases 0.000 description 1
- 108010053085 Complement Factor H Proteins 0.000 description 1
- 102000016550 Complement Factor H Human genes 0.000 description 1
- 102100035436 Complement factor D Human genes 0.000 description 1
- 206010010356 Congenital anomaly Diseases 0.000 description 1
- 206010053138 Congenital aplastic anaemia Diseases 0.000 description 1
- 208000037141 Congenital muscular dystrophy, Fukuyama type Diseases 0.000 description 1
- 108010043471 Core Binding Factor Alpha 2 Subunit Proteins 0.000 description 1
- 208000006069 Corneal Opacity Diseases 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 108091029523 CpG island Proteins 0.000 description 1
- 241000195493 Cryptophyta Species 0.000 description 1
- 101150074775 Csf1 gene Proteins 0.000 description 1
- 102000004480 Cyclin-Dependent Kinase Inhibitor p57 Human genes 0.000 description 1
- 108010017222 Cyclin-Dependent Kinase Inhibitor p57 Proteins 0.000 description 1
- 102100026278 Cysteine sulfinic acid decarboxylase Human genes 0.000 description 1
- 108010079245 Cystic Fibrosis Transmembrane Conductance Regulator Proteins 0.000 description 1
- 201000003883 Cystic fibrosis Diseases 0.000 description 1
- 102100025621 Cytochrome b-245 heavy chain Human genes 0.000 description 1
- 102100025620 Cytochrome b-245 light chain Human genes 0.000 description 1
- 108010052832 Cytochromes Proteins 0.000 description 1
- 102000018832 Cytochromes Human genes 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 101150074155 DHFR gene Proteins 0.000 description 1
- 108010017826 DNA Polymerase I Proteins 0.000 description 1
- 102000004594 DNA Polymerase I Human genes 0.000 description 1
- 239000012625 DNA intercalator Substances 0.000 description 1
- 241000450599 DNA viruses Species 0.000 description 1
- 108700020911 DNA-Binding Proteins Proteins 0.000 description 1
- 101710158312 DNA-binding protein HU-beta Proteins 0.000 description 1
- 101710157974 DNA-binding protein SMUBP-2 Proteins 0.000 description 1
- 101150049660 DRD2 gene Proteins 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- 241000605716 Desulfovibrio Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- SHIBSTMRCDJXLN-UHFFFAOYSA-N Digoxigenin Natural products C1CC(C2C(C3(C)CCC(O)CC3CC2)CC2O)(O)C2(C)C1C1=CC(=O)OC1 SHIBSTMRCDJXLN-UHFFFAOYSA-N 0.000 description 1
- 102100023319 Dihydrolipoyl dehydrogenase, mitochondrial Human genes 0.000 description 1
- 102100031112 Disintegrin and metalloproteinase domain-containing protein 12 Human genes 0.000 description 1
- 102100031111 Disintegrin and metalloproteinase domain-containing protein 17 Human genes 0.000 description 1
- 102100024361 Disintegrin and metalloproteinase domain-containing protein 9 Human genes 0.000 description 1
- 102100037832 Docking protein 1 Human genes 0.000 description 1
- 102100033156 Dopamine beta-hydroxylase Human genes 0.000 description 1
- 101150097070 Drd3 gene Proteins 0.000 description 1
- 101150043870 Drd4 gene Proteins 0.000 description 1
- 102100037024 E3 ubiquitin-protein ligase XIAP Human genes 0.000 description 1
- 239000001692 EU approved anti-caking agent Substances 0.000 description 1
- 102100023226 Early growth response protein 1 Human genes 0.000 description 1
- 102100034239 Emerin Human genes 0.000 description 1
- 201000009344 Emery-Dreifuss muscular dystrophy Diseases 0.000 description 1
- 102100031780 Endonuclease Human genes 0.000 description 1
- 102100029727 Enteropeptidase Human genes 0.000 description 1
- 108010013369 Enteropeptidase Proteins 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 108091008815 Eph receptors Proteins 0.000 description 1
- 241000588698 Erwinia Species 0.000 description 1
- 101710100588 Erythroid transcription factor Proteins 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 101000661485 Escherichia coli (strain K12) Cysteine desulfurase Proteins 0.000 description 1
- 101000956229 Escherichia coli (strain K12) Cysteine desulfurase CsdA Proteins 0.000 description 1
- QTANTQQOYSUMLC-UHFFFAOYSA-O Ethidium cation Chemical compound C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 QTANTQQOYSUMLC-UHFFFAOYSA-O 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 108010082945 Eukaryotic Initiation Factor-2B Proteins 0.000 description 1
- 102100035549 Eukaryotic translation initiation factor 2 subunit 1 Human genes 0.000 description 1
- 101710151743 Eukaryotic translation initiation factor 2 subunit 1 Proteins 0.000 description 1
- 108010007457 Extracellular Signal-Regulated MAP Kinases Proteins 0.000 description 1
- 206010015866 Extravasation Diseases 0.000 description 1
- 108091008794 FGF receptors Proteins 0.000 description 1
- 208000037149 Facioscapulohumeral dystrophy Diseases 0.000 description 1
- 108010014172 Factor V Proteins 0.000 description 1
- 108010054218 Factor VIII Proteins 0.000 description 1
- 102000001690 Factor VIII Human genes 0.000 description 1
- 201000003542 Factor VIII deficiency Diseases 0.000 description 1
- 201000007176 Factor XII Deficiency Diseases 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 108010087740 Fanconi Anemia Complementation Group A protein Proteins 0.000 description 1
- 102000018825 Fanconi Anemia Complementation Group C protein Human genes 0.000 description 1
- 108010027673 Fanconi Anemia Complementation Group C protein Proteins 0.000 description 1
- 108010026653 Fanconi Anemia Complementation Group D2 protein Proteins 0.000 description 1
- 102000010634 Fanconi Anemia Complementation Group E protein Human genes 0.000 description 1
- 108010077898 Fanconi Anemia Complementation Group E protein Proteins 0.000 description 1
- 102000012216 Fanconi Anemia Complementation Group F protein Human genes 0.000 description 1
- 108010022012 Fanconi Anemia Complementation Group F protein Proteins 0.000 description 1
- 108700026162 Fanconi Anemia Complementation Group L protein Proteins 0.000 description 1
- 201000004939 Fanconi anemia Diseases 0.000 description 1
- 102100027286 Fanconi anemia group C protein Human genes 0.000 description 1
- 102100040306 Fanconi anemia group D2 protein Human genes 0.000 description 1
- 102000008857 Ferritin Human genes 0.000 description 1
- 108050000784 Ferritin Proteins 0.000 description 1
- 238000008416 Ferritin Methods 0.000 description 1
- 101800000656 Fetal antigen 1 Proteins 0.000 description 1
- 102100031752 Fibrinogen alpha chain Human genes 0.000 description 1
- 206010016654 Fibrosis Diseases 0.000 description 1
- 241000605909 Fusobacterium Species 0.000 description 1
- 102100033452 GMP synthase [glutamine-hydrolyzing] Human genes 0.000 description 1
- 101710071060 GMPS Proteins 0.000 description 1
- 101150021949 GRIN1 gene Proteins 0.000 description 1
- 208000036893 GUCY2D-related dominant retinopathy Diseases 0.000 description 1
- 101150014889 Gad1 gene Proteins 0.000 description 1
- 208000033136 Gamma-sarcoglycan-related limb-girdle muscular dystrophy R5 Diseases 0.000 description 1
- 102100028953 Gelsolin Human genes 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 1
- 229940123611 Genome editing Drugs 0.000 description 1
- 241001135750 Geobacter Species 0.000 description 1
- 208000010412 Glaucoma Diseases 0.000 description 1
- 108090000079 Glucocorticoid Receptors Proteins 0.000 description 1
- 102100039684 Glucose-6-phosphate exchanger SLC37A4 Human genes 0.000 description 1
- 108010060309 Glucuronidase Proteins 0.000 description 1
- 102000053187 Glucuronidase Human genes 0.000 description 1
- 102100035902 Glutamate decarboxylase 1 Human genes 0.000 description 1
- 102100035857 Glutamate decarboxylase 2 Human genes 0.000 description 1
- 102100030651 Glutamate receptor 2 Human genes 0.000 description 1
- 102100039264 Glycogen [starch] synthase, liver Human genes 0.000 description 1
- 102100029481 Glycogen phosphorylase, liver form Human genes 0.000 description 1
- 101150049131 Gria1 gene Proteins 0.000 description 1
- 102100031150 Growth arrest and DNA damage-inducible protein GADD45 alpha Human genes 0.000 description 1
- 241000288105 Grus Species 0.000 description 1
- ZIXGXMMUKPLXBB-UHFFFAOYSA-N Guatambuinine Natural products N1C2=CC=CC=C2C2=C1C(C)=C1C=CN=C(C)C1=C2 ZIXGXMMUKPLXBB-UHFFFAOYSA-N 0.000 description 1
- 108091005772 HDAC11 Proteins 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 101150096895 HSPB1 gene Proteins 0.000 description 1
- 101150050738 HTR1B gene Proteins 0.000 description 1
- 241000204988 Haloferax mediterranei Species 0.000 description 1
- 102100039165 Heat shock protein beta-1 Human genes 0.000 description 1
- 108091005904 Hemoglobin subunit beta Proteins 0.000 description 1
- 102100039894 Hemoglobin subunit delta Human genes 0.000 description 1
- 208000036066 Hemophagocytic Lymphohistiocytosis Diseases 0.000 description 1
- 208000009292 Hemophilia A Diseases 0.000 description 1
- 206010019629 Hepatic adenoma Diseases 0.000 description 1
- 206010019663 Hepatic failure Diseases 0.000 description 1
- 102000019267 Hepatic lipases Human genes 0.000 description 1
- 108050006747 Hepatic lipases Proteins 0.000 description 1
- 208000003923 Hereditary Corneal Dystrophies Diseases 0.000 description 1
- 101001023784 Heteractis crispa GFP-like non-fluorescent chromoprotein Proteins 0.000 description 1
- 108091027305 Heteroduplex Proteins 0.000 description 1
- 208000032672 Histiocytosis haematophagic Diseases 0.000 description 1
- 102100039385 Histone deacetylase 11 Human genes 0.000 description 1
- 102100039999 Histone deacetylase 2 Human genes 0.000 description 1
- 102100021455 Histone deacetylase 3 Human genes 0.000 description 1
- 102100021454 Histone deacetylase 4 Human genes 0.000 description 1
- 102100021453 Histone deacetylase 5 Human genes 0.000 description 1
- 102100022537 Histone deacetylase 6 Human genes 0.000 description 1
- 102100038719 Histone deacetylase 7 Human genes 0.000 description 1
- 102100038720 Histone deacetylase 9 Human genes 0.000 description 1
- 101001058479 Homo sapiens 1,4-alpha-glucan-branching enzyme Proteins 0.000 description 1
- 101001025044 Homo sapiens 1-phosphatidylinositol 3-phosphate 5-kinase Proteins 0.000 description 1
- 101001000686 Homo sapiens 4-aminobutyrate aminotransferase, mitochondrial Proteins 0.000 description 1
- 101000985215 Homo sapiens 4-hydroxyphenylpyruvate dioxygenase Proteins 0.000 description 1
- 101001083755 Homo sapiens 5-aminolevulinate synthase, erythroid-specific, mitochondrial Proteins 0.000 description 1
- 101001029059 Homo sapiens ATP-binding cassette sub-family C member 10 Proteins 0.000 description 1
- 101000730838 Homo sapiens ATP-dependent 6-phosphofructokinase, muscle type Proteins 0.000 description 1
- 101000928956 Homo sapiens Activated CDC42 kinase 1 Proteins 0.000 description 1
- 101000929495 Homo sapiens Adenosine deaminase Proteins 0.000 description 1
- 101000775498 Homo sapiens Adenylate cyclase type 10 Proteins 0.000 description 1
- 101000924727 Homo sapiens Alternative prion protein Proteins 0.000 description 1
- 101000793115 Homo sapiens Aryl hydrocarbon receptor nuclear translocator Proteins 0.000 description 1
- 101000874566 Homo sapiens Axin-1 Proteins 0.000 description 1
- 101000971234 Homo sapiens B-cell lymphoma 6 protein Proteins 0.000 description 1
- 101000596896 Homo sapiens BDNF/NT-3 growth factors receptor Proteins 0.000 description 1
- 101000798320 Homo sapiens Bcl-2 homologous antagonist/killer Proteins 0.000 description 1
- 101000971203 Homo sapiens Bcl-2-binding component 3, isoforms 1/2 Proteins 0.000 description 1
- 101000971209 Homo sapiens Bcl-2-binding component 3, isoforms 3/4 Proteins 0.000 description 1
- 101000903449 Homo sapiens Bestrophin-1 Proteins 0.000 description 1
- 101001090662 Homo sapiens Beta-1,3-glucuronyltransferase LARGE1 Proteins 0.000 description 1
- 101000919505 Homo sapiens Beta-crystallin B1 Proteins 0.000 description 1
- 101001045433 Homo sapiens Beta-hexosaminidase subunit beta Proteins 0.000 description 1
- 101000984541 Homo sapiens Bleomycin hydrolase Proteins 0.000 description 1
- 101000777599 Homo sapiens C-C chemokine receptor type 2 Proteins 0.000 description 1
- 101000946926 Homo sapiens C-C chemokine receptor type 5 Proteins 0.000 description 1
- 101000824531 Homo sapiens CAAX prenyl protease 1 homolog Proteins 0.000 description 1
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 1
- 101000715398 Homo sapiens Caspase-1 Proteins 0.000 description 1
- 101000916264 Homo sapiens Catenin delta-1 Proteins 0.000 description 1
- 101000715467 Homo sapiens Caveolin-1 Proteins 0.000 description 1
- 101000912851 Homo sapiens Clathrin heavy chain 1 Proteins 0.000 description 1
- 101000749331 Homo sapiens Claudin-1 Proteins 0.000 description 1
- 101000980888 Homo sapiens Codanin-1 Proteins 0.000 description 1
- 101000737554 Homo sapiens Complement factor D Proteins 0.000 description 1
- 101000855583 Homo sapiens Cysteine sulfinic acid decarboxylase Proteins 0.000 description 1
- 101000856723 Homo sapiens Cytochrome b-245 light chain Proteins 0.000 description 1
- 101000736065 Homo sapiens DNA replication complex GINS protein PSF2 Proteins 0.000 description 1
- 101000599038 Homo sapiens DNA-binding protein Ikaros Proteins 0.000 description 1
- 101000902365 Homo sapiens Dihydropteridine reductase Proteins 0.000 description 1
- 101000832769 Homo sapiens Disintegrin and metalloproteinase domain-containing protein 9 Proteins 0.000 description 1
- 101000805172 Homo sapiens Docking protein 1 Proteins 0.000 description 1
- 101000927562 Homo sapiens Dopamine beta-hydroxylase Proteins 0.000 description 1
- 101000848191 Homo sapiens E3 ubiquitin-protein ligase FANCL Proteins 0.000 description 1
- 101000804865 Homo sapiens E3 ubiquitin-protein ligase XIAP Proteins 0.000 description 1
- 101001049697 Homo sapiens Early growth response protein 1 Proteins 0.000 description 1
- 101001024566 Homo sapiens Ecto-ADP-ribosyltransferase 4 Proteins 0.000 description 1
- 101100119754 Homo sapiens FANCL gene Proteins 0.000 description 1
- 101000914673 Homo sapiens Fanconi anemia group A protein Proteins 0.000 description 1
- 101000914680 Homo sapiens Fanconi anemia group C protein Proteins 0.000 description 1
- 101000846244 Homo sapiens Fibrinogen alpha chain Proteins 0.000 description 1
- 101000980756 Homo sapiens G1/S-specific cyclin-D1 Proteins 0.000 description 1
- 101001059150 Homo sapiens Gelsolin Proteins 0.000 description 1
- 101000886173 Homo sapiens Glucose-6-phosphate exchanger SLC37A4 Proteins 0.000 description 1
- 101000873786 Homo sapiens Glutamate decarboxylase 2 Proteins 0.000 description 1
- 101001010449 Homo sapiens Glutamate receptor 2 Proteins 0.000 description 1
- 101001072736 Homo sapiens Glycine-tRNA ligase Proteins 0.000 description 1
- 101001036117 Homo sapiens Glycogen [starch] synthase, liver Proteins 0.000 description 1
- 101000700616 Homo sapiens Glycogen phosphorylase, liver form Proteins 0.000 description 1
- 101001066158 Homo sapiens Growth arrest and DNA damage-inducible protein GADD45 alpha Proteins 0.000 description 1
- 101001035011 Homo sapiens Histone deacetylase 2 Proteins 0.000 description 1
- 101000899282 Homo sapiens Histone deacetylase 3 Proteins 0.000 description 1
- 101000899259 Homo sapiens Histone deacetylase 4 Proteins 0.000 description 1
- 101000899255 Homo sapiens Histone deacetylase 5 Proteins 0.000 description 1
- 101000899330 Homo sapiens Histone deacetylase 6 Proteins 0.000 description 1
- 101001032113 Homo sapiens Histone deacetylase 7 Proteins 0.000 description 1
- 101001032092 Homo sapiens Histone deacetylase 9 Proteins 0.000 description 1
- 101000843809 Homo sapiens Hydroxycarboxylic acid receptor 2 Proteins 0.000 description 1
- 101000976075 Homo sapiens Insulin Proteins 0.000 description 1
- 101001034652 Homo sapiens Insulin-like growth factor 1 receptor Proteins 0.000 description 1
- 101000599940 Homo sapiens Interferon gamma Proteins 0.000 description 1
- 101001076418 Homo sapiens Interleukin-1 receptor type 1 Proteins 0.000 description 1
- 101000599048 Homo sapiens Interleukin-6 receptor subunit alpha Proteins 0.000 description 1
- 101000599056 Homo sapiens Interleukin-6 receptor subunit beta Proteins 0.000 description 1
- 101001043809 Homo sapiens Interleukin-7 receptor subunit alpha Proteins 0.000 description 1
- 101001046633 Homo sapiens Junctional adhesion molecule A Proteins 0.000 description 1
- 101100086477 Homo sapiens KRAS gene Proteins 0.000 description 1
- 101000998020 Homo sapiens Keratin, type I cytoskeletal 18 Proteins 0.000 description 1
- 101000975496 Homo sapiens Keratin, type II cytoskeletal 8 Proteins 0.000 description 1
- 101000945492 Homo sapiens Killer cell immunoglobulin-like receptor 3DS1 Proteins 0.000 description 1
- 101001137642 Homo sapiens Kinase suppressor of Ras 1 Proteins 0.000 description 1
- 101001091610 Homo sapiens Krev interaction trapped protein 1 Proteins 0.000 description 1
- 101001004946 Homo sapiens Lactoylglutathione lyase Proteins 0.000 description 1
- 101001005166 Homo sapiens Lens fiber membrane intrinsic protein Proteins 0.000 description 1
- 101001003687 Homo sapiens Lipoma-preferred partner Proteins 0.000 description 1
- 101001018100 Homo sapiens Lysozyme C Proteins 0.000 description 1
- 101000634835 Homo sapiens M1-specific T cell receptor alpha chain Proteins 0.000 description 1
- 101000573901 Homo sapiens Major prion protein Proteins 0.000 description 1
- 101001008874 Homo sapiens Mast/stem cell growth factor receptor Kit Proteins 0.000 description 1
- 101001011906 Homo sapiens Matrix metalloproteinase-14 Proteins 0.000 description 1
- 101000990902 Homo sapiens Matrix metalloproteinase-9 Proteins 0.000 description 1
- 101000614988 Homo sapiens Mediator of RNA polymerase II transcription subunit 12 Proteins 0.000 description 1
- 101001057159 Homo sapiens Melanoma-associated antigen C3 Proteins 0.000 description 1
- 101000615488 Homo sapiens Methyl-CpG-binding domain protein 2 Proteins 0.000 description 1
- 101000615261 Homo sapiens Multiple coagulation factor deficiency protein 2 Proteins 0.000 description 1
- 101000958866 Homo sapiens Myogenic factor 6 Proteins 0.000 description 1
- 101001030232 Homo sapiens Myosin-9 Proteins 0.000 description 1
- 101001128138 Homo sapiens NACHT, LRR and PYD domains-containing protein 2 Proteins 0.000 description 1
- 101001111187 Homo sapiens NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial Proteins 0.000 description 1
- 101000603172 Homo sapiens Neuroligin-3 Proteins 0.000 description 1
- 101000577540 Homo sapiens Neuropilin-1 Proteins 0.000 description 1
- 101000981336 Homo sapiens Nibrin Proteins 0.000 description 1
- 101001124991 Homo sapiens Nitric oxide synthase, inducible Proteins 0.000 description 1
- 101000598160 Homo sapiens Nuclear mitotic apparatus protein 1 Proteins 0.000 description 1
- 101000602930 Homo sapiens Nuclear receptor coactivator 2 Proteins 0.000 description 1
- 101000974356 Homo sapiens Nuclear receptor coactivator 3 Proteins 0.000 description 1
- 101000974015 Homo sapiens Nucleosome assembly protein 1-like 1 Proteins 0.000 description 1
- 101000613806 Homo sapiens Osteopetrosis-associated transmembrane protein 1 Proteins 0.000 description 1
- 101000614405 Homo sapiens P2X purinoceptor 1 Proteins 0.000 description 1
- 101001098175 Homo sapiens P2X purinoceptor 7 Proteins 0.000 description 1
- 101000601647 Homo sapiens Paired box protein Pax-6 Proteins 0.000 description 1
- 101000987578 Homo sapiens Peripherin Proteins 0.000 description 1
- 101000741790 Homo sapiens Peroxisome proliferator-activated receptor gamma Proteins 0.000 description 1
- 101000730454 Homo sapiens Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha Proteins 0.000 description 1
- 101000595674 Homo sapiens Pituitary homeobox 3 Proteins 0.000 description 1
- 101001126417 Homo sapiens Platelet-derived growth factor receptor alpha Proteins 0.000 description 1
- 101001074444 Homo sapiens Polycystin-1 Proteins 0.000 description 1
- 101000610107 Homo sapiens Pre-B-cell leukemia transcription factor 1 Proteins 0.000 description 1
- 101000892338 Homo sapiens Protein AF1q Proteins 0.000 description 1
- 101001123963 Homo sapiens Protein O-mannosyl-transferase 1 Proteins 0.000 description 1
- 101000735417 Homo sapiens Protein PAPPAS Proteins 0.000 description 1
- 101000781981 Homo sapiens Protein Wnt-11 Proteins 0.000 description 1
- 101000804792 Homo sapiens Protein Wnt-5a Proteins 0.000 description 1
- 101000780643 Homo sapiens Protein argonaute-2 Proteins 0.000 description 1
- 101000928791 Homo sapiens Protein diaphanous homolog 1 Proteins 0.000 description 1
- 101000863978 Homo sapiens Protein downstream neighbor of Son Proteins 0.000 description 1
- 101000644045 Homo sapiens Protein unc-13 homolog D Proteins 0.000 description 1
- 101000666171 Homo sapiens Protein-glutamine gamma-glutamyltransferase 2 Proteins 0.000 description 1
- 101000600434 Homo sapiens Putative uncharacterized protein encoded by MIR7-3HG Proteins 0.000 description 1
- 101001091536 Homo sapiens Pyruvate kinase PKLR Proteins 0.000 description 1
- 101000687448 Homo sapiens REST corepressor 1 Proteins 0.000 description 1
- 101001109145 Homo sapiens Receptor-interacting serine/threonine-protein kinase 1 Proteins 0.000 description 1
- 101001075466 Homo sapiens Regulatory factor X-associated protein Proteins 0.000 description 1
- 101000742938 Homo sapiens Retinol dehydrogenase 12 Proteins 0.000 description 1
- 101000846336 Homo sapiens Ribitol-5-phosphate transferase FKTN Proteins 0.000 description 1
- 101000945093 Homo sapiens Ribosomal protein S6 kinase alpha-4 Proteins 0.000 description 1
- 101000650588 Homo sapiens Roundabout homolog 3 Proteins 0.000 description 1
- 101100421141 Homo sapiens SELENON gene Proteins 0.000 description 1
- 101000939246 Homo sapiens SUMO-conjugating enzyme UBC9 Proteins 0.000 description 1
- 101000873658 Homo sapiens Secretogranin-3 Proteins 0.000 description 1
- 101000785063 Homo sapiens Serine-protein kinase ATM Proteins 0.000 description 1
- 101000904787 Homo sapiens Serine/threonine-protein kinase ATR Proteins 0.000 description 1
- 101001026882 Homo sapiens Serine/threonine-protein kinase D2 Proteins 0.000 description 1
- 101000755690 Homo sapiens Single-stranded DNA cytosine deaminase Proteins 0.000 description 1
- 101000868152 Homo sapiens Son of sevenless homolog 1 Proteins 0.000 description 1
- 101000881247 Homo sapiens Spectrin beta chain, erythrocytic Proteins 0.000 description 1
- 101000652369 Homo sapiens Spermatogenesis-associated protein 7 Proteins 0.000 description 1
- 101000829367 Homo sapiens Src substrate cortactin Proteins 0.000 description 1
- 101000821100 Homo sapiens Synapsin-1 Proteins 0.000 description 1
- 101000575685 Homo sapiens Synembryn-B Proteins 0.000 description 1
- 101000617808 Homo sapiens Synphilin-1 Proteins 0.000 description 1
- 101000634836 Homo sapiens T cell receptor alpha chain MC.7.G5 Proteins 0.000 description 1
- 101000625330 Homo sapiens T-cell acute lymphocytic leukemia protein 2 Proteins 0.000 description 1
- 101000946860 Homo sapiens T-cell surface glycoprotein CD3 epsilon chain Proteins 0.000 description 1
- 101000738413 Homo sapiens T-cell surface glycoprotein CD3 gamma chain Proteins 0.000 description 1
- 101100368708 Homo sapiens TACSTD2 gene Proteins 0.000 description 1
- 101000652482 Homo sapiens TBC1 domain family member 8 Proteins 0.000 description 1
- 101000596277 Homo sapiens TSC22 domain family protein 3 Proteins 0.000 description 1
- 101000649068 Homo sapiens Tapasin Proteins 0.000 description 1
- 101000658622 Homo sapiens Testis-specific Y-encoded-like protein 2 Proteins 0.000 description 1
- 101000802084 Homo sapiens Thiosulfate sulfurtransferase Proteins 0.000 description 1
- 101000715050 Homo sapiens Thromboxane A2 receptor Proteins 0.000 description 1
- 101000625299 Homo sapiens Transcription initiation factor TFIID subunit 4B Proteins 0.000 description 1
- 101000894871 Homo sapiens Transcription regulator protein BACH1 Proteins 0.000 description 1
- 101001057686 Homo sapiens Translation initiation factor eIF-2B subunit alpha Proteins 0.000 description 1
- 101001057681 Homo sapiens Translation initiation factor eIF-2B subunit beta Proteins 0.000 description 1
- 101000925982 Homo sapiens Translation initiation factor eIF-2B subunit delta Proteins 0.000 description 1
- 101000925985 Homo sapiens Translation initiation factor eIF-2B subunit epsilon Proteins 0.000 description 1
- 101001049688 Homo sapiens Translation initiation factor eIF-2B subunit gamma Proteins 0.000 description 1
- 101000631620 Homo sapiens Translocation protein SEC63 homolog Proteins 0.000 description 1
- 101000795167 Homo sapiens Tumor necrosis factor receptor superfamily member 13B Proteins 0.000 description 1
- 101000611185 Homo sapiens Tumor necrosis factor receptor superfamily member 5 Proteins 0.000 description 1
- 101000613251 Homo sapiens Tumor susceptibility gene 101 protein Proteins 0.000 description 1
- 101001087422 Homo sapiens Tyrosine-protein phosphatase non-receptor type 13 Proteins 0.000 description 1
- 101000617285 Homo sapiens Tyrosine-protein phosphatase non-receptor type 6 Proteins 0.000 description 1
- 101000749634 Homo sapiens Uromodulin Proteins 0.000 description 1
- 101001061851 Homo sapiens V(D)J recombination-activating protein 2 Proteins 0.000 description 1
- 101000742373 Homo sapiens Vesicular inhibitory amino acid transporter Proteins 0.000 description 1
- 101001104102 Homo sapiens X-linked retinitis pigmentosa GTPase regulator Proteins 0.000 description 1
- 101100377226 Homo sapiens ZBTB16 gene Proteins 0.000 description 1
- 101000964425 Homo sapiens Zinc finger and BTB domain-containing protein 16 Proteins 0.000 description 1
- 101001074035 Homo sapiens Zinc finger protein GLI2 Proteins 0.000 description 1
- 101001117146 Homo sapiens [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial Proteins 0.000 description 1
- 206010020460 Human T-cell lymphotropic virus type I infection Diseases 0.000 description 1
- 241000714260 Human T-lymphotropic virus 1 Species 0.000 description 1
- 241000701109 Human adenovirus 2 Species 0.000 description 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 1
- 102000016252 Huntingtin Human genes 0.000 description 1
- 108050004784 Huntingtin Proteins 0.000 description 1
- 208000025500 Hutchinson-Gilford progeria syndrome Diseases 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- WOBHKFSMXKNTIM-UHFFFAOYSA-N Hydroxyethyl methacrylate Chemical compound CC(=C)C(=O)OCCO WOBHKFSMXKNTIM-UHFFFAOYSA-N 0.000 description 1
- 108010031794 IGF Type 1 Receptor Proteins 0.000 description 1
- 102000038455 IGF Type 1 Receptor Human genes 0.000 description 1
- 108010031792 IGF Type 2 Receptor Proteins 0.000 description 1
- 102000038460 IGF Type 2 Receptor Human genes 0.000 description 1
- 101150088952 IGF1 gene Proteins 0.000 description 1
- 101150016712 IKZF1 gene Proteins 0.000 description 1
- 101150002416 Igf2 gene Proteins 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 208000029462 Immunodeficiency disease Diseases 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 108050000123 Inactive phospholipase C-like protein 1 Proteins 0.000 description 1
- 101710128560 Initiator protein NS1 Proteins 0.000 description 1
- 102100023915 Insulin Human genes 0.000 description 1
- 102100036721 Insulin receptor Human genes 0.000 description 1
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 description 1
- 102100034349 Integrase Human genes 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 102100026016 Interleukin-1 receptor type 1 Human genes 0.000 description 1
- 102100039068 Interleukin-10 Human genes 0.000 description 1
- 102100037792 Interleukin-6 receptor subunit alpha Human genes 0.000 description 1
- 102100037795 Interleukin-6 receptor subunit beta Human genes 0.000 description 1
- 102100021593 Interleukin-7 receptor subunit alpha Human genes 0.000 description 1
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 1
- 208000034613 Isolated polycystic liver disease Diseases 0.000 description 1
- 102100022304 Junctional adhesion molecule A Human genes 0.000 description 1
- 108700042464 KRIT1 Proteins 0.000 description 1
- 101150090242 KRIT1 gene Proteins 0.000 description 1
- 102100033421 Keratin, type I cytoskeletal 18 Human genes 0.000 description 1
- 102100023972 Keratin, type II cytoskeletal 8 Human genes 0.000 description 1
- 102100034833 Killer cell immunoglobulin-like receptor 3DS1 Human genes 0.000 description 1
- 102100021001 Kinase suppressor of Ras 1 Human genes 0.000 description 1
- 101150105104 Kras gene Proteins 0.000 description 1
- ZGUNAGUHMKGQNY-ZETCQYMHSA-N L-alpha-phenylglycine zwitterion Chemical compound OC(=O)[C@@H](N)C1=CC=CC=C1 ZGUNAGUHMKGQNY-ZETCQYMHSA-N 0.000 description 1
- 108010064700 L-arabinitol 4-dehydrogenase Proteins 0.000 description 1
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 102100026004 Lactoylglutathione lyase Human genes 0.000 description 1
- 101710128836 Large T antigen Proteins 0.000 description 1
- 201000002503 Leber congenital amaurosis 1 Diseases 0.000 description 1
- 208000005906 Leber congenital amaurosis 3 Diseases 0.000 description 1
- 101710115990 Lens fiber membrane intrinsic protein Proteins 0.000 description 1
- 102100026358 Lipoma-preferred partner Human genes 0.000 description 1
- 241000186781 Listeria Species 0.000 description 1
- 108010009491 Lysosomal-Associated Membrane Protein 2 Proteins 0.000 description 1
- 102100038225 Lysosome-associated membrane glycoprotein 2 Human genes 0.000 description 1
- 102100033468 Lysozyme C Human genes 0.000 description 1
- 102000043136 MAP kinase family Human genes 0.000 description 1
- 108091054455 MAP kinase family Proteins 0.000 description 1
- 239000007993 MOPS buffer Substances 0.000 description 1
- 108700012912 MYCN Proteins 0.000 description 1
- 101150022024 MYCN gene Proteins 0.000 description 1
- 101150053046 MYD88 gene Proteins 0.000 description 1
- 208000035719 Maculopathy Diseases 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 102100027754 Mast/stem cell growth factor receptor Kit Human genes 0.000 description 1
- 102100030216 Matrix metalloproteinase-14 Human genes 0.000 description 1
- 102100030412 Matrix metalloproteinase-9 Human genes 0.000 description 1
- 102100021070 Mediator of RNA polymerase II transcription subunit 12 Human genes 0.000 description 1
- 108700020845 Medullary Cystic Kidney Disease 2 Proteins 0.000 description 1
- 108010023338 Member 3 Subfamily B ATP Binding Cassette Transporter Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 241000202974 Methanobacterium Species 0.000 description 1
- 241000203353 Methanococcus Species 0.000 description 1
- 241000204675 Methanopyrus Species 0.000 description 1
- 241000205276 Methanosarcina Species 0.000 description 1
- 102100021299 Methyl-CpG-binding domain protein 2 Human genes 0.000 description 1
- 241000589345 Methylococcus Species 0.000 description 1
- 108060004795 Methyltransferase Proteins 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 102100040243 Microtubule-associated protein tau Human genes 0.000 description 1
- 108010047660 Mitochondrial intermediate peptidase Proteins 0.000 description 1
- 102100025744 Mothers against decapentaplegic homolog 1 Human genes 0.000 description 1
- 102100025751 Mothers against decapentaplegic homolog 2 Human genes 0.000 description 1
- 101710143123 Mothers against decapentaplegic homolog 2 Proteins 0.000 description 1
- 102100025748 Mothers against decapentaplegic homolog 3 Human genes 0.000 description 1
- 101710143111 Mothers against decapentaplegic homolog 3 Proteins 0.000 description 1
- 102100025725 Mothers against decapentaplegic homolog 4 Human genes 0.000 description 1
- 101710143112 Mothers against decapentaplegic homolog 4 Proteins 0.000 description 1
- 102100021387 Multiple coagulation factor deficiency protein 2 Human genes 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101000981253 Mus musculus GPI-linked NAD(P)(+)-arginine ADP-ribosyltransferase 1 Proteins 0.000 description 1
- 101000834850 Mus musculus KICSTOR complex protein SZT2 Proteins 0.000 description 1
- 101100127196 Mus musculus Kera gene Proteins 0.000 description 1
- 101100078999 Mus musculus Mx1 gene Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 241000186359 Mycobacterium Species 0.000 description 1
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 1
- 102100024134 Myeloid differentiation primary response protein MyD88 Human genes 0.000 description 1
- 102100038379 Myogenic factor 6 Human genes 0.000 description 1
- 201000004458 Myoma Diseases 0.000 description 1
- 102100038938 Myosin-9 Human genes 0.000 description 1
- 241000863420 Myxococcus Species 0.000 description 1
- 108700026495 N-Myc Proto-Oncogene Proteins 0.000 description 1
- WWGBHDIHIVGYLZ-UHFFFAOYSA-N N-[4-[3-[[[7-(hydroxyamino)-7-oxoheptyl]amino]-oxomethyl]-5-isoxazolyl]phenyl]carbamic acid tert-butyl ester Chemical compound C1=CC(NC(=O)OC(C)(C)C)=CC=C1C1=CC(C(=O)NCCCCCCC(=O)NO)=NO1 WWGBHDIHIVGYLZ-UHFFFAOYSA-N 0.000 description 1
- 102100030124 N-myc proto-oncogene protein Human genes 0.000 description 1
- 102100023964 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial Human genes 0.000 description 1
- 102000004019 NADPH Oxidase 1 Human genes 0.000 description 1
- 108090000424 NADPH Oxidase 1 Proteins 0.000 description 1
- 108010082739 NADPH Oxidase 2 Proteins 0.000 description 1
- 108091061960 Naked DNA Proteins 0.000 description 1
- 102100021867 Natural resistance-associated macrophage protein 2 Human genes 0.000 description 1
- 102000048850 Neoplasm Genes Human genes 0.000 description 1
- 108700019961 Neoplasm Genes Proteins 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 102400000058 Neuregulin-1 Human genes 0.000 description 1
- 208000007382 Neurofibromatosis-Noonan syndrome Diseases 0.000 description 1
- 108010088373 Neurofilament Proteins Proteins 0.000 description 1
- 102000008763 Neurofilament Proteins Human genes 0.000 description 1
- 102100038940 Neuroligin-3 Human genes 0.000 description 1
- 108090000772 Neuropilin-1 Proteins 0.000 description 1
- 101100058191 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) bcp-1 gene Proteins 0.000 description 1
- 101100385413 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) csm-3 gene Proteins 0.000 description 1
- 102100024403 Nibrin Human genes 0.000 description 1
- 102100029438 Nitric oxide synthase, inducible Human genes 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 241000605122 Nitrosomonas Species 0.000 description 1
- 101710144127 Non-structural protein 1 Proteins 0.000 description 1
- 108020004485 Nonsense Codon Proteins 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108010062309 Nuclear Receptor Interacting Protein 1 Proteins 0.000 description 1
- 102100036961 Nuclear mitotic apparatus protein 1 Human genes 0.000 description 1
- 102100037226 Nuclear receptor coactivator 2 Human genes 0.000 description 1
- 102100022883 Nuclear receptor coactivator 3 Human genes 0.000 description 1
- 102100029558 Nuclear receptor-interacting protein 1 Human genes 0.000 description 1
- 102100040559 Osteopetrosis-associated transmembrane protein 1 Human genes 0.000 description 1
- 101710189973 P2X purinoceptor 1 Proteins 0.000 description 1
- 101710189965 P2X purinoceptor 7 Proteins 0.000 description 1
- 108010032788 PAX6 Transcription Factor Proteins 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 101150102323 PDYN gene Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 108010028924 PPAR alpha Proteins 0.000 description 1
- 102000023984 PPAR alpha Human genes 0.000 description 1
- 108010016731 PPAR gamma Proteins 0.000 description 1
- 102000000536 PPAR gamma Human genes 0.000 description 1
- 101150010978 PRKCE gene Proteins 0.000 description 1
- 241000606860 Pasteurella Species 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 102000008880 Peptidase C12, ubiquitin carboxyl-terminal hydrolases Human genes 0.000 description 1
- 108090000882 Peptidyl-Dipeptidase A Proteins 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 102100038825 Peroxisome proliferator-activated receptor gamma Human genes 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 201000011252 Phenylketonuria Diseases 0.000 description 1
- 102100032615 Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha Human genes 0.000 description 1
- 108010064209 Phosphoribosylglycinamide formyltransferase Proteins 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 241000607568 Photobacterium Species 0.000 description 1
- 241000204826 Picrophilus Species 0.000 description 1
- 101100352419 Pithecopus hypochondrialis psn1 gene Proteins 0.000 description 1
- 102100036088 Pituitary homeobox 3 Human genes 0.000 description 1
- 108010051742 Platelet-Derived Growth Factor beta Receptor Proteins 0.000 description 1
- 102100030485 Platelet-derived growth factor receptor alpha Human genes 0.000 description 1
- 102100026547 Platelet-derived growth factor receptor beta Human genes 0.000 description 1
- 108010054050 Plectin Proteins 0.000 description 1
- RVGRUAULSDPKGF-UHFFFAOYSA-N Poloxamer Chemical compound C1CO1.CC1CO1 RVGRUAULSDPKGF-UHFFFAOYSA-N 0.000 description 1
- 108010064218 Poly (ADP-Ribose) Polymerase-1 Proteins 0.000 description 1
- 102100023712 Poly [ADP-ribose] polymerase 1 Human genes 0.000 description 1
- 108010061844 Poly(ADP-ribose) Polymerases Proteins 0.000 description 1
- 102000012338 Poly(ADP-ribose) Polymerases Human genes 0.000 description 1
- 229920000776 Poly(Adenosine diphosphate-ribose) polymerase Polymers 0.000 description 1
- 241000605894 Porphyromonas Species 0.000 description 1
- 102100040171 Pre-B-cell leukemia transcription factor 1 Human genes 0.000 description 1
- 108010015078 Pregnancy-Associated alpha 2-Macroglobulins Proteins 0.000 description 1
- 108091000054 Prion Proteins 0.000 description 1
- 102000029797 Prion Human genes 0.000 description 1
- WDVSHHCDHLJJJR-UHFFFAOYSA-N Proflavine Chemical compound C1=CC(N)=CC2=NC3=CC(N)=CC=C3C=C21 WDVSHHCDHLJJJR-UHFFFAOYSA-N 0.000 description 1
- 208000007932 Progeria Diseases 0.000 description 1
- 108010049395 Prokaryotic Initiation Factor-2 Proteins 0.000 description 1
- 108700003766 Promyelocytic Leukemia Zinc Finger Proteins 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-N Propionic acid Chemical class CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 1
- 102100040665 Protein AF1q Human genes 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 102100028120 Protein O-mannosyl-transferase 1 Human genes 0.000 description 1
- 102100036567 Protein Wnt-11 Human genes 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 102100036467 Protein delta homolog 1 Human genes 0.000 description 1
- 102100036490 Protein diaphanous homolog 1 Human genes 0.000 description 1
- 102100023068 Protein kinase C-binding protein NELL1 Human genes 0.000 description 1
- 102100020988 Protein unc-13 homolog D Human genes 0.000 description 1
- 102100038095 Protein-glutamine gamma-glutamyltransferase 2 Human genes 0.000 description 1
- 208000032225 Proximal spinal muscular atrophy type 1 Diseases 0.000 description 1
- 208000033522 Proximal spinal muscular atrophy type 2 Diseases 0.000 description 1
- 208000033526 Proximal spinal muscular atrophy type 3 Diseases 0.000 description 1
- 208000033550 Proximal spinal muscular atrophy type 4 Diseases 0.000 description 1
- 102100037401 Putative uncharacterized protein encoded by MIR7-3HG Human genes 0.000 description 1
- 241000205226 Pyrobaculum Species 0.000 description 1
- 241000205160 Pyrococcus Species 0.000 description 1
- 102100034909 Pyruvate kinase PKLR Human genes 0.000 description 1
- 102000001183 RAG-1 Human genes 0.000 description 1
- 108060006897 RAG1 Proteins 0.000 description 1
- 102100024864 REST corepressor 1 Human genes 0.000 description 1
- 102000014450 RNA Polymerase III Human genes 0.000 description 1
- 108010078067 RNA Polymerase III Proteins 0.000 description 1
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 1
- 230000007022 RNA scission Effects 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 101100047461 Rattus norvegicus Trpm8 gene Proteins 0.000 description 1
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 1
- 102100029986 Receptor tyrosine-protein kinase erbB-3 Human genes 0.000 description 1
- 102100029981 Receptor tyrosine-protein kinase erbB-4 Human genes 0.000 description 1
- 101710100963 Receptor tyrosine-protein kinase erbB-4 Proteins 0.000 description 1
- 102100022501 Receptor-interacting serine/threonine-protein kinase 1 Human genes 0.000 description 1
- 102100021043 Regulatory factor X-associated protein Human genes 0.000 description 1
- 108091081062 Repeated sequence (DNA) Proteins 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 102100038054 Retinol dehydrogenase 12 Human genes 0.000 description 1
- 208000006289 Rett Syndrome Diseases 0.000 description 1
- 102100039643 Rho-related GTP-binding protein Rho6 Human genes 0.000 description 1
- 101710199571 Rho-related GTP-binding protein Rho6 Proteins 0.000 description 1
- 102100039640 Rho-related GTP-binding protein RhoE Human genes 0.000 description 1
- 108050007494 Rho-related GTP-binding protein RhoE Proteins 0.000 description 1
- 102100031754 Ribitol-5-phosphate transferase FKTN Human genes 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 102100033644 Ribosomal protein S6 kinase alpha-4 Human genes 0.000 description 1
- 208000032822 Ring chromosome 11 syndrome Diseases 0.000 description 1
- KJTLSVCANCCWHF-UHFFFAOYSA-N Ruthenium Chemical compound [Ru] KJTLSVCANCCWHF-UHFFFAOYSA-N 0.000 description 1
- 101150019520 SGCA gene Proteins 0.000 description 1
- SUYXJDLXGFPMCQ-INIZCTEOSA-N SJ000287331 Natural products CC1=c2cnccc2=C(C)C2=Nc3ccccc3[C@H]12 SUYXJDLXGFPMCQ-INIZCTEOSA-N 0.000 description 1
- 108091006618 SLC11A2 Proteins 0.000 description 1
- 108091006647 SLC9A1 Proteins 0.000 description 1
- 101700032040 SMAD1 Proteins 0.000 description 1
- 108060009345 SORL1 Proteins 0.000 description 1
- 101150058731 STAT5A gene Proteins 0.000 description 1
- 102100029807 SUMO-conjugating enzyme UBC9 Human genes 0.000 description 1
- 101000825534 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 40S ribosomal protein S2 Proteins 0.000 description 1
- 101100379220 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) API2 gene Proteins 0.000 description 1
- 101100170553 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) DLD2 gene Proteins 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 101000702553 Schistosoma mansoni Antigen Sm21.7 Proteins 0.000 description 1
- 101000714192 Schistosoma mansoni Tegument antigen Proteins 0.000 description 1
- 101100294206 Schizosaccharomyces pombe (strain 972 / ATCC 24843) fta4 gene Proteins 0.000 description 1
- 241000252141 Semionotiformes Species 0.000 description 1
- 102100023921 Serine/threonine-protein kinase ATR Human genes 0.000 description 1
- 102100031081 Serine/threonine-protein kinase Chk1 Human genes 0.000 description 1
- 102100024481 Signal transducer and activator of transcription 5A Human genes 0.000 description 1
- 101150045565 Socs1 gene Proteins 0.000 description 1
- 102100030980 Sodium/hydrogen exchanger 1 Human genes 0.000 description 1
- 102100025639 Sortilin-related receptor Human genes 0.000 description 1
- 102100037613 Spectrin beta chain, erythrocytic Human genes 0.000 description 1
- 102100030257 Spermatogenesis-associated protein 7 Human genes 0.000 description 1
- 208000033145 Spinal muscular atrophy with respiratory distress type 1 Diseases 0.000 description 1
- 102100023719 Src substrate cortactin Human genes 0.000 description 1
- 241000320123 Streptococcus pyogenes M1 GAS Species 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 241000205101 Sulfolobus Species 0.000 description 1
- 102100032891 Superoxide dismutase [Mn], mitochondrial Human genes 0.000 description 1
- 108700027336 Suppressor of Cytokine Signaling 1 Proteins 0.000 description 1
- 102100024779 Suppressor of cytokine signaling 1 Human genes 0.000 description 1
- 108010002687 Survivin Proteins 0.000 description 1
- 102000001435 Synapsin Human genes 0.000 description 1
- 108050009621 Synapsin Proteins 0.000 description 1
- 102100026014 Synembryn-B Human genes 0.000 description 1
- 102100021997 Synphilin-1 Human genes 0.000 description 1
- 102100029452 T cell receptor alpha chain constant Human genes 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 102100025039 T-cell acute lymphocytic leukemia protein 2 Human genes 0.000 description 1
- 102100035794 T-cell surface glycoprotein CD3 epsilon chain Human genes 0.000 description 1
- 102100037911 T-cell surface glycoprotein CD3 gamma chain Human genes 0.000 description 1
- 108700012457 TACSTD2 Proteins 0.000 description 1
- 102100033456 TGF-beta receptor type-1 Human genes 0.000 description 1
- 101150080074 TP53 gene Proteins 0.000 description 1
- 102100035260 TSC22 domain family protein 3 Human genes 0.000 description 1
- 101800000849 Tachykinin-associated peptide 2 Proteins 0.000 description 1
- 102000018679 Tacrolimus Binding Proteins Human genes 0.000 description 1
- 108010027179 Tacrolimus Binding Proteins Proteins 0.000 description 1
- 101150117918 Tacstd2 gene Proteins 0.000 description 1
- 102100034917 Testis-specific Y-encoded-like protein 2 Human genes 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 208000002903 Thalassemia Diseases 0.000 description 1
- 241000186339 Thermoanaerobacter Species 0.000 description 1
- 241000204667 Thermoplasma Species 0.000 description 1
- 241000204652 Thermotoga Species 0.000 description 1
- 241000589596 Thermus Species 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 102100036704 Thromboxane A2 receptor Human genes 0.000 description 1
- 241000283907 Tragelaphus oryx Species 0.000 description 1
- 102100025035 Transcription initiation factor TFIID subunit 4B Human genes 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 108010011702 Transforming Growth Factor-beta Type I Receptor Proteins 0.000 description 1
- 102100027065 Translation initiation factor eIF-2B subunit beta Human genes 0.000 description 1
- 102100034266 Translation initiation factor eIF-2B subunit delta Human genes 0.000 description 1
- 102100034267 Translation initiation factor eIF-2B subunit epsilon Human genes 0.000 description 1
- 102100023225 Translation initiation factor eIF-2B subunit gamma Human genes 0.000 description 1
- 102100029006 Translocation protein SEC63 homolog Human genes 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 102100029675 Tumor necrosis factor receptor superfamily member 13B Human genes 0.000 description 1
- 102100040879 Tumor susceptibility gene 101 protein Human genes 0.000 description 1
- 208000006391 Type 1 Hyper-IgM Immunodeficiency Syndrome Diseases 0.000 description 1
- 101710116241 Tyrosine-protein phosphatase non-receptor type 11 Proteins 0.000 description 1
- 102100033014 Tyrosine-protein phosphatase non-receptor type 13 Human genes 0.000 description 1
- 102100021657 Tyrosine-protein phosphatase non-receptor type 6 Human genes 0.000 description 1
- 101150044377 UBA1 gene Proteins 0.000 description 1
- 101150035006 UBA3 gene Proteins 0.000 description 1
- 208000033130 UMOD-related autosomal dominant tubulointerstitial kidney disease Diseases 0.000 description 1
- VGQOVCHZGQWAOI-UHFFFAOYSA-N UNPD55612 Natural products N1C(O)C2CC(C=CC(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-UHFFFAOYSA-N 0.000 description 1
- 101150038861 Uchl1 gene Proteins 0.000 description 1
- 101150051860 Uchl3 gene Proteins 0.000 description 1
- 101000868086 Unknown prokaryotic organism Cysteine/Cysteine sulfinic acid decarboxylase Proteins 0.000 description 1
- 101710160987 Uracil-DNA glycosylase Proteins 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 102100040613 Uromodulin Human genes 0.000 description 1
- 102100029591 V(D)J recombination-activating protein 2 Human genes 0.000 description 1
- 102100038170 Vesicular inhibitory amino acid transporter Human genes 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 101710088929 Voltage-dependent L-type calcium channel subunit alpha-1S Proteins 0.000 description 1
- 101150112441 Vsx1 gene Proteins 0.000 description 1
- 108091093126 WHP Posttrascriptional Response Element Proteins 0.000 description 1
- 208000026481 Werdnig-Hoffmann disease Diseases 0.000 description 1
- 239000005862 Whey Substances 0.000 description 1
- 102000007544 Whey Proteins Human genes 0.000 description 1
- 108010046377 Whey Proteins Proteins 0.000 description 1
- 102000043366 Wnt-5a Human genes 0.000 description 1
- 241000605941 Wolinella Species 0.000 description 1
- 201000001696 X-linked hyper IgM syndrome Diseases 0.000 description 1
- 241000589634 Xanthomonas Species 0.000 description 1
- 241000607734 Yersinia <bacteria> Species 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- 108010016200 Zinc Finger Protein GLI1 Proteins 0.000 description 1
- 108010088665 Zinc Finger Protein Gli2 Proteins 0.000 description 1
- 102100035535 Zinc finger protein GLI1 Human genes 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- DPKHZNPWBDQZCN-UHFFFAOYSA-N acridine orange free base Chemical compound C1=CC(N(C)C)=CC2=NC3=CC(N(C)C)=CC=C3C=C21 DPKHZNPWBDQZCN-UHFFFAOYSA-N 0.000 description 1
- 150000001251 acridines Chemical class 0.000 description 1
- 229940023020 acriflavine Drugs 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000004658 acute-phase response Effects 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N adenyl group Chemical group N1=CN=C2N=CNC2=C1N GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 201000006960 adult spinal muscular atrophy Diseases 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 235000010419 agar Nutrition 0.000 description 1
- 206010064930 age-related macular degeneration Diseases 0.000 description 1
- 230000009418 agronomic effect Effects 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 102000009899 alpha Karyopherins Human genes 0.000 description 1
- 108010077099 alpha Karyopherins Proteins 0.000 description 1
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 229940037003 alum Drugs 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- DZHSAHHDTRWUTF-SIQRNXPUSA-N amyloid-beta polypeptide 42 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 DZHSAHHDTRWUTF-SIQRNXPUSA-N 0.000 description 1
- 206010002022 amyloidosis Diseases 0.000 description 1
- 208000007502 anemia Diseases 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- VGQOVCHZGQWAOI-HYUHUPJXSA-N anthramycin Chemical compound N1[C@@H](O)[C@@H]2CC(\C=C\C(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-HYUHUPJXSA-N 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 108010018755 aquaporin 0 Proteins 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 239000005441 aurora Substances 0.000 description 1
- 201000008045 autosomal dominant osteopetrosis 2 Diseases 0.000 description 1
- 208000021033 autosomal dominant polycystic liver disease Diseases 0.000 description 1
- 201000001038 autosomal recessive chronic granulomatous disease cytochrome b-positive type II Diseases 0.000 description 1
- 201000000527 autosomal recessive distal spinal muscular atrophy 1 Diseases 0.000 description 1
- 201000003291 autosomal recessive osteopetrosis 1 Diseases 0.000 description 1
- 230000003376 axonal effect Effects 0.000 description 1
- 150000001558 benzoic acid derivatives Chemical class 0.000 description 1
- DZBUGLKDJFMEHC-UHFFFAOYSA-N benzoquinolinylidene Natural products C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 1
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical group NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 229920003123 carboxymethyl cellulose sodium Polymers 0.000 description 1
- 229940063834 carboxymethylcellulose sodium Drugs 0.000 description 1
- 201000009847 cataract 14 multiple types Diseases 0.000 description 1
- 201000009853 cataract 16 multiple types Diseases 0.000 description 1
- 230000001364 causal effect Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 210000003855 cell nucleus Anatomy 0.000 description 1
- 210000003710 cerebral cortex Anatomy 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 229960003677 chloroquine Drugs 0.000 description 1
- WHTVZRBIWZFKQO-UHFFFAOYSA-N chloroquine Natural products ClC1=CC=C2C(NC(C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-UHFFFAOYSA-N 0.000 description 1
- ZYVSOIYQKUDENJ-WKSBCEQHSA-N chromomycin A3 Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@@H]1OC(C)=O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@@H](O)[C@H](O[C@@H]3O[C@@H](C)[C@H](OC(C)=O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@@H]1C[C@@H](O)[C@@H](OC)[C@@H](C)O1 ZYVSOIYQKUDENJ-WKSBCEQHSA-N 0.000 description 1
- 230000007882 cirrhosis Effects 0.000 description 1
- 208000019425 cirrhosis of liver Diseases 0.000 description 1
- 230000015271 coagulation Effects 0.000 description 1
- 238000005345 coagulation Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000010205 computational analysis Methods 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 235000008504 concentrate Nutrition 0.000 description 1
- 201000006754 cone-rod dystrophy Diseases 0.000 description 1
- 201000000464 cone-rod dystrophy 2 Diseases 0.000 description 1
- 201000000440 cone-rod dystrophy 6 Diseases 0.000 description 1
- 201000000398 cone-rod dystrophy 9 Diseases 0.000 description 1
- 238000004624 confocal microscopy Methods 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 101150055601 cops2 gene Proteins 0.000 description 1
- 239000011258 core-shell material Substances 0.000 description 1
- 201000003046 cornea plana Diseases 0.000 description 1
- 206010011005 corneal dystrophy Diseases 0.000 description 1
- 230000000139 costimulatory effect Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 108091000099 cysteine desulfurase Proteins 0.000 description 1
- 210000004292 cytoskeleton Anatomy 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 239000000412 dendrimer Substances 0.000 description 1
- 229920000736 dendritic polymer Polymers 0.000 description 1
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- QONQRTHLHBTMGP-UHFFFAOYSA-N digitoxigenin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C11OC1CC2C1=CC(=O)OC1 QONQRTHLHBTMGP-UHFFFAOYSA-N 0.000 description 1
- SHIBSTMRCDJXLN-KCZCNTNESA-N digoxigenin Chemical compound C1([C@@H]2[C@@]3([C@@](CC2)(O)[C@H]2[C@@H]([C@@]4(C)CC[C@H](O)C[C@H]4CC2)C[C@H]3O)C)=CC(=O)OC1 SHIBSTMRCDJXLN-KCZCNTNESA-N 0.000 description 1
- 102000004419 dihydrofolate reductase Human genes 0.000 description 1
- 201000011290 dilated cardiomyopathy 1G Diseases 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 108010083141 dipeptidyl carboxypeptidase Proteins 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 208000021347 distal spinal muscular atrophy 1 Diseases 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 206010013663 drug dependence Diseases 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 230000008482 dysregulation Effects 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 230000005670 electromagnetic radiation Effects 0.000 description 1
- 108010025678 empty spiracles homeobox proteins Proteins 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 238000001952 enzyme assay Methods 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 1
- 229960005542 ethidium bromide Drugs 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 229940073505 ethyl vanillin Drugs 0.000 description 1
- 230000002964 excitative effect Effects 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 230000036251 extravasation Effects 0.000 description 1
- 208000008570 facioscapulohumeral muscular dystrophy Diseases 0.000 description 1
- 201000007386 factor VII deficiency Diseases 0.000 description 1
- 208000005376 factor X deficiency Diseases 0.000 description 1
- 201000007219 factor XI deficiency Diseases 0.000 description 1
- 229960000301 factor viii Drugs 0.000 description 1
- 208000015756 familial Alzheimer disease Diseases 0.000 description 1
- 201000007249 familial juvenile hyperuricemic nephropathy Diseases 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 108010021843 fluorescent protein 583 Proteins 0.000 description 1
- 108091006047 fluorescent proteins Proteins 0.000 description 1
- 102000034287 fluorescent proteins Human genes 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 210000001222 gaba-ergic neuron Anatomy 0.000 description 1
- 238000003500 gene array Methods 0.000 description 1
- 238000003209 gene knockout Methods 0.000 description 1
- 230000009368 gene silencing by RNA Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 208000007345 glycogen storage disease Diseases 0.000 description 1
- 101150002245 grin2a gene Proteins 0.000 description 1
- 101150055960 hemB gene Proteins 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 208000014752 hemophagocytic syndrome Diseases 0.000 description 1
- 208000009429 hemophilia B Diseases 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 208000006359 hepatoblastoma Diseases 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 102000056115 human SYN1 Human genes 0.000 description 1
- 210000005119 human aortic smooth muscle cell Anatomy 0.000 description 1
- 239000003906 humectant Substances 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 208000026095 hyper-IgM syndrome type 1 Diseases 0.000 description 1
- 208000018949 hyper-IgM syndrome type 2 Diseases 0.000 description 1
- 208000025762 hyper-IgM syndrome type 4 Diseases 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 230000007813 immunodeficiency Effects 0.000 description 1
- 201000001373 immunodeficiency with hyper-IgM type 2 Diseases 0.000 description 1
- 201000001399 immunodeficiency with hyper-IgM type 4 Diseases 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 238000000530 impalefection Methods 0.000 description 1
- 238000000126 in silico method Methods 0.000 description 1
- 238000007901 in situ hybridization Methods 0.000 description 1
- 238000003017 in situ immunoassay Methods 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000006882 induction of apoptosis Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 108700032552 influenza virus INS1 Proteins 0.000 description 1
- 230000004941 influx Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 239000012212 insulator Substances 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 201000006913 intermediate spinal muscular atrophy Diseases 0.000 description 1
- 102000008371 intracellularly ATP-gated chloride channel activity proteins Human genes 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 208000028507 juvenile open angle glaucoma Diseases 0.000 description 1
- 201000004815 juvenile spinal muscular atrophy Diseases 0.000 description 1
- 101150044508 key gene Proteins 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 231100000835 liver failure Toxicity 0.000 description 1
- 208000007903 liver failure Diseases 0.000 description 1
- 210000005228 liver tissue Anatomy 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 150000002690 malonic acid derivatives Chemical class 0.000 description 1
- 210000005075 mammary gland Anatomy 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000008204 material by function Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 230000003387 muscular Effects 0.000 description 1
- 201000000585 muscular atrophy Diseases 0.000 description 1
- 201000006938 muscular dystrophy Diseases 0.000 description 1
- 208000025855 muscular dystrophy-dystroglycanopathy (congenital with brain and eye anomalies), type A, 4 Diseases 0.000 description 1
- 201000006946 muscular dystrophy-dystroglycanopathy type B6 Diseases 0.000 description 1
- UPBAOYRENQEPJO-UHFFFAOYSA-N n-[5-[[5-[(3-amino-3-iminopropyl)carbamoyl]-1-methylpyrrol-3-yl]carbamoyl]-1-methylpyrrol-3-yl]-4-formamido-1-methylpyrrole-2-carboxamide Chemical compound CN1C=C(NC=O)C=C1C(=O)NC1=CN(C)C(C(=O)NC2=CN(C)C(C(=O)NCCC(N)=N)=C2)=C1 UPBAOYRENQEPJO-UHFFFAOYSA-N 0.000 description 1
- 239000002070 nanowire Substances 0.000 description 1
- 230000009826 neoplastic cell growth Effects 0.000 description 1
- 210000005044 neurofilament Anatomy 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 125000004433 nitrogen atom Chemical group N* 0.000 description 1
- 230000037434 nonsense mutation Effects 0.000 description 1
- 230000009438 off-target cleavage Effects 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 210000000963 osteoblast Anatomy 0.000 description 1
- 208000002865 osteopetrosis Diseases 0.000 description 1
- 201000001937 osteoporosis-pseudoglioma syndrome Diseases 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 229940090668 parachlorophenol Drugs 0.000 description 1
- 102000045222 parkin Human genes 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 239000001814 pectin Substances 0.000 description 1
- 235000010987 pectin Nutrition 0.000 description 1
- 229920001277 pectin Polymers 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 239000000816 peptidomimetic Substances 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 229940067107 phenylethyl alcohol Drugs 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 108010034343 phosphoribosylamine-glycine ligase Proteins 0.000 description 1
- 108091005981 phosphorylated proteins Proteins 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 229960003171 plicamycin Drugs 0.000 description 1
- 229960000502 poloxamer Drugs 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 208000030761 polycystic kidney disease Diseases 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 125000004424 polypyridyl Polymers 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 1
- 235000010241 potassium sorbate Nutrition 0.000 description 1
- 239000004302 potassium sorbate Substances 0.000 description 1
- 229940069338 potassium sorbate Drugs 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 238000003825 pressing Methods 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 229960000286 proflavine Drugs 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 1
- 239000000473 propyl gallate Substances 0.000 description 1
- 235000010388 propyl gallate Nutrition 0.000 description 1
- 229940075579 propyl gallate Drugs 0.000 description 1
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- ODLMAHJVESYWTB-UHFFFAOYSA-N propylbenzene Chemical compound CCCC1=CC=CC=C1 ODLMAHJVESYWTB-UHFFFAOYSA-N 0.000 description 1
- 235000004252 protein component Nutrition 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 238000001273 protein sequence alignment Methods 0.000 description 1
- 230000012743 protein tagging Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- ZJFJVRPLNAMIKH-UHFFFAOYSA-N pseudo-u Chemical compound O=C1NC(=O)C(C)=CN1C1OC(COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=NC=NC(N)=C3N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=NC=NC(N)=C3N=C2)COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=NC=NC(N)=C3N=C2)CO)C(O)C1 ZJFJVRPLNAMIKH-UHFFFAOYSA-N 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 238000012207 quantitative assay Methods 0.000 description 1
- 239000013645 rAAV1 vector Substances 0.000 description 1
- 239000013646 rAAV2 vector Substances 0.000 description 1
- 108700022487 rRNA Genes Proteins 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 102000005912 ran GTP Binding Protein Human genes 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000009711 regulatory function Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 230000000754 repressing effect Effects 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 108020004418 ribosomal RNA Proteins 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 201000006956 rigid spine muscular dystrophy 1 Diseases 0.000 description 1
- 229910052707 ruthenium Inorganic materials 0.000 description 1
- 238000007480 sanger sequencing Methods 0.000 description 1
- 208000010532 sarcoglycanopathy Diseases 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 208000007056 sickle cell anemia Diseases 0.000 description 1
- 229910052710 silicon Inorganic materials 0.000 description 1
- 239000010703 silicon Substances 0.000 description 1
- 230000005783 single-strand break Effects 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- 235000017557 sodium bicarbonate Nutrition 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 238000011895 specific detection Methods 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 108010042747 stallimycin Proteins 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 102000005969 steroid hormone receptors Human genes 0.000 description 1
- 108020003113 steroid hormone receptors Proteins 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 230000035882 stress Effects 0.000 description 1
- 208000011117 substance-related disease Diseases 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 229940044609 sulfur dioxide Drugs 0.000 description 1
- 235000010269 sulphur dioxide Nutrition 0.000 description 1
- 108010045815 superoxide dismutase 2 Proteins 0.000 description 1
- 239000002344 surface layer Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 208000031906 susceptibility to X-linked 2 autism Diseases 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 108010059434 tapasin Proteins 0.000 description 1
- 238000010809 targeting technique Methods 0.000 description 1
- 108010026424 tau Proteins Proteins 0.000 description 1
- WWJZWCUNLNYYAU-UHFFFAOYSA-N temephos Chemical compound C1=CC(OP(=S)(OC)OC)=CC=C1SC1=CC=C(OP(=S)(OC)OC)C=C1 WWJZWCUNLNYYAU-UHFFFAOYSA-N 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 229940094937 thioredoxin Drugs 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000037426 transcriptional repression Effects 0.000 description 1
- 230000031998 transcytosis Effects 0.000 description 1
- 238000011426 transformation method Methods 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- OHOTVSOGTVKXEL-UHFFFAOYSA-K trisodium;2-[bis(carboxylatomethyl)amino]propanoate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)C(C)N(CC([O-])=O)CC([O-])=O OHOTVSOGTVKXEL-UHFFFAOYSA-K 0.000 description 1
- 230000010415 tropism Effects 0.000 description 1
- 238000010396 two-hybrid screening Methods 0.000 description 1
- 208000032471 type 1 spinal muscular atrophy Diseases 0.000 description 1
- 208000032521 type II spinal muscular atrophy Diseases 0.000 description 1
- 208000032527 type III spinal muscular atrophy Diseases 0.000 description 1
- 208000005606 type IV spinal muscular atrophy Diseases 0.000 description 1
- 108091005990 tyrosine-phosphorylated proteins Proteins 0.000 description 1
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 239000007762 w/o emulsion Substances 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1082—Preparation or screening gene libraries by chromosomal integration of polynucleotide sequences, HR-, site-specific-recombination, transposons, viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8201—Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation
- C12N15/8213—Targeted insertion of genes into the plant genome by homologous recombination
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/96—Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/22—Vectors comprising a coding region that has been codon optimised for expression in a respective host
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2810/00—Vectors comprising a targeting moiety
- C12N2810/10—Vectors comprising a non-peptidic targeting moiety
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention generally relates to the engineering and optimization of systems, methods and compositions used for the control of gene expression involving sequence targeting, such as genome perturbation or gene-editing, that relate to Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and components thereof.
- sequence targeting such as genome perturbation or gene-editing
- CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
- the CRISPR Cas or the CRISPR-Cas system does not require the generation of customized proteins to target specific sequences but rather a single Cas enzyme can be programmed by a short RNA molecule to recognize a specific DNA target, in other words the Cas enzyme can be recruited to a specific DNA target using said short RNA molecule.
- Adding the CRISPR-Cas system to the repertoire of genome sequencing techniques and analysis methods may significantly simplify the methodology and accelerate the ability to catalog and map genetic factors associated with a diverse range of biological functions and diseases.
- An exemplary CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within the target polynucleotide, wherein the CRISPR enzyme is a Cas ortholog, e.g.
- a Cas9 ortholog of a genus which includes but is not limited to Corynebacter, Sutterella, Legionella, Treponema, Filifactor, Eubacterium, Streptococcus, Lactobacillus, Mycoplasma, Bacteroides, Flaviivola, Flavobacterium, Sphaerochaeta, Azospirillum, Gluconacetobacter, Neisseria, Roseburia, Parvibaculum, Staphylococcus, Nitratifractor, Mycoplasma and Campylobacter .
- the guide sequence is linked to a tracr mate sequence, which in turn hybridizes to a tracr sequence.
- the invention provides methods for using one or more elements of a CRISPR system.
- the CRISPR complex of the invention provides an effective means for modifying a target polynucleotide.
- the CRISPR complex of the invention has a wide variety of utilities including modifying (e.g., deleting, inserting, translocating, inactivating, activating, repressing, altering methylation, transferring specific moieties) a target polynucleotide in a multiplicity of cell types.
- modifying e.g., deleting, inserting, translocating, inactivating, activating, repressing, altering methylation, transferring specific moieties
- the CRISPR complex of the invention has a broad spectrum of applications in, e.g., gene or genome editing, gene regulation, gene therapy, drug discovery, drug screening, disease diagnosis, and prognosis.
- the CRISPR complex comprises a Cas enzyme, preferably a Cas9 ortholog, of a genus which includes but is not limited to Corynebacter, Sutterella, Legionella, Treponema, Filifactor, Eubacterium, Streptococcus, Lactobacillus, Mycoplasma, Bacteroides, Flaviivola, Flavobacterium, Sphaerochaeta, Azospirillum, Gluconacetobacter, Neisseria, Roseburia, Parvibaculum, Staphylococcus, Nitratifractor, Mycoplasma and Campylobacter.
- a Cas enzyme preferably a Cas9 ortholog
- aspects of the invention relate to CRISPR enzymes having optimized function.
- the CRISPR enzyme being a Cas enzyme
- preferred embodiments of the invention relate to Cas9 orthologs having improved target specificity in a CRISPR-Cas9 system. This may be accomplished by approaches that include but are not limited to designing and preparing guide RNAs having optimal activity, selecting Cas9 enzymes of a specific length, truncating the Cas9 enzyme making it smaller in length than the corresponding wild-type Cas9 enzyme by truncating the nucleic acid molecules coding therefor and generating chimeric Cas9 enzymes wherein different parts of the enzyme are swapped or exchanged between different orthologs to arrive at chimeric enzymes having tailored specificity.
- aspects of the invention also relate to methods of improving the target specificity of a Cas9 ortholog enzyme or of designing a CRISPR-Cas9 system comprising designing or preparing guide RNAs having optimal activity and/or selecting or preparing a Cas9 ortholog enzyme having a smaller size or length than the corresponding wild-type Cas9 whereby packaging a nucleic acid coding therefor into a delivery vector is advanced as there is less coding sequence therefor in the delivery vector than for the corresponding wild-type Cas9 and/or generating chimeric Cas9 enzymes.
- a CRISPR enzyme e.g. a Cas9 enzyme may comprise one or more mutations and may be used as a generic DNA binding protein with or without fusion to or being operably linked to a functional domain.
- the mutations may be artificially introduced mutations and may include but are not limited to one or more mutations in a catalytic domain.
- Examples of catalytic domains with reference to a Cas9 enzyme may include but are not limited to RuvC I, RuvC II, RuvC III and HNH domains.
- Preferred examples of suitable mutations are the catalytic residue(s) in the N-term RuvC I domain of Cas9 or the catalytic residue(s) in the internal HNH domain.
- the Cas9 is (or is derived from) the Streptococcus pyogenes Cas9 (SpCas9).
- preferred mutations are at any or all of positions 10, 762, 840, 854, 863 and/or 986 of SpCas9 or corresponding positions in other Cas9 orthologs with reference to the position numbering of SpCas9 (which may be ascertained for instance by standard sequence comparison tools, e.g. ClustalW or MegAlign by Lasergene 10 suite).
- any or all of the following mutations are preferred in SpCas9: D10A, E762A, H840A, N854A, N863A and/or D986A; as well as conservative substitution for any of the replacement amino acids is also envisaged.
- the same mutations (or conservative substitutions of these mutations) at corresponding positions with reference to the position numbering of SpCas9 in other Cas9 orthologs are also preferred.
- Particularly preferred are D10 and H840 in SpCas9.
- residues corresponding to SpCas9 D10 and H840 are also preferred.
- mutated Cas 9 enzyme being fused to or operably linked to domains which include but are not limited to a transcriptional activator, transcriptional repressor, a recombinase, a transposase, a histone remodeler, a DNA methyltransferase, a cryptochrome, a light inducible/controllable domain or a chemically inducible/controllable domain.
- a further aspect of the invention provides for chimeric Cas9 proteins and methods of generating chimeric Cas9 proteins.
- Chimeric Cas9 proteins are proteins that comprise fragments that originate from different Cas9 orthologs. For instance, the N-terminal of a first Cas9 ortholog may be fused with the C-terminal of a second Cas9 ortholog to generate a resultant Cas9 chimeric protein.
- These chimeric Cas9 proteins may have a higher specificity or a higher efficiency than the original specificity or efficiency of either of the individual Cas9 enzymes from which the chimeric protein was generated.
- These chimeric proteins may also comprise one or more mutations or may be linked to one or more functional domains.
- aspects of the invention relate to a chimeric Cas enzyme wherein the enzyme comprises one or more fragments from a first Cas ortholog and one or more fragments from a second Cas ortholog.
- the one or more fragments of the first or second Cas ortholog are from the C- or N-terminal of the first or second Cas ortholog.
- the first or second Cas ortholog is selected from a genus belonging to the group consisting of Corynebacter, Sutterella, Legionella, Treponema, Filifactor, Eubacterium, Streptococcus, Lactobacillus, Mycoplasma, Bacteroides, Flaviivola, Flavobacterium, Sphaerochaeta, Azospirillum, Gluconacetobacter, Neisseria, Roseburia, Parvibaculum, Staphylococcus, Nitratifractor, Mycoplasma and Campylobacter.
- the invention provides for methods to generate mutant components of the CRISPR complex comprising a Cas enzyme, e.g. Cas9 ortholog.
- the mutant components may include but are not limited to mutant tracrRNA and tracr mate sequences or mutant chimeric guide sequences that allow for enhancing performance of these RNAs in cells.
- Use of the present composition or the enzyme in the preparation of a medicament for modification of a target sequence is also provided.
- compositions and methods related to a non-naturally occurring or engineered composition comprising:
- chiRNA CRISPR-Cas system chimeric RNA
- a polynucleotide sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences, wherein (a), (b) and (c) are arranged in a 5′ to 3′ orientation, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence and the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA, or (B) I.
- polynucleotides comprising: (a) a guide sequence capable of hybridizing to a target sequence in a prokaryotic cell, and (b) at least one or more tracr mate sequences, II. a polynucleotide sequence encoding a CRISPR enzyme, and III.
- a polynucleotide sequence comprising a tracr sequence, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, and the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA, and wherein the CRISPR enzyme is a Cas9 ortholog of a genus belonging to the group consisting of Corynebacter, Sutterella, Legionella, Treponema, Filifactor, Eubacterium, Streptococcus, Lactobacillus, Mycoplasma, Bacteroides, Flaviivola, Flavobacterium, Sphaerochaeta, Azospirillum, Gluconacetobacter, Neisser
- the invention in yet a further aspect provides: (A) A non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising: I. a first regulatory element operably linked to a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence, wherein the polynucleotide sequence comprises (a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, (b) a tracr mate sequence, and (c) a tracr sequence, and II.
- chiRNA CRISPR-Cas system chimeric RNA
- a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences, wherein (a), (b) and (c) are arranged in a 5′ to 3′ orientation, wherein components I and II are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, wherein the CRISPR enzyme is a Cas9 ortholog of a genus belonging to the group consisting of Corynebacter, Sutterella, Legionella, Treponema, Filifactor, Eubacterium, Streptococcus, Lactobacillus, Mycoplasma, Bacteroides,
- a first regulatory element operably linked to (a) a guide sequence capable of hybridizing to a target sequence in a prokaryotic cell, and (b) at least one or more tracr mate sequences, II. a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, and III.
- a third regulatory element operably linked to a tracr sequence wherein components I, II and III are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, wherein the CRISPR enzyme is a Cas9 ortholog of a genus belonging to the group consisting of Corynebacter, Sutterella, Legionella, Treponema, Filifactor, Eubacterium, Streptococcus, Lactobacillus, Mycoplasma, Bacteroides, Flaviivola, Flavobacterium, Sphaerochaeta, Azospirillum, Gluconacetobacter, Neisseria, Roseburia, Par
- the CRISPR enzyme having a specific size is selected and has a length of at least 500 amino acids, at least 800-899 amino acids, at least 900-999 amino acids, at least 1000-1099 amino acids, at least 1100-1199 amino acids, at least 1200-1299 amino acids, at least 1300-1399 amino acids, at least 1400-1499 amino acids, at least 1500-1599 amino acids, at least 1600-1699 amino acids or at least 2000 amino acids; and/or the CRISPR enzyme is truncated in comparison to the corresponding wild type CRISPR enzyme; and/or the CRISPR enzyme is a nuclease directing cleavage of both strands at the location of the target sequence, or the CRISPR enzyme is a nickase directing cleavage of one strand at the location of the target sequence; and/or the guide sequence comprises at least 10, at least 15 or at least 20 nucleotides; and/or the CRISPR enzyme is codon-optimized or codon-optimized for expression in a euk
- the CRISPR enzyme is truncated in comparison to a wild type CRISPR enzyme or the CRISPR enzyme is comprised of at least 500 amino acids, at least 800-899 amino acids, at least 900-999 amino acids, at least 1000-1099 amino acids, at least 1100-1199 amino acids, at least 1200-1299 amino acids, at least 1300-1399 amino acids, at least 1400-1499 amino acids, at least 1500-1599 amino acids, at least 1600-1699 amino acids or at least 2000 amino acids.
- the CRISPR enzyme is a Cas enzyme, e.g. a Cas9 ortholog.
- the CRISPR enzyme is a nuclease directing cleavage of both strands at the location of the target sequence, or the CRISPR enzyme is a nickase directing cleavage of one strand at the location of the target sequence.
- the CRISPR enzyme is a catalytically null mutant that is a generic DNA binding protein.
- the CRISPR enzyme is a Cas enzyme, e.g. a Cas9 ortholog.
- the guide sequence comprises at least fifteen nucleotides.
- the CRISPR enzyme is codon-optimized or codon-optimized for expression in a eukaryotic cell.
- the CRISPR enzyme comprises one or more mutations.
- the CRISPR enzyme comprises a chimeric CRISPR enzyme.
- the CRISPR enzyme has one or more other attributes herein discussed.
- the CRISPR enzyme is a Cas enzyme, e.g. a Cas9 ortholog.
- the CRISPR enzyme comprises one or more mutations.
- the one or more mutations may be in a particular domain of the enzyme.
- the one or more mutations may be in a catalytic domain.
- the catalytic domain is a RuvC I, RuvC II, RuvC III or HNH domain.
- the one or more mutations is in a RuvC1 or HNH domain of the CRISPR enzyme.
- the CRISPR enzyme is a Cas enzyme, e.g.
- the CRISPR enzyme has one or more mutations in a particular domain of the enzyme, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the enzyme further comprises a functional domain.
- the functional domain may include but is not limited to transcriptional activator, transcriptional repressor, a recombinase, a transposase, a histone remodeler, a DNA methyltransferase, a cryptochrome, a light inducible/controllable domain or a chemically inducible/controllable domain.
- the functional domain is the transcriptional activator domain VP64. In some embodiments, the functional domain is the transcriptional repressor domain KRAB. In some embodiments, the transcriptional repressor domain is SID, or concatemers of SID (i.e. SID4X). In some embodiments, an epigenetic modifying enzyme is provided, e.g. a histone modifying protein or an epigenetic chromatin modifying protein. In some embodiments, an activator domain is provided, which may be the P65 activator domain.
- a further aspect of the invention comprehends methods of modifying two or more genomic loci of interest.
- two or more genomic loci are differentially modulated by utilizing one or more CRISPR enzymes, e.g. two or more Cas9 orthologs, each ortholog being operably linked to one or more functional domain.
- the invention provides for a method of modifying two or more genomic loci in a eukaryotic cell. Therefore, aspects of the invention provide for a method of modulating the expression of two or more genomic loci of interest in an organism comprising delivering a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising
- a first regulatory element operably linked to a first CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence, wherein the first polynucleotide sequence comprises
- a second regulatory element operably linked to a second CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence, wherein the second polynucleotide sequence comprises
- a third regulatory element operably linked to an enzyme-coding sequence encoding a first CRISPR enzyme comprising at least one or more nuclear localization sequences and operably linked to a first functional domain
- a fourth regulatory element operably linked to an enzyme-coding sequence encoding a second CRISPR enzyme comprising at least one or more nuclear localization sequences and operably linked to a second functional domain, wherein (i), (ii) and (iii) in I and II are arranged in a 5′ to 3′ orientation, wherein components I, II, III and IV are located on the same or different vectors of the system, wherein when transcribed, each tracr mate sequences hybridizes to its corresponding tracr sequence and the first and second guide sequences direct sequence-specific binding of the first and second CRISPR complex to the first and second target sequence, wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence and wherein expression of the CRISPR enzyme provides manipulation of the target sequence, wherein the first and second CRISPR enzyme each comprise two or more mutations, wherein the first and second CRISPR enzyme is
- the first functional domain is selected from the group consisting of a transcriptional activator, transcriptional repressor, a recombinase, a transposase, a histone remodeler, a DNA methyltransferase, a cryptochrome and a light inducible/controllable domain or a chemically inducible/controllable domain.
- the second functional domain is selected from the group consisting of a transcriptional activator, transcriptional repressor, a recombinase, a transposase, a histone remodeler, a DNA methyltransferase, a cryptochrome and a light inducible/controllable domain or a chemically inducible/controllable domain.
- the first or second CRISPR enzyme is a Sutterella wadsworthensis Cas9, a Filifactor alocis Cas9, a Lactobacillus johnsonii Cas9, a Campylobacter lari Cas9, a Corynebacter diptheriae Cas9, a Parvibaculum lavamentivorans Cas9, a Mycoplasma gallisepticum Cas9, a Staphylococcus aureus subsubspecies Aureus Cas9, a Legionella pneumophila Paris Cas9, a Treponema denticola Cas9, a Staphylococcus pseudintermedius Cas9, a Neisseria cinerea Cas9.
- the CRISPR enzyme is a type I, II or III CRISPR enzyme, preferably a type II CRISPR enzyme.
- This type II CRISPR enzyme may be any Cas enzyme.
- a Cas enzyme may be identified as Cas9 as this can refer to the general class of enzymes that share homology to the biggest nuclease with multiple nuclease domains from the type II CRISPR system.
- the Cas9 enzyme is from, or is derived from, SpCas9 or Staphylococcus aureus subsubspecies Aureus SaCas9.
- derived it is meant that the derived enzyme is largely based, in the sense of having a high degree of sequence homology with, a wildtype enzyme, but that it has been mutated (modified) in some way as described herein.
- Cas and CRISPR enzyme are generally used herein interchangeably, unless otherwise apparent.
- residue numberings used herein refer to the Cas9 enzyme from the type II CRISPR locus in Streptococcus pyogenes .
- this invention includes many more Cas9s from other species of microbes such as those belonging to the genus Corynebacter, Sutterella, Legionella, Treponema, Filifactor, Eubacterium, Streptococcus, Lactobacillus, Mycoplasma, Bacteroides, Flaviivola, Flavobacterium, Sphaerochaeta, Azospirillum, Gluconacetobacter, Neisseria, Roseburia, Parvibaculum, Staphylococcus, Nitratifractor, Mycoplasma or Campylobacter , such as SpCas9, SaCas9, St1Cas9, St3Cas9 and so forth, wherein St is Streptococcus thermophilus.
- codon optimized sequence in this instance optimized for humans (i.e. being optimized for expression in humans) is provided herein, see the SaCas9 human codon optimized sequence. Whilst this is preferred, it will be appreciated that other examples are possible and codon optimization for a host species is known.
- Another aspect of the invention relates to the stabilization of chimeric RNA, and/or guide sequence and or a portion thereof of CRISPR complexes wherein the CRISPR enzyme is a CRISPR ortholog, wherein the chimeric RNA, and/or guide sequence and or a portion thereof is stabilized by synthetic or chemically modified nucleotides (e.g. LNA/BNA: thiol-modification, 2′/3′-OH crosslink modification), is modified to be degradation/hydrolysis resistant and to which elements of structural stability have been added.
- synthetic or chemically modified nucleotides
- the invention further comprehends in certain embodiments a method of modifying an organism or a non-human organism by manipulation of a target sequence in a genomic locus of interest comprising delivering a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors operably encoding a composition herein discussed for expression thereof.
- the vector is a viral vector, such as a lenti- or baculo- or preferably adeno-viral/adeno-associated viral vectors, but other means of delivery are known (such as yeast systems, microvesicles, gene guns/means of attaching vectors to gold nanoparticles) and are provided.
- the CRISPR enzyme for instance a Cas9, and/or any of the present RNAs, for instance a guide RNA, can be delivered using adeno associated virus (AAV), lentivirus, adenovirus or other viral vector types, or combinations thereof.
- Cas9 and one or more guide RNAs can be packaged into one or more viral vectors.
- the viral vector is delivered to the tissue of interest by, for example, an intramuscular injection, while othertimes the viral delivery is via intravenous, transdermal, intranasal, oral, mucosal, or other delivery methods. Such delivery may be either via a single dose, or multiple doses.
- the actual dosage to be delivered herein may vary greatly depending upon a variety of factors, such as the vector chosen, the target cell, organism, or tissue, the general condition of the subject to be treated, the degree of transformation/modification sought, the administration route, the administration mode, the type of transformation/modification sought, etc.
- Such a dosage may further contain, for example, a carrier (water, saline, ethanol, glycerol, lactose, sucrose, calcium phosphate, gelatin, dextran, agar, pectin, peanut oil, sesame oil, etc.), a diluent, a pharmaceutically-acceptable carrier (e.g., phosphate-buffered saline), a pharmaceutically-acceptable excipient, an adjuvant to enhance antigenicity, an immunostimulatory compound or molecule, and/or other compounds known in the art.
- a carrier water, saline, ethanol, glycerol, lactose, sucrose, calcium phosphate, gelatin, dextran, agar, pectin, peanut oil, sesame oil, etc.
- a pharmaceutically-acceptable carrier e.g., phosphate-buffered saline
- a pharmaceutically-acceptable excipient e.g., an adju
- the adjuvant herein may contain a suspension of minerals (alum, aluminum hydroxide, aluminum phosphate) on which antigen is adsorbed; or water-in-oil emulsion in which antigen solution is emulsified in oil (MF-59, Freund's incomplete adjuvant), sometimes with the inclusion of killed mycobacteria (Freund's complete adjuvant) to further enhance antigenicity (inhibits degradation of antigen and/or causes influx of macrophages).
- Adjuvants also include immunostimulatory molecules, such as cytokines, costimulatory molecules, and for example, immunostimulatory DNA or RNA molecules, such as CpG oligonucleotides. Such a dosage formulation is readily ascertainable by one skilled in the art.
- the dosage may further contain one or more pharmaceutically acceptable salts such as, for example, a mineral acid salt such as a hydrochloride, a hydrobromide, a phosphate, a sulfate, etc.; and the salts of organic acids such as acetates, propionates, malonates, benzoates, etc.
- auxiliary substances such as wetting or emulsifying agents, pH buffering substances, gels or gelling materials, flavorings, colorants, microspheres, polymers, suspension agents, etc. may also be present.
- Suitable exemplary ingredients include microcrystalline cellulose, carboxymethylcellulose sodium, polysorbate 80, phenylethyl alcohol, chlorobutanol, potassium sorbate, sorbic acid, sulfur dioxide, propyl gallate, the parabens, ethyl vanillin, glycerin, phenol, parachlorophenol, gelatin, albumin and a combination thereof.
- the delivery is via an adenovirus, which may be at a single booster dose containing at least 1 ⁇ 10 5 particles (also referred to as particle units, pu) of adenoviral vector.
- the dose preferably is at least about 1 ⁇ 10 6 particles (for example, about 1 ⁇ 10 6 -1 ⁇ 10 12 particles), more preferably at least about 1 ⁇ 10 7 particles, more preferably at least about 1 ⁇ 10 8 particles (e.g., about 1 ⁇ 10 8 -1 ⁇ 10 11 particles or about 1 ⁇ 10 9 -1 ⁇ 10 12 particles), and most preferably at least about 1 ⁇ 10 0 particles (e.g., about 1* ⁇ 10 9 -1 ⁇ 10 10 particles or about 1 ⁇ 10 9 -1 ⁇ 10 12 particles), or even at least about 1 ⁇ 10 10 particles (e.g., about 1 ⁇ 10 10 -1 ⁇ 10 12 particles) of the adenoviral vector.
- the dose comprises no more than about 1 ⁇ 10 14 particles, preferably no more than about 1 ⁇ 10 13 particles, even more preferably no more than about 1 ⁇ 10 12 particles, even more preferably no more than about 1 ⁇ 10 11 particles, and most preferably no more than about 1 ⁇ 10 10 particles (e.g., no more than about 1 ⁇ 10 9 articles).
- the dose may contain a single dose of adenoviral vector with, for example, about 1 ⁇ 10 6 particle units (pu), about 2 ⁇ 10 6 pu, about 4 ⁇ 10 6 pu, about 1 ⁇ 10 7 pu, about 2 ⁇ 10 7 pu, about 4 ⁇ 10 7 pu, about 1 ⁇ 10 8 pu, about 2 ⁇ 10 8 pu, about 4 ⁇ 10 8 pu, about 1 ⁇ 10 9 pu, about 2 ⁇ 10 9 pu, about 4 ⁇ 10 9 pu, about 1 ⁇ 10 10 pu, about 2 ⁇ 10 10 pu, about 4 ⁇ 10 10 pu, about 1 ⁇ 10 11 pu, about 2 ⁇ 10 11 pu, about 4 ⁇ 10 11 pu, about 1 ⁇ 10 12 pu, about 2 ⁇ 10 12 pu, or about 4 ⁇ 10 12 pu of adenoviral vector.
- adenoviral vector with, for example, about 1 ⁇ 10 6 particle units (pu), about 2 ⁇ 10 6 pu, about 4 ⁇ 10 6 pu, about 1 ⁇ 10 7 pu, about 2 ⁇ 10 7 pu, about 4 ⁇ 10 7 pu, about 1 ⁇ 10 8 pu, about 2 ⁇ 10 8 pu, about 4 ⁇ 10
- the adenoviral vectors in U.S. Pat. No. 8,454,972 B2 to Nabel, et. al., granted on Jun. 4, 2013; incorporated by reference herein, and the dosages at col 29, lines 36-58 thereof.
- the adenovirus is delivered via multiple doses.
- the delivery is via an AAV.
- a therapeutically effective dosage for in vivo delivery of the AAV to a human is believed to be in the range of from about 20 to about 50 ml of saline solution containing from about 1 ⁇ 10 10 to about 1 ⁇ 10 10 functional AAV/ml solution. The dosage may be adjusted to balance the therapeutic benefit against any side effects.
- the AAV dose is generally in the range of concentrations of from about 1 ⁇ 10 5 to 1 ⁇ 10 50 genomes AAV, from about 1 ⁇ 10 8 to 1 ⁇ 10 20 genomes AAV, from about 1 ⁇ 10 10 to about 1 ⁇ 10 16 genomes, or about 1 ⁇ 10 11 to about 1 ⁇ 10 16 genomes AAV.
- a human dosage may be about 1 ⁇ 10 13 genomes AAV.
- Such concentrations may be delivered in from about 0.001 ml to about 100 ml, about 0.05 to about 50 ml, or about 10 to about 25 ml of a carrier solution.
- Other effective dosages can be readily established by one of ordinary skill in the art through routine trials establishing dose response curves. See, for example, U.S. Pat. No. 8,404,658 B2 to Hajjar, et al., granted on Mar. 26, 2013, at col. 27, lines 45-60.
- the delivery is via a plasmid.
- the dosage should be a sufficient amount of plasmid to elicit a response.
- suitable quantities of plasmid DNA in plasmid compositions can be from about 0.1 to about 2 mg, or from about 1 ⁇ g to about 10 ⁇ g.
- the doses herein are based on an average 70 kg individual.
- the frequency of administration is within the ambit of the medical or veterinary practitioner (e.g., physician, veterinarian), or scientist skilled in the art.
- the viral vectors can be injected into the tissue of interest.
- the expression of Cas9 can be driven by a cell-type specific promoter.
- liver-specific expression might use the Albumin promoter and neuron-specific expression might use the Synapsin I promoter.
- RNA delivery The CRISPR enzyme, for instance a Cas9, and/or any of the present RNAs, for instance a guide RNA, can also be delivered in the form of RNA.
- Cas9 mRNA can be generated using in vitro transcription.
- Cas9 mRNA can be synthesized using a PCR cassette containing the following elements: T7_promoter-kozak sequence (GCCACC)-Cas9-3′ UTR from beta globin-polyA tail (a string of 120 or more adenines).
- the cassette can be used for transcription by T7 polymerase.
- Guide RNAs can also be transcribed using in vitro transcription from a cassette containing T7_promoter-GG-guide RNA sequence.
- the CRISPR enzyme and/or guide RNA can be modified using pseudo-U or 5-Methyl-C.
- CRISPR enzyme mRNA and guide RNA may be delivered simultaneously using nanoparticles or lipid envelopes.
- mRNA delivery methods are especially promising for liver delivery currently.
- CRISPR enzyme mRNA and guideRNA might also be delivered separately.
- CRISPR enzyme mRNA can be delivered prior to the guide RNA to give time for CRISPR enzyme to be expressed.
- CRISPR enzyme mRNA might be administered 1-12 hours (preferably around 2-6 hours) prior to the administration of guideRNA.
- CRISPR enzyme mRNA and guide RNA can be administered together.
- a second booster dose of guide RNA can be administered 1-12 hours (preferably around 2-6 hours) after the initial administration of CRISPR enzyme mRNA+guideRNA.
- CRISPR enzyme mRNA and/or guide RNA might be useful to achieve the most efficient levels of genome modification.
- CRISPR enzyme mRNA and guide RNA For minimization of toxicity and off-target effects, it will be important to control the concentration of CRISPR enzyme mRNA and guide RNA delivered.
- Optimal concentrations of CRISPR enzyme mRNA and guide RNA can be determined by testing different concentrations in a cellular or animal model and using deep sequencing to analyze the extent of modification at potential off-target genomic loci.
- CRISPR enzyme nickase mRNA for example S. pyogenes Cas9 with the D10A mutation
- CRISPR enzyme nickase mRNA can be delivered with a pair of guide RNAs targeting a site of interest.
- the two guide RNAs need to be spaced as follows. Guide sequences in red (single underline) and blue (double underline) respectively (these examples are based on the PAM requirement for Streptococcus pyogenes Cas9).
- the 5′ overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs.
- the 5′ overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs or 1-34 base pairs.
- the first guide sequence directing cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directing cleavage of other strand near the second target sequence results in a blunt cut or a 3′ overhang.
- the 3′ overhang is at most 150, 100 or 25 base pairs or at least 15, 10 or 1 base pairs. In preferred embodiments the 3′ overhang is 1-100 base pairs.
- aspects of the invention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5′ overhangs to reanneal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased.
- the gene product is a protein.
- each guide used in these assays is able to efficiently induce indels when paired with wildtype Cas9, indicating that the relative positions of the guide pairs are the most important parameters in predicting double nicking activity.
- Cas9n and Cas9H840A nick opposite strands of DNA
- substitution of Cas9n with Cas9H840A with a given sgRNA pair should result in the inversion of the overhang type.
- a pair of sgRNAs that will generate a 5′ overhang with Cas9n should in principle generate the corresponding 3′ overhang instead. Therefore, sgRNA pairs that lead to the generation of a 3′ overhang with Cas9n might be used with Cas9H840A to generate a 5′ overhang.
- Additional delivery options for the brain include encapsulation of CRISPR enzyme and guide RNA in the form of either DNA or RNA into liposomes and conjugating to molecular Trojan horses for trans-blood brain barrier (BBB) delivery.
- BBB trans-blood brain barrier
- Molecular Trojan horses have been shown to be effective for delivery of B-gal expression vectors into the brain of non-human primates.
- the same approach can be used to delivery vectors containing CRISPR enzyme and guide RNA.
- Xia C F and Boado R J, Pardridge W M (“Antibody-mediated targeting of siRNA via the human insulin receptor using avidin-biotin technology.” Mol Pharm. 2009 May-June; 6(3):747-51.
- siRNA short interfering RNA
- mAb monoclonal antibody
- avidin-biotin a receptor-specific monoclonal antibody
- the authors also report that because the bond between the targeting mAb and the siRNA is stable with avidin-biotin technology, and RNAi effects at distant sites such as brain are observed in vivo following an intravenous administration of the targeted siRNA.
- MAb monoclonal antibody
- HIR human insulin receptor
- the HIRMAb enables the liposome carrying the exogenous gene to undergo transcytosis across the blood-brain barrier and endocytosis across the neuronal plasma membrane following intravenous injection.
- the level of luciferase gene expression in the brain was 50-fold higher in the rhesus monkey as compared to the rat.
- Widespread neuronal expression of the beta-galactosidase gene in primate brain was demonstrated by both histochemistry and confocal microscopy. The authors indicate that this approach makes feasible reversible adult transgenics in 24 hours. Accordingly, the use of immunoliposome is preferred. These may be used in conjunction with antibodies to target specific tissues or cell surface proteins.
- RNA Ribonucleic acid
- nanoparticles Cho, S., Goldberg, M., Son, S., Xu, Q., Yang, F., Mei, Y., Bogatyrev, S., Langer, R. and Anderson, D., Lipid-like nanoparticles for small interfering RNA delivery to endothelial cells. Advanced Functional Materials, 19: 3112-3118, 2010) or exosomes (Schroeder, A., Levins, C., Cortez, C., Langer, R., and Anderson, D., Lipid-based nanotherapeutics for siRNA delivery, Journal of Internal Medicine, 267: 9-21, 2010, PMID: 20059641).
- exozomes have been shown to be particularly useful in delivery siRNA, a system with some parallels to the CRISPR system.
- El-Andaloussi S, et al. (“Exosome-mediated delivery of siRNA in vitro and in vivo.” Nat Protoc. 2012 December; 7(12):2112-26. doi: 10.1038/nprot.2012.131. Epub 2012 Nov. 15.) describe how exosomes are promising tools for drug delivery across different biological barriers and can be harnessed for delivery of siRNA in vitro and in vivo.
- Their approach is to generate targeted exosomes through transfection of an expression vector, comprising an exosomal protein fused with a peptide ligand. The exosomes are then purified and characterized from transfected cell supernatant, then siRNA is loaded into the exosomes.
- One aspect of manipulation of a target sequence also refers to the epigenetic manipulation of a target sequence. This may be of the chromatin state of a target sequence, such as by modification of the methylation state of the target sequence (i.e. addition or removal of methylation or methylation patterns or CpG islands), histone modification, increasing or reducing accessibility to the target sequence, or by promoting or reducing 3D folding.
- a vector may mean not only a viral or yeast system (for instance, where the nucleic acids of interest may be operably linked to and under the control of (in terms of expression, such as to ultimately provide a processed RNA) a promoter, but also direct delivery of nucleic acids into a host cell.
- the invention also comprehends, in certain embodiments, a method of treating or inhibiting a condition caused by a defect in a target sequence in a genomic locus of interest in a subject or a non-human subject in need thereof comprising modifying the subject or a non-human subject by manipulation of the target sequence and wherein the condition is susceptible to treatment or inhibition by manipulation of the target sequence comprising providing treatment comprising: delivering a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising operably encoding a composition herein discussed for expression thereof, wherein the target sequence is manipulated by the composition when expressed.
- the methods can include inducing expression, which can be inducing expression of the CRISPR enzyme and/or inducing expression of the guide, tracr or tracr mate sequences.
- the organism or subject is a eukaryote or a non-human eukaryote.
- the organism or subject is a plant.
- the organism or subject is a mammal or a non-human mammal.
- the organism or subject is algae.
- the vector may be a viral vector and this is advantageously an AAV
- viral vectors as herein discussed can be employed.
- baculoviruses may be used for expression in insect cells. These insect cells may, in turn be useful for producing large quantities of further vectors, such as AAV vectors adapted for delivery of the present invention.
- a method of delivering the present CRISPR enzyme comprising delivering to a cell mRNA encoding the CRISPR enzyme.
- the CRISPR enzyme is truncated, is of a specific size as described herein, is a nuclease or nickase or generic DNA binding protein, is codon-optimized, comprises one or more mutations, and/or comprises a chimeric CRISPR enzyme, or the other options as herein discussed.
- compositions or the present CRISPR enzymes of the invention are also envisaged.
- AAV viral vectors are preferred.
- a method of preparing an AAV viral vector comprising transfecting plasmid(s) containing or consisting essentially of nucleic acid molecule(s) coding for the AAV into AAV-infected cells, and supplying AAV rep and/or cap obligatory for replication and packaging of the AAV.
- the CRISPR enzyme is truncated, comprised of less than one thousand amino acids or less than four thousand amino acids, is a nuclease or nickase, is codon-optimized comprises one or more mutations, and/or comprises a chimeric CRISPR enzyme, as herein discussed.
- the AAV rep and/or cap obligatory for replication and packaging of the AAV are supplied by transfecting the cells with helper plasmid(s) or helper virus(es).
- the helper virus is a poxvirus, adenovirus, herpesvirus or baculovirus.
- the poxvirus is a vaccinia virus.
- the cells are mammalian cells. And in some embodiments the cells are insect cells and the helper virus is baculovirus.
- the invention further comprehends in certain embodiments a modified CRISPR enzyme.
- Differences from the wild type CRISPR enzyme can comprise: the modified CRISPR enzyme is truncated in comparison to a wild type CRISPR enzyme, or the CRISPR enzyme is of a specific size, e.g.
- the CRISPR enzyme is a nuclease directing cleavage of both strands at the location of the target sequence, or the CRISPR enzyme is a nickase directing cleavage of one strand at the location of the target sequence, or the CRISPR enzyme is a catalytic null mutant that functions as a DNA binding protein; and/or the CRISPR enzyme is codon-optimized or codon-optimized for expression in a eukaryotic cell, and/or the CRISPR enzyme comprises one or more mutations, and/or the CRISPR enzyme comprises a chimeric CRISPR enzyme and/or the CRISPR enzyme
- the CRISPR enzyme comprises one or more mutations in catalytic residues such as spCa9 D10A, E762A, H840A, N854A. N863A or D986A or those corresponding to them in other Cas enzymes (as described herein) with reference to the position numbering of SpCas9, and/or has one or more mutations is in a RuvC I, RuvC II, RuvC III, HNH or other domain described herein of the CRISPR enzyme and/or the CRISPR enzyme has one or more mutations in a catalytic domain, wherein when transcribed, a tracr mate sequence hybridizes to a tracr sequence and a guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence, and wherein the enzyme further comprises a functional domain.
- catalytic residues such as spCa9 D10A, E762A, H840A, N854A.
- the functional domain may include but is not limited to transcriptional activator, transcriptional repressor, a recombinase, a transposase, a histone remodeler, a DNA methyltransferase, a cryptochrome, a light inducible/controllable domain or a chemically inducible/controllable domain.
- the CRISPR enzyme in certain embodiments can have the functional domain be a transcriptional activator domain, e.g., VP64.
- a transcription repressor domains is KRAB.
- a transcription repressor domain is SID, or concatemers of SID (i.e. SID4X).
- an epigenetic modifying enzyme is provided.
- the CRISPR enzyme is a Cas enzyme, e.g. a Cas9 ortholog.
- aspects of the invention also comprehend identifying novel orthologs of CRISPR enzymes.
- Methods of identifying novel orthologs of CRISPR enzymes may involve identifying tracr sequences in genomes of interest. Identification of tracr sequences may relate to the following steps: Search for the direct repeats or tracr mate sequences in a database to identify a CRISPR region comprising a CRISPR enzyme, e.g. FIG. 18 . Search for homologous sequences in the CRISPR region flanking the CRISPR enzyme in both the sense and antisense directions. Look for transcriptional terminators and secondary structures.
- the invention comprehends in certain embodiments use of a composition as described herein or a CRISPR enzyme in medicine.
- the invention further comprehends in certain embodiments a composition or CRISPR enzyme of the invention used in a method of the invention.
- the invention also comprehends, in certain embodiments, use of a composition or a CRISPR enzyme of the invention in, preferably ex vivo, gene or genome editing or, preferably an ex vivo, gene or genome editing method.
- the invention accordingly also comprehends in certain embodiments use of a composition according or a CRISPR enzyme of the invention in the manufacture of a medicament for ex vivo gene or genome editing or for use in a method as herein discussed.
- the invention in certain embodiments comprehends a composition or a CRISPR enzyme of the invention, wherein the target sequence is flanked or followed, at its 3′ end, by a PAM suitable for the CRISPR enzyme, typically a Cas and in particular a Cas9.
- a PAM suitable for the CRISPR enzyme typically a Cas and in particular a Cas9.
- This PAM sequence is specific for each Cas9 but may be readily determined by methods described herein.
- a suitable PAM is 5′-NRG or 5′-NNGRR for SpCas9 or SaCas9 enzymes (or derived enzymes), respectively.
- Staphylococcus aureus preferably includes Staphylococcus aureus subspecies Aureus.
- FIG. 1 shows a schematic of RNA-guided Cas9 nuclease.
- the Cas9 nuclease from Streptococcus pyogenes is targeted to genomic DNA by a synthetic guide RNA (sgRNA) consisting of a 20-nt guide sequence and a scaffold.
- the guide sequence base-pairs with the DNA target, directly upstream of a requisite 5′-NGG protospacer adjacent motif (PAM), and Cas9 mediates a double-stranded break (DSB) ⁇ 3 bp upstream of the PAM (indicated by triangle).
- PAM protospacer adjacent motif
- FIG. 2A-F shows an exemplary CRISPR system and a possible mechanism of action (A), an example adaptation for expression in eukaryotic cells, and results of tests assessing nuclear localization and CRISPR activity (B-F).
- FIG. 2C discloses SEQ ID NOS 92 and 93, respectively, in order of appearance.
- FIG. 2E discloses SEQ ID NOS 94-96, respectively, in order of appearance.
- FIG. 2F discloses SEQ ID NOS 97-101, respectively, in order of appearance.
- FIG. 3 shows a schematic representation of AAV in vivo delivery plasmids utilizing inverted terminal repeats (ITRs) sequences and guide chimeric RNAs to preferably aid delivery by AAV or AAV-associated systems.
- ITRs inverted terminal repeats
- FIG. 4A-D shows a circular depiction of the phylogenetic analysis revealing five families of Cas9s, including three groups of large Cas9s ( ⁇ 1400 amino acids) and two of small Cas9s ( ⁇ 1100 amino acids).
- FIG. 5 A-F shows a liner depiction of the phylogenetic analysis revealing five families of Cas9s, including three groups of large Cas9s ( ⁇ 1400 amino acids) and two of small Cas9s ( ⁇ 1100 amino acids).
- FIG. 6 shows a graph representing the length distribution of Cas9 orthologs.
- FIG. 7 shows a representation of the sequence logos of the PAMs of the Cas9 orthologs as reverse complements.
- FIG. 8 A-J shows 18 chimeric RNA structures that preserved the sequence and secondary structures of the tracr mate:tracr sequence duplex while shortening the region of base-pairing and fusing the two RNA elements through an artificial loop.
- FIGS. 8A-J disclose SEQ ID NOS 102-118, respectively, in order of appearance.
- FIG. 9 A-O shows a list of the human codon optimized Cas9 sequences to pair with the chimeric guide RNAs provided in FIGS. 8 A-J.
- FIGS. 9A-O disclose SEQ ID NOS 119-137, respectively, in order of appearance.
- FIG. 10 A-M shows sequences where the mutation points are located within the SpCas9 gene.
- FIGS. 10A-M disclose the nucleotide sequence as SEQ ID NO: 138 and the amino acid sequence as SEQ ID NO: 139.
- FIG. 11 shows Type II CRISPR loci in different organisms.
- FIG. 12 shows guide RNA sequences (SEQ ID NOS 140-157, respectively, in order of appearance) corresponding to CRISPR loci in different organisms.
- FIG. 13 A-II shows a table listing Cas9 orthologs and their corresponding PAM sequences.
- FIG. 13 A-II discloses SEQ ID NOS 158-199, respectively, in order of appearance.
- FIG. 14 shows that the PAM for Staphylococcus aureus subspecies Aureus Cas9 is NNGRR.
- FIG. 14 discloses SEQ ID NOS 200-209, respectively, in order of appearance.
- FIG. 15A-D shows single and multiple vector designs for SaCas9.
- FIG. 16 shows a vector design and gel images for Cas9 orthologs and respective sgRNAs being used to cleave two candidate targets present in a pUC19-based library.
- FIG. 16 discloses SEQ ID NOS 210 and 211, respectively, in order of appearance.
- FIG. 17 shows in vitro cleavage by SpCas9, St3Cas9, Sp_St3 chimera and St3_Sp chimera.
- the PAMs for St3Cas9 and St3_Sp chimeric Cas9 are NGG.
- FIG. 18 shows an image of the CRISPRs web server.
- FIG. 19 A-L shows a multiple sequence alignment for 12 Cas9 orthologs. Two catalytic residues are highlighted. The first residue highlighted is the catalytic Asp residue in the RuvC1 domain, and the second residue highlighted is the catalytic His residue in the HNH domain. Mutation of one or the other residue into Ala can convert Cas9 into a nickase. Mutation of both residues converts Cas9 into a catalytically null mutant—useful for generic DNA binding.
- FIGS. 19A-L disclose SEQ ID NOS 186, 212, 168, 171, 180, 192, 195, 177, 189, 183, 159 and 162, respectively, in order of appearance.
- FIG. 20 shows a western blot showing that Cas9 orthologs are expressed in HEK 293FT cells; DNA plasmids encoding Cas9 orthologs are transfected into HEK 293FT cells and cell lysates are harvested for Western blot. No DNA is transfected for Cas9 ortholog #8.
- FIG. 21 shows in vitro cleavage of candidate targets on pUC19 plasmid by 10 Cas9 orthologs. Consensus PAMs are predicted by sequence logos ( FIG. 7 ), based on which candidate targets on pUC19 are chosen. 7 of 9 new Cas9 orthologs tested have successfully cleaved at least one pUC19 target. SpCas9 can also cleave NGA in vitro.
- FIG. 21 discloses SEQ ID NOS 213-228, respectively, in order of appearance.
- FIG. 22 shows a Representative Surveyor Gel showing genomic cleavage by SaCas9.
- FIG. 23 shows Genome Cleavage Efficiency of PAM Sequences (All targets).
- FIG. 24 shows Genome Cleavage Efficiency of PAM Sequences (Cleaved targets)
- FIG. 25 shows Genome Cleavage Efficiency of PAM Sequences (All targets, discard low-efficiency and orphan targets).
- FIG. 26 shows Genome Cleavage Efficiency of PAM Sequences (Cleaved targets, discard low-efficiency and orphan targets).
- FIG. 27 shows a Sequence Logo for Working Cleaved Spacers & PAMs (New endogenous genome test showing that T is not required).
- the invention relates to the engineering and optimization of systems, methods and compositions used for the control of gene expression involving sequence targeting, such as genome perturbation or gene-editing, that relate to the CRISPR-Cas system and components thereof.
- the CRISPR enzyme is a Cas enzyme, e.g. a Cas9 ortholog.
- the invention uses nucleic acids to bind target DNA sequences. This is advantageous as nucleic acids are much easier and cheaper to produce than, for example, peptides, and the specificity can be varied according to the length of the stretch where homology is sought. Complex 3-D positioning of multiple fingers, for example is not required.
- polynucleotide refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
- Polynucleotides may have any three dimensional structure, and may perform any function, known or unknown.
- polynucleotides coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, short interfering RNA (siRNA), short-hairpin RNA (shRNA), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
- loci locus defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, short interfering RNA (siRNA), short-hairpin RNA (shRNA), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branched poly
- a polynucleotide may comprise one or more modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- chimeric RNA refers to the polynucleotide sequence comprising the guide sequence, the tracr sequence and the tracr mate sequence.
- guide sequence refers to the about 20 bp sequence within the guide RNA that specifies the target site and may be used interchangeably with the terms “guide” or “spacer”.
- tracr mate sequence may also be used interchangeably with the term “direct repeat(s)”.
- wild type is a term of the art understood by skilled persons and means the typical form of an organism, strain, gene or characteristic as it occurs in nature as distinguished from mutant or variant forms.
- variable should be taken to mean the exhibition of qualities that have a pattern that deviates from what occurs in nature.
- nucleic acid molecules or polypeptides mean that the nucleic acid molecule or the polypeptide is at least substantially free from at least one other component with which they are naturally associated in nature and as found in nature.
- “Complementarity” refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick base pairing or other non-traditional types.
- a percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%, 90%, and 100% complementary).
- Perfectly complementary means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence.
- “Substantially complementary” as used herein refers to a degree of complementarity that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more nucleotides, or refers to two nucleic acids that hybridize under stringent conditions.
- stringent conditions for hybridization refer to conditions under which a nucleic acid having complementarity to a target sequence predominantly hybridizes with the target sequence, and substantially does not hybridize to non-target sequences. Stringent conditions are generally sequence-dependent, and vary depending on a number of factors. In general, the longer the sequence, the higher the temperature at which the sequence specifically hybridizes to its target sequence. Non-limiting examples of stringent conditions are described in detail in Tijssen (1993). Laboratory Techniques In Biochemistry And Molecular Biology-Hybridization With Nucleic Acid Probes Part I, Second Chapter “Overview of principles of hybridization and the strategy of nucleic acid probe assay”, Elsevier, N.Y.
- complementary or partially complementary sequences are also envisaged. These are preferably capable of hybridising to the reference sequence under highly stringent conditions.
- relatively low-stringency hybridization conditions are selected: about 20 to 25° C. lower than the thermal melting point (Tm).
- Tm is the temperature at which 50% of specific target sequence hybridizes to a perfectly complementary probe in solution at a defined ionic strength and pH.
- highly stringent washing conditions are selected to be about 5 to 15° C. lower than the Tm.
- moderately-stringent washing conditions are selected to be about 15 to 30° C. lower than the Tm.
- Highly permissive (very low stringency) washing conditions may be as low as 50° C. below the Tm, allowing a high level of mis-matching between hybridized sequences.
- Other physical and chemical parameters in the hybridization and wash stages can also be altered to affect the outcome of a detectable hybridization signal from a specific level of homology between target and probe sequences.
- Preferred highly stringent conditions comprise incubation in 50% formamide, 5 ⁇ SSC, and 1% SDS at 42° C., or incubation in 5 ⁇ SSC and 1% SDS at 65° C., with wash in 0.2 ⁇ SSC and 0.1% SDS at 65° C.
- Hybridization refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues.
- the hydrogen bonding may occur by Watson Crick base pairing, Hoogstein binding, or in any other sequence specific manner.
- the complex may comprise two strands forming a duplex structure, three or more strands forming a multi stranded complex, a single self-hybridizing strand, or any combination of these.
- a hybridization reaction may constitute a step in a more extensive process, such as the initiation of PCR, or the cleavage of a polynucleotide by an enzyme.
- a sequence capable of hybridizing with a given sequence is referred to as the “complement” of the given sequence.
- genomic locus or “locus” (plural loci) is the specific location of a gene or DNA sequence on a chromosome.
- a “gene” refers to stretches of DNA or RNA that encode a polypeptide or an RNA chain that has functional role to play in an organism and hence is the molecular unit of heredity in living organisms.
- genes include regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences.
- a gene includes, but is not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites and locus control regions.
- expression of a genomic locus is the process by which information from a gene is used in the synthesis of a functional gene product.
- the products of gene expression are often proteins, but in non-protein coding genes such as rRNA genes or tRNA genes, the product is functional RNA.
- the process of gene expression is used by all known life—eukaryotes (including multicellular organisms), prokaryotes (bacteria and archaea) and viruses to generate functional products to survive.
- expression of a gene or nucleic acid encompasses not only cellular gene expression, but also the transcription and translation of nucleic acid(s) in cloning systems and in any other context.
- expression also refers to the process by which a polynucleotide is transcribed from a DNA template (such as into and mRNA or other RNA transcript) and/or the process by which a transcribed mRNA is subsequently translated into peptides, polypeptides, or proteins.
- Transcripts and encoded polypeptides may be collectively referred to as “gene product.” If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell.
- polypeptide refers to polymers of amino acids of any length.
- the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non amino acids.
- the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
- amino acid includes natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics.
- domain refers to a part of a protein sequence that may exist and function independently of the rest of the protein chain.
- sequence identity is related to sequence homology. Homology comparisons may be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs may calculate percent (%) homology between two or more sequences and may also calculate the sequence identity shared by two or more amino acid or nucleic acid sequences. Sequence homologies may be generated by any of a number of computer programs known in the art, for example BLAST or FASTA, etc. A suitable computer program for carrying out such an alignment is the GCG Wisconsin Bestfit package (University of Wisconsin, U.S.A; Devereux et al., 1984, Nucleic Acids Research 12:387).
- Examples of other software than may perform sequence comparisons include, but are not limited to, the BLAST package (see Ausubel et al., 1999 ibid—Chapter 18), FASTA (Atschul et al., 1990, J. Mol. Biol., 403-410) and the GENEWORKS suite of comparison tools. Both BLAST and FASTA are available for offline and online searching (see Ausubel et al., 1999 ibid, pages 7-58 to 7-60). However it is preferred to use the GCG Bestfit program.
- % homology may be calculated over contiguous sequences, i.e., one sequence is aligned with the other sequence and each amino acid or nucleotide in one sequence is directly compared with the corresponding amino acid or nucleotide in the other sequence, one residue at a time. This is called an “ungapped” alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues.
- gaps penalties assign “gap penalties” to each gap that occurs in the alignment so that, for the same number of identical amino acids, a sequence alignment with as few gaps as possible—reflecting higher relatedness between the two compared sequences—may achieve a higher score than one with many gaps.
- “Affinity gap costs” are typically used that charge a relatively high cost for the existence of a gap and a smaller penalty for each subsequent residue in the gap. This is the most commonly used gap scoring system. High gap penalties may, of course, produce optimized alignments with fewer gaps. Most alignment programs allow the gap penalties to be modified. However, it is preferred to use the default values when using such software for sequence comparisons. For example, when using the GCG Wisconsin Bestfit package the default gap penalty for amino acid sequences is ⁇ 12 for a gap and ⁇ 4 for each extension.
- Calculation of maximum % homology therefore first requires the production of an optimal alignment, taking into consideration gap penalties.
- a suitable computer program for carrying out such an alignment is the GCG Wisconsin Bestfit package (Devereux et al., 1984 Nuc. Acids Research 12 p 387).
- Examples of other software that may perform sequence comparisons include, but are not limited to, the BLAST package (see Ausubel et al., 1999 Short Protocols in Molecular Biology, 4th Ed.—Chapter 18), FASTA (Altschul et al., 1990 J. Mol. Biol. 403-410) and the GENEWORKS suite of comparison tools.
- BLAST and FASTA are available for offline and online searching (see Ausubel et al., 1999, Short Protocols in Molecular Biology, pages 7-58 to 7-60). However, for some applications, it is preferred to use the GCG Bestfit program.
- a new tool, called BLAST 2 Sequences is also available for comparing protein and nucleotide sequences (see FEMS Microbiol Lett. 1999 174(2): 247-50; FEMS Microbiol Lett. 1999 177(1): 187-8 and the website of the National Center for Biotechnology information at the website of the National Institutes for Health).
- a scaled similarity score matrix is generally used that assigns scores to each pair-wise comparison based on chemical similarity or evolutionary distance.
- An example of such a matrix commonly used is the BLOSUM62 matrix—the default matrix for the BLAST suite of programs.
- GCG Wisconsin programs generally use either the public default values or a custom symbol comparison table, if supplied (see user manual for further details). For some applications, it is preferred to use the public default values for the GCG package, or in the case of other software, the default matrix, such as BLOSUM62.
- percentage homologies may be calculated using the multiple alignment feature in DNASISTM (Hitachi Software), based on an algorithm, analogous to CLUSTAL (Higgins D G & Sharp P M (1988), Gene 73(1), 237-244).
- DNASISTM Hagachi Software
- CLUSTAL Higgins D G & Sharp P M (1988), Gene 73(1), 237-244
- sequences may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent substance.
- Deliberate amino acid substitutions may be made on the basis of similarity in amino acid properties (such as polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues) and it is therefore useful to group amino acids together in functional groups.
- Amino acids may be grouped together based on the properties of their side chains alone. However, it is more useful to include mutation data as well.
- the sets of amino acids thus derived are likely to be conserved for structural reasons. These sets may be described in the form of a Venn diagram (Livingstone C. D. and Barton G. J.
- Embodiments of the invention include sequences (both polynucleotide or polypeptide) which may comprise homologous substitution (substitution and replacement are both used herein to mean the interchange of an existing amino acid residue or nucleotide, with an alternative residue or nucleotide) that may occur i.e., like-for-like substitution in the case of amino acids such as basic for basic, acidic for acidic, polar for polar, etc.
- Non-homologous substitution may also occur i.e., from one class of residue to another or alternatively involving the inclusion of unnatural amino acids such as ornithine (hereinafter referred to as Z), diaminobutyric acid ornithine (hereinafter referred to as B), norleucine ornithine (hereinafter referred to as O), pyridylalanine, thienylalanine, naphthylalanine and phenylglycine.
- Z ornithine
- B diaminobutyric acid ornithine
- O norleucine ornithine
- Variant amino acid sequences may include suitable spacer groups that may be inserted between any two amino acid residues of the sequence including alkyl groups such as methyl, ethyl or propyl groups in addition to amino acid spacers such as glycine or ⁇ -alanine residues.
- alkyl groups such as methyl, ethyl or propyl groups
- amino acid spacers such as glycine or ⁇ -alanine residues.
- a further form of variation which involves the presence of one or more amino acid residues in peptoid form, may be well understood by those skilled in the art.
- the peptoid form is used to refer to variant amino acid residues wherein the ⁇ -carbon substituent group is on the residue's nitrogen atom rather than the ⁇ -carbon.
- the invention provides for vectors that are used in the engineering and optimization of CRISPR-Cas systems.
- a “vector” is a tool that allows or facilitates the transfer of an entity from one environment to another. It is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment.
- a vector is capable of replication when associated with the proper control elements.
- the term “vector” refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partially double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g.
- vectors refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques.
- viral vector wherein virally-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g. retroviruses, replication defective retroviruses, adenoviruses, replication defective adenoviruses, and adeno-associated viruses).
- Viral vectors also include polynucleotides carried by a virus for transfection into a host cell.
- vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as “expression vectors.” Common expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. Further discussion of vectors is provided herein.
- Recombinant expression vectors can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory elements, which may be selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed.
- “operably linked” is intended to mean that the nucleotide sequence of interest is linked to the regulatory element(s) in a manner that allows for expression of the nucleotide sequence (e.g. in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).
- the Cas9 is driven by the CBh promoter.
- the chimeric RNA is driven by a U6 promoter.
- the CBh and U6 are used together in the sense that the Cas9 is driven by the CBh promoter and the chimeric RNA is driven by a U6 promoter.
- the chimeric guide RNA consists of a 20 bp guide sequence (Ns) joined to the tracr sequence (running from the first “U” of the lower strand to the end of the transcript), which is truncated at various positions as indicated.
- the guide and tracr sequences are preferably separated by the tracr-mate sequence.
- a preferred example of a tracr-mate sequence is GUUUUAGAGCUA (SEQ ID NO: 58). This is preferably followed by a loop sequence.
- the loop is preferably GAAA, but it is not limited to this sequence or indeed to being only 4 bp in length. Indeed, preferred loop forming sequences for use in hairpin structures are four nucleotides in length, and most preferably have the sequence GAAA. However, longer or shorter loop sequences may be used, as may alternative sequences.
- the sequences preferably include a nucleotide triplet (for example, AAA), and an additional nucleotide (for example C or G). Examples of loop forming sequences include CAAA and AAAG. Throughout this application, chimeric RNA may also be called single guide, or synthetic guide RNA (sgRNA).
- chimeric guide RNAs may be designed as shown in FIG. 8 .
- the CRISPR loci in some of these families is depicted in FIG. 11 .
- the corresponding guide RNA sequences are shown in FIG. 12 .
- tracrRNA candidate sequences Based on the direct repeat sequence, we searched for tracrRNA candidate sequences with the following criteria: outside the crRNA array but containing high degree of homology to direct repeats (as required for direct repeat:tracrRNA base-pairing; custom computational analysis), outside the coding regions of the protein components, containing Rho-independent transcriptional termination signals ⁇ 60 bp-120 bp downstream from region of homology from with direct repeats, and co-folding with direct repeat to form a duplex, followed by two or more hairpin structures in the distal end of tracrRNA sequence. Based on these prediction criteria, we selected an initial set of 18 Cas9 proteins and their uniquely associated direct repeats and tracrRNAs distributed across all five Cas9 families.
- Applicants further generated a set of 18 chimeric RNA structures that preserved the sequence and secondary structures of the native direct repeat:tracrRNA duplex while shortening the region of base-pairing and fusing the two RNA elements through an artificial loop ( FIGS. 6 A-J).
- regulatory element is intended to include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences).
- promoters e.g. promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences).
- IRES internal ribosomal entry sites
- regulatory elements e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences.
- Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences).
- a tissue-specific promoter may direct expression primarily in a desired tissue of interest, such as muscle, neuron, bone, skin, blood, specific organs (e.g. liver, pancreas), or particular cell types (e.g. lymphocytes). Regulatory elements may also direct expression in a temporal-dependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific.
- a vector comprises one or more pol III promoter (e.g. 1, 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g. 1, 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g.
- pol III promoters include, but are not limited to, U6 and H1 promoters.
- pol II promoters include, but are not limited to, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) [see, e.g., Boshart et al, Cell, 41:521-530 (1985)], the SV40 promoter, the dihydrofolate reductase promoter, the ⁇ -actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EF1 ⁇ promoter.
- RSV Rous sarcoma virus
- CMV cytomegalovirus
- PGK phosphoglycerol kinase
- enhancer elements such as WPRE; CMV enhancers; the R-U5′ segment in LTR of HTLV-I (Mol. Cell. Biol., Vol. 8(1), p. 466-472, 1988); SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit ⁇ -globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31, 1981).
- WPRE WPRE
- CMV enhancers the R-U5′ segment in LTR of HTLV-I
- SV40 enhancer SV40 enhancer
- the intron sequence between exons 2 and 3 of rabbit ⁇ -globin Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31, 1981.
- a vector can be introduced into host cells to thereby produce transcripts, proteins, or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., clustered regularly interspersed short palindromic repeats (CRISPR) transcripts, proteins, enzymes, mutant forms thereof, fusion proteins thereof, etc.).
- CRISPR clustered regularly interspersed short palindromic repeats
- CRISPR transcripts e.g. nucleic acid transcripts, proteins, or enzymes
- CRISPR transcripts can be expressed in bacterial cells such as Escherichia coli , insect cells (using baculovirus expression vectors), yeast cells, or mammalian cells. Suitable host cells are discussed further in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990).
- the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
- Vectors may be introduced and propagated in a prokaryote or prokaryotic cell.
- a prokaryote is used to amplify copies of a vector to be introduced into a eukaryotic cell or as an intermediate vector in the production of a vector to be introduced into a eukaryotic cell (e.g. amplifying a plasmid as part of a viral vector packaging system).
- a prokaryote is used to amplify copies of a vector and express one or more nucleic acids, such as to provide a source of one or more proteins for delivery to a host cell or host organism.
- Fusion vectors add a number of amino acids to a protein encoded therein, such as to the amino terminus of the recombinant protein.
- Such fusion vectors may serve one or more purposes, such as: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification.
- a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein.
- enzymes, and their cognate recognition sequences include Factor Xa, thrombin and enterokinase.
- Example fusion expression vectors include pGEX (Pharmacia Biotech Inc, Smith and Johnson, 1988.
- GST glutathione S-transferase
- E. coli expression vectors examples include pTrc (Amrann et al., (1988) Gene 69:301-315) and pET 11d (Studier et al., GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89).
- a vector is a yeast expression vector.
- yeast expression vectors for expression in yeast Saccharomyces cerevisae include pYepSec1 (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kuijan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al., 1987. Gene 54: 113-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.).
- a vector drives protein expression in insect cells using baculovirus expression vectors.
- Baculovirus vectors available for expression of proteins in cultured insect cells include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
- a vector is capable of driving expression of one or more sequences in mammalian cells using a mammalian expression vector.
- mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J. 6: 187-195).
- the expression vector's control functions are typically provided by one or more regulatory elements.
- commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, simian virus 40, and others disclosed herein and known in the art.
- the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid).
- tissue-specific regulatory elements are known in the art.
- suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al., 1987. Genes Dev. 1: 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J.
- a regulatory element is operably linked to one or more elements of a CRISPR system so as to drive expression of the one or more elements of the CRISPR system.
- CRISPRs Clustered Regularly Interspaced Short Palindromic Repeats
- SPIDRs Sacer Interspersed Direct Repeats
- the CRISPR locus comprises a distinct class of interspersed short sequence repeats (SSRs) that were recognized in E. coli (Ishino et al., J. Bacteriol., 169:5429-5433 [1987]; and Nakata et al., J.
- the CRISPR loci typically differ from other SSRs by the structure of the repeats, which have been termed short regularly spaced repeats (SRSRs) (Janssen et al., OMICS J. Integ. Biol., 6:23-33 [2002]; and Mojica et al., Mol. Microbiol., 36:244-246 [2000]).
- SRSRs short regularly spaced repeats
- the repeats are short elements that occur in clusters that are regularly spaced by unique intervening sequences with a substantially constant length (Mojica et al., [2000], supra).
- the repeat sequences are highly conserved between strains, the number of interspersed repeats and the sequences of the spacer regions typically differ from strain to strain (van Embden et al., J.
- CRISPR loci have been identified in more than 40 prokaryotes (See e.g., Jansen et al., Mol. Microbiol., 43:1565-1575 [2002]; and Mojica et al., [2005]) including, but not limited to Aeropyrum, Pyrobaculum, Sulfolobus, Archaeoglobus, Halocarcula, Methanobacterium, Methanococcus, Methanosarcina, Methanopyrus, Pyrococcus, Picrophilus, Thermoplasma, Corynebacterium, Mycobacterium, Streptomyces, Aquifex, Porphyromonas, Chlorobium, Thermus, Bacillus, Listeria, Staphylococcus, Clostridium, Thermoanaerobacter, Mycoplasma, Fusobacterium, Azarcus, Chromobacterium, Neisseria, Nitrosomon
- CRISPR system refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated (“Cas”) genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g. tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a “direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a “spacer” in the context of an endogenous CRISPR system), or other sequences and transcripts from a CRISPR locus.
- a tracr trans-activating CRISPR
- tracr-mate sequence encompassing a “direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system
- guide sequence also referred to as a “spacer” in the context of an endogenous CRISPR system
- one or more elements of a CRISPR system is derived from a type I, type II, or type III CRISPR system. In some embodiments, one or more elements of a CRISPR system is derived from a particular organism comprising an endogenous CRISPR system, such as Streptococcus pyogenes . In general, a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR system).
- target sequence refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence and a guide sequence promotes the formation of a CRISPR complex.
- a target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides.
- a target sequence is located in the nucleus or cytoplasm of a cell.
- the CRISPR system is a type II CRISPR system and the Cas enzyme is Cas9, which catalyzes DNA cleavage.
- the Cas enzyme is Cas9, which catalyzes DNA cleavage.
- Enzymatic action by Cas9 derived from Streptococcus pyogenes or any closely related Cas9 generates double stranded breaks at target site sequences which hybridize to 20 nucleotides of the guide sequence and that have a protospacer-adjacent motif (PAM) sequence NGG/NRG (for example, as discussed elsewhere, a suitable PAM is 5′-NRG or 5′-NNGRR for SpCas9 or SaCas9 enzymes (or derived enzymes), respectively) following the 20 nucleotides of the target sequence.
- PAM protospacer-adjacent motif
- CRISPR activity through Cas9 for site-specific DNA recognition and cleavage is defined by the guide sequence, the tracr sequence that hybridizes in part to the guide sequence and the PAM sequence. More aspects of the CRISPR system are described in Karginov and Hannon, The CRISPR system: small RNA-guided defense in bacteria and archae, Mole Cell 2010, Jan. 15; 37(1): 7.
- the type II CRISPR locus from Streptococcus pyogenes SF370 contains a cluster of four genes Cas9, Cas1, Cas2, and Csn1, as well as two non-coding RNA elements, tracrRNA and a characteristic array of repetitive sequences (direct repeats) interspaced by short stretches of non-repetitive sequences (spacers, about 30 bp each).
- DSB targeted DNA double-strand break
- tracrRNA hybridizes to the direct repeats of pre-crRNA, which is then processed into mature crRNAs containing individual spacer sequences.
- the mature crRNA:tracrRNA complex directs Cas9 to the DNA target consisting of the protospacer and the corresponding PAM via heteroduplex formation between the spacer region of the crRNA and the protospacer DNA.
- Cas9 mediates cleavage of target DNA upstream of PAM to create a DSB within the protospacer ( FIG. 2A ).
- FIG. 2B demonstrates the nuclear localization of the codon optimized Cas9.
- the RNA polymerase III-based U6 promoter was selected to drive the expression of tracrRNA ( FIG. 2C ).
- a U6 promoter-based construct was developed to express a pre-crRNA array consisting of a single spacer flanked by two direct repeats (DRs, also encompassed by the term “tracr-mate sequences”; FIG. 2C ).
- the initial spacer was designed to target a 33-base-pair (bp) target site (30-bp protospacer plus a 3-bp CRISPR motif (PAM) sequence satisfying the NGG recognition motif of Cas9) in the human EMX1 locus ( FIG. 2C ), a key gene in the development of the cerebral cortex.
- bp 33-base-pair
- PAM 3-bp CRISPR motif
- FIG. 16 shows Cas9 orthologs and respective sgRNAs are used to cleave two candidate targets present in a pUC19-based library.
- Target 1 is followed by a randomized PAM containing 7 degenerate bases (5′-NNNNN-3′), and target 1′, which contains the same target sequence as target 1, is followed by a fixed PAM (5′-TGGAGAAT-3′).
- the sgRNA of each Cas9 ortholog contains the guide sequence against target 1 or target 1′.
- Gel images show successful cleavage by 20 Cas9 orthologs, indicating that these sgRNA designs are functional with their respective Cas9 enzymes.
- direct repeats or tracr mate sequences are either downloaded from the CRISPRs database or identified in silico by searching for repetitive motifs that are 1. found in a 2 kb window of genomic sequence flanking the type II CRISPR locus, 2. span from 20 to 50 bp, and 3. interspaced by 20 to 50 bp.
- 2 of these criteria may be used, for instance 1 and 2, 2 and 3, or 1 and 3.
- all 3 criteria may be used.
- candidate tracrRNA are subsequently predicted by 1. sequence homology to direct repeats (motif search in Geneious with up to 18-bp mismatches), 2. presence of a predicted Rho-independent transcriptional terminator in direction of transcription, and 3. stable hairpin secondary structure between tracrRNA and direct repeat.
- 2 of these criteria may be used, for instance 1 and 2, 2 and 3, or 1 and 3.
- all 3 criteria may be used.
- chimeric synthetic guide RNAs (sgRNAs) designs incorporate at least 8 bp of duplex structure between the direct repeat and tracrRNA.
- Optimal Cas9 activity may depend on the availability of free Mg2+ at levels higher than that present in the mammalian nucleus (see e.g. Jinek et al., 2012, Science, 337:816), and the preference for an NGG/NRG motif immediately downstream of the protospacer restricts the ability to target on average every 12-bp in the human genome.
- a CRISPR complex comprising a guide sequence hybridized to a target sequence and complexed with one or more Cas proteins
- formation of a CRISPR complex results in cleavage of one or both strands in or near (e.g. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or more base pairs from) the target sequence.
- the tracr sequence which may comprise or consist of all or a portion of a wild-type tracr sequence (e.g.
- one or more vectors driving expression of one or more elements of a CRISPR system are introduced into a host cell such that expression of the elements of the CRISPR system direct formation of a CRISPR complex at one or more target sites.
- a Cas enzyme, a guide sequence linked to a tracr-mate sequence, and a tracr sequence could each be operably linked to separate regulatory elements on separate vectors.
- two or more of the elements expressed from the same or different regulatory elements may be combined in a single vector, with one or more additional vectors providing any components of the CRISPR system not included in the first vector.
- CRISPR system elements that are combined in a single vector may be arranged in any suitable orientation, such as one element located 5′ with respect to (“upstream” of) or 3′ with respect to (“downstream” of) a second element.
- the coding sequence of one element may be located on the same or opposite strand of the coding sequence of a second element, and oriented in the same or opposite direction.
- a single promoter drives expression of a transcript encoding a CRISPR enzyme and one or more of the guide sequence, tracr mate sequence (optionally operably linked to the guide sequence), and a tracr sequence embedded within one or more intron sequences (e.g. each in a different intron, two or more in at least one intron, or all in a single intron).
- the CRISPR enzyme, guide sequence, tracr mate sequence, and tracr sequence are operably linked to and expressed from the same promoter.
- a vector comprises one or more insertion sites, such as a restriction endonuclease recognition sequence (also referred to as a “cloning site”).
- one or more insertion sites e.g. about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more insertion sites are located upstream and/or downstream of one or more sequence elements of one or more vectors.
- a vector comprises an insertion site upstream of a tracr mate sequence, and optionally downstream of a regulatory element operably linked to the tracr mate sequence, such that following insertion of a guide sequence into the insertion site and upon expression the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotic cell.
- a vector comprises two or more insertion sites, each insertion site being located between two tracr mate sequences so as to allow insertion of a guide sequence at each site.
- the two or more guide sequences may comprise two or more copies of a single guide sequence, two or more different guide sequences, or combinations of these.
- a single expression construct may be used to target CRISPR activity to multiple different, corresponding target sequences within a cell.
- a single vector may comprise about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or more guide sequences. In some embodiments, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more such guide-sequence-containing vectors may be provided, and optionally delivered to a cell.
- a vector comprises a regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, such as a Cas protein.
- Cas proteins include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csn1 and Csx12), Cas10, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx15, Csf1, Csf2, Csf3, Csf4, homologues thereof, or modified versions thereof.
- the unmodified CRISPR enzyme has DNA cleavage activity, such as Cas9.
- the CRISPR enzyme directs cleavage of one or both strands at the location of a target sequence, such as within the target sequence and/or within the complement of the target sequence. In some embodiments, the CRISPR enzyme directs cleavage of one or both strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence.
- a vector encodes a CRISPR enzyme that is mutated with respect to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence.
- an aspartate-to-alanine substitution (D10A) in the RuvC I catalytic domain of Cas9 from S. pyogenes converts Cas9 from a nuclease that cleaves both strands to a nickase (cleaves a single strand).
- D10A aspartate-to-alanine substitution
- pyogenes converts Cas9 from a nuclease that cleaves both strands to a nickase (cleaves a single strand).
- Other examples of mutations that render Cas9 a nickase include, without limitation.
- FIG. 19 shows a multiple sequence alignment of 12 Cas9 orthologs and indicates the conserved catalytic Asp residue in the RuvC I domain and the conserved catalytic His residue in the HNH domain. Mutation of one or the other residue into Ala may convert the Cas9 ortholog into a nickase. Mutation of both residues may convert the Cas9 ortholog into a catalytically null mutant—useful for generic DNA binding.
- two or more catalytic domains of Cas9 may be mutated to produce a mutated Cas9 ortholog substantially lacking all DNA cleavage activity.
- a D10A mutation is combined with one or more of H840A, N854A, or N863A mutations to produce a Cas9 enzyme substantially lacking all DNA cleavage activity.
- a CRISPR enzyme is considered to substantially lack all DNA cleavage activity when the DNA cleavage activity of the mutated enzyme is less than about 25%, 10%, 5%, 1%, 0.1%, 0.01%, or lower with respect to its non-mutated form.
- SpCas9 and SpCas9n indeed catalyzed integration of the HR template into the EMX1 locus.
- PCR amplification of the target region followed by restriction digest with HindIII revealed cleavage products corresponding to expected fragment sizes, with SpCas9 and SpCas9n mediating similar levels of HR efficiencies.
- FIG. 10A-M provides a scheme indicating positions of mutations in SpCas9 and Cas9 orthologs typically share the general organization of 3-4 RuvC domains and a HNH domain. The 5′ most RuvC domain cleaves the non-complementary strand, and the HNH domain cleaves the complementary strand.
- the catalytic residue in the 5′ RuvC domain is identified through homology comparison of the Cas9 of interest with other Cas9 orthologs (from S. pyogenes type II CRISPR locus, S. thermophilus CRISPR locus 1, S. thermophilus CRISPR locus 3, and Franciscilla novicida type II CRISPR locus), and the conserved Asp residue is mutated to alanine to convert Cas9 into a complementary-strand nicking enzyme. Similarly, the conserved His and Asn residues in the HNH domains are mutated to Alanine to convert Cas9 into a non-complementary-strand nicking enzyme.
- an enzyme coding sequence encoding a CRISPR enzyme is codon optimized for expression in particular cells, such as eukaryotic cells.
- the eukaryotic cells may be those of or derived from a particular organism, such as a mammal, including but not limited to human, mouse, rat, rabbit, dog, or non-human mammal including non-human primate.
- processes for modifying the germ line genetic identity of human beings and/or processes for modifying the genetic identity of animals which are likely to cause them suffering without any substantial medical benefit to man or animal, and also animals resulting from such processes may be excluded.
- codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g. about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence.
- codon bias differs in codon usage between organisms
- mRNA messenger RNA
- tRNA transfer RNA
- Codon usage tables are readily available, for example, at the “Codon Usage Database” available at www.kazusa.orjp/codon/ (visited Jul. 9, 2002), and these tables can be adapted in a number of ways. See Nakamura, Y., et al. “Codon usage tabulated from the international DNA sequence databases: status for the year 2000” Nucl. Acids Res. 28:292 (2000).
- codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; Jacobus, Pa.), are also available.
- one or more codons e.g. 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more, or all codons
- one or more codons in a sequence encoding a CRISPR enzyme correspond to the most frequently used codon for a particular amino acid.
- a vector encodes a CRISPR enzyme comprising one or more nuclear localization sequences (NLSs), such as about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs.
- the CRISPR enzyme comprises about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the amino-terminus, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the carboxy-terminus, or a combination of these (e.g. one or more NLS at the amino-terminus and one or more NLS at the carboxy terminus).
- the CRISPR enzyme comprises at most 6 NLSs.
- an NLS is considered near the N- or C-terminus when the nearest amino acid of the NLS is within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids along the polypeptide chain from the N- or C-terminus.
- Non-limiting examples of NLSs include an NLS sequence derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKRKV (SEQ ID NO: 59); the NLS from nucleoplasmin (e.g.
- the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK (SEQ ID NO: 60)); the c-myc NLS having the amino acid sequence PAAKRVKLD (SEQ ID NO: 61) or RQRRNELKRSP (SEQ ID NO: 62); the hRNPA1 M9 NLS having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO: 63); the sequence RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 64) of the IBB domain from importin-alpha; the sequences VSRKRPRP (SEQ ID NO: 65) and PPKKARED (SEQ ID NO: 66) of the myoma T protein; the sequence PQPKKKPL (SEQ ID NO: 67) of human p53; the sequence SALIKKKKKMAP (SEQ ID NO: 68) of mouse c-
- the one or more NLSs are of sufficient strength to drive accumulation of the CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic cell.
- strength of nuclear localization activity may derive from the number of NLSs in the CRISPR enzyme, the particular NLS(s) used, or a combination of these factors.
- Detection of accumulation in the nucleus may be performed by any suitable technique.
- a detectable marker may be fused to the CRISPR enzyme, such that location within a cell may be visualized, such as in combination with a means for detecting the location of the nucleus (e.g. a stain specific for the nucleus such as DAPI).
- Cell nuclei may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or enzyme activity assay. Accumulation in the nucleus may also be determined indirectly, such as by an assay for the effect of CRISPR complex formation (e.g. assay for DNA cleavage or mutation at the target sequence, or assay for altered gene expression activity affected by CRISPR complex formation and/or CRISPR enzyme activity), as compared to a control no exposed to the CRISPR enzyme or complex, or exposed to a CRISPR enzyme lacking the one or more NLSs.
- an assay for the effect of CRISPR complex formation e.g. assay for DNA cleavage or mutation at the target sequence, or assay for altered gene expression activity affected by CRISPR complex formation and/or CRISPR enzyme activity
- a guide sequence is any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of a CRISPR complex to the target sequence.
- the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more.
- Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting example of which include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g. the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies; available at www.novocraft.com), ELAND (Illumina, San Diego, Calif.), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net).
- Burrows-Wheeler Transform e.g. the Burrows Wheeler Aligner
- ClustalW Clustal X
- BLAT Novoalign
- ELAND Illumina, San Diego, Calif.
- SOAP available at soap.genomics.org.cn
- Maq available at maq.sourceforge.net.
- a guide sequence is about or more than about 5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in length. In some embodiments, a guide sequence is less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in length. The ability of a guide sequence to direct sequence-specific binding of a CRISPR complex to a target sequence may be assessed by any suitable assay.
- the components of a CRISPR system sufficient to form a CRISPR complex may be provided to a host cell having the corresponding target sequence, such as by transfection with vectors encoding the components of the CRISPR sequence, followed by an assessment of preferential cleavage within the target sequence, such as by Surveyor assay as described herein.
- cleavage of a target polynucleotide sequence may be evaluated in a test tube by providing the target sequence, components of a CRISPR complex, including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at the target sequence between the test and control guide sequence reactions.
- Other assays are possible, and will occur to those skilled in the art.
- Cas9 nickases may be advantageously used in combination with pairs of guide RNAs to generate DNA double strand breaks with defined overhangs.
- pairs of guide RNAs When two pairs of guide RNAs are used, it is possible to excise an intervening DNA fragment. If an exogenous piece of DNA is cleaved by the two pairs of guide RNAs to generate compatible overhangs with the genomic DNA, then the exogenous DNA fragment may be ligated into the genomic DNA to replace the excised fragment. For example, this may be used to remove trinucleotide repeat expansion in the huntingtin (HTT) gene to treat Huntington's Disease.
- HTT huntingtin
- Cas9 and its chimeric guide RNA, or combination of tracrRNA and crRNA can be delivered either as DNA or RNA. Delivery of Cas9 and guide RNA both as RNA (normal or containing base or backbone modifications) molecules can be used to reduce the amount of time that Cas9 protein persist in the cell. This may reduce the level of off-target cleavage activity in the target cell. Since delivery of Cas9 as mRNA takes time to be translated into protein, it might be advantageous to deliver the guide RNA several hours following the delivery of Cas9 mRNA, to maximize the level of guide RNA available for interaction with Cas9 protein.
- a variety of delivery systems can be introduced to introduce Cas9 (DNA or RNA) and guide RNA (DNA or RNA) into the host cell. These include the use of liposomes, viral vectors, electroporation, nanoparticles, nanowires (Shalek et al., Nano Letters, 2012), exosomes. Molecular trojan horses liposomes (Pardridge et al., Cold Spring Harb Protoc; 2010; doi: 10.1101/pdb.prot5407) may be used to deliver Cas9 and guide RNA across the blood brain barrier.
- a guide sequence is selected to reduce the degree secondary structure within the guide RNA. In some embodiments, about or less than about 75%, 50%, 40%, 30%, 25%, 20%. 15%, 10%, 5%, 1%, or fewer of the nucleotides of the guide RNA participate in self-complementary base pairing when optimally folded. Optimal folding may be determined by any suitable polynucleotide folding algorithm. Some programs are based on calculating the minimal Gibbs free energy. An example of one such algorithm is mFold, as described by Zuker and Stiegler (Nucleic Acids Res. 9 (1981), 133-148).
- a method of optimizing the guide RNA of a Cas9 ortholog comprises breaking up polyU tracts in the guide RNA.
- PolyU tracts that may be broken up may comprise a series of 4, 5, 6, 7, 8, 9 or 10 Us.
- a tracr mate sequence includes any sequence that has sufficient complementarity with a tracr sequence to promote one or more of: (1) excision of a guide sequence flanked by tracr mate sequences in a cell containing the corresponding tracr sequence; and (2) formation of a CRISPR complex at a target sequence, wherein the CRISPR complex comprises the tracr mate sequence hybridized to the tracr sequence.
- degree of complementarity is with reference to the optimal alignment of the tracr mate sequence and tracr sequence, along the length of the shorter of the two sequences.
- Optimal alignment may be determined by any suitable alignment algorithm, and may further account for secondary structures, such as self-complementarity within either the tracr sequence or tracr mate sequence.
- the degree of complementarity between the tracr sequence and tracr mate sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%. 40%, 50%, 60%, 70%. 80%, 90%, 95%, 97.5%, 99%, or higher.
- the tracr sequence is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more nucleotides in length.
- the tracr sequence and tracr mate sequence are contained within a single transcript, such that hybridization between the two produces a transcript having a secondary structure, such as a hairpin.
- the transcript or transcribed polynucleotide sequence has at least two or more hairpins. In preferred embodiments, the transcript has two, three, four or five hairpins. In a further embodiment of the invention, the transcript has at most five hairpins. In a hairpin structure the portion of the sequence 5′ of the final “N” and upstream of the loop corresponds to the tracr mate sequence, and the portion of the sequence 3′ of the loop corresponds to the tracr sequence.
- single polynucleotides comprising a guide sequence, a tracr mate sequence, and a tracr sequence are as follows (listed 5′ to 3′), where “N” represents a base of a guide sequence, the first block of lower case letters represent the tracr mate sequence, and the second block of lower case letters represent the tracr sequence, and the final poly-T sequence represents the transcription terminator: (1) NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNgttttgtactctcaagatttaGAAAtaaatcttgcagaagctacaaagataggctt catgccgaaatcaacaccctgtcattttatggcagggtgttttcgttatttaaTTTTTTTTTTTT (SEQ ID NO: 75); (2) NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
- sequences (1) to (3) are used in combination with Cas9 from S. thermophilus CRISPR1.
- sequences (4) to (6) are used in combination with Cas9 from S. pyogenes .
- the tracr sequence is a separate transcript from a transcript comprising the tracr mate sequence.
- a recombination template is also provided.
- a recombination template may be a component of another vector as described herein, contained in a separate vector, or provided as a separate polynucleotide.
- a recombination template is designed to serve as a template in homologous recombination, such as within or near a target sequence nicked or cleaved by a CRISPR enzyme as a part of a CRISPR complex.
- a template polynucleotide may be of any suitable length, such as about or more than about 10, 15, 20, 25, 50, 75, 100, 150, 200, 500, 1000, or more nucleotides in length.
- the template polynucleotide is complementary to a portion of a polynucleotide comprising the target sequence.
- a template polynucleotide might overlap with one or more nucleotides of a target sequences (e.g. about or more than about 1, 5, 10, 15, 20, or more nucleotides).
- the nearest nucleotide of the template polynucleotide is within about 1, 5, 10, 15, 20, 25, 50, 75, 100, 200, 300, 400, 500, 1000, 5000, 10000, or more nucleotides from the target sequence.
- the CRISPR enzyme is part of a fusion protein comprising one or more heterologous protein domains (e.g. about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more domains in addition to the CRISPR enzyme).
- a CRISPR enzyme fusion protein may comprise any additional protein sequence, and optionally a linker sequence between any two domains.
- protein domains that may be fused to a CRISPR enzyme include, without limitation, epitope tags, reporter gene sequences, and protein domains having one or more of the following activities: methylase activity, demethylase activity, transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, RNA cleavage activity and nucleic acid binding activity.
- epitope tags include histidine (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags.
- reporter genes include, but are not limited to, glutathione-S-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, beta-glucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and autofluorescent proteins including blue fluorescent protein (BFP).
- GST glutathione-S-transferase
- HRP horseradish peroxidase
- CAT chloramphenicol acetyltransferase
- beta-galactosidase beta-galactosidase
- beta-glucuronidase beta-galactosidase
- luciferase green fluorescent protein
- GFP green fluorescent protein
- HcRed HcRed
- DsRed cyan fluorescent protein
- a CRISPR enzyme may be fused to a gene sequence encoding a protein or a fragment of a protein that bind DNA molecules or bind other cellular molecules, including but not limited to maltose binding protein (MBP), S-tag, Lex A DNA binding domain (DBD) fusions, GAL4A DNA binding domain fusions, and herpes simplex virus (HSV) BP16 protein fusions. Additional domains that may form part of a fusion protein comprising a CRISPR enzyme are described in US20110059502, incorporated herein by reference. In some embodiments, a tagged CRISPR enzyme is used to identify the location of a target sequence.
- MBP maltose binding protein
- DBD Lex A DNA binding domain
- HSV herpes simplex virus
- a CRISPR enzyme may form a component of an inducible system.
- the inducible nature of the system would allow for spatiotemporal control of gene editing or gene expression using a form of energy.
- the form of energy may include but is not limited to electromagnetic radiation, sound energy, chemical energy and thermal energy.
- inducible system include tetracycline inducible promoters (Tet-On or Tet-Off), small molecule two-hybrid transcription activations systems (FKBP, ABA, etc), or light inducible systems (Phytochrome, LOV domains, or cryptochorome).
- the CRISPR enzyme may be a part of a Light Inducible Transcriptional Effector (LITE) to direct changes in transcriptional activity in a sequence-specific manner.
- the components of a light may include a CRISPR enzyme, a light-responsive cytochrome heterodimer (e.g. from Arabidopsis thaliana ), and a transcriptional activation/repression domain.
- LITE Light Inducible Transcriptional Effector
- the invention provides methods comprising delivering one or more polynucleotides, such as or one or more vectors as described herein, one or more transcripts thereof, and/or one or proteins transcribed therefrom, to a host cell.
- the invention further provides cells produced by such methods, and animals comprising or produced from such cells.
- a CRISPR enzyme in combination with (and optionally complexed with) a guide sequence is delivered to a cell.
- Conventional viral and non-viral based gene transfer methods can be used to introduce nucleic acids in mammalian cells or target tissues. Such methods can be used to administer nucleic acids encoding components of a CRISPR system to cells in culture, or in a host organism.
- Non-viral vector delivery systems include DNA plasmids, RNA (e.g. a transcript of a vector described herein), naked nucleic acid, and nucleic acid complexed with a delivery vehicle, such as a liposome.
- Viral vector delivery systems include DNA and RNA viruses, which have either episomal or integrated genomes after delivery to the cell.
- Methods of non-viral delivery of nucleic acids include lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA.
- Lipofection is described in e.g., U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., TransfectamTM and LipofectinTM).
- Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Felgner, WO 91/17424; WO 91/16024. Delivery can be to cells (e.g. in vitro or ex vivo administration) or target tissues (e.g. in vivo administration).
- lipid:nucleic acid complexes including targeted liposomes such as immunolipid complexes
- the preparation of lipid:nucleic acid complexes, including targeted liposomes such as immunolipid complexes is well known to one of skill in the art (see, e.g., Crystal, Science 270:404-410 (1995); Blaese et al., Cancer Gene Ther. 2:291-297 (1995); Behr et al., Bioconjugate Chem. 5:382-389 (1994); Remy et al., Bioconjugate Chem. 5:647-654 (1994); Gao et al., Gene Therapy 2:710-722 (1995); Ahmad et al., Cancer Res. 52:4817-4820 (1992); U.S. Pat. Nos. 4,186,183, 4,217,344, 4,235,871, 4,261,975, 4,485,054, 4,501,728, 4,774,085, 4,837,028, and 4,946,787).
- RNA or DNA viral based systems for the delivery of nucleic acids take advantage of highly evolved processes for targeting a virus to specific cells in the body and trafficking the viral payload to the nucleus.
- Viral vectors can be administered directly to patients (in vivo) or they can be used to treat cells in vitro, and the modified cells may optionally be administered to patients (ex vivo).
- Conventional viral based systems could include retroviral, lentivirus, adenoviral, adeno-associated and herpes simplex virus vectors for gene transfer. Integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene. Additionally, high transduction efficiencies have been observed in many different cell types and target tissues.
- Lentiviral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and typically produce high viral titers. Selection of a retroviral gene transfer system would therefore depend on the target tissue. Retroviral vectors are comprised of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LTRs are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cell to provide permanent transgene expression.
- Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immuno deficiency virus (SIV), human immuno deficiency virus (HIV), and combinations thereof (see, e.g., Buchscher et al., J. Virol. 66:2731-2739 (1992); Johann et al., J. Virol. 66:1635-1640 (1992); Sommnerfelt et al., Virol. 176:58-59 (1990); Wilson et al., J. Virol. 63:2374-2378 (1989); Miller et al., J. Virol. 65:2220-2224 (1991); PCT/US94/05700).
- MiLV murine leukemia virus
- GaLV gibbon ape leukemia virus
- SIV Simian Immuno deficiency virus
- HAV human immuno deficiency virus
- adenoviral based systems may be used.
- Adenoviral based vectors are capable of very high transduction efficiency in many cell types and do not require cell division. With such vectors, high titer and levels of expression have been obtained. This vector can be produced in large quantities in a relatively simple system.
- Adeno-associated virus (“AAV”) vectors may also be used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and for in vivo and ex vivo gene therapy procedures (see, e.g., West et al., Virology 160:38-47 (1987); U.S. Pat. No. 4,797,368; WO 93/24641; Kotin, Human Gene Therapy 5:793-801 (1994); Muzyczka, J. Clin. Invest. 94:1351 (1994). Construction of recombinant AAV vectors are described in a number of publications, including U.S. Pat. No.
- Packaging cells are typically used to form virus particles that are capable of infecting a host cell. Such cells include 293 cells, which package adenovirus, and ⁇ 2 cells or PA317 cells, which package retrovirus.
- Viral vectors used in gene therapy are usually generated by producer a cell line that packages a nucleic acid vector into a viral particle. The vectors typically contain the minimal viral sequences required for packaging and subsequent integration into a host, other viral sequences being replaced by an expression cassette for the polynucleotide(s) to be expressed. The missing viral functions are typically supplied in trans by the packaging cell line. For example, AAV vectors used in gene therapy typically only possess ITR sequences from the AAV genome which are required for packaging and integration into the host genome.
- Viral DNA is packaged in a cell line, which contains a helper plasmid encoding the other AAV genes, namely rep and cap, but lacking ITR sequences.
- the cell line may also infected with adenovirus as a helper.
- the helper virus promotes replication of the AAV vector and expression of AAV genes from the helper plasmid.
- the helper plasmid is not packaged in significant amounts due to a lack of ITR sequences. Contamination with adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV. Additional methods for the delivery of nucleic acids to cells are known to those skilled in the art. See, for example, US20030087817, incorporated herein by reference.
- AAV is considered an ideal candidate for use as a transducing vector.
- Such AAV transducing vectors can comprise sufficient cis-acting functions to replicate in the presence of adenovirus or herpesvirus or poxvirus (e.g., vaccinia virus) helper functions provided in trans.
- Recombinant AAV rAAV
- rAAV Recombinant AAV
- these vectors the AAV cap and/or rep genes are deleted from the viral genome and replaced with a DNA segment of choice.
- Current AAV vectors may accommodate up to 4300 bases of inserted DNA.
- rAAV there are a number of ways to produce rAAV, and the invention provides rAAV and methods for preparing rAAV.
- plasmid(s) containing or consisting essentially of the desired viral construct are transfected into AAV-infected cells.
- a second or additional helper plasmid is cotransfected into these cells to provide the AAV rep and/or cap genes which are obligatory for replication and packaging of the recombinant viral construct. Under these conditions, the rep and/or cap proteins of AAV act in trans to stimulate replication and packaging of the rAAV construct.
- Two to Three days after transfection rAAV is harvested. Traditionally rAAV is harvested from the cells along with adenovirus.
- rAAV is advantageously harvested not from the cells themselves, but from cell supernatant.
- rAAV can be prepared by a method that comprises or consists essentially of: infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, and helper virus (e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus) wherein the rAAV lacks functioning cap and/or rep (and the helper virus (e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus) provides the cap and/or rev function that the rAAV lacks); or infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, wherein the recombinant lacks functioning cap and/or rep, and
- helper virus e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus
- the rAAV can be from an AAV as herein described, and advantageously can be an rAAV1, rAAV2, AAV5 or rAAV having hybrid or capsid which may comprise AAV1, AAV2, AAV5 or any combination thereof.
- the invention provides rAAV that contains or consists essentially of an exogenous nucleic acid molecule encoding a CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) system, e.g., a plurality of cassettes comprising or consisting a first cassette comprising or consisting essentially of a promoter, a nucleic acid molecule encoding a CRISPR-associated (Cas) protein (putative nuclease or helicase proteins), e.g., Cas9 and a terminator, and a two, or more, advantageously up to the packaging size limit of the vector, e.g., in total (including the first cassette) five, cassettes comprising or consisting essentially of a promoter, nucleic acid molecule encoding guide RNA (gRNA) and a terminator (e.g., each cassette schematically represented as Promoter-gRNA 1-terminator, Promoter-gRNA2-terminator .
- CRISPR Clustered Regularly Inter
- Promoter-gRNA(N)-terminator (where N is a number that can be inserted that is at an upper limit of the packaging size limit of the vector), or two or more individual rAAVs, each containing one or more than one cassette of a CRISPR system, e.g., a first rAAV containing the first cassette comprising or consisting essentially of a promoter, a nucleic acid molecule encoding Cas, e.g., Cas9 and a terminator, and a second rAAV containing a plurality, four, cassettes comprising or consisting essentially of a promoter, nucleic acid molecule encoding guide RNA (gRNA) and a terminator (e.g., each cassette schematically represented as Promoter-gRNA 1-terminator, Promoter-gRNA2-terminator .
- gRNA nucleic acid molecule encoding guide RNA
- N is a number that can be inserted that is at an upper limit of the packaging size limit of the vector.
- N is a number that can be inserted that is at an upper limit of the packaging size limit of the vector.
- the promoter is in some embodiments advantageously human Synapsin I promoter (hSyn).
- Double Virus Vector
- Vector 1 containing one expression cassette for driving the expression of Cas9 Promoter-Cas9 coding nucleic acid molecule-terminator
- Vector 2 containing one more expression cassettes for driving the expression of one or more guideRNAs Promoter-gRNA 1-terminator Promoter-gRNA(N)-terminator (up to size limit of vector)
- an additional vector is used to deliver a homology-direct repair template.
- Promoter used to drive Cas9 coding nucleic acid molecule expression can include: AAV ITR can serve as a promoter: this is advantageous for eliminating the need for an additional promoter element (which can take up space in the vector). The additional space freed up can be used to drive the expression of additional elements (gRNA, etc). Also, ITR activity is relatively weaker, so can be used to reduce toxicity due to over expression of Cas9.
- promoters CMV, CAG, CBh, PGK, SV40, Ferritin heavy or light chains, etc.
- promoters for brain expression, can use promoters: SynapsinI for all neurons, CaMKIIalpha for excitatory neurons, GAD67 or GAD65 or VGAT for GABAergic neurons, etc.
- Albumin promoter For liver expression, can use Albumin promoter For lung expression, can use SP-B For endothelial cells, can use ICAM For hematopoietic cells can use IFNbeta or CD45
- Promoter used to drive guide RNA can include: Pol III promoters such as U6 or H1 Use of Pol II promoter and intronic cassettes to express gRNA
- the AAV can be AAV1, AAV2, AAV5 or any combination thereof.
- AAV8 is useful for delivery to the liver. The above promoters and vectors are preferred individually.
- a host cell is transiently or non-transiently transfected with one or more vectors described herein.
- a cell is transfected as it naturally occurs in a subject.
- a cell that is transfected is taken from a subject.
- the cell is derived from cells taken from a subject, such as a cell line. A wide variety of cell lines for tissue culture are known in the art.
- cell lines include, but are not limited to, C8161, CCRF-CEM, MOLT, mIMCD-3, NHDF, HeLa-S3, Huh1, Huh4, Huh7, HUVEC, HASMC, HEKn, HEKa, MiaPaCell, Panc1, PC-3, TF1, CTLL-2, C1R, Rat6, CV1, RPTE, A10, T24, J82, A375, ARH-77, Calu1, SW480, SW620, SKOV3, SK-UT, CaCo2, P388D1, SEM-K2, WEHI-231, HB56, TIB55, Jurkat, J45.01, LRMB, Bcl-1, BC-3, IC21, DLD2, Raw264.7, NRK, NRK-52E, MRC5, MEF, Hep G2, HeLa B, HeLa T4, COS, COS-1, COS-6, COS-M6A, BS-C-1 monkey kidney epithelial, BALB
- a cell transfected with one or more vectors described herein is used to establish a new cell line comprising one or more vector-derived sequences.
- a cell transiently transfected with the components of a CRISPR system as described herein (such as by transient transfection of one or more vectors, or transfection with RNA), and modified through the activity of a CRISPR complex, is used to establish a new cell line comprising cells containing the modification but lacking any other exogenous sequence.
- cells transiently or non-transiently transfected with one or more vectors described herein, or cell lines derived from such cells are used in assessing one or more test compounds.
- one or more vectors described herein are used to produce a non-human transgenic animal or transgenic plant.
- the transgenic animal is a mammal, such as a mouse, rat, or rabbit.
- Methods for producing transgenic plants and animals are known in the art, and generally begin with a method of cell transfection, such as described herein.
- the invention provides for methods of modifying a target polynucleotide in a eukaryotic cell, which may be in vivo, ex vivo or in vitro.
- the method comprises sampling a cell or population of cells from a human or non-human animal or plant (including micro-algae), and modifying the cell or cells. Culturing may occur at any stage ex vivo.
- the cell or cells may even be re-introduced into the non-human animal or plant (including micro-algae). For re-introduced cells it is particularly preferred that the cells are stem cells.
- the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
- the invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell.
- the method comprises allowing a CRISPR complex to bind to the polynucleotide such that said binding results in increased or decreased expression of said polynucleotide; wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
- Similar considerations apply as above for methods of modifying a target polynucleotide. In fact, these sampling, culturing and re-introduction options apply across the aspects of the present invention.
- kits containing any one or more of the elements disclosed in the above methods and compositions. Elements may provide individually or in combinations, and may provided in any suitable container, such as a vial, a bottle, or a tube. In some embodiments, the kit includes instructions in one or more languages, for example in more than one language.
- a kit comprises one or more reagents for use in a process utilizing one or more of the elements described herein.
- Reagents may be provided in any suitable container.
- a kit may provide one or more reaction or storage buffers.
- Reagents may be provided in a form that is usable in a particular assay, or in a form that requires addition of one or more other components before use (e.g. in concentrate or lyophilized form).
- a buffer can be any buffer, including but not limited to a sodium carbonate buffer, a sodium bicarbonate buffer, a borate buffer, a Tris buffer, a MOPS buffer, a HEPES buffer, and combinations thereof.
- the buffer is alkaline.
- the buffer has a pH from about 7 to about 10.
- the kit comprises one or more oligonucleotides corresponding to a guide sequence for insertion into a vector so as to operably link the guide sequence and a regulatory element.
- the kit comprises a homologous recombination template polynucleotide.
- the invention provides methods for using one or more elements of a CRISPR system.
- the CRISPR complex of the invention provides an effective means for modifying a target polynucleotide.
- the CRISPR complex of the invention has a wide variety of utility including modifying (e.g., deleting, inserting, translocating, inactivating, activating) a target polynucleotide in a multiplicity of cell types.
- the CRISPR complex of the invention has a broad spectrum of applications in, e.g., gene therapy, drug screening, disease diagnosis, and prognosis.
- An exemplary CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within the target polynucleotide.
- the guide sequence is linked to a tracr mate sequence, which in turn hybridizes to a tracr sequence.
- this invention provides a method of cleaving a target polynucleotide.
- the method comprises modifying a target polynucleotide using a CRISPR complex that binds to the target polynucleotide and effect cleavage of said target polynucleotide.
- the CRISPR complex of the invention when introduced into a cell, creates a break (e.g., a single or a double strand break) in the genome sequence.
- the method can be used to cleave a disease gene in a cell.
- the break created by the CRISPR complex can be repaired by a repair processes such as the error prone non-homologous end joining (NHEJ) pathway or the high fidelity homology-directed repair (HDR).
- NHEJ error prone non-homologous end joining
- HDR high fidelity homology-directed repair
- an exogenous polynucleotide template can be introduced into the genome sequence.
- the HDR process is used to modify a genome sequence.
- an exogenous polynucleotide template comprising a sequence to be integrated flanked by an upstream sequence and a downstream sequence is introduced into a cell.
- the upstream and downstream sequences share sequence similarity with either side of the site of integration in the chromosome.
- a donor polynucleotide can be DNA, e.g., a DNA plasmid, a bacterial artificial chromosome (BAC), a yeast artificial chromosome (YAC), a viral vector, a linear piece of DNA, a PCR fragment, a naked nucleic acid, or a nucleic acid complexed with a delivery vehicle such as a liposome or poloxamer.
- DNA e.g., a DNA plasmid, a bacterial artificial chromosome (BAC), a yeast artificial chromosome (YAC), a viral vector, a linear piece of DNA, a PCR fragment, a naked nucleic acid, or a nucleic acid complexed with a delivery vehicle such as a liposome or poloxamer.
- the exogenous polynucleotide template comprises a sequence to be integrated (e.g, a mutated gene).
- the sequence for integration may be a sequence endogenous or exogenous to the cell.
- Examples of a sequence to be integrated include polynucleotides encoding a protein or a non-coding RNA (e.g., a microRNA).
- the sequence for integration may be operably linked to an appropriate control sequence or sequences.
- the sequence to be integrated may provide a regulatory function.
- the upstream and downstream sequences in the exogenous polynucleotide template are selected to promote recombination between the chromosomal sequence of interest and the donor polynucleotide.
- the upstream sequence is a nucleic acid sequence that shares sequence similarity with the genome sequence upstream of the targeted site for integration.
- the downstream sequence is a nucleic acid sequence that shares sequence similarity with the chromosomal sequence downstream of the targeted site of integration.
- the upstream and downstream sequences in the exogenous polynucleotide template can have 75%, 80%, 85%, 90%, 95%, or 100% sequence identity with the targeted genome sequence.
- the upstream and downstream sequences in the exogenous polynucleotide template have about 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with the targeted genome sequence. In some methods, the upstream and downstream sequences in the exogenous polynucleotide template have about 99% or 100% sequence identity with the targeted genome sequence.
- An upstream or downstream sequence may comprise from about 20 bp to about 2500 bp, for example, about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, or 2500 bp.
- the exemplary upstream or downstream sequence has about 200 bp to about 2000 bp, about 600 bp to about 1000 bp, or more particularly about 700 bp to about 1000 bp.
- the exogenous polynucleotide template may further comprise a marker.
- a marker may make it easy to screen for targeted integrations. Examples of suitable markers include restriction sites, fluorescent proteins, or selectable markers.
- the exogenous polynucleotide template of the invention can be constructed using recombinant techniques (see, for example, Sambrook et al., 2001 and Ausubel et al., 1996).
- a double stranded break is introduced into the genome sequence by the CRISPR complex, the break is repaired via homologous recombination an exogenous polynucleotide template such that the template is integrated into the genome.
- the presence of a double-stranded break facilitates integration of the template.
- this invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell.
- the method comprises increasing or decreasing expression of a target polynucleotide by using a CRISPR complex that binds to the polynucleotide.
- a target polynucleotide can be inactivated to effect the modification of the expression in a cell. For example, upon the binding of a CRISPR complex to a target sequence in a cell, the target polynucleotide is inactivated such that the sequence is not transcribed, the coded protein is not produced, or the sequence does not function as the wild-type sequence does. For example, a protein or microRNA coding sequence may be inactivated such that the protein is not produced.
- control sequence refers to any nucleic acid sequence that effects the transcription, translation, or accessibility of a nucleic acid sequence. Examples of a control sequence include, a promoter, a transcription terminator, and an enhancer are control sequences.
- the inactivated target sequence may include a deletion mutation (i.e., deletion of one or more nucleotides), an insertion mutation (i.e., insertion of one or more nucleotides), or a nonsense mutation (i.e., substitution of a single nucleotide for another nucleotide such that a stop codon is introduced).
- a deletion mutation i.e., deletion of one or more nucleotides
- an insertion mutation i.e., insertion of one or more nucleotides
- a nonsense mutation i.e., substitution of a single nucleotide for another nucleotide such that a stop codon is introduced.
- An altered expression of one or more genome sequences associated with a signaling biochemical pathway can be determined by assaying for a difference in the mRNA levels of the corresponding genes between the test model cell and a control cell, when they are contacted with a candidate agent.
- the differential expression of the sequences associated with a signaling biochemical pathway is determined by detecting a difference in the level of the encoded polypeptide or gene product.
- nucleic acid contained in a sample is first extracted according to standard methods in the art.
- mRNA can be isolated using various lytic enzymes or chemical solutions according to the procedures set forth in Sambrook et al. (1989), or extracted by nucleic-acid-binding resins following the accompanying instructions provided by the manufacturers.
- the mRNA contained in the extracted nucleic acid sample is then detected by amplification procedures or conventional hybridization assays (e.g. Northern blot analysis) according to methods widely known in the art or based on the methods exemplified herein.
- amplification means any method employing a primer and a polymerase capable of replicating a target sequence with reasonable fidelity.
- Amplification may be carried out by natural or recombinant DNA polymerases such as TaqGoldTM, T7 DNA polymerase, Klenow fragment of E. coli DNA polymerase, and reverse transcriptase.
- a preferred amplification method is PCR.
- the isolated RNA can be subjected to a reverse transcription assay that is coupled with a quantitative polymerase chain reaction (RT-PCR) in order to quantify the expression level of a sequence associated with a signaling biochemical pathway.
- RT-PCR quantitative polymerase chain reaction
- Detection of the gene expression level can be conducted in real time in an amplification assay.
- the amplified products can be directly visualized with fluorescent DNA-binding agents including but not limited to DNA intercalators and DNA groove binders. Because the amount of the intercalators incorporated into the double-stranded DNA molecules is typically proportional to the amount of the amplified DNA products, one can conveniently determine the amount of the amplified products by quantifying the fluorescence of the intercalated dye using conventional optical systems in the art.
- DNA-binding dye suitable for this application include SYBR green, SYBR blue, DAPI, propidium iodine, Hoeste, SYBR gold, ethidium bromide, acridines, proflavine, acridine orange, acriflavine, fluorcoumanin, ellipticine, daunomycin, chloroquine, distamycin D, chromomycin, homidium, mithramycin, ruthenium polypyridyls, anthramycin, and the like.
- probe-based quantitative amplification relies on the sequence-specific detection of a desired amplified product. It utilizes fluorescent, target-specific probes (e.g., TaqMan® probes) resulting in increased specificity and sensitivity. Methods for performing probe-based quantitative amplification are well established in the art and are taught in U.S. Pat. No. 5,210,015.
- probes are allowed to form stable complexes with the sequences associated with a signaling biochemical pathway contained within the biological sample derived from the test subject in a hybridization reaction.
- antisense used as the probe nucleic acid
- the target polynucleotides provided in the sample are chosen to be complementary to sequences of the antisense nucleic acids.
- the target polynucleotide is selected to be complementary to sequences of the sense nucleic acid.
- Hybridization can be performed under conditions of various stringency, for instance as described herein. Suitable hybridization conditions for the practice of the present invention are such that the recognition interaction between the probe and sequences associated with a signaling biochemical pathway is both sufficiently specific and sufficiently stable. Conditions that increase the stringency of a hybridization reaction are widely known and published in the art. See, for example, (Sambrook, et al., (1989); Nonradioactive In Situ Hybridization Application Manual, Boehringer Mannheim, second edition).
- the hybridization assay can be formed using probes immobilized on any solid support, including but are not limited to nitrocellulose, glass, silicon, and a variety of gene arrays. A preferred hybridization assay is conducted on high-density gene chips as described in U.S. Pat. No. 5,445,934.
- the nucleotide probes are conjugated to a detectable label.
- Detectable labels suitable for use in the present invention include any composition detectable by photochemical, biochemical, spectroscopic, immunochemical, electrical, optical or chemical means.
- a wide variety of appropriate detectable labels are known in the art, which include fluorescent or chemiluminescent labels, radioactive isotope labels, enzymatic or other ligands.
- a fluorescent label or an enzyme tag such as digoxigenin, ⁇ -galactosidase, urease, alkaline phosphatase or peroxidase, avidin/biotin complex.
- the detection methods used to detect or quantify the hybridization intensity will typically depend upon the label selected above.
- radiolabels may be detected using photographic film or a phosphoimager.
- Fluorescent markers may be detected and quantified using a photodetector to detect emitted light.
- Enzymatic labels are typically detected by providing the enzyme with a substrate and measuring the reaction product produced by the action of the enzyme on the substrate; and finally colorimetric labels are detected by simply visualizing the colored label.
- An agent-induced change in expression of sequences associated with a signaling biochemical pathway can also be determined by examining the corresponding gene products. Determining the protein level typically involves a) contacting the protein contained in a biological sample with an agent that specifically bind to a protein associated with a signaling biochemical pathway; and (b) identifying any agent:protein complex so formed.
- the agent that specifically binds a protein associated with a signaling biochemical pathway is an antibody, preferably a monoclonal antibody.
- the reaction is performed by contacting the agent with a sample of the proteins associated with a signaling biochemical pathway derived from the test samples under conditions that will allow a complex to form between the agent and the proteins associated with a signaling biochemical pathway.
- the formation of the complex can be detected directly or indirectly according to standard procedures in the art.
- the agents are supplied with a detectable label and unreacted agents may be removed from the complex; the amount of remaining label thereby indicating the amount of complex formed.
- an indirect detection procedure may use an agent that contains a label introduced either chemically or enzymatically.
- a desirable label generally does not interfere with binding or the stability of the resulting agent:polypeptide complex.
- the label is typically designed to be accessible to an antibody for an effective binding and hence generating a detectable signal.
- labels suitable for detecting protein levels are known in the art.
- Non-limiting examples include radioisotopes, enzymes, colloidal metals, fluorescent compounds, bioluminescent compounds, and chemiluminescent compounds.
- agent:polypeptide complexes formed during the binding reaction can be quantified by standard quantitative assays. As illustrated above, the formation of agent:polypeptide complex can be measured directly by the amount of label remained at the site of binding.
- the protein associated with a signaling biochemical pathway is tested for its ability to compete with a labeled analog for binding sites on the specific agent. In this competitive assay, the amount of label captured is inversely proportional to the amount of protein sequences associated with a signaling biochemical pathway present in a test sample.
- a number of techniques for protein analysis based on the general principles outlined above are available in the art. They include but are not limited to radioimmunoassays, ELISA (enzyme linked immunoradiometric assays), “sandwich” immunoassays, immunoradiometric assays, in situ immunoassays (using e.g., colloidal gold, enzyme or radioisotope labels), western blot analysis, immunoprecipitation assays, immunofluorescent assays, and SDS-PAGE.
- radioimmunoassays ELISA (enzyme linked immunoradiometric assays), “sandwich” immunoassays, immunoradiometric assays, in situ immunoassays (using e.g., colloidal gold, enzyme or radioisotope labels), western blot analysis, immunoprecipitation assays, immunofluorescent assays, and SDS-PAGE.
- Antibodies that specifically recognize or bind to proteins associated with a signaling biochemical pathway are preferable for conducting the aforementioned protein analyses.
- antibodies that recognize a specific type of post-translational modifications e.g., signaling biochemical pathway inducible modifications
- Post-translational modifications include but are not limited to glycosylation, lipidation, acetylation, and phosphorylation. These antibodies may be purchased from commercial vendors.
- anti-phosphotyrosine antibodies that specifically recognize tyrosine-phosphorylated proteins are available from a number of vendors including Invitrogen and Perkin Elmer.
- Anti-phosphotyrosine antibodies are particularly useful in detecting proteins that are differentially phosphorylated on their tyrosine residues in response to an ER stress.
- proteins include but are not limited to eukaryotic translation initiation factor 2 alpha (eIF-2 ⁇ ).
- eIF-2 ⁇ eukaryotic translation initiation factor 2 alpha
- these antibodies can be generated using conventional polyclonal or monoclonal antibody technologies by immunizing a host animal or an antibody-producing cell with a target protein that exhibits the desired post-translational modification.
- tissue-specific, cell-specific or subcellular structure specific antibodies capable of binding to protein markers that are preferentially expressed in certain tissues, cell types, or subcellular structures.
- An altered expression of a gene associated with a signaling biochemical pathway can also be determined by examining a change in activity of the gene product relative to a control cell.
- the assay for an agent-induced change in the activity of a protein associated with a signaling biochemical pathway will dependent on the biological activity and/or the signal transduction pathway that is under investigation.
- a change in its ability to phosphorylate the downstream substrate(s) can be determined by a variety of assays known in the art. Representative assays include but are not limited to immunoblotting and immunoprecipitation with antibodies such as anti-phosphotyrosine antibodies that recognize phosphorylated proteins.
- kinase activity can be detected by high throughput chemiluminescent assays such as AlphaScreenTM (available from Perkin Elmer) and eTagTM assay (Chan-Hui, et al. (2003) Clinical Immunology 111: 162-174).
- high throughput chemiluminescent assays such as AlphaScreenTM (available from Perkin Elmer) and eTagTM assay (Chan-Hui, et al. (2003) Clinical Immunology 111: 162-174).
- pH sensitive molecules such as fluorescent pH dyes can be used as the reporter molecules.
- the protein associated with a signaling biochemical pathway is an ion channel
- fluctuations in membrane potential and/or intracellular ion concentration can be monitored.
- Representative instruments include FLIPRTM (Molecular Devices, Inc.) and VIPR (Aurora Biosciences). These instruments are capable of detecting reactions in over 1000 sample wells of a microplate simultaneously, and providing real-time measurement and functional data within a second or even a minisecond.
- a suitable vector can be introduced to a cell or an embryo via one or more methods known in the art, including without limitation, microinjection, electroporation, sonoporation, biolistics, calcium phosphate-mediated transfection, cationic transfection, liposome transfection, dendrimer transfection, heat shock transfection, nucleofection transfection, magnetofection, lipofection, impalefection, optical transfection, proprietary agent-enhanced uptake of nucleic acids, and delivery via liposomes, immunoliposomes, virosomes, or artificial virions.
- the vector is introduced into an embryo by microinjection.
- the vector or vectors may be microinjected into the nucleus or the cytoplasm of the embryo.
- the vector or vectors may be introduced into a cell by nucleofection.
- the target polynucleotide of a CRISPR complex can be any polynucleotide endogenous or exogenous to the eukaryotic cell.
- the target polynucleotide can be a polynucleotide residing in the nucleus of the eukaryotic cell.
- the target polynucleotide can be a sequence coding a gene product (e.g., a protein) or a non-coding sequence (e.g., a regulatory polynucleotide or a junk DNA).
- target polynucleotides include a sequence associated with a signaling biochemical pathway, e.g., a signaling biochemical pathway-associated gene or polynucleotide.
- target polynucleotides include a disease associated gene or polynucleotide.
- a “disease-associated” gene or polynucleotide refers to any gene or polynucleotide which is yielding transcription or translation products at an abnormal level or in an abnormal form in cells derived from a disease-affected tissues compared with tissues or cells of a non disease control.
- a disease-associated gene also refers to a gene possessing mutation(s) or genetic variation that is directly responsible or is in linkage disequilibrium with a gene(s) that is responsible for the etiology of a disease.
- the transcribed or translated products may be known or unknown, and may be at a normal or abnormal level.
- the target polynucleotide of a CRISPR complex can be any polynucleotide endogenous or exogenous to the eukaryotic cell.
- the target polynucleotide can be a polynucleotide residing in the nucleus of the eukaryotic cell.
- the target polynucleotide can be a sequence coding a gene product (e.g., a protein) or a non-coding sequence (e.g., a regulatory polynucleotide or a junk DNA).
- the target polynucleotide of a CRISPR complex may include a number of disease-associated genes and polynucleotides as well as signaling biochemical pathway-associated genes and polynucleotides as listed in U.S. provisional patent applications 61/736,527 and 61/748,427 having Broad reference BI-2011/008/WSGR Docket No. 44063-701.101 and BI-2011/008/WSGR Docket No. 44063-701.102 respectively, both entitled SYSTEMS METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION filed on Dec. 12, 2012 and Jan. 2, 2013, respectively, the contents of all of which are herein incorporated by reference in their entirety.
- target polynucleotides include a sequence associated with a signaling biochemical pathway, e.g., a signaling biochemical pathway-associated gene or polynucleotide.
- target polynucleotides include a disease associated gene or polynucleotide.
- a “disease-associated” gene or polynucleotide refers to any gene or polynucleotide which is yielding transcription or translation products at an abnormal level or in an abnormal form in cells derived from a disease-affected tissues compared with tissues or cells of a non disease control.
- a disease-associated gene also refers to a gene possessing mutation(s) or genetic variation that is directly responsible or is in linkage disequilibrium with a gene(s) that is responsible for the etiology of a disease.
- the transcribed or translated products may be known or unknown, and may be at a normal or abnormal level.
- disease-associated genes and polynucleotides are available from McKusick-Nathans Institute of Genetic Medicine, Johns Hopkins University (Baltimore, Md.) and National Center for Biotechnology Information, National Library of Medicine (Bethesda, Md.), available on the World Wide Web.
- genes, diseases and proteins can result in production of improper proteins or proteins in improper amounts which affect function.
- genes, diseases and proteins are hereby incorporated by reference from U.S. Provisional applications 61/736,527 filed on Dec. 12, 2012 and 61/748,427 filed on Jan. 2, 2013.
- Such genes, proteins and pathways may be the target polynucleotide of a CRISPR complex.
- Neoplasia PTEN ATM; ATR; EGFR; ERBB2; ERBB3; ERBB4; Notch1; Notch2; Notch3; Notch4; AKT; AKT2; AKT3; HIF; HIF1a; HIF3a; Met; HRG; Bcl2; PPAR alpha; PPAR gamma; WT1 (Wilms Tumor); FGF Receptor Family members (5 members: 1, 2, 3, 4, 5); CDKN2a; APC; RB (retinoblastoma); MEN1; VHL; BRCA1; BRCA2; AR (Androgen Receptor); TSG101; IGF; IGF Receptor; Igf1 (4 variants); Igf2 (3 variants); Igf 1 Receptor; Igf 2 Receptor; Bax; Bcl2; caspases family (9 members: 1, 2, 3, 4, 6, 7, 8, 9, 12); Kras;
- BCL7A BCL7
- Leukemia TAL1, and oncology TCL5, SCL, TAL2, FLT3, NBS1, NBS, ZNFN1A1, IK1, LYF1, diseases and disorders HOXD4, HOX4B, BCR, CML, PHL, ALL, ARNT, KRAS2, RASK2, GMPS, AF10, ARHGEF12, LARG, KIAA0382, CALM, CLTH, CEBPA, CEBP, CHIC2, BTL, FLT3, KIT, PBT, LPP, NPM1, NUP214, D9S46E, CAN, CAIN, RUNX1, CBFA2, AML1, WHSC1L1, NSD3, FLT3, AF1Q, NPM1, NUMA1, ZNF145, PLZF, PML, MYL, STAT5B, AF10, CALM, CLTH, ARL11, ARLTS1, P2RX7,
- Inflammation and AIDS Keratinization and AIDS (KIR3DL1, NKAT3, NKB1, AMB11, KIR3DS1, IFNG, CXCL12, immune related SDF1); Autoimmune lymphoproliferative syndrome (TNFRSF6, APT1, diseases and disorders FAS, CD95, ALPS1A); Combined immunodeficiency, (IL2RG, SCIDX1, SCIDX, IMD4); HIV-1 (CCL5, SCYA5, D17S136E, TCP228), HIV susceptibility or infection (IL10, CSIF, CMKBR2, CCR2, CMKBR5, CCCKR5 (CCR5)); Immunodeficiencies (CD3E, CD3G, AICDA, AID, HIGM2, TNFRSF5, CD40, UNG, DGU, HIGM4, TNFSF5, CD40LG, HIGM1, IGM, FOXP3, IPEX, AIID, XPID, PIDX, TNFRSF14B, TACI
- Muscular/Skeletal Becker muscular dystrophy (DMD, BMD, MYF6), Duchenne Muscular diseases and disorders Dystrophy (DMD, BMD); Emery-Dreifuss muscular dystrophy (LMNA, LMN1, EMD2, FPLD, CMD1A, HGPS, LGMD1B, LMNA, LMN1, EMD2, FPLD, CMD1A); Facioscapulohumeral muscular dystrophy (FSHMD1A, FSHD1A); Muscular dystrophy (FKRP, MDC1C, LGMD2I, LAMA2, LAMM, LARGE, KIAA0609, MDC1D, FCMD, TTID, MYOT, CAPN3, CANP3, DYSF, LGMD2B, SGCG, LGMD2C, DMDA1, SCG3, SGCA, ADL, DAG2, LGMD2D, DMDA2, SGCB, LGMD2E, SGCD, SGD, LGMD2F, C
- Neurological and ALS SOD1, ALS2, STEX, FUS, TARDBP, VEGF (VEGF-a, VEGF-b, neuronal diseases and VEGF-c); Alzheimer disease (APP, AAA, CVAP, AD1, APOE, AD2, disorders PSEN2, AD4, STM2, APBB2, FE65L1, NOS3, PLAU, URK, ACE, DCP1, ACE1, MPO, PACIP1, PAXIP1L, PTIP, A2M, BLMH, BMH, PSEN1, AD3); Autism (Mecp2, BZRAP1, MDGA2, Sema5A, Neurexin1, GLO1, MECP2, RTT, PPMX, MRX16, MRX79, NLGN3, NLGN4, KIAA1260, AUTSX2); Fragile X Syndrome (FMR2, FXR1, FXR2, mGLUR5); Huntington's disease and disease like disorders (HD, IT15, PRNP, PRIP, JPH3,
- Occular diseases and Age-related macular degeneration (Abcr, Ccl2, Cc2, cp (ceruloplasmin), disorders Timp3, cathepsinD, Vldlr, Ccr2); Cataract (CRYAA, CRYA1, CRYBB2, CRYB2, PITX3, BFSP2, CP49, CP47, CRYAA, CRYA1, PAX6, AN2, MGDA, CRYBA1, CRYB1, CRYGC, CRYG3, CCL, LIM2, MP19, CRYGD, CRYG4, BFSP2, CP49, CP47, HSF4, CTM, HSF4, CTM, MIP, AQP0, CRYAB, CRYA2, CTPP2, CRYBB1, CRYGD, CRYG4, CRYBB2, CRYB2, CRYGC, CRYG3, CCL, CRYAA, CRYA1, GJA8, CX50, CAE1, GJA3, CX46, CZP3, CAE3, CCM1, CAM
- Embodiments of the invention also relate to methods and compositions related to knocking out genes, amplifying genes and repairing particular mutations associated with DNA repeat instability and neurological disorders (Robert D. Wells, Tetsuo Ashizawa, Genetic Instabilities and Neurological Diseases, Second Edition, Academic Press, Oct. 13, 2011—Medical). Specific aspects of tandem repeat sequences have been found to be responsible for more than twenty human diseases (New insights into repeat instability: role of RNA•DNA hybrids. McIvor E I, Polak U, Napierala M. RNA Biol. 2010 September-October; 7(5):551-8). The CRISPR-Cas system may be harnessed to correct these defects of genomic instability.
- a further aspect of the invention relates to utilizing the CRISPR-Cas system for correcting defects in the EMP2A and EMP2B genes that have been identified to be associated with Lafora disease.
- Lafora disease is an autosomal recessive condition which is characterized by progressive myoclonus epilepsy which may start as epileptic seizures in adolescence.
- a few cases of the disease may be caused by mutations in genes yet to be identified.
- the disease causes seizures, muscle spasms, difficulty walking, dementia, and eventually death. There is currently no therapy that has proven effective against disease progression.
- the CRISPR-Cas system may be used to correct ocular defects that arise from several genetic mutations further described in Genetic Diseases of the Eye, Second Edition, edited by Elias I. Traboulsi, Oxford University Press, 2012.
- the genetic brain diseases may include but are not limited to Adrenoleukodystrophy, Agenesis of the Corpus Callosum, Aicardi Syndrome, Alpers' Disease, Alzheimer's Disease, Barth Syndrome, Batten Disease, CADASIL, Cerebellar Degeneration, Fabry's Disease, Gerstmann-Straussler-Scheinker Disease, Huntington's Disease and other Triplet Repeat Disorders, Leigh's Disease, Lesch-Nyhan Syndrome, Menkes Disease, Mitochondrial Myopathies and NINDS Colpocephaly. These diseases are further described on the website of the National Institutes of Health under the subsection Genetic Brain Disorders.
- the condition may be neoplasia. In some embodiments, where the condition is neoplasia, the genes to be targeted are any of those listed in Table A (in this case PTEN asn so forth). In some embodiments, the condition may be Age-related Macular Degeneration. In some embodiments, the condition may be a Schizophrenic Disorder. In some embodiments, the condition may be a Trinucleotide Repeat Disorder. In some embodiments, the condition may be Fragile X Syndrome. In some embodiments, the condition may be a Secretase Related Disorder. In some embodiments, the condition may be a Prion—related disorder. In some embodiments, the condition may be ALS. In some embodiments, the condition may be a drug addiction. In some embodiments, the condition may be Autism. In some embodiments, the condition may be Alzheimer's Disease. In some embodiments, the condition may be inflammation. In some embodiments, the condition may be Parkinson's Disease.
- proteins associated with Parkinson's disease include but are not limited to ⁇ -synuclein, DJ-1, LRRK2, PINK1, Parkin, UCHL1, Synphilin-1, and NURR1.
- addiction-related proteins may include ABAT for example.
- inflammation-related proteins may include the monocyte chemoattractant protein-1 (MCP1) encoded by the Ccr2 gene, the C—C chemokine receptor type 5 (CCR5) encoded by the Ccr5 gene, the IgG receptor IIB (FCGR2b, also termed CD32) encoded by the Fcgr2b gene, or the Fc epsilon R1g (FCER1g) protein encoded by the Fcer1g gene, for example.
- MCP1 monocyte chemoattractant protein-1
- CCR5 C—C chemokine receptor type 5
- FCGR2b also termed CD32
- FCER1g Fc epsilon R1g
- cardiovascular diseases associated proteins may include IL1B (interleukin 1, beta), XDH (xanthine dehydrogenase), TP53 (tumor protein p53), PTGIS (prostaglandin 12 (prostacyclin) synthase), MB (myoglobin), IL4 (interleukin 4), ANGPT1 (angiopoietin 1), ABCG8 (ATP-binding cassette, sub-family G (WHITE), member 8), or CTSK (cathepsin K), for example.
- IL1B interleukin 1, beta
- XDH xanthine dehydrogenase
- TP53 tumor protein p53
- PTGIS prostaglandin 12 (prostacyclin) synthase)
- MB myoglobin
- IL4 interleukin 4
- ANGPT1 angiopoietin 1
- ABCG8 ATP-binding cassette, sub-family G (WHITE), member 8
- CTSK
- Examples of Alzheimer's disease associated proteins may include the very low density lipoprotein receptor protein (VLDLR) encoded by the VLDLR gene, the ubiquitin-like modifier activating enzyme 1 (UBA1) encoded by the UBA1 gene, or the NEDD8-activating enzyme E1 catalytic subunit protein (UBE1C) encoded by the UBA3 gene, for example.
- VLDLR very low density lipoprotein receptor protein
- UBA1 ubiquitin-like modifier activating enzyme 1
- UBE1C NEDD8-activating enzyme E1 catalytic subunit protein
- proteins associated Autism Spectrum Disorder may include the benzodiazapine receptor (peripheral) associated protein 1 (BZRAP1) encoded by the BZRAP1 gene, the AF4/FMR2 family member 2 protein (AFF2) encoded by the AFF2 gene (also termed MFR2), the fragile X mental retardation autosomal homolog 1 protein (FXR1) encoded by the FXR1 gene, or the fragile X mental retardation autosomal homolog 2 protein (FXR2) encoded by the FXR2 gene, for example.
- BZRAP1 benzodiazapine receptor (peripheral) associated protein 1
- AFF2 AF4/FMR2 family member 2 protein
- FXR1 fragile X mental retardation autosomal homolog 1 protein
- FXR2 fragile X mental retardation autosomal homolog 2 protein
- proteins associated Macular Degeneration may include the ATP-binding cassette, sub-family A (ABC1) member 4 protein (ABCA4) encoded by the ABCR gene, the apolipoprotein E protein (APOE) encoded by the APOE gene, or the chemokine (C—C motif) Ligand 2 protein (CCL2) encoded by the CCL2 gene, for example.
- ABC1 sub-family A
- APOE apolipoprotein E protein
- CCL2 Ligand 2 protein
- proteins associated Schizophrenia may include NRG1, ErbB4, CPLX1, TPH1, TPH2, NRXN1, GSK3A, BDNF, DISC1, GSK3B, and combinations thereof.
- proteins involved in tumor suppression may include ATM (ataxia telangiectasia mutated), ATR (ataxia telangiectasia and Rad3 related), EGFR (epidermal growth factor receptor), ERBB2 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 2), ERBB3 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 3), ERBB4 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 4), Notch 1, Notch 2, Notch 3, or Notch 4, for example.
- ATM ataxia telangiectasia mutated
- ATR ataxia telangiectasia and Rad3 related
- EGFR epidermatitise
- ERBB2 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2
- ERBB3 v-erb-b2 erythroblastic leukemia viral on
- proteins associated with a secretase disorder may include PSENEN (presenilin enhancer 2 homolog ( C. elegans )), CTSB (cathepsin B), PSEN1 (presenilin 1), APP (amyloid beta (A4) precursor protein), APH1B (anterior pharynx defective 1 homolog B ( C. elegans )), PSEN2 (presenilin 2 (Alzheimer disease 4)), or BACE1 (beta-site APP-cleaving enzyme 1), for example.
- proteins associated with Amyotrophic Lateral Sclerosis may include SOD1 (superoxide dismutase 1), ALS2 (amyotrophic lateral sclerosis 2), FUS (fused in sarcoma), TARDBP (TAR DNA binding protein), VAGFA (vascular endothelial growth factor A), VAGFB (vascular endothelial growth factor B), and VAGFC (vascular endothelial growth factor C), and any combination thereof.
- SOD1 superoxide dismutase 1
- ALS2 amotrophic lateral sclerosis 2
- FUS fused in sarcoma
- TARDBP TAR DNA binding protein
- VAGFA vascular endothelial growth factor A
- VAGFB vascular endothelial growth factor B
- VAGFC vascular endothelial growth factor C
- proteins associated with prion diseases may include SOD1 (superoxide dismutase 1), ALS2 (amyotrophic lateral sclerosis 2), FUS (fused in sarcoma), TARDBP (TAR DNA binding protein), VAGFA (vascular endothelial growth factor A), VAGFB (vascular endothelial growth factor B), and VAGFC (vascular endothelial growth factor C), and any combination thereof.
- proteins related to neurodegenerative conditions in prion disorders may include A2M (Alpha-2-Macroglobulin), AATF (Apoptosis antagonizing transcription factor), ACPP (Acid phosphatase prostate), ACTA2 (Actin alpha 2 smooth muscle aorta), ADAM22 (ADAM metallopeptidase domain), ADORA3 (Adenosine A3 receptor), or ADRA1D (Alpha-1D adrenergic receptor for Alpha-1D adrenoreceptor), for example.
- A2M Alpha-2-Macroglobulin
- AATF Apoptosis antagonizing transcription factor
- ACPP Acid phosphatase prostate
- ACTA2 Actin alpha 2 smooth muscle aorta
- ADAM22 ADAM metallopeptidase domain
- ADORA3 Adosine A3 receptor
- ADRA1D Alpha-1D adrenergic receptor for Alpha-1D adrenoreceptor
- proteins associated with Immunodeficiency may include A2M [alpha-2-macroglobulin]; AANAT [arylalkylamine N-acetyltransferase]; ABCA1 [ATP-binding cassette, sub-family A (ABC1), member 1]; ABCA2 [ATP-binding cassette, sub-family A (ABC), member 2]; or ABCA3 [ATP-binding cassette, sub-family A (ABC1), member 3]; for example.
- A2M alpha-2-macroglobulin
- AANAT arylalkylamine N-acetyltransferase
- ABCA1 ATP-binding cassette, sub-family A (ABC1), member 1]
- ABCA2 ATP-binding cassette, sub-family A (ABC), member 2]
- ABCA3 [ATP-binding cassette, sub-family A (ABC1), member 3] for example.
- proteins associated with Trinucleotide Repeat Disorders include AR (androgen receptor), FMR1 (fragile X mental retardation 1), HTT (huntingtin), or DMPK (dystrophia myotonica-protein kinase), FXN (frataxin), ATXN2 (ataxin 2), for example.
- proteins associated with Neurotransmission Disorders include SST (somatostatin), NOS1 (nitric oxide synthase 1 (neuronal)), ADRA2A (adrenergic, alpha-2A-, receptor), ADRA2C (adrenergic, alpha-2C-, receptor), TACR1 (tachykinin receptor 1), or HTR2c (5-hydroxytryptamine (serotonin) receptor 2C), for example.
- neurodevelopmental-associated sequences include A2BP1 [ataxin 2-binding protein 1], AADAT [aminoadipate aminotransferase], AANAT [arylalkylamine N-acetyltransferase], ABAT [4-aminobutyrate aminotransferase], ABCA1 [ATP-binding cassette, sub-family A (ABC1), member 1], or ABCA13 [ATP-binding cassette, sub-family A (ABC1), member 13], for example.
- A2BP1 ataxin 2-binding protein 1
- AADAT aminoadipate aminotransferase
- AANAT arylalkylamine N-acetyltransferase
- ABAT 4-aminobutyrate aminotransferase
- ABCA1 ATP-binding cassette, sub-family A (ABC1), member 1
- ABCA13 ATP-binding cassette, sub-family A (ABC1), member 13
- preferred conditions treatable with the present system include may be selected from: Aicardi-Goutines Syndrome; Alexander Disease; Allan-Herndon-Dudley Syndrome; POLG-Related Disorders; Alpha-Mannosidosis (Type II and III); Alström Syndrome; Angelman; Syndrome; Ataxia-Telangiectasia; Neuronal Ceroid-Lipofuscinoses; Beta-Thalassemia; Bilateral Optic Atrophy and (Infantile) Optic Atrophy Type 1; Retinoblastoma (bilateral); Canavan Disease; Cerebrooculofacioskeletal Syndrome 1 [COFS1]; Cerebrotendinous Xanthomatosis; Cornelia de Lange Syndrome; MAPT-Related Disorders; Genetic Prion Diseases; Dravet Syndrome; Early-Onset Familial Alzheimer Disease; Friedreich Ataxia [FRDA]; Fryns Syndrome; Fucosidosis; Fukuyama Congenital Muscular Dystrophy; Galactosialidosis; Gau
- the present system can be used to target any polynucleotide sequence of interest.
- Some examples of conditions or diseases that might be usefully treated using the present system are included in the Tables above and examples of genes currently associated with those conditions are also provided there. However, the genes exemplified are not exhaustive.
- FIG. 6 A graph representing the length distribution of Cas9 homologs is shown in FIG. 6 : The graph is generated from sequences deposited in GenBank. Some of the sequences may have been mis-annotated and therefore the exact frequency for each length may not necessarily be accurate. Nevertheless it provides a glimpse at distribution of Cas9 proteins and suggest that there are shorter Cas9 homologs.
- CjCas9 can be easily packaged into AAV, lentiviruses, Adenoviruses, and other viral vectors for robust delivery into primary cells and in vivo animal models.
- the Cas9 protein from S. aureus is used.
- Campylobacter jejuni Cas9 (CjCas9) (SEQ ID NO: 81) MARILAFDIGISSIGWAFSENDELKDCGVRIFTKVENPKTGESLALPRRL ARSARKRLARRKARLNHLKHLIANEFKLNYEDYQSFDESLAKAYKGSLIS PYELRFRALNELLSKQDFARVILHIAKRRGYDDIKNSDDKEKGAILKAIK QNEEKLANYQSVGEYLYKEYFQKFKENSKEFTNVRNKKESYERCIAQSFL KDELKLIFKKQREFGFSFSKKFEEEVLSVAFYKRALKDFSHLVGNCSFFT DEKRAPKNSPLAFMFVALTRIINLLNNLKNTEGILYTKDDLNALLNEVLK NGTLTYKQTKKLLGLSDDYEFKGEKGTYFIEFKKYKEFIKALGEHNLSQD DLNEIAKDITLIKDEIKLKKALAKYDLNQNQIDSLSKLEFKD
- the putative tracrRNA element for this CjCas9 is:
- the Direct Repeat sequence is:
- chimeric guideRNA for CjCas9 is:
- the wild-type CRISPR-Cas system is an adaptive immune mechanism against invading exogenous DNA employed by diverse species across bacteria and archaea.
- the type II CRISPR-Cas system consists of a set of genes encoding proteins responsible for the “acquisition” of foreign DNA into the CRISPR locus, as well as a set of genes encoding the “execution” of the DNA cleavage mechanism; these include the DNA nuclease (Cas9), a non-coding transactivating cr-RNA (tracrRNA), and an array of foreign DNA-derived spacers flanked by direct repeats (crRNAs).
- the tracRNA and crRNA duplex guide the Cas9 nuclease to a target DNA sequence specified by the spacer guide sequences, and mediates double-stranded breaks in the DNA near a short sequence motif in the target DNA that is required for cleavage and specific to each CRISPR-Cas system.
- the type II CRISPR-Cas systems are found throughout the bacterial kingdom and highly diverse in Cas9 protein sequence and size, tracrRNA and crRNA direct repeat sequence, genome organization of these elements, and the motif requirement for target cleavage.
- One species may have multiple distinct CRISPR-Cas systems.
- the tracr mate sequences or the direct repeats are either downloaded from the CRISPRs database or identified in silico by searching for repetitive motifs that are 1. found in a 2 kb window of genomic sequence flanking the type II CRISPR locus, 2. span from 20 to 50 bp, and 3. interspaced by 20 to 50 bp. In some embodiments, 2 of these criteria may be used, for instance 1 and 2, 2 and 3, or 1 and 3. In some embodiments, all 3 criteria may be used. In some embodiments candidate tracrRNA are subsequently predicted by 1. sequence homology to direct repeats (motif search in Geneious with up to 18-bp mismatches), 2. presence of a predicted Rho-independent transcriptional terminator in direction of transcription, and 3.
- chimeric synthetic guide RNAs designs incorporate at least 12 bp of duplex structure between the direct repeat and tracrRNA.
- FIGS. 9 A-O The list of the human codon optimized Cas9 ortholog sequences to pair with the chimeric RNAs provided in FIGS. 8 A-J is provided in FIGS. 9 A-O.
- Applicants have also shown that the Cas9 orthologs can cleave their targets in in vitro cleavage assays ( FIG. 16 ).
- the CRISPR loci in some of these families is depicted in FIG. 11 .
- the corresponding guide RNA sequences are shown in FIG. 12 .
- Applicants systematically analyzed the genomic DNA sequence within ⁇ 2 kb of the Cas9 proteins using custom computational analysis code and identified direct repeats ranging from 35 bp to 50 bp, with intervening spacers ranging from 29 bp to 35 bp.
- tracrRNA candidate sequences Based on the direct repeat sequence, Applicants computationally searched for tracrRNA candidate sequences with the following criteria: outside the crRNA array but containing high degree of homology to direct repeats (as required for direct repeat:tracrRNA base-pairing; custom computational analysis), outside the coding regions of the protein components, containing Rho-independent transcriptional termination signals ⁇ 60 bp-120 bp downstream from region of homology from with direct repeats, and co-folding with direct repeat to form a duplex, followed by two or more hairpin structures in the distal end of tracrRNA sequence. Based on these prediction criteria, Applicants selected an initial set of 18 Cas9 proteins and their uniquely associated direct repeats and tracrRNAs distributed across all five Cas9 families.
- Applicants further generated a set of 18 chimeric RNA structures that preserved the sequence and secondary structures of the native direct repeat:tracrRNA duplex while shortening the region of base-pairing and fusing the two RNA elements through an artificial loop ( FIGS. 8A-J ).
- Applicants have generated codon optimized Cas9 orthologs to advance expression in eukaryotic cells.
- FIG. 13A-II Applicants analyzed Cas9 orthologs to identify the relevant PAM sequences and the corresponding chimeric guide RNA as indicated in FIG. 13A-II .
- This expanded set of PAMs provides broader targeting across the genome and also significantly increases the number of unique target sites and provides potential for identifying novel Cas9s with increased levels of specificity in the genome.
- Staphylococcus aureus subspecies Aureus Cas9 is also known as SaCas9.
- FIG. 15 a - d provides SaCas9 single or multiple vector designs.
- FIG. 7 show sequence logos for putative PAMs as indicated by reverse complements.
- Cas9 orthologs and their respective sgRNAs were used to cleave a library of targets bearing a randomized PAM (7-bp sequence immediately 3′ of the target sequence). Cleaved products were isolated and deep-sequenced to yield 7-bp candidate sequences that were permissive to cleavage for each Cas9 ortholog.
- consensus PAMs were determined by aligning all 7-bp candidate sequences. ( FIGS. 7 and 21 ).
- Applicants provide sequences showing where the mutation points are located within the SpCas9 gene ( FIG. 100A-M ). Applicants also show that the nickases are still able to mediate homologous recombination. Furthermore. SpCas9 with these mutations (individually) reduce the level of double strand break. Cas9 orthologs all share the general organization of 3-4 RuvC domains and a HNH domain ( FIG. 19 ). The 5′ most RuvC domain cleaves the non-complementary strand, and the HNH domain cleaves the complementary strand. All notations are in reference to the guide sequence.
- the catalytic residue in the 5′ RuvC domain is identified through homology comparison of the Cas9 of interest with other Cas9 orthologs (from S. pyogenes type II CRISPR locus, S. thermophilus CRISPR locus 1, S. thermophilus CRISPR locus 3, and Franciscilla novicida type II CRISPR locus), and the conserved Asp residue is mutated to alanine to convert Cas9 into a complementary-strand nicking enzyme. Similarly, the conserved His and Asn residues in the HNH domains are mutated to Alanine to convert Cas9 into a non-complementary-strand nicking enzyme.
- Applicants For enhanced function or to develop new functions, Applicants generate chimeric Cas9 proteins by combining fragments from different Cas9 orthologs.
- Sp_St3 chimeric proteins have shown in vitro cleavage by SpCas9, St3Cas9, Sp_St3 chimera and St3_Sp chimera ( FIG. 17 ).
- chimeric Cas9 The benefit of making chimeric Cas9 include:
- AAV vectors may accommodate up to 4300 bases of inserted DNA, as an upper limit or a packaging limit, AAV can have of 4.5 or 4.75 KB inserted DNA.
- DNA encoding a Cas9 enzyme as well as a promoter and transcription terminator have to be all fit into the same viral vector. Constructs larger than 4.5 or 4.75 KB will lead to significantly reduced virus production.
- SpCas9 is quite large, the gene itself is over 4.1 kb, which makes it difficult for packing into AAV. Therefore embodiments of the invention include utilizing orthologs of Cas9 that are shorter. For example:
- FIG. 3 provides schematic representations of AAV vectors which may be used in methods and compositions of the invention. Packaging is discussed above.
- Method 1 Applicants deliver Cas9 and guide RNA using a vector that expresses Cas9 under the control of a constitutive promoter such as Hsp70A-Rbc S2 or Beta2-tubulin.
- a constitutive promoter such as Hsp70A-Rbc S2 or Beta2-tubulin.
- Method 2 Applicants deliver Cas9 and T7 polymerase using vectors that expresses Cas9 and T7 polymerase under the control of a constitutive promoter such as Hsp70A-Rbc S2 or Beta2-tubulin.
- Guide RNA will be delivered using a vector containing T7 promoter driving the guide RNA.
- Method 3 Applicants deliver Cas9 mRNA and in vitro transcribed guide RNA to algae cells.
- RNA can be in vitro transcribed.
- Cas9 mRNA will consist of the coding region for Cas9 as well as 3′UTR from Cop1 to ensure stabilization of the Cas9 mRNA.
- Applicants provide an additional homology directed repair template.
- T7 promoter T7 promoter, Ns represent targeting sequence
- Electroporation protocol follows standard recommended protocol from the GeneArt Chlamydomonas Engineering kit (website information at tools.invitrogen.com/content/sfs/manuals/geneart_chlamy_kits_man.pdf).
- Applicants generate a line of Chlamydomonas reinhardtii that expresses Cas9 constitutively. This can be done by using pChlamyl (linearized using PvuI) and selecting for hygromycin resistant colonies. Sequence for pChlamyl containing Cas9 is below. In this way to achieve gene knockout one simply needs to deliver RNA for the guideRNA. For homologous recombination Applicants deliver guideRNA as well as a linearized homologous recombination template.
- Applicants use PCR, SURVEYOR nuclease assay, and DNA sequencing to verify successful modification.
- Sp Streptococcus pyogenes
- St Streptococcus thermophiles
- CRISPR Cas system with smaller size so Applicants could deliver them in vivo in a single vector with mammalian viral delivery system such as adeno-associated virus (AAV) vectors that has a packaging size limit (the current Sp or St system exceed this limit of 4.7 kb)
- AAV adeno-associated virus
- the components of this system are a Cas9 protein from Sa, a guide CRISPR RNA with direct repeats (DR) from Sa that will form a functional guide RNA complex with tracrRNA from Sa.
- DR direct repeats
- Applicants designed a two-component system, where Applicants fused the Sa tracrRNA to the Sa guide CRISPR RNA via a short stem-loop to form a chimeric guide RNA, exactly as Applicants did with the Streptococcus pyogenes (Sp) CRISPR/Cas system.
- This chimeric guide RNA was able to support cleavage of dsDNA in vitro. Therefore, Applicants decided to clone the full two-component system: cas9 and the chimeric guide RNA, into an AAV vector to test its functionality in living organisms.
- AAV AAV-based, non-immunogenic mammalian virus that has broad-spectrum of tropism in different tissues/organs depending on the serotype that has been shown to be safe for in vivo application and also support long-term expression of transgene in living organisms.
- Design of the initial AAV vector has (1) CMV promoter driving SaCas9 protein with a single NLS and a HA epitope tag. (2) human U6 promoter driving the chimeric RNA. These are placed in between two Inverted Terminal Repeats (ITRs) from the most-well studied AAV serotype 2 that serve as the viral packaging signal.
- ITRs Inverted Terminal Repeats
- the PAM sequence test on endogenous mammalian genome is as follows: SaCas9 target spacers were selected across multiple genes to cover different potential PAM sequences. Different spacers were cloned into U6-sgRNA (single-guide RNA) expression dsDNA cassette U6-sgRNA expression dsDNA cassette were co-transfected into mammalian cells lines (293FT for human targets, N2a and Hepa for mouse targets). 72 hours following transfection, all genomic DNA were extracted and subjected to surveyor nuclease assay. Run through TBE Page Gel to detect genomic cleavage. Quantify genomic DNA cleavage efficiency and plot.
- U6-sgRNA single-guide RNA
- Results from the PAM test are shown in FIGS. 22-27 .
- NNGRR for general SaCas9 PAM—helpful for design new targets
- NNGRG may be a more potent PAM.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- Plant Pathology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Medicinal Chemistry (AREA)
- Virology (AREA)
- Cell Biology (AREA)
- Bioinformatics & Computational Biology (AREA)
- Mycology (AREA)
- Crystallography & Structural Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Ophthalmology & Optometry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Epidemiology (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Immobilizing And Processing Of Enzymes And Microorganisms (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US14/104,977 US20140186919A1 (en) | 2012-12-12 | 2013-12-12 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US14/222,930 US8865406B2 (en) | 2012-12-12 | 2014-03-24 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US14/293,674 US8889418B2 (en) | 2012-12-12 | 2014-06-02 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US14/293,498 US8895308B1 (en) | 2012-12-12 | 2014-06-02 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US15/330,876 US20170198269A1 (en) | 2012-12-12 | 2016-11-07 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US19/025,663 US20250236856A1 (en) | 2012-12-12 | 2025-01-16 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
Applications Claiming Priority (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201261736527P | 2012-12-12 | 2012-12-12 | |
| US201361748427P | 2013-01-02 | 2013-01-02 | |
| US201361758468P | 2013-01-30 | 2013-01-30 | |
| US201361769046P | 2013-02-25 | 2013-02-25 | |
| US201361802174P | 2013-03-15 | 2013-03-15 | |
| US201361791409P | 2013-03-15 | 2013-03-15 | |
| US201361806375P | 2013-03-28 | 2013-03-28 | |
| US201361814263P | 2013-04-20 | 2013-04-20 | |
| US201361819803P | 2013-05-06 | 2013-05-06 | |
| US201361828130P | 2013-05-28 | 2013-05-28 | |
| US201361836101P | 2013-06-17 | 2013-06-17 | |
| US201361835931P | 2013-06-17 | 2013-06-17 | |
| US14/104,977 US20140186919A1 (en) | 2012-12-12 | 2013-12-12 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
Related Child Applications (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/222,930 Continuation US8865406B2 (en) | 2012-12-12 | 2014-03-24 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US14/293,674 Continuation US8889418B2 (en) | 2012-12-12 | 2014-06-02 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US14/293,498 Continuation US8895308B1 (en) | 2012-12-12 | 2014-06-02 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US15/330,876 Continuation US20170198269A1 (en) | 2012-12-12 | 2016-11-07 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20140186919A1 true US20140186919A1 (en) | 2014-07-03 |
Family
ID=49883291
Family Applications (6)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/104,977 Abandoned US20140186919A1 (en) | 2012-12-12 | 2013-12-12 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US14/222,930 Active US8865406B2 (en) | 2012-12-12 | 2014-03-24 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US14/293,498 Active US8895308B1 (en) | 2012-12-12 | 2014-06-02 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US14/293,674 Active US8889418B2 (en) | 2012-12-12 | 2014-06-02 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US15/330,876 Pending US20170198269A1 (en) | 2012-12-12 | 2016-11-07 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US19/025,663 Pending US20250236856A1 (en) | 2012-12-12 | 2025-01-16 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
Family Applications After (5)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/222,930 Active US8865406B2 (en) | 2012-12-12 | 2014-03-24 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US14/293,498 Active US8895308B1 (en) | 2012-12-12 | 2014-06-02 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US14/293,674 Active US8889418B2 (en) | 2012-12-12 | 2014-06-02 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US15/330,876 Pending US20170198269A1 (en) | 2012-12-12 | 2016-11-07 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| US19/025,663 Pending US20250236856A1 (en) | 2012-12-12 | 2025-01-16 | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
Country Status (15)
| Country | Link |
|---|---|
| US (6) | US20140186919A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP2898075B1 (cg-RX-API-DMAC7.html) |
| JP (6) | JP6552965B2 (cg-RX-API-DMAC7.html) |
| KR (1) | KR20150105634A (cg-RX-API-DMAC7.html) |
| CN (2) | CN105209621B (cg-RX-API-DMAC7.html) |
| AU (4) | AU2013359212B2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA2894684A1 (cg-RX-API-DMAC7.html) |
| DK (2) | DK2898075T3 (cg-RX-API-DMAC7.html) |
| ES (2) | ES2786193T3 (cg-RX-API-DMAC7.html) |
| IL (2) | IL300461A (cg-RX-API-DMAC7.html) |
| PL (1) | PL2898075T3 (cg-RX-API-DMAC7.html) |
| PT (1) | PT2898075E (cg-RX-API-DMAC7.html) |
| SG (3) | SG11201504519TA (cg-RX-API-DMAC7.html) |
| WO (1) | WO2014093635A1 (cg-RX-API-DMAC7.html) |
| ZA (1) | ZA201504081B (cg-RX-API-DMAC7.html) |
Cited By (302)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104546931A (zh) * | 2014-09-30 | 2015-04-29 | 深圳华大基因科技有限公司 | 华德萨特氏菌在治疗或预防类风湿性关节炎或其相关疾病中的应用 |
| WO2015065964A1 (en) | 2013-10-28 | 2015-05-07 | The Broad Institute Inc. | Functional genomics using crispr-cas systems, compositions, methods, screens and applications thereof |
| WO2015089354A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders |
| WO2015089364A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Crystal structure of a crispr-cas system, and uses thereof |
| WO2015089419A2 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components |
| WO2015089465A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders |
| WO2015089486A2 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Systems, methods and compositions for sequence manipulation with optimized functional crispr-cas systems |
| US9234213B2 (en) | 2013-03-15 | 2016-01-12 | System Biosciences, Llc | Compositions and methods directed to CRISPR/Cas genomic engineering systems |
| US9260752B1 (en) | 2013-03-14 | 2016-02-16 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| WO2016036754A1 (en) | 2014-09-02 | 2016-03-10 | The Regents Of The University Of California | Methods and compositions for rna-directed target dna modification |
| WO2016049251A1 (en) | 2014-09-24 | 2016-03-31 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling mutations in leukocytes |
| WO2016049163A2 (en) | 2014-09-24 | 2016-03-31 | The Broad Institute Inc. | Use and production of chd8+/- transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder |
| WO2016057061A2 (en) | 2014-10-10 | 2016-04-14 | Massachusetts Eye And Ear Infirmary | Efficient delivery of therapeutic molecules in vitro and in vivo |
| WO2016069591A2 (en) | 2014-10-27 | 2016-05-06 | The Broad Institute Inc. | Compositions, methods and use of synthetic lethal screening |
| WO2016086227A2 (en) | 2014-11-26 | 2016-06-02 | The Regents Of The University Of California | Therapeutic compositions comprising transcription factors and methods of making and using the same |
| WO2016086197A1 (en) | 2014-11-25 | 2016-06-02 | The Brigham And Women's Hospital, Inc. | Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease |
| WO2016094880A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Delivery, use and therapeutic applications of crispr systems and compositions for genome editing as to hematopoietic stem cells (hscs) |
| WO2016094872A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Dead guides for crispr transcription factors |
| WO2016094867A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Protected guide rnas (pgrnas) |
| WO2016094874A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Escorted and functionalized guides for crispr-cas systems |
| WO2016100974A1 (en) | 2014-12-19 | 2016-06-23 | The Broad Institute Inc. | Unbiased identification of double-strand breaks and genomic rearrangement by genome-wide insert capture sequencing |
| WO2016106236A1 (en) | 2014-12-23 | 2016-06-30 | The Broad Institute Inc. | Rna-targeting system |
| WO2016106244A1 (en) | 2014-12-24 | 2016-06-30 | The Broad Institute Inc. | Crispr having or associated with destabilization domains |
| WO2016108926A1 (en) | 2014-12-30 | 2016-07-07 | The Broad Institute Inc. | Crispr mediated in vivo modeling and genetic screening of tumor growth and metastasis |
| US20160201072A1 (en) * | 2013-08-22 | 2016-07-14 | Pioneer Hi-Bred International, Inc. | Genome modification using guide polynucleotide/cas endonuclease systems and methods of use |
| WO2016114972A1 (en) | 2015-01-12 | 2016-07-21 | The Regents Of The University Of California | Heterodimeric cas9 and methods of use thereof |
| WO2016138488A2 (en) | 2015-02-26 | 2016-09-01 | The Broad Institute Inc. | T cell balance gene expression, compositions of matters and methods of use thereof |
| WO2016141224A1 (en) | 2015-03-03 | 2016-09-09 | The General Hospital Corporation | Engineered crispr-cas9 nucleases with altered pam specificity |
| WO2016138574A1 (en) | 2015-03-02 | 2016-09-09 | Sinai Health System | Homologous recombination factors |
| WO2016164356A1 (en) | 2015-04-06 | 2016-10-13 | The Board Of Trustees Of The Leland Stanford Junior University | Chemically modified guide rnas for crispr/cas-mediated gene regulation |
| WO2016182893A1 (en) | 2015-05-08 | 2016-11-17 | Teh Broad Institute Inc. | Functional genomics using crispr-cas systems for saturating mutagenesis of non-coding elements, compositions, methods, libraries and applications thereof |
| US20160348074A1 (en) * | 2015-05-29 | 2016-12-01 | Agenovir Corporation | Methods and compositions for treating cells for transplant |
| US9512446B1 (en) | 2015-08-28 | 2016-12-06 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| WO2016196655A1 (en) | 2015-06-03 | 2016-12-08 | The Regents Of The University Of California | Cas9 variants and methods of use thereof |
| WO2016205745A2 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Cell sorting |
| WO2016205749A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| WO2016205764A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| WO2016205728A1 (en) | 2015-06-17 | 2016-12-22 | Massachusetts Institute Of Technology | Crispr mediated recording of cellular events |
| US9567604B2 (en) | 2013-03-15 | 2017-02-14 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
| US9580701B2 (en) | 2015-01-28 | 2017-02-28 | Pioneer Hi-Bred International, Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| WO2017040348A1 (en) | 2015-08-28 | 2017-03-09 | The General Hospital Corporation | Engineered crispr-cas9 nucleases |
| WO2017070605A1 (en) | 2015-10-22 | 2017-04-27 | The Broad Institute Inc. | Type vi-b crispr enzymes and systems |
| WO2017069958A2 (en) | 2015-10-09 | 2017-04-27 | The Brigham And Women's Hospital, Inc. | Modulation of novel immune checkpoint targets |
| WO2017075451A1 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting pou2af1 |
| WO2017075478A2 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by use of immune cell gene signatures |
| WO2017075465A1 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting gata3 |
| WO2017075294A1 (en) | 2015-10-28 | 2017-05-04 | The Board Institute Inc. | Assays for massively combinatorial perturbation profiling and cellular circuit reconstruction |
| WO2017074788A1 (en) | 2015-10-27 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for targeting cancer-specific sequence variations |
| WO2017083852A1 (en) | 2015-11-13 | 2017-05-18 | MOORE, Tara | Methods for the treatment of corneal dystrophies |
| WO2017087708A1 (en) | 2015-11-19 | 2017-05-26 | The Brigham And Women's Hospital, Inc. | Lymphocyte antigen cd5-like (cd5l)-interleukin 12b (p40) heterodimers in immunity |
| WO2017095960A1 (en) * | 2015-11-30 | 2017-06-08 | Synthetic Genomics, Inc. | Compositions and methods for expressing genes in algae |
| WO2017106657A1 (en) | 2015-12-18 | 2017-06-22 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| WO2017114497A1 (en) | 2015-12-30 | 2017-07-06 | Novartis Ag | Immune effector cell therapies with enhanced efficacy |
| WO2017143071A1 (en) | 2016-02-18 | 2017-08-24 | The Regents Of The University Of California | Methods and compositions for gene editing in stem cells |
| WO2017147196A1 (en) | 2016-02-22 | 2017-08-31 | Massachusetts Institute Of Technology | Methods for identifying and modulating immune phenotypes |
| WO2017161043A1 (en) | 2016-03-16 | 2017-09-21 | The J. David Gladstone Institutes | Methods and compositions for treating obesity and/or diabetes and for identifying candidate treatment agents |
| WO2017161325A1 (en) | 2016-03-17 | 2017-09-21 | Massachusetts Institute Of Technology | Methods for identifying and modulating co-occurant cellular phenotypes |
| WO2017161068A1 (en) * | 2016-03-18 | 2017-09-21 | President And Fellows Of Harvard College | Mutant cas proteins |
| WO2017184768A1 (en) | 2016-04-19 | 2017-10-26 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| WO2017184786A1 (en) | 2016-04-19 | 2017-10-26 | The Broad Institute Inc. | Cpf1 complexes with reduced indel activity |
| WO2017189308A1 (en) | 2016-04-19 | 2017-11-02 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| US9822370B2 (en) | 2013-04-04 | 2017-11-21 | President And Fellows Of Harvard College | Method of making a deletion in a target sequence in isolated primary cells using Cas9 and two guide RNAs |
| WO2017219027A1 (en) | 2016-06-17 | 2017-12-21 | The Broad Institute Inc. | Type vi crispr orthologs and systems |
| WO2018013840A1 (en) | 2016-07-13 | 2018-01-18 | Vertex Pharmaceuticals Incorporated | Methods, compositions and kits for increasing genome editing efficiency |
| US9885026B2 (en) | 2011-12-30 | 2018-02-06 | Caribou Biosciences, Inc. | Modified cascade ribonucleoproteins and uses thereof |
| WO2018035387A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
| WO2018035364A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute Inc. | Product and methods useful for modulating and evaluating immune responses |
| WO2018035250A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute, Inc. | Methods for identifying class 2 crispr-cas systems |
| WO2018035388A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
| WO2018039145A1 (en) | 2016-08-20 | 2018-03-01 | Avellino Lab Usa, Inc. | Single guide rna, crispr/cas9 systems, and methods of use thereof |
| WO2018049168A1 (en) | 2016-09-09 | 2018-03-15 | The Board Of Trustees Of The Leland Stanford Junior University | High-throughput precision genome editing |
| WO2018049025A2 (en) | 2016-09-07 | 2018-03-15 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses |
| WO2018047183A1 (en) | 2016-09-11 | 2018-03-15 | Yeda Research And Development Co. Ltd. | Compositions and methods for regulating gene expression for targeted mutagenesis |
| US9926546B2 (en) | 2015-08-28 | 2018-03-27 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| WO2018064371A1 (en) | 2016-09-30 | 2018-04-05 | The Regents Of The University Of California | Rna-guided nucleic acid modifying enzymes and methods of use thereof |
| WO2018067991A1 (en) | 2016-10-07 | 2018-04-12 | The Brigham And Women's Hospital, Inc. | Modulation of novel immune checkpoint targets |
| WO2018083606A1 (en) | 2016-11-01 | 2018-05-11 | Novartis Ag | Methods and compositions for enhancing gene editing |
| US9970030B2 (en) | 2014-08-27 | 2018-05-15 | Caribou Biosciences, Inc. | Methods for increasing CAS9-mediated engineering efficiency |
| US10000772B2 (en) | 2012-05-25 | 2018-06-19 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| WO2018112278A1 (en) | 2016-12-14 | 2018-06-21 | Ligandal, Inc. | Methods and compositions for nucleic acid and protein payload delivery |
| US10011850B2 (en) | 2013-06-21 | 2018-07-03 | The General Hospital Corporation | Using RNA-guided FokI Nucleases (RFNs) to increase specificity for RNA-Guided Genome Editing |
| WO2018129544A1 (en) | 2017-01-09 | 2018-07-12 | Whitehead Institute For Biomedical Research | Methods of altering gene expression by perturbing transcription factor multimers that structure regulatory loops |
| US10039777B2 (en) | 2012-03-20 | 2018-08-07 | Neuro-Lm Sas | Methods and pharmaceutical compositions of the treatment of autistic syndrome disorders |
| WO2018170515A1 (en) | 2017-03-17 | 2018-09-20 | The Broad Institute, Inc. | Methods for identifying and modulating co-occurant cellular phenotypes |
| WO2018170333A1 (en) | 2017-03-15 | 2018-09-20 | The Broad Institute, Inc. | Novel cas13b orthologues crispr enzymes and systems |
| WO2018191750A2 (en) | 2017-04-14 | 2018-10-18 | The Broad Institute Inc. | Novel delivery of large payloads |
| WO2018191520A1 (en) | 2017-04-12 | 2018-10-18 | The Broad Institute, Inc. | Respiratory and sweat gland ionocytes |
| WO2018191553A1 (en) | 2017-04-12 | 2018-10-18 | Massachusetts Eye And Ear Infirmary | Tumor signature for metastasis, compositions of matter methods of use thereof |
| WO2018191388A1 (en) | 2017-04-12 | 2018-10-18 | The Broad Institute, Inc. | Novel type vi crispr orthologs and systems |
| WO2018195545A2 (en) | 2017-04-21 | 2018-10-25 | The General Hospital Corporation | Variants of cpf1 (cas12a) with altered pam specificity |
| WO2018195486A1 (en) | 2017-04-21 | 2018-10-25 | The Broad Institute, Inc. | Targeted delivery to beta cells |
| WO2018195019A1 (en) | 2017-04-18 | 2018-10-25 | The Broad Institute Inc. | Compositions for detecting secretion and methods of use |
| WO2018217981A1 (en) | 2017-05-26 | 2018-11-29 | North Carolina State University | Altered guide rnas for modulating cas9 activity and methods of use |
| WO2018218206A1 (en) | 2017-05-25 | 2018-11-29 | The General Hospital Corporation | Bipartite base editor (bbe) architectures and type-ii-c-cas9 zinc finger editing |
| WO2019003193A1 (en) | 2017-06-30 | 2019-01-03 | Novartis Ag | METHODS FOR TREATING DISEASES USING GENE EDITING SYSTEMS |
| WO2019005884A1 (en) | 2017-06-26 | 2019-01-03 | The Broad Institute, Inc. | CRISPR / CAS-ADENINE DEAMINASE COMPOSITIONS, SYSTEMS AND METHODS FOR TARGETED NUCLEIC ACID EDITION |
| WO2019018440A1 (en) | 2017-07-17 | 2019-01-24 | The Broad Institute, Inc. | HUMAN COLON CELL ATLAS IN GOOD HEALTH AND WITH HEMORRHAGIC RECTO-COLITIS |
| US10190137B2 (en) | 2013-11-07 | 2019-01-29 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| US10208319B2 (en) | 2013-07-09 | 2019-02-19 | President And Fellows Of Harvard College | Therapeutic uses of genome editing with CRISPR/Cas systems |
| WO2019051419A1 (en) * | 2017-09-08 | 2019-03-14 | University Of North Texas Health Science Center | Engineered cas9 variants |
| WO2019060746A1 (en) | 2017-09-21 | 2019-03-28 | The Broad Institute, Inc. | SYSTEMS, METHODS, AND COMPOSITIONS FOR THE TARGETED EDITING OF NUCLEIC ACIDS |
| WO2019070755A1 (en) | 2017-10-02 | 2019-04-11 | The Broad Institute, Inc. | METHODS AND COMPOSITIONS FOR DETECTING AND MODULATING A GENETIC SIGNATURE OF IMMUNOTHERAPY RESISTANCE IN CANCER |
| WO2019071054A1 (en) | 2017-10-04 | 2019-04-11 | The Broad Institute, Inc. | METHODS AND COMPOSITIONS FOR MODIFYING THE FUNCTION AND STRUCTURE OF BUCKLES AND / OR CHROMATIN DOMAINS |
| WO2019087113A1 (en) | 2017-11-01 | 2019-05-09 | Novartis Ag | Synthetic rnas and methods of use |
| US10286084B2 (en) | 2014-02-18 | 2019-05-14 | Duke University | Compositions for the inactivation of virus replication and methods of making and using the same |
| WO2019094983A1 (en) | 2017-11-13 | 2019-05-16 | The Broad Institute, Inc. | Methods and compositions for treating cancer by targeting the clec2d-klrb1 pathway |
| WO2019099943A1 (en) | 2017-11-16 | 2019-05-23 | Astrazeneca Ab | Compositions and methods for improving the efficacy of cas9-based knock-in strategies |
| EP3502253A1 (en) | 2015-06-18 | 2019-06-26 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| WO2019126709A1 (en) | 2017-12-22 | 2019-06-27 | The Broad Institute, Inc. | Cas12b systems, methods, and compositions for targeted dna base editing |
| EP3514246A1 (en) | 2014-02-27 | 2019-07-24 | The Broad Institute Inc. | T cell balance gene expression and methods of use thereof |
| WO2019143675A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Dna-pk inhibitors |
| WO2019143677A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Quinoxalinone compounds, compositions, methods, and kits for increasing genome editing efficiency |
| WO2019143678A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Dna-pk inhibitors |
| US10428319B2 (en) | 2017-06-09 | 2019-10-01 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US10450576B2 (en) | 2015-03-27 | 2019-10-22 | E I Du Pont De Nemours And Company | Soybean U6 small nuclear RNA gene promoters and their use in constitutive expression of small RNA genes in plants |
| WO2019204585A1 (en) | 2018-04-19 | 2019-10-24 | Massachusetts Institute Of Technology | Single-stranded break detection in double-stranded dna |
| EP3560330A1 (en) | 2018-04-24 | 2019-10-30 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
| WO2019210268A2 (en) | 2018-04-27 | 2019-10-31 | The Broad Institute, Inc. | Sequencing-based proteomics |
| WO2019213660A2 (en) | 2018-05-04 | 2019-11-07 | The Broad Institute, Inc. | Compositions and methods for modulating cgrp signaling to regulate innate lymphoid cell inflammatory responses |
| WO2019232542A2 (en) | 2018-06-01 | 2019-12-05 | Massachusetts Institute Of Technology | Methods and compositions for detecting and modulating microenvironment gene signatures from the csf of metastasis patients |
| US10501794B2 (en) | 2014-06-23 | 2019-12-10 | The General Hospital Corporation | Genomewide unbiased identification of DSBs evaluated by sequencing (GUIDE-seq) |
| WO2020006049A1 (en) | 2018-06-26 | 2020-01-02 | The Broad Institute, Inc. | Crispr/cas and transposase based amplification compositions, systems and methods |
| WO2020006036A1 (en) | 2018-06-26 | 2020-01-02 | Massachusetts Institute Of Technology | Crispr effector system based amplification methods, systems, and diagnostics |
| US10526589B2 (en) | 2013-03-15 | 2020-01-07 | The General Hospital Corporation | Multiplex guide RNAs |
| WO2020014528A1 (en) | 2018-07-13 | 2020-01-16 | The Regents Of The University Of California | Retrotransposon-based delivery vehicle and methods of use thereof |
| WO2020028555A2 (en) | 2018-07-31 | 2020-02-06 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
| WO2020033601A1 (en) | 2018-08-07 | 2020-02-13 | The Broad Institute, Inc. | Novel cas12b enzymes and systems |
| WO2020041380A1 (en) | 2018-08-20 | 2020-02-27 | The Broad Institute, Inc. | Methods and compositions for optochemical control of crispr-cas9 |
| WO2020041387A1 (en) | 2018-08-20 | 2020-02-27 | The Brigham And Women's Hospital, Inc. | Degradation domain modifications for spatio-temporal control of rna-guided nucleases |
| WO2020041456A1 (en) | 2018-08-22 | 2020-02-27 | The Regents Of The University Of California | Variant type v crispr/cas effector polypeptides and methods of use thereof |
| WO2020051507A1 (en) | 2018-09-06 | 2020-03-12 | The Broad Institute, Inc. | Nucleic acid assemblies for use in targeted delivery |
| WO2020049158A1 (en) | 2018-09-07 | 2020-03-12 | Astrazeneca Ab | Compositions and methods for improved nucleases |
| WO2020061591A1 (en) | 2018-09-21 | 2020-03-26 | President And Fellows Of Harvard College | Methods and compositions for treating diabetes, and methods for enriching mrna coding for secreted proteins |
| WO2020077236A1 (en) | 2018-10-12 | 2020-04-16 | The Broad Institute, Inc. | Method for extracting nuclei or whole cells from formalin-fixed paraffin-embedded tissues |
| WO2020081808A1 (en) * | 2018-10-18 | 2020-04-23 | Chan Zuckerberg Biohub, Inc. | Methods and compositions involving thermostable cas9 protein variants |
| WO2020081730A2 (en) | 2018-10-16 | 2020-04-23 | Massachusetts Institute Of Technology | Methods and compositions for modulating microenvironment |
| EP3653229A1 (en) | 2013-12-12 | 2020-05-20 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for genome editing |
| US10669539B2 (en) | 2016-10-06 | 2020-06-02 | Pioneer Biolabs, Llc | Methods and compositions for generating CRISPR guide RNA libraries |
| US10676754B2 (en) | 2014-07-11 | 2020-06-09 | E I Du Pont De Nemours And Company | Compositions and methods for producing plants resistant to glyphosate herbicide |
| US20200190508A1 (en) * | 2017-06-07 | 2020-06-18 | Arc Bio, Llc | Creation and use of guide nucleic acids |
| WO2020131586A2 (en) | 2018-12-17 | 2020-06-25 | The Broad Institute, Inc. | Methods for identifying neoantigens |
| WO2020131862A1 (en) | 2018-12-17 | 2020-06-25 | The Broad Institute, Inc. | Crispr-associated transposase systems and methods of use thereof |
| EP3686279A1 (en) | 2014-08-17 | 2020-07-29 | The Broad Institute, Inc. | Genome editing using cas9 nickases |
| US10731181B2 (en) | 2012-12-06 | 2020-08-04 | Sigma, Aldrich Co. LLC | CRISPR-based genome modification and regulation |
| US10738303B2 (en) | 2015-09-30 | 2020-08-11 | The General Hospital Corporation | Comprehensive in vitro reporting of cleavage events by sequencing (CIRCLE-seq) |
| WO2020163856A1 (en) | 2019-02-10 | 2020-08-13 | The J. David Gladstone Institutes, A Testamentary Trust Established Under The Will Of J. David Gladstone | Modified mitochondrion and methods of use thereof |
| WO2020163396A1 (en) | 2019-02-04 | 2020-08-13 | The General Hospital Corporation | Adenine dna base editor variants with reduced off-target rna editing |
| US10767201B2 (en) | 2015-09-10 | 2020-09-08 | Yeda Research And Development Co. Ltd. | CYP76AD1-beta clade polynucleotides, polypeptides, and uses thereof |
| WO2020206036A1 (en) | 2019-04-01 | 2020-10-08 | The Broad Institute, Inc. | Novel nucleic acid modifier |
| WO2020225754A1 (en) | 2019-05-06 | 2020-11-12 | Mcmullen Tara | Crispr gene editing for autosomal dominant diseases |
| WO2020229533A1 (en) | 2019-05-13 | 2020-11-19 | KWS SAAT SE & Co. KGaA | Drought tolerance in corn |
| WO2020236972A2 (en) | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Non-class i multi-component nucleic acid targeting systems |
| WO2020236967A1 (en) | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Random crispr-cas deletion mutant |
| US10851380B2 (en) | 2012-10-23 | 2020-12-01 | Toolgen Incorporated | Methods for cleaving a target DNA using a guide RNA specific for the target DNA and Cas protein-encoding nucleic acid or Cas protein |
| WO2020243661A1 (en) | 2019-05-31 | 2020-12-03 | The Broad Institute, Inc. | Methods for treating metabolic disorders by targeting adcy5 |
| WO2020239680A2 (en) | 2019-05-25 | 2020-12-03 | KWS SAAT SE & Co. KGaA | Haploid induction enhancer |
| EP3772542A1 (en) | 2019-08-07 | 2021-02-10 | KWS SAAT SE & Co. KGaA | Modifying genetic variation in crops by modulating the pachytene checkpoint protein 2 |
| US10934536B2 (en) | 2018-12-14 | 2021-03-02 | Pioneer Hi-Bred International, Inc. | CRISPR-CAS systems for genome editing |
| WO2021041922A1 (en) | 2019-08-30 | 2021-03-04 | The Broad Institute, Inc. | Crispr-associated mu transposase systems |
| WO2021055874A1 (en) | 2019-09-20 | 2021-03-25 | The Broad Institute, Inc. | Novel type vi crispr enzymes and systems |
| WO2021074367A1 (en) | 2019-10-17 | 2021-04-22 | KWS SAAT SE & Co. KGaA | Enhanced disease resistance of crops by downregulation of repressor genes |
| US11001829B2 (en) | 2014-09-25 | 2021-05-11 | The Broad Institute, Inc. | Functional screening with optimized functional CRISPR-Cas systems |
| US11028429B2 (en) | 2015-09-11 | 2021-06-08 | The General Hospital Corporation | Full interrogation of nuclease DSBs and sequencing (FIND-seq) |
| WO2021130752A1 (en) | 2019-12-22 | 2021-07-01 | Yeda Research And Development Co. Ltd. | Systems and methods for identifying cells that have undergone genome editing |
| WO2021150919A1 (en) | 2020-01-23 | 2021-07-29 | The Children's Medical Center Corporation | Stroma-free t cell differentiation from human pluripotent stem cells |
| US11092607B2 (en) | 2015-10-28 | 2021-08-17 | The Board Institute, Inc. | Multiplex analysis of single cell constituents |
| EP3877517A1 (en) | 2018-11-09 | 2021-09-15 | Inari Agriculture, Inc. | Rna-guided nucleases and dna binding proteins |
| US11124796B2 (en) | 2014-09-24 | 2021-09-21 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for modeling competition of multiple cancer mutations in vivo |
| WO2021202938A1 (en) | 2020-04-03 | 2021-10-07 | Creyon Bio, Inc. | Oligonucleotide-based machine learning |
| WO2021216623A1 (en) | 2020-04-21 | 2021-10-28 | Aspen Neuroscience, Inc. | Gene editing of lrrk2 in stem cells and method of use of cells differentiated therefrom |
| WO2021216622A1 (en) | 2020-04-21 | 2021-10-28 | Aspen Neuroscience, Inc. | Gene editing of gba1 in stem cells and method of use of cells differentiated therefrom |
| US11180792B2 (en) | 2015-01-28 | 2021-11-23 | The Regents Of The University Of California | Methods and compositions for labeling a single-stranded target nucleic acid |
| CN113728097A (zh) * | 2019-02-14 | 2021-11-30 | 宏基因组学知识产权技术有限责任公司 | 具有ruvc结构域的酶 |
| CN113728098A (zh) * | 2019-02-14 | 2021-11-30 | 宏基因组学知识产权技术有限责任公司 | 具有ruvc结构域的酶 |
| WO2021239986A1 (en) | 2020-05-29 | 2021-12-02 | KWS SAAT SE & Co. KGaA | Plant haploid induction |
| US11214800B2 (en) | 2015-08-18 | 2022-01-04 | The Broad Institute, Inc. | Methods and compositions for altering function and structure of chromatin loops and/or domains |
| DE212020000516U1 (de) | 2019-03-07 | 2022-01-17 | The Regents of the University of California | CRISPR-CAS-Effektorpolypeptide |
| US11236313B2 (en) | 2016-04-13 | 2022-02-01 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| US11286468B2 (en) | 2017-08-23 | 2022-03-29 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US11332736B2 (en) | 2017-12-07 | 2022-05-17 | The Broad Institute, Inc. | Methods and compositions for multiplexing single cell and single nuclei sequencing |
| US20220213507A1 (en) * | 2016-10-14 | 2022-07-07 | President And Fellows Of Harvard College | Aav delivery of nucleobase editors |
| US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
| US11407995B1 (en) | 2018-10-26 | 2022-08-09 | Inari Agriculture Technology, Inc. | RNA-guided nucleases and DNA binding proteins |
| US11414657B2 (en) | 2015-06-29 | 2022-08-16 | Ionis Pharmaceuticals, Inc. | Modified CRISPR RNA and modified single CRISPR RNA and uses thereof |
| US11434477B1 (en) | 2018-11-02 | 2022-09-06 | Inari Agriculture Technology, Inc. | RNA-guided nucleases and DNA binding proteins |
| US11447527B2 (en) | 2018-09-18 | 2022-09-20 | Vnv Newco Inc. | Endogenous Gag-based capsids and uses thereof |
| US11466271B2 (en) | 2017-02-06 | 2022-10-11 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
| US11492646B2 (en) | 2015-09-25 | 2022-11-08 | The Board Of Trustees Of The Leland Stanford Junior University | Nuclease-mediated genome editing of primary cells |
| US11499151B2 (en) | 2017-04-28 | 2022-11-15 | Editas Medicine, Inc. | Methods and systems for analyzing guide RNA molecules |
| US11547614B2 (en) | 2017-10-31 | 2023-01-10 | The Broad Institute, Inc. | Methods and compositions for studying cell evolution |
| US11549126B2 (en) | 2015-06-03 | 2023-01-10 | Board Of Regents Of The University Of Nebraska | Treatment methods using DNA editing with single-stranded DNA |
| US11560568B2 (en) | 2014-09-12 | 2023-01-24 | E. I. Du Pont De Nemours And Company | Generation of site-specific-integration sites for complex trait loci in corn and soybean, and methods of use |
| WO2023006933A1 (en) | 2021-07-30 | 2023-02-02 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
| WO2023279118A3 (en) * | 2021-07-02 | 2023-02-23 | University Of Maryland, College Park | Cytidine deaminases and methods of genome editing using the same |
| US11591601B2 (en) | 2017-05-05 | 2023-02-28 | The Broad Institute, Inc. | Methods for identification and modification of lncRNA associated with target genotypes and phenotypes |
| US11597924B2 (en) | 2016-03-25 | 2023-03-07 | Editas Medicine, Inc. | Genome editing systems comprising repair-modulating enzyme molecules and methods of their use |
| WO2023044100A1 (en) | 2021-09-20 | 2023-03-23 | Revivicor, Inc. | Multitran scenic pigs comprising ten genetic modifications for xenotransplantation |
| WO2023052508A2 (en) | 2021-09-30 | 2023-04-06 | Astrazeneca Ab | Use of inhibitors to increase efficiency of crispr/cas insertions |
| WO2023081756A1 (en) | 2021-11-03 | 2023-05-11 | The J. David Gladstone Institutes, A Testamentary Trust Established Under The Will Of J. David Gladstone | Precise genome editing using retrons |
| WO2023093862A1 (en) | 2021-11-26 | 2023-06-01 | Epigenic Therapeutics Inc. | Method of modulating pcsk9 and uses thereof |
| US11667911B2 (en) | 2015-09-24 | 2023-06-06 | Editas Medicine, Inc. | Use of exonucleases to improve CRISPR/CAS-mediated genome editing |
| US11680268B2 (en) | 2014-11-07 | 2023-06-20 | Editas Medicine, Inc. | Methods for improving CRISPR/Cas-mediated genome-editing |
| US11680296B2 (en) | 2017-10-16 | 2023-06-20 | Massachusetts Institute Of Technology | Mycobacterium tuberculosis host-pathogen interaction |
| EP4198124A1 (en) | 2021-12-15 | 2023-06-21 | Versitech Limited | Engineered cas9-nucleases and method of use thereof |
| WO2023115041A1 (en) | 2021-12-17 | 2023-06-22 | Sana Biotechnology, Inc. | Modified paramyxoviridae attachment glycoproteins |
| WO2023115039A2 (en) | 2021-12-17 | 2023-06-22 | Sana Biotechnology, Inc. | Modified paramyxoviridae fusion glycoproteins |
| WO2023133595A2 (en) | 2022-01-10 | 2023-07-13 | Sana Biotechnology, Inc. | Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses |
| US20230220374A1 (en) * | 2020-05-08 | 2023-07-13 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| WO2023141602A2 (en) | 2022-01-21 | 2023-07-27 | Renagade Therapeutics Management Inc. | Engineered retrons and methods of use |
| EP4219699A1 (en) | 2013-12-12 | 2023-08-02 | The Broad Institute, Inc. | Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation |
| WO2023150518A1 (en) | 2022-02-01 | 2023-08-10 | Sana Biotechnology, Inc. | Cd3-targeted lentiviral vectors and uses thereof |
| WO2023150647A1 (en) | 2022-02-02 | 2023-08-10 | Sana Biotechnology, Inc. | Methods of repeat dosing and administration of lipid particles or viral vectors and related systems and uses |
| US11725228B2 (en) | 2017-10-11 | 2023-08-15 | The General Hospital Corporation | Methods for detecting site-specific and spurious genomic deamination induced by base editing technologies |
| US11739156B2 (en) | 2019-01-06 | 2023-08-29 | The Broad Institute, Inc. Massachusetts Institute of Technology | Methods and compositions for overcoming immunosuppression |
| US20230272398A1 (en) * | 2018-12-27 | 2023-08-31 | LifeEDIT Therapeutics, Inc. | Polypeptides useful for gene editing and methods of use |
| US11845987B2 (en) | 2018-04-17 | 2023-12-19 | The General Hospital Corporation | Highly sensitive in vitro assays to define substrate preferences and sites of nucleic acid cleaving agents |
| US20240002822A1 (en) * | 2021-09-08 | 2024-01-04 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US11866697B2 (en) | 2017-05-18 | 2024-01-09 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
| US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
| WO2024020346A2 (en) | 2022-07-18 | 2024-01-25 | Renagade Therapeutics Management Inc. | Gene editing components, systems, and methods of use |
| US11884915B2 (en) | 2021-09-10 | 2024-01-30 | Agilent Technologies, Inc. | Guide RNAs with chemical modification for prime editing |
| WO2024023734A1 (en) | 2022-07-26 | 2024-02-01 | Bit Bio Limited | MULTI-gRNA GENOME EDITING |
| US11897953B2 (en) | 2017-06-14 | 2024-02-13 | The Broad Institute, Inc. | Compositions and methods targeting complement component 3 for inhibiting tumor growth |
| US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
| US11913075B2 (en) | 2017-04-01 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer |
| WO2024042199A1 (en) | 2022-08-26 | 2024-02-29 | KWS SAAT SE & Co. KGaA | Use of paired genes in hybrid breeding |
| WO2024044723A1 (en) | 2022-08-25 | 2024-02-29 | Renagade Therapeutics Management Inc. | Engineered retrons and methods of use |
| WO2024044655A1 (en) | 2022-08-24 | 2024-02-29 | Sana Biotechnology, Inc. | Delivery of heterologous proteins |
| US11920181B2 (en) | 2013-08-09 | 2024-03-05 | President And Fellows Of Harvard College | Nuclease profiling system |
| WO2024047587A1 (en) | 2022-08-31 | 2024-03-07 | Regel Therapeutics, Inc. | Cas-phi compositions and methods of use |
| WO2024064838A1 (en) | 2022-09-21 | 2024-03-28 | Sana Biotechnology, Inc. | Lipid particles comprising variant paramyxovirus attachment glycoproteins and uses thereof |
| US11946039B2 (en) | 2020-03-31 | 2024-04-02 | Metagenomi, Inc. | Class II, type II CRISPR systems |
| WO2024074888A2 (en) | 2022-10-03 | 2024-04-11 | The Regents Of The University Of California | Circumventing barriers to hybrid crops from genetically distant crosses |
| US11957695B2 (en) | 2018-04-26 | 2024-04-16 | The Broad Institute, Inc. | Methods and compositions targeting glucocorticoid signaling for modulating immune responses |
| WO2024081820A1 (en) | 2022-10-13 | 2024-04-18 | Sana Biotechnology, Inc. | Viral particles targeting hematopoietic stem cells |
| US11963966B2 (en) | 2017-03-31 | 2024-04-23 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for treating ovarian tumors |
| US11981922B2 (en) | 2019-10-03 | 2024-05-14 | Dana-Farber Cancer Institute, Inc. | Methods and compositions for the modulation of cell interactions and signaling in the tumor microenvironment |
| US11994512B2 (en) | 2018-01-04 | 2024-05-28 | Massachusetts Institute Of Technology | Single-cell genomic methods to generate ex vivo cell systems that recapitulate in vivo biology with improved fidelity |
| US11999947B2 (en) | 2016-08-03 | 2024-06-04 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| WO2024119157A1 (en) | 2022-12-02 | 2024-06-06 | Sana Biotechnology, Inc. | Lipid particles with cofusogens and methods of producing and using the same |
| US12006520B2 (en) | 2011-07-22 | 2024-06-11 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US12024727B2 (en) | 2019-02-14 | 2024-07-02 | Metagenomi, Inc. | Enzymes with RuvC domains |
| US12031155B2 (en) | 2015-05-08 | 2024-07-09 | President And Fellows Of Harvard College | Universal donor stem cells and related methods |
| US12036240B2 (en) | 2018-06-14 | 2024-07-16 | The Broad Institute, Inc. | Compositions and methods targeting complement component 3 for inhibiting tumor growth |
| US12037601B2 (en) | 2016-03-04 | 2024-07-16 | Indoor Biotechnologies Inc. | Method of inactivating a FEL D1 gene using crispr |
| US12043852B2 (en) | 2015-10-23 | 2024-07-23 | President And Fellows Of Harvard College | Evolved Cas9 proteins for gene editing |
| US12049643B2 (en) | 2017-07-14 | 2024-07-30 | The Broad Institute, Inc. | Methods and compositions for modulating cytotoxic lymphocyte activity |
| WO2024168253A1 (en) | 2023-02-10 | 2024-08-15 | Possible Medicines Llc | Delivery of an rna guided recombination system |
| WO2024168265A1 (en) | 2023-02-10 | 2024-08-15 | Possible Medicines Llc | Aav delivery of rna guided recombination system |
| US12084676B2 (en) | 2018-02-23 | 2024-09-10 | Pioneer Hi-Bred International, Inc. | Cas9 orthologs |
| US12084663B2 (en) | 2016-08-24 | 2024-09-10 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| WO2024201368A1 (en) | 2023-03-29 | 2024-10-03 | Astrazeneca Ab | Use of inhibitors to increase efficiency of crispr/cas insertions |
| US12110545B2 (en) | 2017-01-06 | 2024-10-08 | Editas Medicine, Inc. | Methods of assessing nuclease cleavage |
| WO2024220560A1 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Engineered protein g fusogens and related lipid particles and methods thereof |
| WO2024220598A2 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Lentiviral vectors with two or more genomes |
| WO2024220574A1 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Universal protein g fusogens and adapter systems thereof and related lipid particles and uses |
| WO2024243340A1 (en) | 2023-05-23 | 2024-11-28 | Sana Biotechnology, Inc. | Tandem fusogens and related lipid particles |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| US12161694B2 (en) | 2017-03-24 | 2024-12-10 | The Broad Institute, Inc. | Methods and compositions for regulating innate lymphoid cell inflammatory responses |
| US12165743B2 (en) | 2018-11-09 | 2024-12-10 | The Broad Institute, Inc. | Compressed sensing for screening and tissue imaging |
| US12168789B2 (en) | 2015-06-18 | 2024-12-17 | The Broad Institute, Inc. | Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation |
| US12171783B2 (en) | 2017-11-13 | 2024-12-24 | The Broad Institute, Inc. | Methods and compositions for targeting developmental and oncogenic programs in H3K27M gliomas |
| US12180263B2 (en) | 2014-11-06 | 2024-12-31 | President And Fellows Of Harvard College | Cells lacking B2M surface expression and methods for allogeneic administration of such cells |
| US12201699B2 (en) | 2014-10-10 | 2025-01-21 | Editas Medicine, Inc. | Compositions and methods for promoting homology directed repair |
| US12221720B2 (en) | 2017-11-13 | 2025-02-11 | The Broad Institute, Inc. | Methods for determining spatial and temporal gene expression dynamics during adult neurogenesis in single cells |
| US12227742B2 (en) | 2017-10-23 | 2025-02-18 | The Broad Institute, Inc. | Nucleic acid modifiers |
| US12226479B2 (en) | 2017-05-11 | 2025-02-18 | The General Hospital Corporation | Methods and compositions of use of CD8+ tumor infiltrating lymphocyte subtypes and gene signatures thereof |
| US12227578B2 (en) | 2016-11-11 | 2025-02-18 | The Broad Institute, Inc. | Modulation of intestinal epithelial cell differentiation, maintenance and/or function through T cell action |
| US12239646B2 (en) | 2017-07-19 | 2025-03-04 | Dana-Farber Cancer Institute, Inc. | Cancer diagnostic and treatment |
| WO2025049959A2 (en) | 2023-09-01 | 2025-03-06 | Renagade Therapeutics Management Inc. | Gene editing systems, compositions, and methods for treatment of vexas syndrome |
| WO2025054202A1 (en) | 2023-09-05 | 2025-03-13 | Sana Biotechnology, Inc. | Method of screening a sample comprising a transgene with a unique barcode |
| WO2025059215A1 (en) | 2023-09-12 | 2025-03-20 | Aadigen, Llc | Methods and compositions for treating or preventing cancer |
| US12264341B2 (en) | 2020-01-24 | 2025-04-01 | The General Hospital Corporation | CRISPR-Cas enzymes with enhanced on-target activity |
| US12264323B2 (en) | 2018-12-17 | 2025-04-01 | The Broad Institute, Inc. | CRISPR CPF1 direct repeat variants |
| WO2025081042A1 (en) | 2023-10-12 | 2025-04-17 | Renagade Therapeutics Management Inc. | Nickase-retron template-based precision editing system and methods of use |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12281303B2 (en) | 2019-03-19 | 2025-04-22 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12286727B2 (en) | 2016-12-19 | 2025-04-29 | Editas Medicine, Inc. | Assessing nuclease cleavage |
| US12297436B2 (en) | 2017-05-18 | 2025-05-13 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
| US12312613B2 (en) | 2020-01-24 | 2025-05-27 | The General Hospital Corporation | Unconstrained genome targeting with near-PAMless engineered CRISPR-Cas9 variants |
| US12338436B2 (en) | 2018-06-29 | 2025-06-24 | Editas Medicine, Inc. | Synthetic guide molecules, compositions and methods relating thereto |
| US12338444B2 (en) | 2011-03-23 | 2025-06-24 | Pioneer Hi-Bred International, Inc. | Methods for producing a complex transgenic trait locus |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| US12359218B2 (en) | 2017-07-28 | 2025-07-15 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| WO2025151838A1 (en) | 2024-01-12 | 2025-07-17 | Sana Biotechnology, Inc. | Safety switches to control in vitro and in vivo proliferation of cell therapy products |
| WO2025155753A2 (en) | 2024-01-17 | 2025-07-24 | Renagade Therapeutics Management Inc. | Improved gene editing system, guides, and methods |
| EP4596696A2 (en) | 2021-09-28 | 2025-08-06 | Acrigen Biosciences | Compositions and methods for nucleic acid modifications |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| WO2025174765A1 (en) | 2024-02-12 | 2025-08-21 | Renagade Therapeutics Management Inc. | Lipid nanoparticles comprising coding rna molecules for use in gene editing and as vaccines and therapeutic agents |
| US12398406B2 (en) | 2014-07-30 | 2025-08-26 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US12402610B2 (en) | 2018-11-09 | 2025-09-02 | The Broad Institute, Inc. | Methods and compositions for modulating innate lymphoid cell pathogenic effectors |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| US12404514B2 (en) | 2016-12-09 | 2025-09-02 | The Broad Institute, Inc. | CRISPR-systems for modifying a trait of interest in a plant |
| WO2025184529A1 (en) | 2024-03-01 | 2025-09-04 | Sana Biotechnology, Inc. | Viral particles with fusogen display and related compositions and methods |
| US12410449B2 (en) | 2021-11-24 | 2025-09-09 | Metagenomi, Inc. | Endonuclease systems |
| US12435323B2 (en) | 2021-08-27 | 2025-10-07 | Metagenomi, Inc. | Enzymes with RUVC domains |
| US12435331B2 (en) | 2017-03-10 | 2025-10-07 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| US12473573B2 (en) | 2013-09-06 | 2025-11-18 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US12499971B2 (en) | 2016-09-28 | 2025-12-16 | The Broad Institute, Inc. | Systematic screening and mapping of regulatory elements in non-coding genomic regions, methods, compositions, and applications thereof |
| US12509680B2 (en) | 2023-05-31 | 2025-12-30 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
Families Citing this family (430)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011002988A1 (en) | 2009-07-01 | 2011-01-06 | Transposagen Biopharmaceuticals, Inc. | Genetically modified rat models for severe combined immunodeficiency (scid) |
| GB201117313D0 (en) | 2011-10-07 | 2011-11-16 | Gt Biolog Ltd | Bacterium for use in medicine |
| KR101904508B1 (ko) | 2012-04-25 | 2018-10-04 | 리제너론 파마슈티칼스 인코포레이티드 | 큰 표적화 벡터를 사용한 뉴클레아제-중재된 표적화 |
| AU2013289206B2 (en) | 2012-07-11 | 2018-08-09 | Sangamo Therapeutics, Inc. | Methods and compositions for the treatment of lysosomal storage diseases |
| US10648001B2 (en) | 2012-07-11 | 2020-05-12 | Sangamo Therapeutics, Inc. | Method of treating mucopolysaccharidosis type I or II |
| EP3808844A1 (en) * | 2012-07-25 | 2021-04-21 | The Broad Institute, Inc. | Inducible dna binding proteins and genome perturbation tools and applications thereof |
| EP2896697B1 (en) | 2012-12-12 | 2015-09-02 | The Broad Institute, Inc. | Engineering of systems, methods and optimized guide compositions for sequence manipulation |
| IL239317B (en) | 2012-12-12 | 2022-07-01 | Broad Inst Inc | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| US20140186919A1 (en) | 2012-12-12 | 2014-07-03 | Feng Zhang | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| EP2931899A1 (en) | 2012-12-12 | 2015-10-21 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions, methods, knock out libraries and applications thereof |
| KR20150105635A (ko) | 2012-12-12 | 2015-09-17 | 더 브로드 인스티튜트, 인코퍼레이티드 | 서열 조작을 위한 crispr-cas 성분 시스템, 방법 및 조성물 |
| WO2014093709A1 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof |
| EP2931898B1 (en) | 2012-12-12 | 2016-03-09 | The Broad Institute, Inc. | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains |
| US9970024B2 (en) | 2012-12-17 | 2018-05-15 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| US10544405B2 (en) | 2013-01-16 | 2020-01-28 | Emory University | Cas9-nucleic acid complexes and uses related thereto |
| EP2958990B1 (en) | 2013-02-20 | 2019-10-16 | Regeneron Pharmaceuticals, Inc. | Genetic modification of rats |
| GB201306536D0 (en) | 2013-04-10 | 2013-05-22 | Gt Biolog Ltd | Polypeptide and immune modulation |
| KR20200136508A (ko) | 2013-04-16 | 2020-12-07 | 리제너론 파마슈티칼스 인코포레이티드 | 랫트 게놈의 표적화된 변형 |
| WO2014172470A2 (en) * | 2013-04-16 | 2014-10-23 | Whitehead Institute For Biomedical Research | Methods of mutating, modifying or modulating nucleic acid in a cell or nonhuman mammal |
| WO2014186686A2 (en) * | 2013-05-17 | 2014-11-20 | Two Blades Foundation | Targeted mutagenesis and genome engineering in plants using rna-guided cas nucleases |
| EP3004339B1 (en) * | 2013-05-29 | 2021-07-07 | Cellectis | New compact scaffold of cas9 in the type ii crispr system |
| US20150067922A1 (en) * | 2013-05-30 | 2015-03-05 | The Penn State Research Foundation | Gene targeting and genetic modification of plants via rna-guided genome editing |
| CN105793425B (zh) | 2013-06-17 | 2021-10-26 | 布罗德研究所有限公司 | 使用病毒组分靶向障碍和疾病的crispr-cas系统和组合物的递送、用途和治疗应用 |
| AU2014281028B2 (en) | 2013-06-17 | 2020-09-10 | Massachusetts Institute Of Technology | Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy |
| WO2014204725A1 (en) | 2013-06-17 | 2014-12-24 | The Broad Institute Inc. | Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation |
| EP3011033B1 (en) | 2013-06-17 | 2020-02-19 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions methods, screens and applications thereof |
| CN106062197A (zh) | 2013-06-17 | 2016-10-26 | 布罗德研究所有限公司 | 用于序列操纵的串联指导系统、方法和组合物的递送、工程化和优化 |
| JP6718813B2 (ja) | 2013-07-10 | 2020-07-08 | プレジデント アンド フェローズ オブ ハーバード カレッジ | Rna誘導性遺伝子制御および編集のための直交性cas9タンパク質 |
| US10563225B2 (en) | 2013-07-26 | 2020-02-18 | President And Fellows Of Harvard College | Genome engineering |
| US9359599B2 (en) | 2013-08-22 | 2016-06-07 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
| JP7118588B2 (ja) | 2013-08-29 | 2022-08-16 | テンプル ユニヴァーシティ オブ ザ コモンウェルス システム オブ ハイヤー エデュケイション | Hiv感染のrnaガイド処置のための方法および組成物 |
| US9388430B2 (en) | 2013-09-06 | 2016-07-12 | President And Fellows Of Harvard College | Cas9-recombinase fusion proteins and uses thereof |
| US9526784B2 (en) | 2013-09-06 | 2016-12-27 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
| ES2844174T3 (es) | 2013-09-18 | 2021-07-21 | Kymab Ltd | Métodos, células y organismos |
| WO2015054507A1 (en) | 2013-10-10 | 2015-04-16 | Pronutria, Inc. | Nutritive polypeptide production systems, and methods of manufacture and use thereof |
| EP3071695A2 (en) * | 2013-11-18 | 2016-09-28 | Crispr Therapeutics AG | Crispr-cas system materials and methods |
| US9074199B1 (en) | 2013-11-19 | 2015-07-07 | President And Fellows Of Harvard College | Mutant Cas9 proteins |
| JP6174811B2 (ja) | 2013-12-11 | 2017-08-02 | リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. | ゲノムの標的改変のための方法及び組成物 |
| US20150166982A1 (en) | 2013-12-12 | 2015-06-18 | President And Fellows Of Harvard College | Methods for correcting pi3k point mutations |
| CN105899657A (zh) | 2013-12-12 | 2016-08-24 | 布罗德研究所有限公司 | 用于改变基因产物表达的crispr-cas系统和方法、结构信息以及诱导型模块化cas酶 |
| RU2714902C2 (ru) | 2013-12-19 | 2020-02-20 | Новартис Аг | Химерные рецепторы антигена против мезотелина человека и их применение |
| WO2015123339A1 (en) | 2014-02-11 | 2015-08-20 | The Regents Of The University Of Colorado, A Body Corporate | Crispr enabled multiplexed genome engineering |
| WO2015131101A1 (en) | 2014-02-27 | 2015-09-03 | Monsanto Technology Llc | Compositions and methods for site directed genomic modification |
| EP3114227B1 (en) | 2014-03-05 | 2021-07-21 | Editas Medicine, Inc. | Crispr/cas-related methods and compositions for treating usher syndrome and retinitis pigmentosa |
| US9938521B2 (en) | 2014-03-10 | 2018-04-10 | Editas Medicine, Inc. | CRISPR/CAS-related methods and compositions for treating leber's congenital amaurosis 10 (LCA10) |
| US11141493B2 (en) | 2014-03-10 | 2021-10-12 | Editas Medicine, Inc. | Compositions and methods for treating CEP290-associated disease |
| US11339437B2 (en) | 2014-03-10 | 2022-05-24 | Editas Medicine, Inc. | Compositions and methods for treating CEP290-associated disease |
| JP2017513818A (ja) | 2014-03-15 | 2017-06-01 | ノバルティス アーゲー | キメラ抗原受容体を使用する癌の処置 |
| US11242525B2 (en) | 2014-03-26 | 2022-02-08 | Editas Medicine, Inc. | CRISPR/CAS-related methods and compositions for treating sickle cell disease |
| EP4123024B1 (en) * | 2014-04-01 | 2024-12-18 | Editas Medicine, Inc. | Crispr/cas-related methods and compositions for treating herpes simplex virus type 1 (hsv-1) |
| WO2015153780A1 (en) | 2014-04-02 | 2015-10-08 | Editas Medicine, Inc. | Crispr/cas-related methods and compositions for treating primary open angle glaucoma |
| ES2876263T3 (es) | 2014-04-07 | 2021-11-12 | Novartis Ag | Tratamiento del cáncer usando receptor de antígeno quimérico anti-cd19 |
| EP3556858A3 (en) | 2014-04-09 | 2020-01-22 | Editas Medicine, Inc. | Crispr/cas-related methods and compositions for treating cystic fibrosis |
| KR102595473B1 (ko) * | 2014-04-18 | 2023-10-30 | 에디타스 메디신, 인코포레이티드 | 암 면역요법을 위한 crispr-cas-관련 방법, 조성물 및 구성성분 |
| US10066241B2 (en) | 2014-05-30 | 2018-09-04 | The Board Of Trustees Of The Leland Stanford Junior University | Compositions and methods of delivering treatments for latent viral infections |
| RU2704283C9 (ru) | 2014-06-06 | 2020-02-07 | Регенерон Фармасьютикалз, Инк. | Способы и композиции для модификации целевого локуса |
| JP6779866B2 (ja) | 2014-06-13 | 2020-11-04 | チルドレンズ メディカル センター コーポレイション | ミトコンドリアを単離するための製品および方法 |
| PT3161128T (pt) | 2014-06-26 | 2018-11-21 | Regeneron Pharma | Métodos e composições para modificações genéticas alvejadas e métodos de utilização |
| FI3169778T3 (fi) * | 2014-07-14 | 2023-12-13 | Univ Washington State | Ituradan soluja ablatoiva nanos-geeninpoisto |
| CN104152414B (zh) * | 2014-07-18 | 2018-03-13 | 中国科学院广州生物医药与健康研究院 | 对细胞基因组的预定位点进行基因改造的方法 |
| US11542488B2 (en) | 2014-07-21 | 2023-01-03 | Novartis Ag | Sortase synthesized chimeric antigen receptors |
| EP3193915A1 (en) | 2014-07-21 | 2017-07-26 | Novartis AG | Combinations of low, immune enhancing. doses of mtor inhibitors and cars |
| US10174095B2 (en) | 2014-07-21 | 2019-01-08 | Novartis Ag | Nucleic acid encoding a humanized anti-BCMA chimeric antigen receptor |
| SG11201700416TA (en) | 2014-07-21 | 2017-02-27 | Novartis Ag | Treatment of cancer using a cd33 chimeric antigen receptor |
| EP3174546B1 (en) | 2014-07-31 | 2019-10-30 | Novartis AG | Subset-optimized chimeric antigen receptor-containing t-cells |
| CN113789317B (zh) * | 2014-08-06 | 2024-02-23 | 基因工具股份有限公司 | 使用空肠弯曲杆菌crispr/cas系统衍生的rna引导的工程化核酸酶的基因编辑 |
| CA2959130A1 (en) * | 2014-08-11 | 2016-02-18 | The Board Of Regents Of The University Of Texas System | Prevention of muscular dystrophy by crispr/cas9-mediated gene editing |
| AU2015301460B2 (en) | 2014-08-14 | 2021-04-08 | Novartis Ag | Treatment of cancer using GFR alpha-4 chimeric antigen receptor |
| DK3183268T3 (da) | 2014-08-19 | 2020-05-11 | Univ Pennsylvania | Behandling af cancer ved anvendelse af en cd123-kimær antigenreceptor |
| KR20210149228A (ko) | 2014-09-17 | 2021-12-08 | 노파르티스 아게 | 입양 면역요법을 위한 키메라 수용체에 의한 세포독성 세포의 표적화 |
| US10040048B1 (en) | 2014-09-25 | 2018-08-07 | Synthego Corporation | Automated modular system and method for production of biopolymers |
| US20160090603A1 (en) * | 2014-09-30 | 2016-03-31 | Sandia Corporation | Delivery platforms for the domestication of algae and plants |
| GB201418965D0 (cg-RX-API-DMAC7.html) | 2014-10-24 | 2014-12-10 | Ospedale San Raffaele And Fond Telethon | |
| EP3222728B1 (en) | 2014-11-19 | 2021-07-14 | Institute for Basic Science | Method for regulating gene expression using cas9 protein expressed from two vectors |
| US10362771B2 (en) | 2014-11-20 | 2019-07-30 | Kyoto University | Method for knock-in of DNA into target region of mammalian genome, and cell |
| EP3521437B1 (en) | 2014-11-21 | 2025-01-15 | Regeneron Pharmaceuticals, Inc. | Methods for targeted genetic modification using paired guide rnas |
| GB201421096D0 (en) | 2014-11-27 | 2015-01-14 | Imp Innovations Ltd | Genome editing methods |
| KR102763527B1 (ko) | 2014-12-03 | 2025-02-05 | 애질런트 테크놀로지스, 인크. | 화학적 변형을 갖는 가이드 rna |
| WO2016094679A1 (en) | 2014-12-10 | 2016-06-16 | Regents Of The University Of Minnesota | Genetically modified cells, tissues, and organs for treating disease |
| EP3786296A1 (en) * | 2014-12-18 | 2021-03-03 | Integrated Dna Technologies, Inc. | Crispr-based compositions and methods of use |
| SG11201704646YA (en) | 2014-12-19 | 2017-07-28 | Regeneron Pharma | Methods and compositions for targeted genetic modification through single-step multiple targeting |
| WO2016098078A2 (en) | 2014-12-19 | 2016-06-23 | Novartis Ag | Dimerization switches and uses thereof |
| HRP20180847T1 (hr) | 2014-12-23 | 2018-08-24 | 4D Pharma Research Limited | Pirinski polipeptid i imunološka modulacija |
| CN113337533A (zh) | 2014-12-23 | 2021-09-03 | 先正达参股股份有限公司 | 用于鉴定和富集包含位点特异性基因组修饰的细胞的方法和组合物 |
| CA2971108C (en) | 2014-12-23 | 2019-09-17 | 4D Pharma Research Limited | A bacteroides thetaiotaomicron strain and use thereof in reducing inflammation |
| US20180245073A1 (en) * | 2015-02-23 | 2018-08-30 | Voyager Therapeutics, Inc. | Regulatable expression using adeno-associated virus (aav) |
| CA2981508A1 (en) * | 2015-04-01 | 2016-10-06 | Editas Medicine, Inc. | Crispr/cas-related methods and compositions for treating duchenne muscular dystrophy and becker muscular dystrophy |
| EP3286211A1 (en) | 2015-04-23 | 2018-02-28 | Novartis AG | Treatment of cancer using chimeric antigen receptor and protein kinase a blocker |
| CA2982966C (en) | 2015-04-24 | 2024-02-20 | Editas Medicine, Inc. | Evaluation of cas9 molecule/guide rna molecule complexes |
| US20180291372A1 (en) * | 2015-05-14 | 2018-10-11 | Massachusetts Institute Of Technology | Self-targeting genome editing system |
| BR112017024534A2 (pt) * | 2015-05-15 | 2018-07-24 | Pioneer Hi Bred Int | sistemas de rna-guia/endonuclease cas9 inovadores |
| US10117911B2 (en) | 2015-05-29 | 2018-11-06 | Agenovir Corporation | Compositions and methods to treat herpes simplex virus infections |
| KR20230110368A (ko) | 2015-06-01 | 2023-07-21 | 템플 유니버시티-오브 더 커먼웰쓰 시스템 오브 하이어 에듀케이션 | Hiv 감염의 rna-가이드된 치료를 위한 방법 및 조성물 |
| US20180296537A1 (en) | 2015-06-05 | 2018-10-18 | Novartis Ag | Methods and compositions for diagnosing, treating, and monitoring treatment of shank3 deficiency associated disorders |
| MA41060B1 (fr) | 2015-06-15 | 2019-11-29 | 4D Pharma Res Ltd | Compositions comprenant des souches bactériennes |
| HUE045413T2 (hu) | 2015-06-15 | 2019-12-30 | 4D Pharma Res Ltd | Baktériumtörzseket tartalmazó készítmények |
| MA41010B1 (fr) | 2015-06-15 | 2020-01-31 | 4D Pharma Res Ltd | Compositions comprenant des souches bactériennes |
| JP6439037B2 (ja) | 2015-06-15 | 2018-12-19 | フォーディー ファーマ リサーチ リミテッド4D Pharma Research Limited | 細菌株を含む組成物 |
| ES2753779T3 (es) | 2015-06-15 | 2020-04-14 | 4D Pharma Res Ltd | Blautia stercosis y wexlerae para la utilización en el tratamiento de enfermedades inflamatorias y autoinmunes |
| WO2016205703A1 (en) | 2015-06-17 | 2016-12-22 | The Uab Research Foundation | Crispr/cas9 complex for genomic editing |
| AU2016278959A1 (en) | 2015-06-17 | 2018-01-18 | The Uab Research Foundation | CRISPR/Cas9 complex for introducing a functional polypeptide into cells of blood cell lineage |
| WO2016205613A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Crispr enzyme mutations reducing off-target effects |
| US10456452B2 (en) | 2015-07-02 | 2019-10-29 | Poseida Therapeutics, Inc. | Compositions and methods for improved encapsulation of functional proteins in polymeric vesicles |
| US20170000743A1 (en) * | 2015-07-02 | 2017-01-05 | Vindico NanoBio Technology Inc. | Compositions and Methods for Delivery of Gene Editing Tools Using Polymeric Vesicles |
| GB2592821B (en) | 2015-07-31 | 2022-01-12 | Univ Minnesota | Modified cells and methods of therapy |
| US9580727B1 (en) | 2015-08-07 | 2017-02-28 | Caribou Biosciences, Inc. | Compositions and methods of engineered CRISPR-Cas9 systems using split-nexus Cas9-associated polynucleotides |
| WO2017027392A1 (en) | 2015-08-07 | 2017-02-16 | Novartis Ag | Treatment of cancer using chimeric cd3 receptor proteins |
| US10842812B2 (en) | 2015-08-12 | 2020-11-24 | The General Hospital Corporation | Compositions and methods that promote hypoxia or the hypoxia response for treatment and prevention of mitochondrial dysfunction and oxidative stress disorders |
| WO2017027910A1 (en) | 2015-08-14 | 2017-02-23 | The University Of Sydney | Connexin 45 inhibition for therapy |
| US20170088828A1 (en) * | 2015-09-29 | 2017-03-30 | Agenovir Corporation | Compositions and methods for treatment of latent viral infections |
| EP3356520B1 (en) | 2015-10-02 | 2022-03-23 | The U.S.A. as represented by the Secretary, Department of Health and Human Services | Lentiviral protein delivery system for rna-guided genome editing |
| DK3350327T3 (en) | 2015-10-23 | 2019-01-21 | Caribou Biosciences Inc | CONSTRUCTED CRISPR CLASS-2-NUCLEIC ACID TARGETING-NUCLEIC ACID |
| WO2017087885A1 (en) | 2015-11-19 | 2017-05-26 | Dana-Farber Cancer Institute, Inc. | Methods of identifying compounds that interfere with erg-driven misguidance of baf complexes in tmprss2-erg driven prostate cancers |
| HUE036362T2 (hu) | 2015-11-20 | 2018-07-30 | 4D Pharma Res Ltd | Baktériumtörzseket tartalmazó készítmények |
| GB201520497D0 (en) | 2015-11-20 | 2016-01-06 | 4D Pharma Res Ltd | Compositions comprising bacterial strains |
| CN109072235B (zh) * | 2015-11-23 | 2023-02-28 | 加利福尼亚大学董事会 | 通过核递送crispr/cas9追踪并操纵细胞rna |
| WO2017095946A1 (en) | 2015-11-30 | 2017-06-08 | Flagship Pioneering, Inc. | Methods and compositions relating to chondrisomes |
| WO2017093370A1 (en) * | 2015-12-03 | 2017-06-08 | Technische Universität München | T-cell specific genome editing |
| CA3004757C (en) | 2015-12-04 | 2020-07-21 | Caribou Biosciences, Inc. | Engineered nucleic-acid targeting nucleic acids |
| JP6821598B2 (ja) | 2015-12-07 | 2021-01-27 | ザイマージェン インコーポレイテッド | Corynebacterium glutamicum由来のプロモーター |
| US11208649B2 (en) | 2015-12-07 | 2021-12-28 | Zymergen Inc. | HTP genomic engineering platform |
| US9988624B2 (en) | 2015-12-07 | 2018-06-05 | Zymergen Inc. | Microbial strain improvement by a HTP genomic engineering platform |
| US11672866B2 (en) | 2016-01-08 | 2023-06-13 | Paul N. DURFEE | Osteotropic nanoparticles for prevention or treatment of bone metastases |
| KR102808969B1 (ko) | 2016-01-11 | 2025-05-15 | 더 보드 어브 트러스티스 어브 더 리랜드 스탠포드 주니어 유니버시티 | 키메라 단백질 및 면역요법 방법 |
| SG11201805792PA (en) | 2016-01-11 | 2018-08-30 | Univ Leland Stanford Junior | Chimeric proteins and methods of regulating gene expression |
| JP7185527B2 (ja) | 2016-01-15 | 2022-12-07 | ザ チルドレンズ メディカル センター コーポレーション | ミトコンドリアおよび組み合わされたミトコンドリア剤の治療的使用 |
| WO2017139309A1 (en) | 2016-02-12 | 2017-08-17 | Ceres, Inc. | Methods and materials for high throughput testing of mutagenized allele combinations |
| CN105543196A (zh) * | 2016-03-01 | 2016-05-04 | 中国水稻研究所 | 植物Cas9变体蛋白VRER及其编码基因与应用 |
| CN105543195A (zh) * | 2016-03-01 | 2016-05-04 | 中国水稻研究所 | 植物Cas9变体蛋白VQR及其编码基因与应用 |
| EP3520801A1 (en) | 2016-03-04 | 2019-08-07 | 4D Pharma Plc | Compositions comprising bacterial blautia strains for treating visceral hypersensitivity |
| GB201612191D0 (en) | 2016-07-13 | 2016-08-24 | 4D Pharma Plc | Compositions comprising bacterial strains |
| EP3219799A1 (en) | 2016-03-17 | 2017-09-20 | IMBA-Institut für Molekulare Biotechnologie GmbH | Conditional crispr sgrna expression |
| WO2017165859A1 (en) * | 2016-03-24 | 2017-09-28 | Research Institute At Nationwide Children's Hospital | Modified viral capsid proteins |
| EP3433364A1 (en) | 2016-03-25 | 2019-01-30 | Editas Medicine, Inc. | Systems and methods for treating alpha 1-antitrypsin (a1at) deficiency |
| SI3443096T1 (sl) | 2016-04-15 | 2023-07-31 | Novartis Ag | Sestavki in postopki za selektivno izražanje himerni antigenskih receptorjev |
| CN107304435A (zh) * | 2016-04-22 | 2017-10-31 | 中国科学院青岛生物能源与过程研究所 | 一种Cas9/RNA系统及其应用 |
| EP3449004B1 (en) | 2016-04-29 | 2021-02-24 | Poseida Therapeutics, Inc. | Poly(histidine)-based micelles for complexation and delivery of proteins and nucleic acids |
| US10767175B2 (en) | 2016-06-08 | 2020-09-08 | Agilent Technologies, Inc. | High specificity genome editing using chemically modified guide RNAs |
| US10017760B2 (en) | 2016-06-24 | 2018-07-10 | Inscripta, Inc. | Methods for generating barcoded combinatorial libraries |
| EP3474849B1 (en) | 2016-06-27 | 2025-05-21 | The Broad Institute, Inc. | Compositions and methods for detecting and treating diabetes |
| EP3478833A4 (en) | 2016-06-30 | 2019-10-02 | Zymergen, Inc. | METHOD FOR PRODUCING A BACTERIAL HEMOGLOBIN LIBRARY AND ITS USE |
| US10544411B2 (en) | 2016-06-30 | 2020-01-28 | Zymergen Inc. | Methods for generating a glucose permease library and uses thereof |
| TW201821093A (zh) | 2016-07-13 | 2018-06-16 | 英商4D製藥有限公司 | 包含細菌菌株之組合物 |
| US20190336504A1 (en) | 2016-07-15 | 2019-11-07 | Novartis Ag | Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor |
| BR112019001887A2 (pt) | 2016-08-02 | 2019-07-09 | Editas Medicine Inc | composições e métodos para o tratamento de doença associada a cep290 |
| US11078481B1 (en) | 2016-08-03 | 2021-08-03 | KSQ Therapeutics, Inc. | Methods for screening for cancer targets |
| CA3033327A1 (en) | 2016-08-09 | 2018-02-15 | President And Fellows Of Harvard College | Programmable cas9-recombinase fusion proteins and uses thereof |
| AU2017308473B2 (en) * | 2016-08-12 | 2021-08-19 | Toolgen Incorporated | Manipulated immunoregulatory element and immunity altered thereby |
| CA3033939A1 (en) | 2016-08-19 | 2018-02-22 | Toolgen Incorporated | Artificially engineered angiogenesis regulatory system |
| US11078483B1 (en) | 2016-09-02 | 2021-08-03 | KSQ Therapeutics, Inc. | Methods for measuring and improving CRISPR reagent function |
| US20190225974A1 (en) | 2016-09-23 | 2019-07-25 | BASF Agricultural Solutions Seed US LLC | Targeted genome optimization in plants |
| EP3519577A1 (en) | 2016-09-28 | 2019-08-07 | Novartis AG | Porous membrane-based macromolecule delivery system |
| GB201617559D0 (en) | 2016-10-17 | 2016-11-30 | University Court Of The University Of Edinburgh The | Swine comprising modified cd163 and associated methods |
| CA3041068A1 (en) | 2016-10-18 | 2018-04-26 | Regents Of The University Of Minnesota | Tumor infiltrating lymphocytes and methods of therapy |
| WO2018081531A2 (en) | 2016-10-28 | 2018-05-03 | Ariad Pharmaceuticals, Inc. | Methods for human t-cell activation |
| EP3532614A1 (en) * | 2016-10-28 | 2019-09-04 | Genethon | Compositions and methods for the treatment of myotonic dystrophy |
| EP3535416A4 (en) | 2016-11-04 | 2020-05-13 | Flagship Pioneering Innovations V. Inc. | NEW PLANT CELLS, PLANTS AND SEEDS |
| US9816093B1 (en) | 2016-12-06 | 2017-11-14 | Caribou Biosciences, Inc. | Engineered nucleic acid-targeting nucleic acids |
| US11674128B2 (en) * | 2016-12-12 | 2023-06-13 | Tsinghua University | Engineering of a minimal SaCas9 CRISPR/Cas system for gene editing and transcriptional regulation optimized by enhanced guide RNA |
| GB201621123D0 (en) | 2016-12-12 | 2017-01-25 | 4D Pharma Plc | Compositions comprising bacterial strains |
| WO2018119225A1 (en) | 2016-12-22 | 2018-06-28 | Monsanto Technology Llc | Genome editing-based crop engineering and production of brachytic plants |
| US10745677B2 (en) | 2016-12-23 | 2020-08-18 | President And Fellows Of Harvard College | Editing of CCR5 receptor gene to protect against HIV infection |
| US11859219B1 (en) | 2016-12-30 | 2024-01-02 | Flagship Pioneering Innovations V, Inc. | Methods of altering a target nucleotide sequence with an RNA-guided nuclease and a single guide RNA |
| WO2018127585A1 (en) | 2017-01-06 | 2018-07-12 | Txcell | Monospecific regulatory t cell population with cytotoxicity for b cells |
| EP3346001A1 (en) | 2017-01-06 | 2018-07-11 | TXCell | Monospecific regulatory t cell population with cytotoxicity for b cells |
| EP3574005B1 (en) | 2017-01-26 | 2021-12-15 | Novartis AG | Cd28 compositions and methods for chimeric antigen receptor therapy |
| SG11201906795SA (en) | 2017-01-28 | 2019-08-27 | Inari Agriculture Inc | Novel plant cells, plants, and seeds |
| CN110582509A (zh) | 2017-01-31 | 2019-12-17 | 诺华股份有限公司 | 使用具有多特异性的嵌合t细胞受体蛋白治疗癌症 |
| WO2018148511A1 (en) | 2017-02-10 | 2018-08-16 | Zymergen Inc. | A modular universal plasmid design strategy for the assembly and editing of multiple dna constructs for multiple hosts |
| EP3589647A1 (en) | 2017-02-28 | 2020-01-08 | Novartis AG | Shp inhibitor compositions and uses for chimeric antigen receptor therapy |
| US11344629B2 (en) | 2017-03-01 | 2022-05-31 | Charles Jeffrey Brinker | Active targeting of cells by monosized protocells |
| GB2574769A (en) | 2017-03-03 | 2019-12-18 | Univ California | RNA Targeting of mutations via suppressor tRNAs and deaminases |
| EP3592853A1 (en) | 2017-03-09 | 2020-01-15 | President and Fellows of Harvard College | Suppression of pain by gene editing |
| WO2018170184A1 (en) | 2017-03-14 | 2018-09-20 | Editas Medicine, Inc. | Systems and methods for the treatment of hemoglobinopathies |
| KR20240116572A (ko) | 2017-03-23 | 2024-07-29 | 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 | 핵산 프로그램가능한 dna 결합 단백질을 포함하는 핵염기 편집제 |
| CN111031790A (zh) | 2017-04-20 | 2020-04-17 | E开创生物技术股份有限公司 | 产生基因修改的动物的方法 |
| EP3615055A1 (en) | 2017-04-28 | 2020-03-04 | Novartis AG | Cells expressing a bcma-targeting chimeric antigen receptor, and combination therapy with a gamma secretase inhibitor |
| US20200179511A1 (en) | 2017-04-28 | 2020-06-11 | Novartis Ag | Bcma-targeting agent, and combination therapy with a gamma secretase inhibitor |
| JP7235391B2 (ja) * | 2017-05-08 | 2023-03-08 | ツールゲン インコーポレイテッド | 人工的に操作された免疫細胞 |
| WO2018209158A2 (en) | 2017-05-10 | 2018-11-15 | Editas Medicine, Inc. | Crispr/rna-guided nuclease systems and methods |
| WO2018208998A1 (en) | 2017-05-10 | 2018-11-15 | The Regents Of The University Of California | Directed editing of cellular rna via nuclear delivery of crispr/cas9 |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| US11692184B2 (en) | 2017-05-16 | 2023-07-04 | The Regents Of The University Of California | Thermostable RNA-guided endonucleases and methods of use thereof |
| CA3064171A1 (en) | 2017-05-22 | 2018-11-29 | 4D Pharma Research Limited | Compositions comprising bacterial strains |
| EP3630942B1 (en) | 2017-05-24 | 2022-11-30 | 4D Pharma Research Limited | Compositions comprising bacterial strain |
| EP3409104A1 (en) | 2017-05-31 | 2018-12-05 | Vilmorin et Cie | Tomato plant resistant to tomato yellow leaf curl virus, powdery mildew, and nematodes |
| EP3409106A1 (en) | 2017-06-01 | 2018-12-05 | Vilmorin et Cie | Tolerance in plants of solanum lycopersicum to the tobamovirus tomato brown rugose fruit virus (tbrfv) |
| WO2020249996A1 (en) | 2019-06-14 | 2020-12-17 | Vilmorin & Cie | Resistance in plants of solanum lycopersicum to the tobamovirus tomato brown rugose fruit virus |
| WO2018226602A1 (en) | 2017-06-05 | 2018-12-13 | Research Institute At Nationwide Children's Hospital | Enhanced modified viral capsid proteins |
| EP3635113A4 (en) | 2017-06-05 | 2021-03-17 | Fred Hutchinson Cancer Research Center | SAFE GENOMIC HAVERS FOR GENETIC THERAPIES IN HUMAN STEM CELLS AND NANOPARTICLES MODIFIED TO ENABLE TARGETED GENETIC THERAPIES |
| EP3485013B1 (en) | 2017-06-06 | 2021-03-24 | Zymergen, Inc. | A htp genomic engineering platform for improving escherichia coli |
| WO2018226900A2 (en) | 2017-06-06 | 2018-12-13 | Zymergen Inc. | A htp genomic engineering platform for improving fungal strains |
| JP2020524993A (ja) | 2017-06-13 | 2020-08-27 | フラッグシップ パイオニアリング イノベーションズ ブイ, インコーポレイテッド | クロンを含む組成物及びその使用 |
| KR102634727B1 (ko) | 2017-06-14 | 2024-02-07 | 위스콘신 얼럼나이 리서어치 화운데이션 | 변형된 가이드 rna, crispr-리보뉴클레오프로테인 복합체 및 사용 방법 |
| JP2020523326A (ja) | 2017-06-14 | 2020-08-06 | フォーディー ファーマ リサーチ リミテッド4D Pharma Research Limited | 細菌株を含む組成物 |
| JP6884889B2 (ja) | 2017-06-14 | 2021-06-09 | フォーディー ファーマ リサーチ リミテッド4D Pharma Research Limited | 細菌株を含む組成物 |
| SMT202100069T1 (it) | 2017-06-14 | 2021-03-15 | 4D Pharma Res Limited | Composizioni comprendenti ceppi batterici |
| US9982279B1 (en) | 2017-06-23 | 2018-05-29 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| US10011849B1 (en) | 2017-06-23 | 2018-07-03 | Inscripta, Inc. | Nucleic acid-guided nucleases |
| CN111511375A (zh) | 2017-06-30 | 2020-08-07 | 因提玛生物科学公司 | 用于基因治疗的腺相关病毒载体 |
| US20190316101A1 (en) | 2017-07-18 | 2019-10-17 | Howard Hughes Medical Institute | Methods and compositions for genetically manipulating genes and cells |
| WO2019023291A2 (en) | 2017-07-25 | 2019-01-31 | Dana-Farber Cancer Institute, Inc. | COMPOSITIONS AND METHODS FOR PRODUCTION AND DECODING OF GUIDE RNA LIBRARIES AND USES THEREOF |
| CN111630170B (zh) | 2017-07-31 | 2025-03-07 | 映像生物有限公司 | 眼部疾病的细胞模型及用于眼部疾病的疗法 |
| WO2019139645A2 (en) | 2017-08-30 | 2019-07-18 | President And Fellows Of Harvard College | High efficiency base editors comprising gam |
| US20190076814A1 (en) | 2017-09-11 | 2019-03-14 | Synthego Corporation | Biopolymer synthesis system and method |
| SG11202002520UA (en) | 2017-09-19 | 2020-04-29 | Univ British Columbia | Anti-hla-a2 antibodies and methods of using the same |
| IT201700105372A1 (it) * | 2017-09-20 | 2019-03-20 | Fondazione St Italiano Tecnologia | Molecola di acido nucleico funzionale e relativo uso |
| JP7317023B2 (ja) | 2017-09-20 | 2023-07-28 | ザ・ユニバーシティ・オブ・ブリティッシュ・コロンビア | 新規抗hla-a2抗体、およびその使用 |
| US11534471B2 (en) | 2017-09-21 | 2022-12-27 | Dana-Farber Cancer Institute, Inc. | Isolation, preservation, compositions and uses of extracts from justicia plants |
| CA3073449A1 (en) | 2017-09-25 | 2019-03-28 | Agrospheres, Inc. | Compositions and methods for scalable production and delivery of biologicals |
| US10933027B1 (en) | 2017-09-25 | 2021-03-02 | National Technology & Engineering Solutions Of Sandia, Llc | Expanded pore particles and delivery methods thereof |
| AU2018352592C1 (en) | 2017-10-16 | 2025-09-25 | Beam Therapeutics, Inc. | Uses of adenosine base editors |
| BR112020007823A2 (pt) | 2017-10-20 | 2020-10-27 | Fred Hutchinson Cancer Research Center | sistemas e métodos para produzir células b geneticamente modificadas para expressar anticorpos selecionados |
| WO2019089798A1 (en) | 2017-10-31 | 2019-05-09 | Novartis Ag | Anti-car compositions and methods |
| MX2020004967A (es) | 2017-11-17 | 2020-08-27 | Iovance Biotherapeutics Inc | Expansion de linfocitos infiltrantes del tumor (til) de aspirados con aguja fina y biopsias por puncion. |
| JP2021503885A (ja) | 2017-11-22 | 2021-02-15 | アイオバンス バイオセラピューティクス,インコーポレイテッド | 末梢血からの末梢血リンパ球(pbl)の拡大培養 |
| CN109912702B (zh) * | 2017-12-13 | 2021-03-16 | 中国科学院遗传与发育生物学研究所 | 蛋白质OsARE1在调控植物抗低氮性中的应用 |
| WO2019118935A1 (en) | 2017-12-14 | 2019-06-20 | Casebia Therapeutics Limited Liability Partnership | Novel rna-programmable endonuclease systems and their use in genome editing and other applications |
| US20190201548A1 (en) | 2017-12-29 | 2019-07-04 | Rubius Therapeutics, Inc. | Gene editing and targeted transcriptional modulation for engineering erythroid cells |
| AU2019207409B2 (en) | 2018-01-12 | 2023-02-23 | Basf Se | Gene underlying the number of spikelets per spike qtl in wheat on chromosome 7a |
| WO2019147743A1 (en) | 2018-01-26 | 2019-08-01 | Massachusetts Institute Of Technology | Structure-guided chemical modification of guide rna and its applications |
| US11926835B1 (en) | 2018-01-29 | 2024-03-12 | Inari Agriculture Technology, Inc. | Methods for efficient tomato genome editing |
| CN112153984A (zh) | 2018-01-30 | 2020-12-29 | 福宏治疗公司 | 化合物及其用途 |
| CN111699254A (zh) | 2018-02-08 | 2020-09-22 | 齐默尔根公司 | 使用crispr在棒状杆菌属中进行基因组编辑 |
| WO2019178426A1 (en) | 2018-03-14 | 2019-09-19 | Editas Medicine, Inc. | Systems and methods for the treatment of hemoglobinopathies |
| MA52074A (fr) | 2018-03-19 | 2021-01-27 | Bayer Healthcare Llc | Nouveaux systèmes d'endonucléase à arn programmable et leurs utilisations |
| AU2019247490A1 (en) | 2018-04-06 | 2020-10-22 | Children's Medical Center Corporation | Compositions and methods for somatic cell reprogramming and modulating imprinting |
| MX2020010808A (es) | 2018-04-13 | 2021-03-02 | Sangamo Therapeutics France | Receptor de antigeno quimerico especifico para el receptor de interleucina-23. |
| EP3781705A4 (en) | 2018-04-19 | 2022-01-26 | The Regents of the University of California | COMPOSITIONS AND METHODS OF GENE EDIT |
| WO2019210153A1 (en) | 2018-04-27 | 2019-10-31 | Novartis Ag | Car t cell therapies with enhanced efficacy |
| WO2019210131A1 (en) | 2018-04-27 | 2019-10-31 | Iovance Biotherapeutics, Inc. | Closed process for expansion and gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy |
| MX2020011339A (es) | 2018-04-27 | 2021-02-09 | Genedit Inc | Polímero catiónico y uso para suministro de biomolecúla. |
| AU2019265916A1 (en) | 2018-05-10 | 2020-12-10 | Auxolytic Ltd | Gene therapy methods and compositions using auxotrophic regulatable cells |
| WO2019222545A1 (en) | 2018-05-16 | 2019-11-21 | Synthego Corporation | Methods and systems for guide rna design and use |
| US11866719B1 (en) | 2018-06-04 | 2024-01-09 | Inari Agriculture Technology, Inc. | Heterologous integration of regulatory elements to alter gene expression in wheat cells and wheat plants |
| EP3806888B1 (en) | 2018-06-12 | 2024-01-31 | Obsidian Therapeutics, Inc. | Pde5 derived regulatory constructs and methods of use in immunotherapy |
| US12227776B2 (en) | 2018-06-13 | 2025-02-18 | Caribou Biosciences, Inc. | Engineered cascade components and cascade complexes |
| MY208825A (en) | 2018-06-13 | 2025-05-30 | Novartis Ag | Bcma chimeric antigen receptors and uses thereof |
| US10227576B1 (en) | 2018-06-13 | 2019-03-12 | Caribou Biosciences, Inc. | Engineered cascade components and cascade complexes |
| US11045554B1 (en) | 2018-06-22 | 2021-06-29 | National Technology & Engineering Solutions Of Sandia, Llc | Lipid-coated particles for treating viral infections |
| US11629179B2 (en) | 2018-06-29 | 2023-04-18 | Stichting Het Nederlands Kanker Instituut—Antoni van Leeuwenhoek Ziekenhuis | TWEAK-receptor agonists for use in combination with immunotherapy of a cancer |
| EP3607819A1 (en) | 2018-08-10 | 2020-02-12 | Vilmorin et Cie | Resistance to xanthomonas campestris pv. campestris (xcc) in cauliflower |
| AU2019318135A1 (en) | 2018-08-10 | 2021-03-04 | Sangamo Therapeutics France | New car constructs comprising TNFR2 domains |
| WO2020086144A2 (en) | 2018-08-15 | 2020-04-30 | Zymergen Inc. | APPLICATIONS OF CRISPRi IN HIGH THROUGHPUT METABOLIC ENGINEERING |
| CN112867792A (zh) | 2018-08-23 | 2021-05-28 | 桑格摩生物治疗股份有限公司 | 工程化靶特异性碱基编辑器 |
| CN113286880A (zh) | 2018-08-28 | 2021-08-20 | 旗舰先锋创新Vi有限责任公司 | 调控基因组的方法和组合物 |
| US11479762B1 (en) | 2018-08-31 | 2022-10-25 | Inari Agriculture Technology, Inc. | Compositions, systems, and methods for genome editing |
| EP4268831A3 (en) | 2018-09-12 | 2024-05-22 | Fred Hutchinson Cancer Center | Reducing cd33 expression to selectively protect therapeutic cells |
| WO2020068798A1 (en) | 2018-09-24 | 2020-04-02 | Guo Jimin | Living mammalian cells modified with functional modular nanoparticles |
| EP3868887A4 (en) * | 2018-09-25 | 2022-12-07 | Microbial Chemistry Research Foundation | NOVEL VIRAL VECTOR AND METHODS OF PRODUCTION AND USE THEREOF |
| EP3867380A2 (en) | 2018-10-18 | 2021-08-25 | Intellia Therapeutics, Inc. | Compositions and methods for expressing factor ix |
| US12116458B2 (en) | 2018-10-24 | 2024-10-15 | Genedit Inc. | Cationic polymer with alkyl side chains and use for biomolecule delivery |
| WO2020086742A1 (en) | 2018-10-24 | 2020-04-30 | Obsidian Therapeutics, Inc. | Er tunable protein regulation |
| US11066663B2 (en) | 2018-10-31 | 2021-07-20 | Zymergen Inc. | Multiplexed deterministic assembly of DNA libraries |
| ES3021682T3 (en) | 2018-11-05 | 2025-05-27 | Iovance Biotherapeutics Inc | Tumour infiltrating lymphocytes for use in treating nsclc patients refractory to anti-pd-1 antibodies |
| US11739320B2 (en) | 2018-11-05 | 2023-08-29 | Wisconsin Alumni Research Foundation | Gene correction of Pompe disease and other autosomal recessive disorders via RNA-guided nucleases |
| MX2021004775A (es) | 2018-11-05 | 2021-06-08 | Iovance Biotherapeutics Inc | Expansion de linfocitos infiltrantes de tumores (tils) usando inhibidores de la via de proteina cinasa b (akt). |
| JP2022506586A (ja) | 2018-11-05 | 2022-01-17 | アイオバンス バイオセラピューティクス,インコーポレイテッド | 腫瘍浸潤リンパ球の産生のためのプロセスおよび免疫療法におけるその使用 |
| AU2019375416A1 (en) | 2018-11-05 | 2021-05-27 | Iovance Biotherapeutics, Inc. | Selection of improved tumor reactive T-cells |
| US11166996B2 (en) | 2018-12-12 | 2021-11-09 | Flagship Pioneering Innovations V, Inc. | Anellovirus compositions and methods of use |
| US20220193131A1 (en) | 2018-12-19 | 2022-06-23 | Iovance Biotherapeutics, Inc. | Methods of Expanding Tumor Infiltrating Lymphocytes Using Engineered Cytokine Receptor Pairs and Uses Thereof |
| US20220062340A1 (en) | 2018-12-19 | 2022-03-03 | King's College London | Immunotherapeutic methods and compositions |
| BR112021013157A8 (pt) | 2019-01-03 | 2022-12-06 | Inst Nat Sante Rech Med | Usos de um inibidor de nrp-1, uso de uma combinação, uso de um anticorpo multiespecífico, método ex vivo para predizer, uso de um inibidor, anticorpo multiespecífico, população de células modificadas, método ex vivo de produção e uso de uma população de células t |
| GB201902277D0 (en) | 2019-02-19 | 2019-04-03 | King S College London | Therapeutic agents |
| US12208164B2 (en) | 2019-02-28 | 2025-01-28 | Unm Rainforest Innovations | Modular metal-organic polyhedra superassembly compositions |
| BR112021016875A2 (pt) | 2019-03-01 | 2022-01-04 | Iovance Biotherapeutics Inc | Processo para expansão de linfócitos de sangue periférico |
| US11053515B2 (en) | 2019-03-08 | 2021-07-06 | Zymergen Inc. | Pooled genome editing in microbes |
| CA3132840A1 (en) | 2019-03-08 | 2020-09-17 | Obsidian Therapeutics, Inc. | Human carbonic anhydrase 2 compositions and methods for tunable regulation |
| JP2022524043A (ja) | 2019-03-08 | 2022-04-27 | ザイマージェン インコーポレイテッド | 微生物の反復ゲノム編集 |
| GB201905360D0 (en) | 2019-04-16 | 2019-05-29 | Univ Nottingham | Fungal strains, production and uses thereof |
| JP2022530224A (ja) | 2019-04-23 | 2022-06-28 | ジーンエディット インコーポレイテッド | アルキル側鎖を有するカチオン性ポリマー |
| WO2020219742A1 (en) | 2019-04-24 | 2020-10-29 | Novartis Ag | Compositions and methods for selective protein degradation |
| BR112021021979A2 (pt) | 2019-05-03 | 2022-12-06 | Specific Biologics Inc | Polipeptídeo, nucleases quiméricas, formulações farmaceuticamente aceitáveis, métodos para editar dna genômico, para deletar comprimentos definidos de uma molécula de dna e para substituir sequências selecionadas de uma molécula de dna, processo, métodos de administração da formulação, de tratamento de uma doença relacionada ao pulmão e de tratamento de doenças monogenéticas e infecciosas, ligante e moléculas de dna doadoras modificadas |
| US11162079B2 (en) | 2019-05-10 | 2021-11-02 | The Regents Of The University Of California | Blood type O Rh-hypo-immunogenic pluripotent cells |
| US20220249559A1 (en) | 2019-05-13 | 2022-08-11 | Iovance Biotherapeutics, Inc. | Methods and compositions for selecting tumor infiltrating lymphocytes and uses of the same in immunotherapy |
| AU2020282798A1 (en) | 2019-05-28 | 2021-12-16 | Genedit Inc. | Polymer comprising multiple functionalized sidechains for biomolecule delivery |
| CN114008203A (zh) | 2019-05-29 | 2022-02-01 | 孟山都技术公司 | 使用基因组编辑产生显性等位基因的方法和组合物 |
| WO2020244759A1 (en) | 2019-06-05 | 2020-12-10 | Klemm & Sohn Gmbh & Co. Kg | New plants having a white foliage phenotype |
| WO2020254850A1 (en) | 2019-06-21 | 2020-12-24 | Vilmorin & Cie | Improvement of quality and permanence of green color of peppers at maturity and over-maturity |
| AU2020301236A1 (en) | 2019-06-25 | 2021-11-25 | Inari Agriculture Technology, Inc. | Improved homology dependent repair genome editing |
| BR112021026832A2 (pt) | 2019-07-02 | 2022-05-10 | Hutchinson Fred Cancer Res | Vetores ad35 recombinantes e aprimoramentos da terapia gênica relacionada |
| WO2021009299A1 (en) | 2019-07-17 | 2021-01-21 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Bcl-xl:fkbp12 fusion proteins suitable for screening agents capable of slowing down the aging process |
| WO2021019272A1 (en) | 2019-07-31 | 2021-02-04 | Vilmorin & Cie | Tolerance to tolcndv in cucumber |
| US12371695B2 (en) | 2019-08-02 | 2025-07-29 | Monsanto Technology Llc | Methods and compositions to promote targeted genome modifications using HUH endonucleases |
| US20240175055A1 (en) * | 2019-08-08 | 2024-05-30 | Fudan University | Crispr/cas9 gene editing system and application thereof |
| WO2021028359A1 (en) | 2019-08-09 | 2021-02-18 | Sangamo Therapeutics France | Controlled expression of chimeric antigen receptors in t cells |
| US20220348937A1 (en) | 2019-09-06 | 2022-11-03 | Obsidian Therapeutics, Inc. | Compositions and methods for dhfr tunable protein regulation |
| CA3153563A1 (en) * | 2019-09-09 | 2021-03-18 | Beam Therapeutics Inc. | Novel crispr enzymes, methods, systems and uses thereof |
| JP2022548399A (ja) | 2019-09-23 | 2022-11-18 | オメガ セラピューティクス, インコーポレイテッド | 肝細胞核因子4-アルファ(HNF4α)遺伝子発現をモジュレートするための組成物および方法 |
| AU2020355000A1 (en) | 2019-09-23 | 2022-03-17 | Omega Therapeutics, Inc. | Compositions and methods for modulating apolipoprotein B (APOB) gene expression |
| EP3808766A1 (en) | 2019-10-15 | 2021-04-21 | Sangamo Therapeutics France | Chimeric antigen receptor specific for interleukin-23 receptor |
| WO2021077000A1 (en) | 2019-10-16 | 2021-04-22 | The Broad Institute, Inc. | Engineered muscle targeting compositions |
| EP4048295A1 (en) | 2019-10-25 | 2022-08-31 | Iovance Biotherapeutics, Inc. | Gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy |
| MX2022005817A (es) * | 2019-11-13 | 2022-06-08 | Crispr Therapeutics Ag | Metodos de fabricacion de linfocitos t-car. |
| BR112022009152A2 (pt) * | 2019-11-13 | 2022-07-26 | Crispr Therapeutics Ag | Processo de fabricação para preparar células t expressando receptores de antígenos quiméricos |
| EP4057802A1 (en) | 2019-11-14 | 2022-09-21 | Vilmorin & Cie | Resistance to acidovorax valerianellae in corn salad |
| EP4061338A1 (en) | 2019-11-22 | 2022-09-28 | President And Fellows Of Harvard College | Ionic liquids for drug delivery |
| EP4069842A1 (en) | 2019-12-02 | 2022-10-12 | Shape Therapeutics Inc. | Therapeutic editing |
| JP7749561B2 (ja) | 2019-12-11 | 2025-10-06 | アイオバンス バイオセラピューティクス,インコーポレイテッド | 腫瘍浸潤リンパ球(til)の産生のためのプロセス及びそれを使用する方法 |
| CA3164591A1 (en) | 2020-01-13 | 2021-07-22 | William Dowdle | Modification of blood type antigens |
| JP7561195B2 (ja) | 2020-01-29 | 2024-10-03 | フォグホーン セラピューティクス インコーポレイテッド | 化合物及びその使用 |
| EP3872190A1 (en) | 2020-02-26 | 2021-09-01 | Antibodies-Online GmbH | A method of using cut&run or cut&tag to validate crispr-cas targeting |
| AU2021230545A1 (en) | 2020-03-04 | 2022-09-29 | Flagship Pioneering Innovations Vi, Llc | Improved methods and compositions for modulating a genome |
| JP2023517326A (ja) | 2020-03-11 | 2023-04-25 | オメガ セラピューティクス, インコーポレイテッド | フォークヘッドボックスp3(foxp3)遺伝子発現をモジュレートするための組成物および方法 |
| IL296546A (en) | 2020-03-20 | 2022-11-01 | Inst Nat Sante Rech Med | Chimeric antigen receptor specific for human cd45rc and uses thereof |
| US11433121B1 (en) | 2020-04-03 | 2022-09-06 | National Technology & Engineering Solutions Of Sandia, Llc | Lipid composition for the delivery of therapeutic cargos |
| WO2021217082A1 (en) | 2020-04-23 | 2021-10-28 | Genedit Inc. | Polymer with cationic and hydrophobic side chains |
| KR20230002481A (ko) * | 2020-04-24 | 2023-01-05 | 기초과학연구원 | Cas9 또는 cas9 변이체를 이용한 유전체 교정 |
| JP2023523855A (ja) | 2020-05-04 | 2023-06-07 | アイオバンス バイオセラピューティクス,インコーポレイテッド | 腫瘍浸潤リンパ球の製造方法及び免疫療法におけるその使用 |
| EP4146797A1 (en) | 2020-05-06 | 2023-03-15 | Orchard Therapeutics (Europe) Limited | Treatment for neurodegenerative diseases |
| US12383555B2 (en) | 2020-05-20 | 2025-08-12 | Foghorn Therapeutics Inc. | Methods of treating cancers |
| WO2021245435A1 (en) | 2020-06-03 | 2021-12-09 | Vilmorin & Cie | Melon plants resistant to scab disease, aphids and powdery mildew |
| US20230276763A1 (en) | 2020-06-05 | 2023-09-07 | Vilmorin & Cie | Resistance in plants of solanum lycopersicum to the tobrfv |
| KR20230024967A (ko) | 2020-06-11 | 2023-02-21 | 노파르티스 아게 | Zbtb32 억제제 및 이의 용도 |
| WO2022029080A1 (en) | 2020-08-03 | 2022-02-10 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Population of treg cells functionally committed to exert a regulatory activity and their use for adoptive therapy |
| EP4192952A1 (en) | 2020-08-10 | 2023-06-14 | Novartis AG | Treatments for retinal degenerative diseases |
| AU2021329371A1 (en) | 2020-08-20 | 2023-04-20 | A2 Biotherapeutics, Inc. | Compositions and methods for treating mesothelin positive cancers |
| AU2021329375A1 (en) | 2020-08-20 | 2023-04-20 | A2 Biotherapeutics, Inc. | Compositions and methods for treating ceacam positive cancers |
| IL300629A (en) | 2020-08-20 | 2023-04-01 | A2 Biotherapeutics Inc | Preparations and methods for the treatment of EGFR positive cancer |
| EP4221492A1 (en) | 2020-10-02 | 2023-08-09 | Vilmorin & Cie | Melon with extended shelf life |
| US20230372397A1 (en) | 2020-10-06 | 2023-11-23 | Iovance Biotherapeutics, Inc. | Treatment of nsclc patients with tumor infiltrating lymphocyte therapies |
| WO2022076606A1 (en) | 2020-10-06 | 2022-04-14 | Iovance Biotherapeutics, Inc. | Treatment of nsclc patients with tumor infiltrating lymphocyte therapies |
| WO2022101286A1 (en) | 2020-11-11 | 2022-05-19 | Leibniz-Institut Für Pflanzenbiochemie | Fusion protein for editing endogenous dna of a eukaryotic cell |
| CN116635062A (zh) | 2020-11-13 | 2023-08-22 | 诺华股份有限公司 | 使用表达嵌合抗原受体(car)的细胞的组合疗法 |
| EP4001429A1 (en) | 2020-11-16 | 2022-05-25 | Antibodies-Online GmbH | Analysis of crispr-cas binding and cleavage sites followed by high-throughput sequencing (abc-seq) |
| MA60481B1 (fr) | 2020-12-03 | 2025-04-30 | Vilmorin & Cie | Plants de tomate résistants au tobrfv, au tmv, au tomv et au tommv, et gènes de résistance correspondants |
| US20240299539A1 (en) | 2020-12-17 | 2024-09-12 | Iovance Biotherapeutics, Inc. | Treatment with tumor infiltrating lymphocyte therapies in combination with ctla-4 and pd-1 inhibitors |
| WO2022133149A1 (en) | 2020-12-17 | 2022-06-23 | Iovance Biotherapeutics, Inc. | Treatment of cancers with tumor infiltrating lymphocytes |
| IL303892A (en) | 2020-12-23 | 2023-08-01 | Flagship Pioneering Innovations V Inc | In vitro assembly of RNA-encapsulating enalavirus capsids |
| EP4284919A1 (en) | 2021-01-29 | 2023-12-06 | Iovance Biotherapeutics, Inc. | Methods of making modified tumor infiltrating lymphocytes and their use in adoptive cell therapy |
| CN117597358A (zh) | 2021-02-16 | 2024-02-23 | A2生物治疗股份有限公司 | 用于治疗her2阳性癌症的组合物和方法 |
| GB202103131D0 (en) | 2021-03-05 | 2021-04-21 | Biosystems Tech Limited | Method for preparation of research organisms |
| TW202304480A (zh) | 2021-03-19 | 2023-02-01 | 美商艾歐凡斯生物治療公司 | 腫瘤浸潤淋巴球(til)中之與cd39/cd69選擇及基因剔除相關之til擴增之方法 |
| WO2022241408A1 (en) | 2021-05-10 | 2022-11-17 | Entrada Therapeutics, Inc. | Compositions and methods for modulating tissue distribution of intracellular therapeutics |
| WO2022213118A1 (en) | 2021-03-31 | 2022-10-06 | Entrada Therapeutics, Inc. | Cyclic cell penetrating peptides |
| WO2022208489A1 (en) | 2021-04-02 | 2022-10-06 | Vilmorin & Cie | Semi-determinate or determinate growth habit trait in cucurbita |
| JP2024515189A (ja) | 2021-04-19 | 2024-04-05 | アイオバンス バイオセラピューティクス,インコーポレイテッド | 細胞免疫療法におけるキメラ共刺激受容体、ケモカイン受容体、及びそれらの使用 |
| AU2022264921A1 (en) * | 2021-04-30 | 2023-11-23 | Metagenomi, Inc. | Enzymes with ruvc domains |
| CA3217862A1 (en) | 2021-05-05 | 2022-11-10 | Radius Pharmaceuticals, Inc. | Animal model having homologous recombination of mouse pth1 receptor |
| CA3217463A1 (en) | 2021-05-10 | 2022-11-17 | Ziqing QIAN | Compositions and methods for modulating mrna splicing |
| WO2022240721A1 (en) | 2021-05-10 | 2022-11-17 | Entrada Therapeutics, Inc. | Compositions and methods for modulating interferon regulatory factor-5 (irf-5) activity |
| JP2024519029A (ja) | 2021-05-17 | 2024-05-08 | アイオバンス バイオセラピューティクス,インコーポレイテッド | Pd-1遺伝子編集された腫瘍浸潤リンパ球及び免疫療法におけるその使用 |
| CA3222023A1 (en) | 2021-06-01 | 2022-12-08 | Arbor Biotechnologies, Inc. | Gene editing systems comprising a crispr nuclease and uses thereof |
| JP2024525141A (ja) | 2021-06-11 | 2024-07-10 | ジーンエディット インコーポレイテッド | ポリアミン基およびポリアルキレンオキシド基を有する側鎖を含む生分解性ポリマー |
| GEAP202416440A (en) | 2021-06-23 | 2024-04-25 | Entrada Therapeutics Inc | Antisense compounds and methods for targeting cug repeats |
| EP4367242A2 (en) | 2021-07-07 | 2024-05-15 | Omega Therapeutics, Inc. | Compositions and methods for modulating secreted frizzled receptor protein 1 (sfrp1) gene expression |
| US20240365776A1 (en) | 2021-07-22 | 2024-11-07 | Iovance Biotherapeutics, Inc | Method for cryopreservation of solid tumor fragments |
| WO2023009716A1 (en) | 2021-07-28 | 2023-02-02 | Iovance Biotherapeutics, Inc. | Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with kras inhibitors |
| IL310564A (en) | 2021-08-06 | 2024-03-01 | Vilmorin & Cie | Resistance to Leveillula Taurica in pepper plant |
| WO2023031885A1 (en) | 2021-09-02 | 2023-03-09 | SESVanderHave NV | Methods and compositions for ppo herbicide tolerance |
| JP7125727B1 (ja) | 2021-09-07 | 2022-08-25 | 国立大学法人千葉大学 | 核酸配列改変用組成物および核酸配列の標的部位を改変する方法 |
| US20250002944A1 (en) * | 2021-10-05 | 2025-01-02 | The J. David Gladstone Institutes, a testamentary trust established under the Will of J. David Glad | Allele specific editing to treat fus-induced neurodegeneration |
| CN118382429A (zh) | 2021-10-08 | 2024-07-23 | 哈佛大学校长及研究员协会 | 用于药物递送的离子液体 |
| JP2024541911A (ja) | 2021-10-27 | 2024-11-13 | アイオバンス バイオセラピューティクス,インコーポレイテッド | 患者特異的免疫療法のための細胞の製造を調整するためのシステム及び方法 |
| WO2023077148A1 (en) | 2021-11-01 | 2023-05-04 | Tome Biosciences, Inc. | Single construct platform for simultaneous delivery of gene editing machinery and nucleic acid cargo |
| CA3237410A1 (en) | 2021-11-10 | 2023-05-19 | Friedrich Graf Finck VON FINCKENSTEIN | Methods of expansion treatment utilizing cd8 tumor infiltrating lymphocytes |
| US20240401074A1 (en) | 2021-11-15 | 2024-12-05 | National University Corporation Tottori University | Method for producing human artificial chromosome vector in human cell |
| GB202118058D0 (en) | 2021-12-14 | 2022-01-26 | Univ Warwick | Methods to increase yields in crops |
| IL313765A (en) | 2021-12-22 | 2024-08-01 | Tome Biosciences Inc | Joint provision of a gene editor structure and a donor template |
| WO2023122800A1 (en) | 2021-12-23 | 2023-06-29 | University Of Massachusetts | Therapeutic treatment for fragile x-associated disorder |
| CA3243419A1 (en) | 2022-01-28 | 2023-08-03 | Iovance Biotherapeutics, Inc. | CYTOKINE-ASSOCIATED TUMOR-INFILTRATING LYMPHOCYTE COMPOSITIONS AND PROCESSES |
| US20250099584A1 (en) | 2022-02-18 | 2025-03-27 | Institut National de la Santé et de la Recherche Médicale | Use of tcr-deficient car-tregs in combination with anti-tcr complex monoclonal antibodies for inducing durable tolerance |
| EP4256950A1 (en) | 2022-04-06 | 2023-10-11 | Vilmorin et Cie | Tolerance to cgmmv in cucumber |
| WO2023196877A1 (en) | 2022-04-06 | 2023-10-12 | Iovance Biotherapeutics, Inc. | Treatment of nsclc patients with tumor infiltrating lymphocyte therapies |
| EP4507704A1 (en) | 2022-04-15 | 2025-02-19 | Iovance Biotherapeutics, Inc. | Til expansion processes using specific cytokine combinations and/or akti treatment |
| WO2023205744A1 (en) | 2022-04-20 | 2023-10-26 | Tome Biosciences, Inc. | Programmable gene insertion compositions |
| WO2023215831A1 (en) | 2022-05-04 | 2023-11-09 | Tome Biosciences, Inc. | Guide rna compositions for programmable gene insertion |
| WO2023219933A1 (en) | 2022-05-09 | 2023-11-16 | Entrada Therapeutics, Inc. | Compositions and methods for delivery of nucleic acid therapeutics |
| EP4522201A1 (en) | 2022-05-09 | 2025-03-19 | Synteny Therapeutics, Inc. | Erythroparvovirus compositions and methods for gene therapy |
| EP4522210A1 (en) | 2022-05-09 | 2025-03-19 | Synteny Therapeutics, Inc. | Erythroparvovirus with a modified genome for gene therapy |
| WO2023220040A1 (en) | 2022-05-09 | 2023-11-16 | Synteny Therapeutics, Inc. | Erythroparvovirus with a modified capsid for gene therapy |
| CA3251533A1 (en) | 2022-05-10 | 2023-11-16 | Iovance Biotherapeutics, Inc. | TREATMENT OF CANCER PATIENTS WITH TUMOR-INFILTRATING LYMPHOCYTE THERAPIES IN COMBINATION WITH AN IL-15R AGONIST |
| WO2023225670A2 (en) | 2022-05-20 | 2023-11-23 | Tome Biosciences, Inc. | Ex vivo programmable gene insertion |
| KR20250017231A (ko) | 2022-05-25 | 2025-02-04 | 플래그쉽 파이어니어링 이노베이션스 Vii, 엘엘씨 | 면역 반응을 조절하기 위한 조성물 및 방법 |
| EP4533088A2 (en) | 2022-05-25 | 2025-04-09 | Flagship Pioneering Innovations VII, LLC | Compositions and methods for modulating genetic drivers |
| WO2023230566A2 (en) | 2022-05-25 | 2023-11-30 | Flagship Pioneering Innovations Vii, Llc | Compositions and methods for modulating cytokines |
| CN120035678A (zh) | 2022-05-25 | 2025-05-23 | 旗舰创业创新第七有限责任公司 | 用于调节循环因子的组合物和方法 |
| CN119947754A (zh) | 2022-05-25 | 2025-05-06 | 旗舰创业创新第七有限责任公司 | 用于调节肿瘤抑制因子和癌基因的组合物和方法 |
| WO2024005864A1 (en) | 2022-06-30 | 2024-01-04 | Inari Agriculture Technology, Inc. | Compositions, systems, and methods for genome editing |
| EP4299739A1 (en) | 2022-06-30 | 2024-01-03 | Inari Agriculture Technology, Inc. | Compositions, systems, and methods for genome editing |
| GB2621813A (en) | 2022-06-30 | 2024-02-28 | Univ Newcastle | Preventing disease recurrence in Mitochondrial replacement therapy |
| EP4299733A1 (en) | 2022-06-30 | 2024-01-03 | Inari Agriculture Technology, Inc. | Compositions, systems, and methods for genome editing |
| WO2024005863A1 (en) | 2022-06-30 | 2024-01-04 | Inari Agriculture Technology, Inc. | Compositions, systems, and methods for genome editing |
| WO2024020587A2 (en) | 2022-07-22 | 2024-01-25 | Tome Biosciences, Inc. | Pleiopluripotent stem cell programmable gene insertion |
| WO2024030930A2 (en) * | 2022-08-01 | 2024-02-08 | The Johns Hopkins University | Compositions and methods for modifying muller glial cells |
| WO2024040222A1 (en) | 2022-08-19 | 2024-02-22 | Generation Bio Co. | Cleavable closed-ended dna (cedna) and methods of use thereof |
| WO2024050544A2 (en) | 2022-09-01 | 2024-03-07 | J.R. Simplot Company | Enhanced targeted knock-in frequency in host genomes through crispr exonuclease processing |
| EP4580392A1 (en) | 2022-09-01 | 2025-07-09 | SESVanderHave NV | Methods and compositions for ppo herbicide tolerance |
| EP4583905A1 (en) | 2022-09-06 | 2025-07-16 | Institut National de la Santé et de la Recherche Médicale | Novel dual split car-t cells for the treatment of cd38-positive hematological malignancies |
| WO2024098024A1 (en) | 2022-11-04 | 2024-05-10 | Iovance Biotherapeutics, Inc. | Expansion of tumor infiltrating lymphocytes from liquid tumors and therapeutic uses thereof |
| EP4612277A1 (en) | 2022-11-04 | 2025-09-10 | Iovance Biotherapeutics, Inc. | Methods for tumor infiltrating lymphocyte (til) expansion related to cd39/cd103 selection |
| JP2025537750A (ja) | 2022-11-10 | 2025-11-20 | セイル バイオメディシンズ インコーポレイテッド | 脂質ナノ粒子または脂質再構成天然メッセンジャーパックを含むrna組成物 |
| EP4623072A2 (en) | 2022-11-21 | 2025-10-01 | Iovance Biotherapeutics, Inc. | Two-dimensional processes for the expansion of tumor infiltrating lymphocytes and therapies therefrom |
| WO2024118836A1 (en) | 2022-11-30 | 2024-06-06 | Iovance Biotherapeutics, Inc. | Processes for production of tumor infiltrating lymphocytes with shortened rep step |
| WO2024138194A1 (en) | 2022-12-22 | 2024-06-27 | Tome Biosciences, Inc. | Platforms, compositions, and methods for in vivo programmable gene insertion |
| IL321652A (en) | 2022-12-29 | 2025-08-01 | Vilmorin & Cie | Tomato plants resistant to TSWV-resistant varieties and genes suitable for resistance |
| EP4658061A1 (en) | 2023-02-01 | 2025-12-10 | United Beet Seeds | Beet yellows virus resistance |
| AU2024220323A1 (en) | 2023-02-15 | 2025-08-14 | Arbor Biotechnologies, Inc. | Gene editing method for inhibiting aberrant splicing in stathmin 2 (stmn2) transcript |
| WO2024197242A1 (en) | 2023-03-23 | 2024-09-26 | Carbon Biosciences, Inc. | Protoparvovirus compositions comprising a protoparvovirus variant vp1 capsid polypeptide and related methods |
| US12225874B2 (en) | 2023-03-27 | 2025-02-18 | Redsea Science And Technology Inc. | Tomato plant designated ‘X22-31’ |
| WO2024211287A1 (en) | 2023-04-03 | 2024-10-10 | Seagen Inc. | Production cell lines with targeted integration sites |
| TW202449159A (zh) | 2023-04-19 | 2024-12-16 | 美商旗艦先鋒創新有限責任(Vii)公司 | 用於產生文庫之組合物及方法 |
| WO2024218295A1 (en) | 2023-04-21 | 2024-10-24 | Vib Vzw | Allelic combinations in crops for yield increase |
| WO2024223900A1 (en) | 2023-04-28 | 2024-10-31 | Vilmorin & Cie | Genetic determinants conferring improved tobrfv resistance |
| WO2024234006A1 (en) | 2023-05-11 | 2024-11-14 | Tome Biosciences, Inc. | Systems, compositions, and methods for targeting liver sinusodial endothelial cells (lsecs) |
| AU2024270764A1 (en) | 2023-05-15 | 2025-12-04 | Nchroma Bio, Inc. | Compositions and methods for epigenetic regulation of hbv gene expression |
| WO2024236547A1 (en) | 2023-05-18 | 2024-11-21 | Inceptor Bio, Llc | Modified phagocytic cells expressing chimeric antigen receptors comprising a herpes virus entry mediator (hvem) co-stimulatory domain and uses thereof |
| WO2024243438A2 (en) | 2023-05-23 | 2024-11-28 | Omega Therapeutics, Inc. | Compositions and methods for reducing cxcl9, cxcl10, and cxcl11 gene expression |
| WO2025006419A1 (en) | 2023-06-26 | 2025-01-02 | Flagship Pioneering Innovations Vii, Llc | Engineered plasmodia and related methods |
| WO2025003305A1 (en) | 2023-06-28 | 2025-01-02 | Vilmorin & Cie | Pepper resistance to meloidogyne enterolobii |
| WO2025021893A1 (en) | 2023-07-24 | 2025-01-30 | Vilmorin & Cie | Resistance to cysdv in melons |
| US20250043304A1 (en) | 2023-08-03 | 2025-02-06 | J.R. Simplot Company | Fusarium wilt resistance genes |
| WO2025046513A1 (en) | 2023-08-29 | 2025-03-06 | Inceptor Bio, Llc | Methods of manufacturing myeloid-derived cells from hematopoietic stem cells and compositions and uses thereof |
| WO2025050069A1 (en) | 2023-09-01 | 2025-03-06 | Tome Biosciences, Inc. | Programmable gene insertion using engineered integration enzymes |
| WO2025054540A1 (en) | 2023-09-08 | 2025-03-13 | Iovance Biotherapeutics, Inc. | Methods of gene-editing using programmable nucleases |
| WO2025064408A1 (en) | 2023-09-18 | 2025-03-27 | The Broad Institute, Inc. | Compositions and methods for treating cardiovascular disease |
| GB202314578D0 (en) | 2023-09-22 | 2023-11-08 | Univ Manchester | Methods of producing homoplasmic modified plants or parts thereof |
| WO2025076141A1 (en) | 2023-10-03 | 2025-04-10 | Inari Agriculture Technology, Inc. | Viral delivery of grna to the scion |
| WO2025101484A1 (en) | 2023-11-06 | 2025-05-15 | Iovance Biotherapeutics, Inc. | Treatment of endometrial cancers with tumor infiltrating lymphocyte therapies |
| US20250161347A1 (en) | 2023-11-22 | 2025-05-22 | Flagship Pioneering Innovations Vii, Llc | Methods and compositions for treating non-alcoholic fatty liver disease |
| WO2025168705A1 (en) | 2024-02-08 | 2025-08-14 | Vib Vzw | Means and methods for the production of saponins with endosomal escape-enhancing properties |
| WO2025171210A1 (en) | 2024-02-09 | 2025-08-14 | Arbor Biotechnologies, Inc. | Compositions and methods for gene editing via homology-mediated end joining |
| WO2025186284A1 (en) | 2024-03-05 | 2025-09-12 | Vilmorin & Cie | Increased yield in cucumber |
| WO2025194019A1 (en) | 2024-03-14 | 2025-09-18 | Flagship Pioneering Innovations Vii, Llc | Methods for treating liver fibrosis and non-alcoholic fatty liver disease |
| WO2025224107A1 (en) | 2024-04-22 | 2025-10-30 | Basecamp Research Ltd | Method and compositions for detecting off-target editing |
| WO2025224182A2 (en) | 2024-04-23 | 2025-10-30 | Basecamp Research Ltd | Single construct platform for simultaneous delivery of gene editing machinery and nucleic acid cargo |
| WO2025240947A1 (en) | 2024-05-17 | 2025-11-20 | University Of Massachusetts | Therapeutic treatment for fragile x-associated disorder |
| WO2025245188A2 (en) | 2024-05-21 | 2025-11-27 | Flagship Pioneering Innovations Vii, Llc | Methods of treating liver steatosis and non-alcoholic fatty liver disease |
| US20250382627A1 (en) | 2024-06-13 | 2025-12-18 | J.R. Simplot Company | Engineering remontant flowering in rosaceae |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140068797A1 (en) * | 2012-05-25 | 2014-03-06 | University Of Vienna | Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription |
Family Cites Families (67)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4217344A (en) | 1976-06-23 | 1980-08-12 | L'oreal | Compositions containing aqueous dispersions of lipid spheres |
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4186183A (en) | 1978-03-29 | 1980-01-29 | The United States Of America As Represented By The Secretary Of The Army | Liposome carriers in chemotherapy of leishmaniasis |
| US4261975A (en) | 1979-09-19 | 1981-04-14 | Merck & Co., Inc. | Viral liposome particle |
| US4485054A (en) | 1982-10-04 | 1984-11-27 | Lipoderm Pharmaceuticals Limited | Method of encapsulating biologically active materials in multilamellar lipid vesicles (MLV) |
| US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
| US4946787A (en) | 1985-01-07 | 1990-08-07 | Syntex (U.S.A.) Inc. | N-(ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor |
| US4897355A (en) | 1985-01-07 | 1990-01-30 | Syntex (U.S.A.) Inc. | N[ω,(ω-1)-dialkyloxy]- and N-[ω,(ω-1)-dialkenyloxy]-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor |
| US5049386A (en) | 1985-01-07 | 1991-09-17 | Syntex (U.S.A.) Inc. | N-ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)Alk-1-YL-N,N,N-tetrasubstituted ammonium lipids and uses therefor |
| US4797368A (en) | 1985-03-15 | 1989-01-10 | The United States Of America As Represented By The Department Of Health And Human Services | Adeno-associated virus as eukaryotic expression vector |
| US4774085A (en) | 1985-07-09 | 1988-09-27 | 501 Board of Regents, Univ. of Texas | Pharmaceutical administration systems containing a mixture of immunomodulators |
| DE122007000007I1 (de) | 1986-04-09 | 2007-05-16 | Genzyme Corp | Genetisch transformierte Tiere, die ein gewünschtes Protein in Milch absondern |
| US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
| US5143854A (en) | 1989-06-07 | 1992-09-01 | Affymax Technologies N.V. | Large scale photolithographic solid phase synthesis of polypeptides and receptor binding screening thereof |
| US5264618A (en) | 1990-04-19 | 1993-11-23 | Vical, Inc. | Cationic lipids for intracellular delivery of biologically active molecules |
| WO1991017424A1 (en) | 1990-05-03 | 1991-11-14 | Vical, Inc. | Intracellular delivery of biologically active substances by means of self-assembling lipid complexes |
| US5210015A (en) | 1990-08-06 | 1993-05-11 | Hoffman-La Roche Inc. | Homogeneous assay system using the nuclease activity of a nucleic acid polymerase |
| US5173414A (en) | 1990-10-30 | 1992-12-22 | Applied Immune Sciences, Inc. | Production of recombinant adeno-associated virus vectors |
| US7150982B2 (en) | 1991-09-09 | 2006-12-19 | Third Wave Technologies, Inc. | RNA detection assays |
| US5587308A (en) | 1992-06-02 | 1996-12-24 | The United States Of America As Represented By The Department Of Health & Human Services | Modified adeno-associated virus vector capable of expression from a novel promoter |
| EP0831854A4 (en) | 1995-06-06 | 2001-01-24 | Isis Pharmaceuticals Inc | OLIGONUCLEOTIDS WITH PHOSPHOROTHIOATE BINDINGS OF HIGH CHIRAL PURITY |
| US5985662A (en) | 1995-07-13 | 1999-11-16 | Isis Pharmaceuticals Inc. | Antisense inhibition of hepatitis B virus replication |
| US5622856A (en) * | 1995-08-03 | 1997-04-22 | Avigen | High efficiency helper system for AAV vector production |
| US6251677B1 (en) * | 1997-08-25 | 2001-06-26 | The Trustees Of The University Of Pennsylvania | Hybrid adenovirus-AAV virus and methods of use thereof |
| JP4303418B2 (ja) | 1997-10-24 | 2009-07-29 | ライフ テクノロジーズ コーポレーション | 組換え部位を有する核酸を使用する組換えクローニング |
| US6750059B1 (en) | 1998-07-16 | 2004-06-15 | Whatman, Inc. | Archiving of vectors |
| US6534261B1 (en) | 1999-01-12 | 2003-03-18 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US7868149B2 (en) | 1999-07-20 | 2011-01-11 | Monsanto Technology Llc | Plant genome sequence and uses thereof |
| US6603061B1 (en) | 1999-07-29 | 2003-08-05 | Monsanto Company | Agrobacterium-mediated plant transformation method |
| WO2003045304A2 (en) | 2001-09-26 | 2003-06-05 | Mayo Foundation For Medical Education And Research | Mutable vaccines |
| US20090100536A1 (en) | 2001-12-04 | 2009-04-16 | Monsanto Company | Transgenic plants with enhanced agronomic traits |
| FR2862659B1 (fr) * | 2003-11-21 | 2006-02-10 | Pasteur Institut | Genome de legionella pneumophila souche paris- applications diagnostiques et epidemiologiques |
| CA2573702C (en) | 2004-07-16 | 2013-10-15 | The Government Of The United States Of America As Represented By The Sec Retary Of The Department Of Health And Human Services | Vaccine constructs and combination of vaccines designed to improve the breadth of the immune response to diverse strains and clades of hiv |
| WO2006116756A1 (en) * | 2005-04-28 | 2006-11-02 | Benitec, Limited. | Multiple-rnai expression cassettes for simultaneous delivery of rnai agents related to heterozygotic expression patterns |
| DK3284833T3 (da) * | 2005-08-26 | 2022-02-07 | Dupont Nutrition Biosci Aps | Anvendelse af crispr-associerede gener (cas) |
| EP1994182B1 (en) | 2006-03-15 | 2019-05-29 | Siemens Healthcare Diagnostics Inc. | Degenerate nucleobase analogs |
| BRPI0808704B1 (pt) | 2007-03-02 | 2022-01-18 | Dupont Nutrition Biosciences Aps | Método para gerar uma cultura inicial compreendendo pelo menos duas cepas variantes resistentes a bacteriófagos, cultura iniciadora e método de fermentação |
| EP2225002A4 (en) | 2007-12-31 | 2011-06-22 | Nanocor Therapeutics Inc | RNA INTERFERENCE FOR THE TREATMENT OF CARDIAC SUFFICIENCIES |
| US8546553B2 (en) | 2008-07-25 | 2013-10-01 | University Of Georgia Research Foundation, Inc. | Prokaryotic RNAi-like system and methods of use |
| US20100076057A1 (en) | 2008-09-23 | 2010-03-25 | Northwestern University | TARGET DNA INTERFERENCE WITH crRNA |
| US9404098B2 (en) | 2008-11-06 | 2016-08-02 | University Of Georgia Research Foundation, Inc. | Method for cleaving a target RNA using a Cas6 polypeptide |
| KR100948767B1 (ko) * | 2008-11-12 | 2010-03-23 | 한국기초과학지원연구원 | 생체 고분자 물질의 상호작용 검출 방법 |
| US8927807B2 (en) | 2009-09-03 | 2015-01-06 | The Regents Of The University Of California | Nitrate-responsive promoter |
| US8889394B2 (en) | 2009-09-07 | 2014-11-18 | Empire Technology Development Llc | Multiple domain proteins |
| US10087431B2 (en) | 2010-03-10 | 2018-10-02 | The Regents Of The University Of California | Methods of generating nucleic acid fragments |
| EP3078753B1 (en) | 2010-05-10 | 2018-04-18 | The Regents of The University of California | Methods using endoribonuclease compositions |
| EP2571512B1 (en) | 2010-05-17 | 2017-08-23 | Sangamo BioSciences, Inc. | Novel dna-binding proteins and uses thereof |
| US9405700B2 (en) | 2010-11-04 | 2016-08-02 | Sonics, Inc. | Methods and apparatus for virtualization in an integrated circuit |
| WO2012164565A1 (en) | 2011-06-01 | 2012-12-06 | Yeda Research And Development Co. Ltd. | Compositions and methods for downregulating prokaryotic genes |
| GB201122458D0 (en) | 2011-12-30 | 2012-02-08 | Univ Wageningen | Modified cascade ribonucleoproteins and uses thereof |
| WO2013141680A1 (en) * | 2012-03-20 | 2013-09-26 | Vilnius University | RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX |
| US9637739B2 (en) * | 2012-03-20 | 2017-05-02 | Vilnius University | RNA-directed DNA cleavage by the Cas9-crRNA complex |
| EP4556564A3 (en) | 2012-10-23 | 2025-09-03 | Toolgen Incorporated | Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof |
| CA2891347C (en) | 2012-12-06 | 2018-02-27 | Sigma-Aldrich Co. Llc | Crispr-based genome modification and regulation |
| WO2014093479A1 (en) | 2012-12-11 | 2014-06-19 | Montana State University | Crispr (clustered regularly interspaced short palindromic repeats) rna-guided control of gene regulation |
| EP2931898B1 (en) | 2012-12-12 | 2016-03-09 | The Broad Institute, Inc. | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains |
| EP2931899A1 (en) | 2012-12-12 | 2015-10-21 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions, methods, knock out libraries and applications thereof |
| US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| PL2771468T3 (pl) | 2012-12-12 | 2015-07-31 | Broad Inst Inc | Inżynieria systemów, metod i zoptymalizowanych kompozycji kierujących dla manipulacji sekwencjami |
| US20140186919A1 (en) | 2012-12-12 | 2014-07-03 | Feng Zhang | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
| KR20150105635A (ko) | 2012-12-12 | 2015-09-17 | 더 브로드 인스티튜트, 인코퍼레이티드 | 서열 조작을 위한 crispr-cas 성분 시스템, 방법 및 조성물 |
| EP2896697B1 (en) | 2012-12-12 | 2015-09-02 | The Broad Institute, Inc. | Engineering of systems, methods and optimized guide compositions for sequence manipulation |
| WO2014093709A1 (en) | 2012-12-12 | 2014-06-19 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof |
| IL239317B (en) | 2012-12-12 | 2022-07-01 | Broad Inst Inc | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
| US9970024B2 (en) | 2012-12-17 | 2018-05-15 | President And Fellows Of Harvard College | RNA-guided human genome engineering |
| EP3071695A2 (en) * | 2013-11-18 | 2016-09-28 | Crispr Therapeutics AG | Crispr-cas system materials and methods |
-
2013
- 2013-12-12 US US14/104,977 patent/US20140186919A1/en not_active Abandoned
- 2013-12-12 CN CN201380072821.XA patent/CN105209621B/zh active Active
- 2013-12-12 PL PL13814364.9T patent/PL2898075T3/pl unknown
- 2013-12-12 ES ES16151694T patent/ES2786193T3/es active Active
- 2013-12-12 JP JP2015547545A patent/JP6552965B2/ja active Active
- 2013-12-12 PT PT138143649T patent/PT2898075E/pt unknown
- 2013-12-12 KR KR1020157018660A patent/KR20150105634A/ko active Pending
- 2013-12-12 EP EP13814364.9A patent/EP2898075B1/en not_active Revoked
- 2013-12-12 WO PCT/US2013/074691 patent/WO2014093635A1/en not_active Ceased
- 2013-12-12 IL IL300461A patent/IL300461A/en unknown
- 2013-12-12 DK DK13814364.9T patent/DK2898075T3/en active
- 2013-12-12 ES ES13814364.9T patent/ES2576126T3/es active Active
- 2013-12-12 DK DK16151694.3T patent/DK3064585T3/da active
- 2013-12-12 AU AU2013359212A patent/AU2013359212B2/en active Active
- 2013-12-12 SG SG11201504519TA patent/SG11201504519TA/en unknown
- 2013-12-12 SG SG10201912327SA patent/SG10201912327SA/en unknown
- 2013-12-12 CN CN202110502128.8A patent/CN113355357B/zh active Active
- 2013-12-12 SG SG10201801969TA patent/SG10201801969TA/en unknown
- 2013-12-12 CA CA2894684A patent/CA2894684A1/en active Pending
-
2014
- 2014-03-24 US US14/222,930 patent/US8865406B2/en active Active
- 2014-06-02 US US14/293,498 patent/US8895308B1/en active Active
- 2014-06-02 US US14/293,674 patent/US8889418B2/en active Active
-
2015
- 2015-06-05 ZA ZA2015/04081A patent/ZA201504081B/en unknown
- 2015-06-10 IL IL239315A patent/IL239315B2/en unknown
-
2016
- 2016-07-01 JP JP2016131404A patent/JP6395765B2/ja active Active
- 2016-11-07 US US15/330,876 patent/US20170198269A1/en active Pending
-
2017
- 2017-04-19 AU AU2017202542A patent/AU2017202542B2/en active Active
-
2018
- 2018-06-25 JP JP2018119670A patent/JP6665230B2/ja active Active
-
2019
- 2019-09-23 AU AU2019236591A patent/AU2019236591B2/en active Active
-
2020
- 2020-02-18 JP JP2020025253A patent/JP7125440B2/ja active Active
-
2022
- 2022-03-24 AU AU2022202048A patent/AU2022202048B2/en active Active
- 2022-06-07 JP JP2022092414A patent/JP2022113766A/ja active Pending
-
2024
- 2024-08-05 JP JP2024128853A patent/JP2024163122A/ja active Pending
-
2025
- 2025-01-16 US US19/025,663 patent/US20250236856A1/en active Pending
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140068797A1 (en) * | 2012-05-25 | 2014-03-06 | University Of Vienna | Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription |
Cited By (542)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12338444B2 (en) | 2011-03-23 | 2025-06-24 | Pioneer Hi-Bred International, Inc. | Methods for producing a complex transgenic trait locus |
| US12006520B2 (en) | 2011-07-22 | 2024-06-11 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US10711257B2 (en) | 2011-12-30 | 2020-07-14 | Caribou Biosciences, Inc. | Modified cascade ribonucleoproteins and uses thereof |
| US9885026B2 (en) | 2011-12-30 | 2018-02-06 | Caribou Biosciences, Inc. | Modified cascade ribonucleoproteins and uses thereof |
| US10954498B2 (en) | 2011-12-30 | 2021-03-23 | Caribou Biosciences, Inc. | Modified cascade ribonucleoproteins and uses thereof |
| US10435678B2 (en) | 2011-12-30 | 2019-10-08 | Caribou Biosciences, Inc. | Modified cascade ribonucleoproteins and uses thereof |
| US11939604B2 (en) | 2011-12-30 | 2024-03-26 | Caribou Biosciences, Inc. | Modified cascade ribonucleoproteins and uses thereof |
| US10039777B2 (en) | 2012-03-20 | 2018-08-07 | Neuro-Lm Sas | Methods and pharmaceutical compositions of the treatment of autistic syndrome disorders |
| US11274318B2 (en) | 2012-05-25 | 2022-03-15 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10487341B2 (en) | 2012-05-25 | 2019-11-26 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US12180503B2 (en) | 2012-05-25 | 2024-12-31 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US12180504B2 (en) | 2012-05-25 | 2024-12-31 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US12123015B2 (en) | 2012-05-25 | 2024-10-22 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10351878B2 (en) | 2012-05-25 | 2019-07-16 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10308961B2 (en) | 2012-05-25 | 2019-06-04 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11970711B2 (en) | 2012-05-25 | 2024-04-30 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US12215343B2 (en) | 2012-05-25 | 2025-02-04 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10358658B2 (en) | 2012-05-25 | 2019-07-23 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10358659B2 (en) | 2012-05-25 | 2019-07-23 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10301651B2 (en) | 2012-05-25 | 2019-05-28 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11814645B2 (en) | 2012-05-25 | 2023-11-14 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10385360B2 (en) | 2012-05-25 | 2019-08-20 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11674159B2 (en) | 2012-05-25 | 2023-06-13 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11634730B2 (en) | 2012-05-25 | 2023-04-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10400253B2 (en) | 2012-05-25 | 2019-09-03 | The Regents Of The University Of California | Methods and compositions or RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10000772B2 (en) | 2012-05-25 | 2018-06-19 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10407697B2 (en) | 2012-05-25 | 2019-09-10 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11549127B2 (en) | 2012-05-25 | 2023-01-10 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10415061B2 (en) | 2012-05-25 | 2019-09-17 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11479794B2 (en) | 2012-05-25 | 2022-10-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11473108B2 (en) | 2012-05-25 | 2022-10-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11401532B2 (en) | 2012-05-25 | 2022-08-02 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10421980B2 (en) | 2012-05-25 | 2019-09-24 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11332761B2 (en) | 2012-05-25 | 2022-05-17 | The Regenis of Wie University of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10428352B2 (en) | 2012-05-25 | 2019-10-01 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11293034B2 (en) | 2012-05-25 | 2022-04-05 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10597680B2 (en) | 2012-05-25 | 2020-03-24 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11242543B2 (en) | 2012-05-25 | 2022-02-08 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11186849B2 (en) | 2012-05-25 | 2021-11-30 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10266850B2 (en) | 2012-05-25 | 2019-04-23 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10337029B2 (en) | 2012-05-25 | 2019-07-02 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10513712B2 (en) | 2012-05-25 | 2019-12-24 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10443076B2 (en) | 2012-05-25 | 2019-10-15 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10519467B2 (en) | 2012-05-25 | 2019-12-31 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11028412B2 (en) | 2012-05-25 | 2021-06-08 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11008589B2 (en) | 2012-05-25 | 2021-05-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11008590B2 (en) | 2012-05-25 | 2021-05-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US11001863B2 (en) | 2012-05-25 | 2021-05-11 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10988782B2 (en) | 2012-05-25 | 2021-04-27 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10988780B2 (en) | 2012-05-25 | 2021-04-27 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10982231B2 (en) | 2012-05-25 | 2021-04-20 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10982230B2 (en) | 2012-05-25 | 2021-04-20 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10227611B2 (en) | 2012-05-25 | 2019-03-12 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10900054B2 (en) | 2012-05-25 | 2021-01-26 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10577631B2 (en) | 2012-05-25 | 2020-03-03 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10526619B2 (en) | 2012-05-25 | 2020-01-07 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10793878B1 (en) | 2012-05-25 | 2020-10-06 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10774344B1 (en) | 2012-05-25 | 2020-09-15 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10533190B2 (en) | 2012-05-25 | 2020-01-14 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10612045B2 (en) | 2012-05-25 | 2020-04-07 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10550407B2 (en) | 2012-05-25 | 2020-02-04 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10752920B2 (en) | 2012-05-25 | 2020-08-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10570419B2 (en) | 2012-05-25 | 2020-02-25 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10626419B2 (en) | 2012-05-25 | 2020-04-21 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10113167B2 (en) | 2012-05-25 | 2018-10-30 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10676759B2 (en) | 2012-05-25 | 2020-06-09 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10669560B2 (en) | 2012-05-25 | 2020-06-02 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10563227B2 (en) | 2012-05-25 | 2020-02-18 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US10640791B2 (en) | 2012-05-25 | 2020-05-05 | The Regents Of The University Of California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription |
| US12473559B2 (en) | 2012-10-23 | 2025-11-18 | Toolgen Incorporated | Cas9/RNA complexes for inducing modifications of target endogenous nucleic acid sequences in nucleuses of eukaryotic cells |
| US10851380B2 (en) | 2012-10-23 | 2020-12-01 | Toolgen Incorporated | Methods for cleaving a target DNA using a guide RNA specific for the target DNA and Cas protein-encoding nucleic acid or Cas protein |
| US10731181B2 (en) | 2012-12-06 | 2020-08-04 | Sigma, Aldrich Co. LLC | CRISPR-based genome modification and regulation |
| US10745716B2 (en) | 2012-12-06 | 2020-08-18 | Sigma-Aldrich Co. Llc | CRISPR-based genome modification and regulation |
| US9725714B2 (en) | 2013-03-14 | 2017-08-08 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US9909122B2 (en) | 2013-03-14 | 2018-03-06 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US9809814B1 (en) | 2013-03-14 | 2017-11-07 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US9803194B2 (en) | 2013-03-14 | 2017-10-31 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US10125361B2 (en) | 2013-03-14 | 2018-11-13 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US9260752B1 (en) | 2013-03-14 | 2016-02-16 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US9410198B2 (en) | 2013-03-14 | 2016-08-09 | Caribou Biosciences, Inc. | Compostions and methods of nucleic acid-targeting nucleic acids |
| US11312953B2 (en) | 2013-03-14 | 2022-04-26 | Caribou Biosciences, Inc. | Compositions and methods of nucleic acid-targeting nucleic acids |
| US10844403B2 (en) | 2013-03-15 | 2020-11-24 | The General Hospital Corporation | Increasing specificity for RNA-guided genome editing |
| US9738908B2 (en) | 2013-03-15 | 2017-08-22 | System Biosciences, Llc | CRISPR/Cas systems for genomic modification and gene modulation |
| US10526589B2 (en) | 2013-03-15 | 2020-01-07 | The General Hospital Corporation | Multiplex guide RNAs |
| US10119133B2 (en) | 2013-03-15 | 2018-11-06 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
| US11098326B2 (en) | 2013-03-15 | 2021-08-24 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
| US10544433B2 (en) | 2013-03-15 | 2020-01-28 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
| US10202619B2 (en) | 2013-03-15 | 2019-02-12 | System Biosciences, Llc | Compositions and methods directed to CRISPR/Cas genomic engineering systems |
| US9567603B2 (en) | 2013-03-15 | 2017-02-14 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
| US9567604B2 (en) | 2013-03-15 | 2017-02-14 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
| US9234213B2 (en) | 2013-03-15 | 2016-01-12 | System Biosciences, Llc | Compositions and methods directed to CRISPR/Cas genomic engineering systems |
| US11168338B2 (en) | 2013-03-15 | 2021-11-09 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
| US9885033B2 (en) | 2013-03-15 | 2018-02-06 | The General Hospital Corporation | Increasing specificity for RNA-guided genome editing |
| US10760064B2 (en) | 2013-03-15 | 2020-09-01 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
| US10138476B2 (en) | 2013-03-15 | 2018-11-27 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
| US10415059B2 (en) | 2013-03-15 | 2019-09-17 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
| US12065668B2 (en) | 2013-03-15 | 2024-08-20 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
| US11920152B2 (en) | 2013-03-15 | 2024-03-05 | The General Hospital Corporation | Increasing specificity for RNA-guided genome editing |
| US11634731B2 (en) | 2013-03-15 | 2023-04-25 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
| US10378027B2 (en) | 2013-03-15 | 2019-08-13 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
| US9822370B2 (en) | 2013-04-04 | 2017-11-21 | President And Fellows Of Harvard College | Method of making a deletion in a target sequence in isolated primary cells using Cas9 and two guide RNAs |
| US10011850B2 (en) | 2013-06-21 | 2018-07-03 | The General Hospital Corporation | Using RNA-guided FokI Nucleases (RFNs) to increase specificity for RNA-Guided Genome Editing |
| US10208319B2 (en) | 2013-07-09 | 2019-02-19 | President And Fellows Of Harvard College | Therapeutic uses of genome editing with CRISPR/Cas systems |
| US11920181B2 (en) | 2013-08-09 | 2024-03-05 | President And Fellows Of Harvard College | Nuclease profiling system |
| US12378566B2 (en) | 2013-08-22 | 2025-08-05 | Pioneer Hi-Bred International, Inc. | Plant genome modification using guide RNA/Cas endonuclease systems and methods of use |
| US20160208271A1 (en) * | 2013-08-22 | 2016-07-21 | E. I. Du Pont De Nemours And Company | Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof |
| US11773400B2 (en) * | 2013-08-22 | 2023-10-03 | E.I. Du Pont De Nemours And Company | Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof |
| US12428645B2 (en) * | 2013-08-22 | 2025-09-30 | Pioneer Hi-Bred International, Inc. | Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof |
| US20240084318A1 (en) * | 2013-08-22 | 2024-03-14 | Corteva Agriscience Llc | Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof |
| US10519457B2 (en) | 2013-08-22 | 2019-12-31 | E I Du Pont De Nemours And Company | Soybean U6 polymerase III promoter and methods of use |
| US20160201072A1 (en) * | 2013-08-22 | 2016-07-14 | Pioneer Hi-Bred International, Inc. | Genome modification using guide polynucleotide/cas endonuclease systems and methods of use |
| US12473573B2 (en) | 2013-09-06 | 2025-11-18 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US11149267B2 (en) | 2013-10-28 | 2021-10-19 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof |
| WO2015065964A1 (en) | 2013-10-28 | 2015-05-07 | The Broad Institute Inc. | Functional genomics using crispr-cas systems, compositions, methods, screens and applications thereof |
| US11390887B2 (en) | 2013-11-07 | 2022-07-19 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| US10190137B2 (en) | 2013-11-07 | 2019-01-29 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
| US10640788B2 (en) | 2013-11-07 | 2020-05-05 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAs |
| EP3470089A1 (en) | 2013-12-12 | 2019-04-17 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components |
| US12410435B2 (en) * | 2013-12-12 | 2025-09-09 | The Broad Institute, Inc. | Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders |
| WO2015089419A2 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components |
| EP3540051A1 (en) | 2013-12-12 | 2019-09-18 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders |
| EP4219699A1 (en) | 2013-12-12 | 2023-08-02 | The Broad Institute, Inc. | Engineering of systems, methods and optimized guide compositions with new architectures for sequence manipulation |
| WO2015089465A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders |
| EP3653229A1 (en) | 2013-12-12 | 2020-05-20 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for genome editing |
| EP3653704A1 (en) | 2013-12-12 | 2020-05-20 | The Broad Institute, Inc. | Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders |
| EP3653703A1 (en) | 2013-12-12 | 2020-05-20 | The Broad Institute, Inc. | Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders |
| WO2015089364A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Crystal structure of a crispr-cas system, and uses thereof |
| US20210277370A1 (en) * | 2013-12-12 | 2021-09-09 | The Broad Institute, Inc. | Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders |
| WO2015089486A2 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Systems, methods and compositions for sequence manipulation with optimized functional crispr-cas systems |
| WO2015089351A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders |
| EP4183876A1 (en) | 2013-12-12 | 2023-05-24 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for hbv and viral diseases and disorders |
| WO2015089354A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders |
| US10286084B2 (en) | 2014-02-18 | 2019-05-14 | Duke University | Compositions for the inactivation of virus replication and methods of making and using the same |
| EP3514246A1 (en) | 2014-02-27 | 2019-07-24 | The Broad Institute Inc. | T cell balance gene expression and methods of use thereof |
| US11209440B2 (en) | 2014-02-27 | 2021-12-28 | The Broad Institute, Inc. | T cell balance gene expression, compositions of matters and methods of use thereof |
| US12104207B2 (en) | 2014-06-23 | 2024-10-01 | The General Hospital Corporation | Genomewide unbiased identification of DSBs evaluated by sequencing (GUIDE-Seq) |
| US10501794B2 (en) | 2014-06-23 | 2019-12-10 | The General Hospital Corporation | Genomewide unbiased identification of DSBs evaluated by sequencing (GUIDE-seq) |
| US10676754B2 (en) | 2014-07-11 | 2020-06-09 | E I Du Pont De Nemours And Company | Compositions and methods for producing plants resistant to glyphosate herbicide |
| US12398406B2 (en) | 2014-07-30 | 2025-08-26 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| EP3686279A1 (en) | 2014-08-17 | 2020-07-29 | The Broad Institute, Inc. | Genome editing using cas9 nickases |
| US9970030B2 (en) | 2014-08-27 | 2018-05-15 | Caribou Biosciences, Inc. | Methods for increasing CAS9-mediated engineering efficiency |
| WO2016036754A1 (en) | 2014-09-02 | 2016-03-10 | The Regents Of The University Of California | Methods and compositions for rna-directed target dna modification |
| US12173294B2 (en) | 2014-09-12 | 2024-12-24 | Corteva Agriscience Llc | Generation of site specific integration sites for complex trait loci in corn and soybean, and methods of use |
| US11560568B2 (en) | 2014-09-12 | 2023-01-24 | E. I. Du Pont De Nemours And Company | Generation of site-specific-integration sites for complex trait loci in corn and soybean, and methods of use |
| US11197467B2 (en) | 2014-09-24 | 2021-12-14 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-cas systems and compositions for modeling mutations in leukocytes |
| US11124796B2 (en) | 2014-09-24 | 2021-09-21 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for modeling competition of multiple cancer mutations in vivo |
| WO2016049163A2 (en) | 2014-09-24 | 2016-03-31 | The Broad Institute Inc. | Use and production of chd8+/- transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder |
| WO2016049251A1 (en) | 2014-09-24 | 2016-03-31 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling mutations in leukocytes |
| US11459557B2 (en) | 2014-09-24 | 2022-10-04 | The Broad Institute, Inc. | Use and production of CHD8+/− transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder |
| US11001829B2 (en) | 2014-09-25 | 2021-05-11 | The Broad Institute, Inc. | Functional screening with optimized functional CRISPR-Cas systems |
| CN104546931A (zh) * | 2014-09-30 | 2015-04-29 | 深圳华大基因科技有限公司 | 华德萨特氏菌在治疗或预防类风湿性关节炎或其相关疾病中的应用 |
| CN104546931B (zh) * | 2014-09-30 | 2019-04-09 | 深圳华大基因科技有限公司 | 华德萨特氏菌在治疗或预防类风湿性关节炎或其相关疾病中的应用 |
| CN107530399A (zh) * | 2014-10-10 | 2018-01-02 | 马萨诸塞眼科耳科诊所 | 治疗分子在体外和体内的有效递送 |
| EP3204032A4 (en) * | 2014-10-10 | 2018-10-10 | Massachusetts Eye & Ear Infirmary | Efficient delivery of therapeutic molecules in vitro and in vivo |
| US12201699B2 (en) | 2014-10-10 | 2025-01-21 | Editas Medicine, Inc. | Compositions and methods for promoting homology directed repair |
| WO2016057061A2 (en) | 2014-10-10 | 2016-04-14 | Massachusetts Eye And Ear Infirmary | Efficient delivery of therapeutic molecules in vitro and in vivo |
| WO2016069591A2 (en) | 2014-10-27 | 2016-05-06 | The Broad Institute Inc. | Compositions, methods and use of synthetic lethal screening |
| US12180263B2 (en) | 2014-11-06 | 2024-12-31 | President And Fellows Of Harvard College | Cells lacking B2M surface expression and methods for allogeneic administration of such cells |
| US11680268B2 (en) | 2014-11-07 | 2023-06-20 | Editas Medicine, Inc. | Methods for improving CRISPR/Cas-mediated genome-editing |
| EP3626832A2 (en) | 2014-11-25 | 2020-03-25 | The Brigham and Women's Hospital, Inc. | Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease |
| WO2016086197A1 (en) | 2014-11-25 | 2016-06-02 | The Brigham And Women's Hospital, Inc. | Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease |
| WO2016086227A2 (en) | 2014-11-26 | 2016-06-02 | The Regents Of The University Of California | Therapeutic compositions comprising transcription factors and methods of making and using the same |
| EP3985115A1 (en) | 2014-12-12 | 2022-04-20 | The Broad Institute, Inc. | Protected guide rnas (pgrnas) |
| WO2016094867A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Protected guide rnas (pgrnas) |
| US10954514B2 (en) | 2014-12-12 | 2021-03-23 | The Broad Institute, Inc. | Escorted and functionalized guides for CRISPR-Cas systems |
| WO2016094874A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Escorted and functionalized guides for crispr-cas systems |
| WO2016094872A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Dead guides for crispr transcription factors |
| EP3889260A1 (en) | 2014-12-12 | 2021-10-06 | The Broad Institute, Inc. | Protected guide rnas (pgrnas) |
| WO2016094880A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Delivery, use and therapeutic applications of crispr systems and compositions for genome editing as to hematopoietic stem cells (hscs) |
| US20170349914A1 (en) * | 2014-12-12 | 2017-12-07 | The Broad Institute Inc. | DELIVERY, USE AND THERAPEUTIC APPLICATIONS OF CRISPR SYSTEMS AND COMPOSITIONS FOR GENOME EDITING AS TO HEMATOPOIETIC STEM CELLS (HSCs) |
| WO2016100974A1 (en) | 2014-12-19 | 2016-06-23 | The Broad Institute Inc. | Unbiased identification of double-strand breaks and genomic rearrangement by genome-wide insert capture sequencing |
| US12215326B2 (en) | 2014-12-23 | 2025-02-04 | The Broad Institute, Inc. | RNA-targeting system |
| WO2016106236A1 (en) | 2014-12-23 | 2016-06-30 | The Broad Institute Inc. | Rna-targeting system |
| WO2016106244A1 (en) | 2014-12-24 | 2016-06-30 | The Broad Institute Inc. | Crispr having or associated with destabilization domains |
| EP3702456A1 (en) | 2014-12-24 | 2020-09-02 | The Broad Institute, Inc. | Crispr having or associated with destabilization domains |
| WO2016108926A1 (en) | 2014-12-30 | 2016-07-07 | The Broad Institute Inc. | Crispr mediated in vivo modeling and genetic screening of tumor growth and metastasis |
| US12116619B2 (en) | 2014-12-30 | 2024-10-15 | The Broad Institute, Inc. | CRISPR mediated in vivo modeling and genetic screening of tumor growth and metastasis |
| WO2016114972A1 (en) | 2015-01-12 | 2016-07-21 | The Regents Of The University Of California | Heterodimeric cas9 and methods of use thereof |
| US9868962B2 (en) | 2015-01-28 | 2018-01-16 | Pioneer Hi-Bred International, Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| US11236364B2 (en) | 2015-01-28 | 2022-02-01 | Caribou Biosciences, Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| US9771601B2 (en) | 2015-01-28 | 2017-09-26 | Pioneer Hi-Bred International. Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| US9580701B2 (en) | 2015-01-28 | 2017-02-28 | Pioneer Hi-Bred International, Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| US9688972B2 (en) | 2015-01-28 | 2017-06-27 | Pioneer Hi-Bred International, Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| US10988781B2 (en) | 2015-01-28 | 2021-04-27 | Caribou Biosciences, Inc. | Method of target cleaving using CRISPR hybrid DNA/RNA polynucleotides |
| US11459588B2 (en) | 2015-01-28 | 2022-10-04 | Caribou Biosciences, Inc. | Methods of use of CRISPR CPF1 hybrid DNA/RNA polynucleotides |
| US11180792B2 (en) | 2015-01-28 | 2021-11-23 | The Regents Of The University Of California | Methods and compositions for labeling a single-stranded target nucleic acid |
| US9650617B2 (en) | 2015-01-28 | 2017-05-16 | Pioneer Hi-Bred International. Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
| US10519468B2 (en) | 2015-01-28 | 2019-12-31 | Pioneer Hi-Bred International, Inc. | Cells containing CRISPR hybrid DNA/RNA polynucleotides |
| US11427869B2 (en) | 2015-02-26 | 2022-08-30 | The Broad Institute, Inc. | T cell balance gene expression, compositions of matters and methods of use thereof |
| WO2016138488A2 (en) | 2015-02-26 | 2016-09-01 | The Broad Institute Inc. | T cell balance gene expression, compositions of matters and methods of use thereof |
| WO2016138574A1 (en) | 2015-03-02 | 2016-09-09 | Sinai Health System | Homologous recombination factors |
| US11859220B2 (en) | 2015-03-03 | 2024-01-02 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| WO2016141224A1 (en) | 2015-03-03 | 2016-09-09 | The General Hospital Corporation | Engineered crispr-cas9 nucleases with altered pam specificity |
| US9926545B2 (en) | 2015-03-03 | 2018-03-27 | The General Hospital Corporation | Engineered CRISPR-CAS9 nucleases with altered PAM specificity |
| US9944912B2 (en) | 2015-03-03 | 2018-04-17 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US12180520B2 (en) | 2015-03-03 | 2024-12-31 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US10479982B2 (en) | 2015-03-03 | 2019-11-19 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US10202589B2 (en) | 2015-03-03 | 2019-02-12 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| EP3858990A1 (en) | 2015-03-03 | 2021-08-04 | The General Hospital Corporation | Engineered crispr-cas9 nucleases with altered pam specificity |
| US10767168B2 (en) | 2015-03-03 | 2020-09-08 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US11220678B2 (en) | 2015-03-03 | 2022-01-11 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US10808233B2 (en) | 2015-03-03 | 2020-10-20 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US9752132B2 (en) | 2015-03-03 | 2017-09-05 | The General Hospital Corporation | Engineered CRISPR-CAS9 nucleases with altered PAM specificity |
| US10450576B2 (en) | 2015-03-27 | 2019-10-22 | E I Du Pont De Nemours And Company | Soybean U6 small nuclear RNA gene promoters and their use in constitutive expression of small RNA genes in plants |
| CN114231527A (zh) * | 2015-04-06 | 2022-03-25 | 里兰斯坦福初级大学理事会 | 用于crispr/cas介导的基因调控的化学修饰的引导rna |
| WO2016164356A1 (en) | 2015-04-06 | 2016-10-13 | The Board Of Trustees Of The Leland Stanford Junior University | Chemically modified guide rnas for crispr/cas-mediated gene regulation |
| US12110500B2 (en) | 2015-05-08 | 2024-10-08 | President And Fellows Of Harvard College | Universal donor stem cells and related methods |
| US12421493B2 (en) | 2015-05-08 | 2025-09-23 | President And Fellows Of Harvard College | Universal donor stem cells and related methods |
| US12497590B2 (en) | 2015-05-08 | 2025-12-16 | President And Fellows Of Harvard College | Universal donor stem cells and related methods |
| US12497610B2 (en) | 2015-05-08 | 2025-12-16 | The Broad Institute, Inc. | Functional genomics using CRISPR-CAS systems for saturating mutagenesis of non-coding elements, compositions, methods, libraries and applications thereof |
| US12031155B2 (en) | 2015-05-08 | 2024-07-09 | President And Fellows Of Harvard College | Universal donor stem cells and related methods |
| US12031154B2 (en) | 2015-05-08 | 2024-07-09 | President And Fellows Of Harvard College | Universal donor stem cells and related methods |
| WO2016182893A1 (en) | 2015-05-08 | 2016-11-17 | Teh Broad Institute Inc. | Functional genomics using crispr-cas systems for saturating mutagenesis of non-coding elements, compositions, methods, libraries and applications thereof |
| US11685917B2 (en) | 2015-05-08 | 2023-06-27 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems for saturating mutagenesis of non-coding elements, compositions, methods, libraries and applications thereof |
| US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
| US20160348074A1 (en) * | 2015-05-29 | 2016-12-01 | Agenovir Corporation | Methods and compositions for treating cells for transplant |
| US11549126B2 (en) | 2015-06-03 | 2023-01-10 | Board Of Regents Of The University Of Nebraska | Treatment methods using DNA editing with single-stranded DNA |
| US11555208B2 (en) | 2015-06-03 | 2023-01-17 | Board Of Regents Of The University Of Nebraska | DNA editing using relatively long single-stranded DNA and CRISPR/Cas9 to increase success rate in methods for preparing transgenic embryos and animals |
| WO2016196655A1 (en) | 2015-06-03 | 2016-12-08 | The Regents Of The University Of California | Cas9 variants and methods of use thereof |
| US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
| US11643669B2 (en) | 2015-06-17 | 2023-05-09 | Massachusetts Institute Of Technology | CRISPR mediated recording of cellular events |
| WO2016205728A1 (en) | 2015-06-17 | 2016-12-22 | Massachusetts Institute Of Technology | Crispr mediated recording of cellular events |
| US11060115B2 (en) | 2015-06-18 | 2021-07-13 | The Broad Institute, Inc. | CRISPR enzymes and systems |
| EP3502253A1 (en) | 2015-06-18 | 2019-06-26 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| WO2016205745A2 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Cell sorting |
| US11236327B2 (en) | 2015-06-18 | 2022-02-01 | The Broad Institute, Inc. | Cell sorting |
| WO2016205749A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| US11180751B2 (en) | 2015-06-18 | 2021-11-23 | The Broad Institute, Inc. | CRISPR enzymes and systems |
| EP3666895A1 (en) | 2015-06-18 | 2020-06-17 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
| EP4159856A1 (en) | 2015-06-18 | 2023-04-05 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
| US11421250B2 (en) | 2015-06-18 | 2022-08-23 | The Broad Institute, Inc. | CRISPR enzymes and systems |
| EP4403638A2 (en) | 2015-06-18 | 2024-07-24 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| US12168789B2 (en) | 2015-06-18 | 2024-12-17 | The Broad Institute, Inc. | Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation |
| WO2016205764A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| US11773412B2 (en) | 2015-06-18 | 2023-10-03 | The Broad Institute, Inc. | Crispr enzymes and systems |
| US11414657B2 (en) | 2015-06-29 | 2022-08-16 | Ionis Pharmaceuticals, Inc. | Modified CRISPR RNA and modified single CRISPR RNA and uses thereof |
| US11214800B2 (en) | 2015-08-18 | 2022-01-04 | The Broad Institute, Inc. | Methods and compositions for altering function and structure of chromatin loops and/or domains |
| EP4036236A1 (en) | 2015-08-28 | 2022-08-03 | The General Hospital Corporation | Engineered crispr-cas9 nucleases |
| US11060078B2 (en) | 2015-08-28 | 2021-07-13 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| WO2017040348A1 (en) | 2015-08-28 | 2017-03-09 | The General Hospital Corporation | Engineered crispr-cas9 nucleases |
| US10526591B2 (en) | 2015-08-28 | 2020-01-07 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US9512446B1 (en) | 2015-08-28 | 2016-12-06 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US10633642B2 (en) | 2015-08-28 | 2020-04-28 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US10093910B2 (en) | 2015-08-28 | 2018-10-09 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US9926546B2 (en) | 2015-08-28 | 2018-03-27 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
| US11932887B2 (en) | 2015-09-10 | 2024-03-19 | Yeda Research And Development Co. Ltd. | CYP76AD1-beta clade polynucleotides, polypeptides, and uses thereof |
| US10767201B2 (en) | 2015-09-10 | 2020-09-08 | Yeda Research And Development Co. Ltd. | CYP76AD1-beta clade polynucleotides, polypeptides, and uses thereof |
| US11028429B2 (en) | 2015-09-11 | 2021-06-08 | The General Hospital Corporation | Full interrogation of nuclease DSBs and sequencing (FIND-seq) |
| US11667911B2 (en) | 2015-09-24 | 2023-06-06 | Editas Medicine, Inc. | Use of exonucleases to improve CRISPR/CAS-mediated genome editing |
| US11492646B2 (en) | 2015-09-25 | 2022-11-08 | The Board Of Trustees Of The Leland Stanford Junior University | Nuclease-mediated genome editing of primary cells |
| US11634732B2 (en) | 2015-09-25 | 2023-04-25 | The Board Of Trustees Of The Leland Stanford Junior University | Pharmaceutical compositions comprising gene-corrected primary cells |
| US10738303B2 (en) | 2015-09-30 | 2020-08-11 | The General Hospital Corporation | Comprehensive in vitro reporting of cleavage events by sequencing (CIRCLE-seq) |
| WO2017069958A2 (en) | 2015-10-09 | 2017-04-27 | The Brigham And Women's Hospital, Inc. | Modulation of novel immune checkpoint targets |
| WO2017070605A1 (en) | 2015-10-22 | 2017-04-27 | The Broad Institute Inc. | Type vi-b crispr enzymes and systems |
| US12234454B2 (en) | 2015-10-22 | 2025-02-25 | The Broad Institute, Inc. | Crispr enzymes and systems |
| US12215318B2 (en) | 2015-10-22 | 2025-02-04 | The Broad Institute, Inc. | Crispr enzymes and systems |
| US12344869B2 (en) | 2015-10-23 | 2025-07-01 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US12043852B2 (en) | 2015-10-23 | 2024-07-23 | President And Fellows Of Harvard College | Evolved Cas9 proteins for gene editing |
| WO2017074788A1 (en) | 2015-10-27 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for targeting cancer-specific sequence variations |
| WO2017075478A2 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by use of immune cell gene signatures |
| WO2017075465A1 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting gata3 |
| WO2017075294A1 (en) | 2015-10-28 | 2017-05-04 | The Board Institute Inc. | Assays for massively combinatorial perturbation profiling and cellular circuit reconstruction |
| WO2017075451A1 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting pou2af1 |
| US11092607B2 (en) | 2015-10-28 | 2021-08-17 | The Board Institute, Inc. | Multiplex analysis of single cell constituents |
| US11180730B2 (en) | 2015-10-28 | 2021-11-23 | The Broad Institute, Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting GATA3 |
| US11186825B2 (en) | 2015-10-28 | 2021-11-30 | The Broad Institute, Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting POU2AF1 |
| WO2017083852A1 (en) | 2015-11-13 | 2017-05-18 | MOORE, Tara | Methods for the treatment of corneal dystrophies |
| EP4036228A1 (en) | 2015-11-13 | 2022-08-03 | Avellino Lab USA, Inc. | Methods for the treatment of corneal dystrophies |
| US11987809B2 (en) | 2015-11-13 | 2024-05-21 | Avellino Lab Usa, Inc. | Methods for the treatment of corneal dystrophies |
| WO2017087708A1 (en) | 2015-11-19 | 2017-05-26 | The Brigham And Women's Hospital, Inc. | Lymphocyte antigen cd5-like (cd5l)-interleukin 12b (p40) heterodimers in immunity |
| US11001622B2 (en) | 2015-11-19 | 2021-05-11 | The Brigham And Women's Hospital, Inc. | Method of treating autoimmune disease with lymphocyte antigen CD5-like (CD5L) protein |
| US11884717B2 (en) | 2015-11-19 | 2024-01-30 | The Brigham And Women's Hospital, Inc. | Method of treating autoimmune disease with lymphocyte antigen CD5-like (CD5L) protein |
| US10041079B2 (en) | 2015-11-30 | 2018-08-07 | Synthetic Genomics, Inc. | Compositions and methods for expressing genes in algae |
| WO2017095960A1 (en) * | 2015-11-30 | 2017-06-08 | Synthetic Genomics, Inc. | Compositions and methods for expressing genes in algae |
| WO2017106657A1 (en) | 2015-12-18 | 2017-06-22 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| EP4219689A2 (en) | 2015-12-30 | 2023-08-02 | Novartis AG | Immune effector cell therapies with enhanced efficacy |
| WO2017114497A1 (en) | 2015-12-30 | 2017-07-06 | Novartis Ag | Immune effector cell therapies with enhanced efficacy |
| WO2017143071A1 (en) | 2016-02-18 | 2017-08-24 | The Regents Of The University Of California | Methods and compositions for gene editing in stem cells |
| WO2017147196A1 (en) | 2016-02-22 | 2017-08-31 | Massachusetts Institute Of Technology | Methods for identifying and modulating immune phenotypes |
| US12037601B2 (en) | 2016-03-04 | 2024-07-16 | Indoor Biotechnologies Inc. | Method of inactivating a FEL D1 gene using crispr |
| WO2017161043A1 (en) | 2016-03-16 | 2017-09-21 | The J. David Gladstone Institutes | Methods and compositions for treating obesity and/or diabetes and for identifying candidate treatment agents |
| US11427861B2 (en) | 2016-03-17 | 2022-08-30 | Massachusetts Institute Of Technology | Methods for identifying and modulating co-occurant cellular phenotypes |
| WO2017161325A1 (en) | 2016-03-17 | 2017-09-21 | Massachusetts Institute Of Technology | Methods for identifying and modulating co-occurant cellular phenotypes |
| WO2017161068A1 (en) * | 2016-03-18 | 2017-09-21 | President And Fellows Of Harvard College | Mutant cas proteins |
| US11597924B2 (en) | 2016-03-25 | 2023-03-07 | Editas Medicine, Inc. | Genome editing systems comprising repair-modulating enzyme molecules and methods of their use |
| US12049651B2 (en) | 2016-04-13 | 2024-07-30 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| US11236313B2 (en) | 2016-04-13 | 2022-02-01 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
| WO2017184768A1 (en) | 2016-04-19 | 2017-10-26 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| WO2017189308A1 (en) | 2016-04-19 | 2017-11-02 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| WO2017184786A1 (en) | 2016-04-19 | 2017-10-26 | The Broad Institute Inc. | Cpf1 complexes with reduced indel activity |
| US11788083B2 (en) | 2016-06-17 | 2023-10-17 | The Broad Institute, Inc. | Type VI CRISPR orthologs and systems |
| WO2017219027A1 (en) | 2016-06-17 | 2017-12-21 | The Broad Institute Inc. | Type vi crispr orthologs and systems |
| US12031150B2 (en) | 2016-07-13 | 2024-07-09 | Vertex Pharmaceuticals Incorporated | Methods, compositions and kits for increasing genome editing efficiency |
| WO2018013840A1 (en) | 2016-07-13 | 2018-01-18 | Vertex Pharmaceuticals Incorporated | Methods, compositions and kits for increasing genome editing efficiency |
| EP4219462A1 (en) | 2016-07-13 | 2023-08-02 | Vertex Pharmaceuticals Incorporated | Methods, compositions and kits for increasing genome editing efficiency |
| US11999947B2 (en) | 2016-08-03 | 2024-06-04 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| WO2018035388A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
| US12305204B2 (en) | 2016-08-17 | 2025-05-20 | The Broad Institute, Inc. | CRISPR enzymes and systems |
| EP4485466A2 (en) | 2016-08-17 | 2025-01-01 | The Broad Institute Inc. | Novel crispr enzymes and systems |
| WO2018035364A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute Inc. | Product and methods useful for modulating and evaluating immune responses |
| WO2018035250A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute, Inc. | Methods for identifying class 2 crispr-cas systems |
| WO2018035387A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
| US12431216B2 (en) | 2016-08-17 | 2025-09-30 | Broad Institute, Inc. | Methods for identifying class 2 crispr-cas systems |
| US11630103B2 (en) | 2016-08-17 | 2023-04-18 | The Broad Institute, Inc. | Product and methods useful for modulating and evaluating immune responses |
| US11352647B2 (en) | 2016-08-17 | 2022-06-07 | The Broad Institute, Inc. | Crispr enzymes and systems |
| WO2018039145A1 (en) | 2016-08-20 | 2018-03-01 | Avellino Lab Usa, Inc. | Single guide rna, crispr/cas9 systems, and methods of use thereof |
| US12084663B2 (en) | 2016-08-24 | 2024-09-10 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| WO2018049025A2 (en) | 2016-09-07 | 2018-03-15 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses |
| EP4431607A2 (en) | 2016-09-09 | 2024-09-18 | The Board of Trustees of the Leland Stanford Junior University | High-throughput precision genome editing |
| WO2018049168A1 (en) | 2016-09-09 | 2018-03-15 | The Board Of Trustees Of The Leland Stanford Junior University | High-throughput precision genome editing |
| US11104910B2 (en) | 2016-09-11 | 2021-08-31 | Yeda Research And Development Co. Ltd. | Compositions and methods for regulating gene expression for targeted mutagenesis |
| WO2018047183A1 (en) | 2016-09-11 | 2018-03-15 | Yeda Research And Development Co. Ltd. | Compositions and methods for regulating gene expression for targeted mutagenesis |
| US12499971B2 (en) | 2016-09-28 | 2025-12-16 | The Broad Institute, Inc. | Systematic screening and mapping of regulatory elements in non-coding genomic regions, methods, compositions, and applications thereof |
| WO2018064371A1 (en) | 2016-09-30 | 2018-04-05 | The Regents Of The University Of California | Rna-guided nucleic acid modifying enzymes and methods of use thereof |
| US10669539B2 (en) | 2016-10-06 | 2020-06-02 | Pioneer Biolabs, Llc | Methods and compositions for generating CRISPR guide RNA libraries |
| WO2018067991A1 (en) | 2016-10-07 | 2018-04-12 | The Brigham And Women's Hospital, Inc. | Modulation of novel immune checkpoint targets |
| US12447213B2 (en) | 2016-10-07 | 2025-10-21 | The Broad Institute, Inc. | Modulation of novel immune checkpoint targets |
| US20220213507A1 (en) * | 2016-10-14 | 2022-07-07 | President And Fellows Of Harvard College | Aav delivery of nucleobase editors |
| WO2018083606A1 (en) | 2016-11-01 | 2018-05-11 | Novartis Ag | Methods and compositions for enhancing gene editing |
| US12227578B2 (en) | 2016-11-11 | 2025-02-18 | The Broad Institute, Inc. | Modulation of intestinal epithelial cell differentiation, maintenance and/or function through T cell action |
| US12404514B2 (en) | 2016-12-09 | 2025-09-02 | The Broad Institute, Inc. | CRISPR-systems for modifying a trait of interest in a plant |
| US10975388B2 (en) | 2016-12-14 | 2021-04-13 | Ligandal, Inc. | Methods and compositions for nucleic acid and protein payload delivery |
| WO2018112278A1 (en) | 2016-12-14 | 2018-06-21 | Ligandal, Inc. | Methods and compositions for nucleic acid and protein payload delivery |
| US12123012B2 (en) | 2016-12-14 | 2024-10-22 | Ligandal, Inc. | Methods and compositions for nucleic acid and protein payload delivery |
| US12286727B2 (en) | 2016-12-19 | 2025-04-29 | Editas Medicine, Inc. | Assessing nuclease cleavage |
| US12110545B2 (en) | 2017-01-06 | 2024-10-08 | Editas Medicine, Inc. | Methods of assessing nuclease cleavage |
| WO2018129544A1 (en) | 2017-01-09 | 2018-07-12 | Whitehead Institute For Biomedical Research | Methods of altering gene expression by perturbing transcription factor multimers that structure regulatory loops |
| EP4249501A2 (en) | 2017-01-09 | 2023-09-27 | Whitehead Institute for Biomedical Research | Methods of altering gene expression by perturbing transcription factor multimers that structure regulatory loops |
| US11466271B2 (en) | 2017-02-06 | 2022-10-11 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| US12435331B2 (en) | 2017-03-10 | 2025-10-07 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| EP4361261A2 (en) | 2017-03-15 | 2024-05-01 | The Broad Institute Inc. | Novel cas13b orthologues crispr enzymes and systems |
| US11739308B2 (en) | 2017-03-15 | 2023-08-29 | The Broad Institute, Inc. | Cas13b orthologues CRISPR enzymes and systems |
| WO2018170333A1 (en) | 2017-03-15 | 2018-09-20 | The Broad Institute, Inc. | Novel cas13b orthologues crispr enzymes and systems |
| US12180546B2 (en) | 2017-03-17 | 2024-12-31 | Massachusetts Institute Of Technology | Methods for identifying and modulating co-occurant cellular phenotypes |
| WO2018170515A1 (en) | 2017-03-17 | 2018-09-20 | The Broad Institute, Inc. | Methods for identifying and modulating co-occurant cellular phenotypes |
| US12161694B2 (en) | 2017-03-24 | 2024-12-10 | The Broad Institute, Inc. | Methods and compositions for regulating innate lymphoid cell inflammatory responses |
| US11963966B2 (en) | 2017-03-31 | 2024-04-23 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for treating ovarian tumors |
| US11913075B2 (en) | 2017-04-01 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer |
| US11840711B2 (en) | 2017-04-12 | 2023-12-12 | The Broad Institute, Inc. | Type VI CRISPR orthologs and systems |
| WO2018191388A1 (en) | 2017-04-12 | 2018-10-18 | The Broad Institute, Inc. | Novel type vi crispr orthologs and systems |
| WO2018191520A1 (en) | 2017-04-12 | 2018-10-18 | The Broad Institute, Inc. | Respiratory and sweat gland ionocytes |
| US12331319B2 (en) | 2017-04-12 | 2025-06-17 | The Broad Institute, Inc. | Respiratory and sweat gland ionocytes |
| WO2018191553A1 (en) | 2017-04-12 | 2018-10-18 | Massachusetts Eye And Ear Infirmary | Tumor signature for metastasis, compositions of matter methods of use thereof |
| WO2018191750A2 (en) | 2017-04-14 | 2018-10-18 | The Broad Institute Inc. | Novel delivery of large payloads |
| US12350368B2 (en) | 2017-04-14 | 2025-07-08 | The Broad Institute, Inc. | Delivery of large payloads |
| WO2018195019A1 (en) | 2017-04-18 | 2018-10-25 | The Broad Institute Inc. | Compositions for detecting secretion and methods of use |
| EP4481049A2 (en) | 2017-04-21 | 2024-12-25 | The General Hospital Corporation | Variants of cpf1 (cas12a) with altered pam specificity |
| WO2018195545A2 (en) | 2017-04-21 | 2018-10-25 | The General Hospital Corporation | Variants of cpf1 (cas12a) with altered pam specificity |
| WO2018195486A1 (en) | 2017-04-21 | 2018-10-25 | The Broad Institute, Inc. | Targeted delivery to beta cells |
| US11499151B2 (en) | 2017-04-28 | 2022-11-15 | Editas Medicine, Inc. | Methods and systems for analyzing guide RNA molecules |
| US11591601B2 (en) | 2017-05-05 | 2023-02-28 | The Broad Institute, Inc. | Methods for identification and modification of lncRNA associated with target genotypes and phenotypes |
| US12226479B2 (en) | 2017-05-11 | 2025-02-18 | The General Hospital Corporation | Methods and compositions of use of CD8+ tumor infiltrating lymphocyte subtypes and gene signatures thereof |
| US12297436B2 (en) | 2017-05-18 | 2025-05-13 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
| US11866697B2 (en) | 2017-05-18 | 2024-01-09 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
| WO2018218206A1 (en) | 2017-05-25 | 2018-11-29 | The General Hospital Corporation | Bipartite base editor (bbe) architectures and type-ii-c-cas9 zinc finger editing |
| WO2018218166A1 (en) | 2017-05-25 | 2018-11-29 | The General Hospital Corporation | Using split deaminases to limit unwanted off-target base editor deamination |
| WO2018217981A1 (en) | 2017-05-26 | 2018-11-29 | North Carolina State University | Altered guide rnas for modulating cas9 activity and methods of use |
| US20200263186A1 (en) * | 2017-05-26 | 2020-08-20 | North Carolina State University | Altered guide rnas for modulating cas9 activity and methods of use |
| EP3630975B1 (en) * | 2017-05-26 | 2025-11-19 | North Carolina State University | Altered guide rnas for modulating cas9 activity and methods of use |
| US20200190508A1 (en) * | 2017-06-07 | 2020-06-18 | Arc Bio, Llc | Creation and use of guide nucleic acids |
| US12297466B2 (en) | 2017-06-09 | 2025-05-13 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US10428319B2 (en) | 2017-06-09 | 2019-10-01 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US11098297B2 (en) | 2017-06-09 | 2021-08-24 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
| US11897953B2 (en) | 2017-06-14 | 2024-02-13 | The Broad Institute, Inc. | Compositions and methods targeting complement component 3 for inhibiting tumor growth |
| WO2019005884A1 (en) | 2017-06-26 | 2019-01-03 | The Broad Institute, Inc. | CRISPR / CAS-ADENINE DEAMINASE COMPOSITIONS, SYSTEMS AND METHODS FOR TARGETED NUCLEIC ACID EDITION |
| WO2019003193A1 (en) | 2017-06-30 | 2019-01-03 | Novartis Ag | METHODS FOR TREATING DISEASES USING GENE EDITING SYSTEMS |
| US12049643B2 (en) | 2017-07-14 | 2024-07-30 | The Broad Institute, Inc. | Methods and compositions for modulating cytotoxic lymphocyte activity |
| US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
| WO2019018440A1 (en) | 2017-07-17 | 2019-01-24 | The Broad Institute, Inc. | HUMAN COLON CELL ATLAS IN GOOD HEALTH AND WITH HEMORRHAGIC RECTO-COLITIS |
| US12105089B2 (en) | 2017-07-17 | 2024-10-01 | The Broad Institute, Inc. | Cell atlas of the healthy and ulcerative colitis human colon |
| US12239646B2 (en) | 2017-07-19 | 2025-03-04 | Dana-Farber Cancer Institute, Inc. | Cancer diagnostic and treatment |
| US12359218B2 (en) | 2017-07-28 | 2025-07-15 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US11624058B2 (en) | 2017-08-23 | 2023-04-11 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US11286468B2 (en) | 2017-08-23 | 2022-03-29 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| US12241096B2 (en) | 2017-08-23 | 2025-03-04 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
| WO2019051419A1 (en) * | 2017-09-08 | 2019-03-14 | University Of North Texas Health Science Center | Engineered cas9 variants |
| US11713452B2 (en) | 2017-09-08 | 2023-08-01 | University Of North Texas Health Science Center | Engineered CAS9 variants |
| WO2019060746A1 (en) | 2017-09-21 | 2019-03-28 | The Broad Institute, Inc. | SYSTEMS, METHODS, AND COMPOSITIONS FOR THE TARGETED EDITING OF NUCLEIC ACIDS |
| WO2019070755A1 (en) | 2017-10-02 | 2019-04-11 | The Broad Institute, Inc. | METHODS AND COMPOSITIONS FOR DETECTING AND MODULATING A GENETIC SIGNATURE OF IMMUNOTHERAPY RESISTANCE IN CANCER |
| US12043870B2 (en) | 2017-10-02 | 2024-07-23 | The Broad Institute, Inc. | Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer |
| WO2019071054A1 (en) | 2017-10-04 | 2019-04-11 | The Broad Institute, Inc. | METHODS AND COMPOSITIONS FOR MODIFYING THE FUNCTION AND STRUCTURE OF BUCKLES AND / OR CHROMATIN DOMAINS |
| US11725228B2 (en) | 2017-10-11 | 2023-08-15 | The General Hospital Corporation | Methods for detecting site-specific and spurious genomic deamination induced by base editing technologies |
| US11680296B2 (en) | 2017-10-16 | 2023-06-20 | Massachusetts Institute Of Technology | Mycobacterium tuberculosis host-pathogen interaction |
| US12227742B2 (en) | 2017-10-23 | 2025-02-18 | The Broad Institute, Inc. | Nucleic acid modifiers |
| US11547614B2 (en) | 2017-10-31 | 2023-01-10 | The Broad Institute, Inc. | Methods and compositions for studying cell evolution |
| US12433803B2 (en) | 2017-10-31 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for studying cell evolution |
| WO2019087113A1 (en) | 2017-11-01 | 2019-05-09 | Novartis Ag | Synthetic rnas and methods of use |
| US12171783B2 (en) | 2017-11-13 | 2024-12-24 | The Broad Institute, Inc. | Methods and compositions for targeting developmental and oncogenic programs in H3K27M gliomas |
| US12221720B2 (en) | 2017-11-13 | 2025-02-11 | The Broad Institute, Inc. | Methods for determining spatial and temporal gene expression dynamics during adult neurogenesis in single cells |
| WO2019094983A1 (en) | 2017-11-13 | 2019-05-16 | The Broad Institute, Inc. | Methods and compositions for treating cancer by targeting the clec2d-klrb1 pathway |
| WO2019099943A1 (en) | 2017-11-16 | 2019-05-23 | Astrazeneca Ab | Compositions and methods for improving the efficacy of cas9-based knock-in strategies |
| US11332736B2 (en) | 2017-12-07 | 2022-05-17 | The Broad Institute, Inc. | Methods and compositions for multiplexing single cell and single nuclei sequencing |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| WO2019126709A1 (en) | 2017-12-22 | 2019-06-27 | The Broad Institute, Inc. | Cas12b systems, methods, and compositions for targeted dna base editing |
| US11994512B2 (en) | 2018-01-04 | 2024-05-28 | Massachusetts Institute Of Technology | Single-cell genomic methods to generate ex vivo cell systems that recapitulate in vivo biology with improved fidelity |
| WO2019143677A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Quinoxalinone compounds, compositions, methods, and kits for increasing genome editing efficiency |
| US12269804B2 (en) | 2018-01-17 | 2025-04-08 | Vertex Pharmaceuticals Incorporated | Quinoxalinone compounds, compositions, methods, and kits for increasing genome editing efficiency |
| WO2019143678A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Dna-pk inhibitors |
| US12121524B2 (en) | 2018-01-17 | 2024-10-22 | Vertex Pharmaceuticals Incorporated | DNA-PK inhibitors |
| US12005127B2 (en) | 2018-01-17 | 2024-06-11 | Vertex Pharmaceuticals Incorporated | DNA-PK inhibitors |
| WO2019143675A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Dna-pk inhibitors |
| US12084676B2 (en) | 2018-02-23 | 2024-09-10 | Pioneer Hi-Bred International, Inc. | Cas9 orthologs |
| US11976324B2 (en) | 2018-04-17 | 2024-05-07 | The General Hospital Corporation | Highly sensitive in vitro assays to define substrate preferences and sites of nucleic-acid binding, modifying, and cleaving agents |
| US11898203B2 (en) | 2018-04-17 | 2024-02-13 | The General Hospital Corporation | Highly sensitive in vitro assays to define substrate preferences and sites of nucleic-acid binding, modifying, and cleaving agents |
| US11845987B2 (en) | 2018-04-17 | 2023-12-19 | The General Hospital Corporation | Highly sensitive in vitro assays to define substrate preferences and sites of nucleic acid cleaving agents |
| WO2019204585A1 (en) | 2018-04-19 | 2019-10-24 | Massachusetts Institute Of Technology | Single-stranded break detection in double-stranded dna |
| US12180490B2 (en) | 2018-04-24 | 2024-12-31 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
| EP3560330A1 (en) | 2018-04-24 | 2019-10-30 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
| WO2019206927A1 (en) | 2018-04-24 | 2019-10-31 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
| US11957695B2 (en) | 2018-04-26 | 2024-04-16 | The Broad Institute, Inc. | Methods and compositions targeting glucocorticoid signaling for modulating immune responses |
| WO2019210268A2 (en) | 2018-04-27 | 2019-10-31 | The Broad Institute, Inc. | Sequencing-based proteomics |
| WO2019213660A2 (en) | 2018-05-04 | 2019-11-07 | The Broad Institute, Inc. | Compositions and methods for modulating cgrp signaling to regulate innate lymphoid cell inflammatory responses |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| WO2019232542A2 (en) | 2018-06-01 | 2019-12-05 | Massachusetts Institute Of Technology | Methods and compositions for detecting and modulating microenvironment gene signatures from the csf of metastasis patients |
| US12036240B2 (en) | 2018-06-14 | 2024-07-16 | The Broad Institute, Inc. | Compositions and methods targeting complement component 3 for inhibiting tumor growth |
| WO2020006049A1 (en) | 2018-06-26 | 2020-01-02 | The Broad Institute, Inc. | Crispr/cas and transposase based amplification compositions, systems and methods |
| WO2020006036A1 (en) | 2018-06-26 | 2020-01-02 | Massachusetts Institute Of Technology | Crispr effector system based amplification methods, systems, and diagnostics |
| US12338436B2 (en) | 2018-06-29 | 2025-06-24 | Editas Medicine, Inc. | Synthetic guide molecules, compositions and methods relating thereto |
| WO2020014528A1 (en) | 2018-07-13 | 2020-01-16 | The Regents Of The University Of California | Retrotransposon-based delivery vehicle and methods of use thereof |
| WO2020028555A2 (en) | 2018-07-31 | 2020-02-06 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
| WO2020033601A1 (en) | 2018-08-07 | 2020-02-13 | The Broad Institute, Inc. | Novel cas12b enzymes and systems |
| WO2020041380A1 (en) | 2018-08-20 | 2020-02-27 | The Broad Institute, Inc. | Methods and compositions for optochemical control of crispr-cas9 |
| US12421507B2 (en) | 2018-08-20 | 2025-09-23 | The Broad Institute, Inc. | Methods and compositions for optochemical control of CRISPR-CAS9 |
| WO2020041387A1 (en) | 2018-08-20 | 2020-02-27 | The Brigham And Women's Hospital, Inc. | Degradation domain modifications for spatio-temporal control of rna-guided nucleases |
| WO2020041456A1 (en) | 2018-08-22 | 2020-02-27 | The Regents Of The University Of California | Variant type v crispr/cas effector polypeptides and methods of use thereof |
| WO2020051507A1 (en) | 2018-09-06 | 2020-03-12 | The Broad Institute, Inc. | Nucleic acid assemblies for use in targeted delivery |
| WO2020049158A1 (en) | 2018-09-07 | 2020-03-12 | Astrazeneca Ab | Compositions and methods for improved nucleases |
| US11447527B2 (en) | 2018-09-18 | 2022-09-20 | Vnv Newco Inc. | Endogenous Gag-based capsids and uses thereof |
| US11505578B2 (en) | 2018-09-18 | 2022-11-22 | Vnv Newco Inc. | Endogenous Gag-based capsids and uses thereof |
| WO2020061591A1 (en) | 2018-09-21 | 2020-03-26 | President And Fellows Of Harvard College | Methods and compositions for treating diabetes, and methods for enriching mrna coding for secreted proteins |
| WO2020077236A1 (en) | 2018-10-12 | 2020-04-16 | The Broad Institute, Inc. | Method for extracting nuclei or whole cells from formalin-fixed paraffin-embedded tissues |
| WO2020081730A2 (en) | 2018-10-16 | 2020-04-23 | Massachusetts Institute Of Technology | Methods and compositions for modulating microenvironment |
| WO2020081808A1 (en) * | 2018-10-18 | 2020-04-23 | Chan Zuckerberg Biohub, Inc. | Methods and compositions involving thermostable cas9 protein variants |
| US11407995B1 (en) | 2018-10-26 | 2022-08-09 | Inari Agriculture Technology, Inc. | RNA-guided nucleases and DNA binding proteins |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12071641B2 (en) | 2018-11-02 | 2024-08-27 | Inari Agriculture Technology, Inc. | RNA-guided nucleases and DNA binding proteins |
| US11434477B1 (en) | 2018-11-02 | 2022-09-06 | Inari Agriculture Technology, Inc. | RNA-guided nucleases and DNA binding proteins |
| EP3877517A1 (en) | 2018-11-09 | 2021-09-15 | Inari Agriculture, Inc. | Rna-guided nucleases and dna binding proteins |
| US12165743B2 (en) | 2018-11-09 | 2024-12-10 | The Broad Institute, Inc. | Compressed sensing for screening and tissue imaging |
| US12402610B2 (en) | 2018-11-09 | 2025-09-02 | The Broad Institute, Inc. | Methods and compositions for modulating innate lymphoid cell pathogenic effectors |
| US12460189B2 (en) | 2018-11-09 | 2025-11-04 | Inari Agriculture Technology, Inc. | RNA-guided nucleases and DNA binding proteins |
| US12365888B2 (en) | 2018-12-14 | 2025-07-22 | Pioneer Hi-Bred International, Inc. | CRISPR-Cas systems for genome editing |
| US11807878B2 (en) | 2018-12-14 | 2023-11-07 | Pioneer Hi-Bred International, Inc. | CRISPR-Cas systems for genome editing |
| US10934536B2 (en) | 2018-12-14 | 2021-03-02 | Pioneer Hi-Bred International, Inc. | CRISPR-CAS systems for genome editing |
| US12215364B2 (en) | 2018-12-14 | 2025-02-04 | Pioneer Hi-Bred International, Inc. | CRISPR-cas systems for genome editing |
| WO2020131862A1 (en) | 2018-12-17 | 2020-06-25 | The Broad Institute, Inc. | Crispr-associated transposase systems and methods of use thereof |
| WO2020131586A2 (en) | 2018-12-17 | 2020-06-25 | The Broad Institute, Inc. | Methods for identifying neoantigens |
| US11384344B2 (en) | 2018-12-17 | 2022-07-12 | The Broad Institute, Inc. | CRISPR-associated transposase systems and methods of use thereof |
| US12264323B2 (en) | 2018-12-17 | 2025-04-01 | The Broad Institute, Inc. | CRISPR CPF1 direct repeat variants |
| US20230272398A1 (en) * | 2018-12-27 | 2023-08-31 | LifeEDIT Therapeutics, Inc. | Polypeptides useful for gene editing and methods of use |
| US12188018B2 (en) * | 2018-12-27 | 2025-01-07 | Life Edit Therapeutics, Inc. | Polypeptides useful for gene editing and methods of use |
| US11739156B2 (en) | 2019-01-06 | 2023-08-29 | The Broad Institute, Inc. Massachusetts Institute of Technology | Methods and compositions for overcoming immunosuppression |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| WO2020163396A1 (en) | 2019-02-04 | 2020-08-13 | The General Hospital Corporation | Adenine dna base editor variants with reduced off-target rna editing |
| WO2020163856A1 (en) | 2019-02-10 | 2020-08-13 | The J. David Gladstone Institutes, A Testamentary Trust Established Under The Will Of J. David Gladstone | Modified mitochondrion and methods of use thereof |
| US12024727B2 (en) | 2019-02-14 | 2024-07-02 | Metagenomi, Inc. | Enzymes with RuvC domains |
| CN113728097A (zh) * | 2019-02-14 | 2021-11-30 | 宏基因组学知识产权技术有限责任公司 | 具有ruvc结构域的酶 |
| CN113728098A (zh) * | 2019-02-14 | 2021-11-30 | 宏基因组学知识产权技术有限责任公司 | 具有ruvc结构域的酶 |
| EP4219700A1 (en) | 2019-03-07 | 2023-08-02 | The Regents of the University of California | Crispr-cas effector polypeptides and methods of use thereof |
| DE212020000516U1 (de) | 2019-03-07 | 2022-01-17 | The Regents of the University of California | CRISPR-CAS-Effektorpolypeptide |
| US12281303B2 (en) | 2019-03-19 | 2025-04-22 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| WO2020206036A1 (en) | 2019-04-01 | 2020-10-08 | The Broad Institute, Inc. | Novel nucleic acid modifier |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| WO2020225754A1 (en) | 2019-05-06 | 2020-11-12 | Mcmullen Tara | Crispr gene editing for autosomal dominant diseases |
| WO2020229533A1 (en) | 2019-05-13 | 2020-11-19 | KWS SAAT SE & Co. KGaA | Drought tolerance in corn |
| WO2020236972A2 (en) | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Non-class i multi-component nucleic acid targeting systems |
| WO2020236967A1 (en) | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Random crispr-cas deletion mutant |
| WO2020239680A2 (en) | 2019-05-25 | 2020-12-03 | KWS SAAT SE & Co. KGaA | Haploid induction enhancer |
| WO2020243661A1 (en) | 2019-05-31 | 2020-12-03 | The Broad Institute, Inc. | Methods for treating metabolic disorders by targeting adcy5 |
| EP3772542A1 (en) | 2019-08-07 | 2021-02-10 | KWS SAAT SE & Co. KGaA | Modifying genetic variation in crops by modulating the pachytene checkpoint protein 2 |
| WO2021041922A1 (en) | 2019-08-30 | 2021-03-04 | The Broad Institute, Inc. | Crispr-associated mu transposase systems |
| WO2021055874A1 (en) | 2019-09-20 | 2021-03-25 | The Broad Institute, Inc. | Novel type vi crispr enzymes and systems |
| US11981922B2 (en) | 2019-10-03 | 2024-05-14 | Dana-Farber Cancer Institute, Inc. | Methods and compositions for the modulation of cell interactions and signaling in the tumor microenvironment |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| WO2021074367A1 (en) | 2019-10-17 | 2021-04-22 | KWS SAAT SE & Co. KGaA | Enhanced disease resistance of crops by downregulation of repressor genes |
| WO2021130752A1 (en) | 2019-12-22 | 2021-07-01 | Yeda Research And Development Co. Ltd. | Systems and methods for identifying cells that have undergone genome editing |
| WO2021150919A1 (en) | 2020-01-23 | 2021-07-29 | The Children's Medical Center Corporation | Stroma-free t cell differentiation from human pluripotent stem cells |
| US12312613B2 (en) | 2020-01-24 | 2025-05-27 | The General Hospital Corporation | Unconstrained genome targeting with near-PAMless engineered CRISPR-Cas9 variants |
| US12264341B2 (en) | 2020-01-24 | 2025-04-01 | The General Hospital Corporation | CRISPR-Cas enzymes with enhanced on-target activity |
| US11946039B2 (en) | 2020-03-31 | 2024-04-02 | Metagenomi, Inc. | Class II, type II CRISPR systems |
| WO2021202938A1 (en) | 2020-04-03 | 2021-10-07 | Creyon Bio, Inc. | Oligonucleotide-based machine learning |
| US12400739B2 (en) | 2020-04-03 | 2025-08-26 | Creyon Bio, Inc. | Oligonucleotide-based machine learning |
| US12057197B2 (en) | 2020-04-03 | 2024-08-06 | Creyon Bio, Inc. | Oligonucleotide-based machine learning |
| WO2021216622A1 (en) | 2020-04-21 | 2021-10-28 | Aspen Neuroscience, Inc. | Gene editing of gba1 in stem cells and method of use of cells differentiated therefrom |
| WO2021216623A1 (en) | 2020-04-21 | 2021-10-28 | Aspen Neuroscience, Inc. | Gene editing of lrrk2 in stem cells and method of use of cells differentiated therefrom |
| US20230220374A1 (en) * | 2020-05-08 | 2023-07-13 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US11912985B2 (en) * | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| WO2021239986A1 (en) | 2020-05-29 | 2021-12-02 | KWS SAAT SE & Co. KGaA | Plant haploid induction |
| WO2023279118A3 (en) * | 2021-07-02 | 2023-02-23 | University Of Maryland, College Park | Cytidine deaminases and methods of genome editing using the same |
| WO2023006933A1 (en) | 2021-07-30 | 2023-02-02 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
| US12435323B2 (en) | 2021-08-27 | 2025-10-07 | Metagenomi, Inc. | Enzymes with RUVC domains |
| US20240076638A1 (en) * | 2021-09-08 | 2024-03-07 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US20240002886A1 (en) * | 2021-09-08 | 2024-01-04 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US20240026324A1 (en) * | 2021-09-08 | 2024-01-25 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12123034B2 (en) * | 2021-09-08 | 2024-10-22 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12024728B2 (en) * | 2021-09-08 | 2024-07-02 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12037617B2 (en) * | 2021-09-08 | 2024-07-16 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12031162B2 (en) * | 2021-09-08 | 2024-07-09 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US20240002822A1 (en) * | 2021-09-08 | 2024-01-04 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US11884915B2 (en) | 2021-09-10 | 2024-01-30 | Agilent Technologies, Inc. | Guide RNAs with chemical modification for prime editing |
| WO2023044100A1 (en) | 2021-09-20 | 2023-03-23 | Revivicor, Inc. | Multitran scenic pigs comprising ten genetic modifications for xenotransplantation |
| US12385025B2 (en) | 2021-09-28 | 2025-08-12 | Acrigen Biosciences | Compositions and methods for nucleic acid modifications |
| EP4596697A2 (en) | 2021-09-28 | 2025-08-06 | Acrigen Biosciences | Compositions and methods for nucleic acid modifications |
| EP4596696A2 (en) | 2021-09-28 | 2025-08-06 | Acrigen Biosciences | Compositions and methods for nucleic acid modifications |
| WO2023052508A2 (en) | 2021-09-30 | 2023-04-06 | Astrazeneca Ab | Use of inhibitors to increase efficiency of crispr/cas insertions |
| WO2023081756A1 (en) | 2021-11-03 | 2023-05-11 | The J. David Gladstone Institutes, A Testamentary Trust Established Under The Will Of J. David Gladstone | Precise genome editing using retrons |
| US12410449B2 (en) | 2021-11-24 | 2025-09-09 | Metagenomi, Inc. | Endonuclease systems |
| WO2023093862A1 (en) | 2021-11-26 | 2023-06-01 | Epigenic Therapeutics Inc. | Method of modulating pcsk9 and uses thereof |
| EP4198124A1 (en) | 2021-12-15 | 2023-06-21 | Versitech Limited | Engineered cas9-nucleases and method of use thereof |
| WO2023115041A1 (en) | 2021-12-17 | 2023-06-22 | Sana Biotechnology, Inc. | Modified paramyxoviridae attachment glycoproteins |
| WO2023115039A2 (en) | 2021-12-17 | 2023-06-22 | Sana Biotechnology, Inc. | Modified paramyxoviridae fusion glycoproteins |
| WO2023133595A2 (en) | 2022-01-10 | 2023-07-13 | Sana Biotechnology, Inc. | Methods of ex vivo dosing and administration of lipid particles or viral vectors and related systems and uses |
| WO2023141602A2 (en) | 2022-01-21 | 2023-07-27 | Renagade Therapeutics Management Inc. | Engineered retrons and methods of use |
| WO2023150518A1 (en) | 2022-02-01 | 2023-08-10 | Sana Biotechnology, Inc. | Cd3-targeted lentiviral vectors and uses thereof |
| WO2023150647A1 (en) | 2022-02-02 | 2023-08-10 | Sana Biotechnology, Inc. | Methods of repeat dosing and administration of lipid particles or viral vectors and related systems and uses |
| WO2024020346A2 (en) | 2022-07-18 | 2024-01-25 | Renagade Therapeutics Management Inc. | Gene editing components, systems, and methods of use |
| WO2024023734A1 (en) | 2022-07-26 | 2024-02-01 | Bit Bio Limited | MULTI-gRNA GENOME EDITING |
| WO2024044655A1 (en) | 2022-08-24 | 2024-02-29 | Sana Biotechnology, Inc. | Delivery of heterologous proteins |
| WO2024044723A1 (en) | 2022-08-25 | 2024-02-29 | Renagade Therapeutics Management Inc. | Engineered retrons and methods of use |
| WO2024042199A1 (en) | 2022-08-26 | 2024-02-29 | KWS SAAT SE & Co. KGaA | Use of paired genes in hybrid breeding |
| WO2024047587A1 (en) | 2022-08-31 | 2024-03-07 | Regel Therapeutics, Inc. | Cas-phi compositions and methods of use |
| WO2024064838A1 (en) | 2022-09-21 | 2024-03-28 | Sana Biotechnology, Inc. | Lipid particles comprising variant paramyxovirus attachment glycoproteins and uses thereof |
| WO2024074888A2 (en) | 2022-10-03 | 2024-04-11 | The Regents Of The University Of California | Circumventing barriers to hybrid crops from genetically distant crosses |
| WO2024081820A1 (en) | 2022-10-13 | 2024-04-18 | Sana Biotechnology, Inc. | Viral particles targeting hematopoietic stem cells |
| WO2024119157A1 (en) | 2022-12-02 | 2024-06-06 | Sana Biotechnology, Inc. | Lipid particles with cofusogens and methods of producing and using the same |
| WO2024168253A1 (en) | 2023-02-10 | 2024-08-15 | Possible Medicines Llc | Delivery of an rna guided recombination system |
| WO2024168265A1 (en) | 2023-02-10 | 2024-08-15 | Possible Medicines Llc | Aav delivery of rna guided recombination system |
| WO2024201368A1 (en) | 2023-03-29 | 2024-10-03 | Astrazeneca Ab | Use of inhibitors to increase efficiency of crispr/cas insertions |
| WO2024220574A1 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Universal protein g fusogens and adapter systems thereof and related lipid particles and uses |
| WO2024220598A2 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Lentiviral vectors with two or more genomes |
| WO2024220560A1 (en) | 2023-04-18 | 2024-10-24 | Sana Biotechnology, Inc. | Engineered protein g fusogens and related lipid particles and methods thereof |
| WO2024243340A1 (en) | 2023-05-23 | 2024-11-28 | Sana Biotechnology, Inc. | Tandem fusogens and related lipid particles |
| US12509680B2 (en) | 2023-05-31 | 2025-12-30 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| WO2025049959A2 (en) | 2023-09-01 | 2025-03-06 | Renagade Therapeutics Management Inc. | Gene editing systems, compositions, and methods for treatment of vexas syndrome |
| WO2025054202A1 (en) | 2023-09-05 | 2025-03-13 | Sana Biotechnology, Inc. | Method of screening a sample comprising a transgene with a unique barcode |
| WO2025059215A1 (en) | 2023-09-12 | 2025-03-20 | Aadigen, Llc | Methods and compositions for treating or preventing cancer |
| WO2025081042A1 (en) | 2023-10-12 | 2025-04-17 | Renagade Therapeutics Management Inc. | Nickase-retron template-based precision editing system and methods of use |
| WO2025151838A1 (en) | 2024-01-12 | 2025-07-17 | Sana Biotechnology, Inc. | Safety switches to control in vitro and in vivo proliferation of cell therapy products |
| WO2025155753A2 (en) | 2024-01-17 | 2025-07-24 | Renagade Therapeutics Management Inc. | Improved gene editing system, guides, and methods |
| WO2025174765A1 (en) | 2024-02-12 | 2025-08-21 | Renagade Therapeutics Management Inc. | Lipid nanoparticles comprising coding rna molecules for use in gene editing and as vaccines and therapeutic agents |
| WO2025184529A1 (en) | 2024-03-01 | 2025-09-04 | Sana Biotechnology, Inc. | Viral particles with fusogen display and related compositions and methods |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20250236856A1 (en) | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation | |
| US20250250577A1 (en) | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains | |
| US20250250553A1 (en) | Engineering of systems, methods and optimized guide compositions for sequence manipulation | |
| EP3705490B1 (en) | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation | |
| EP4245853A2 (en) | Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation | |
| HK1207119B (en) | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation | |
| HK1209154B (en) | Engineering of systems, methods and optimized guide compositions for sequence manipulation | |
| HK1202586B (en) | Engineering of systems, methods and optimized guide compositions for sequence manipulation | |
| HK1223645B (en) | Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: MASSACHUSETTS INSTITUTE OF TECHNOLOGY, MASSACHUSET Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:ZHANG, FENG;REEL/FRAME:031916/0041 Effective date: 20131210 Owner name: THE BROAD INSTITUTE, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:SHALEM, OPHIR;REEL/FRAME:031916/0165 Effective date: 20131210 Owner name: THE BROAD INSTITUTE, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:ZHANG, FENG;REEL/FRAME:031916/0041 Effective date: 20131210 |
|
| AS | Assignment |
Owner name: NATIONAL INSTITUTES OF HEALTH (NIH), U.S. DEPT. OF Free format text: CONFIRMATORY LICENSE;ASSIGNOR:BROAD INSTITUTE, INC.;REEL/FRAME:033753/0859 Effective date: 20140806 |
|
| AS | Assignment |
Owner name: PRESIDENT AND FELLOWS OF HARVARD COLLEGE, MASSACHU Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:RAN, FEI;REEL/FRAME:034124/0526 Effective date: 20141102 |
|
| AS | Assignment |
Owner name: THE BROAD INSTITUTE, INC., MASSACHUSETTS Free format text: CORRECTIVE ASSIGNMENT TO CORRECT THE EXECUTED ASSIGNMENT DOCUMENT PREVIOUSLY RECORDED ON REEL 031916 FRAME 0165. ASSIGNOR(S) HEREBY CONFIRMS THE EXECUTED ASSIGNMENT DOCUMENT;ASSIGNOR:SHALEM, OPHIR;REEL/FRAME:037564/0180 Effective date: 20131210 |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |