WO2016168595A1 - Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells - Google Patents

Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells Download PDF

Info

Publication number
WO2016168595A1
WO2016168595A1 PCT/US2016/027751 US2016027751W WO2016168595A1 WO 2016168595 A1 WO2016168595 A1 WO 2016168595A1 US 2016027751 W US2016027751 W US 2016027751W WO 2016168595 A1 WO2016168595 A1 WO 2016168595A1
Authority
WO
WIPO (PCT)
Prior art keywords
cells
cell
car
population
immune effector
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/027751
Other languages
English (en)
French (fr)
Other versions
WO2016168595A8 (en
Inventor
David Maxwell BARRETT
Felipe Bedoya
Saba GHASSEMI
Carl H. June
Bruce L. Levine
Jan J. MELENHORST
Michael C. MILONE
Daniel J. POWELL
Nathan Amar SINGH
Zoe ZHENG
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Individual
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN202410855992.XA priority Critical patent/CN118726268A/zh
Priority to SG11201708516YA priority patent/SG11201708516YA/en
Priority to EP16720247.2A priority patent/EP3283619B1/en
Priority to ES16720247T priority patent/ES2948133T3/es
Priority to CN201680035218.8A priority patent/CN108473957B/zh
Priority to US15/567,156 priority patent/US11896614B2/en
Priority to CA2982996A priority patent/CA2982996A1/en
Priority to JP2018505581A priority patent/JP7114457B2/ja
Priority to AU2016249005A priority patent/AU2016249005B2/en
Application filed by Individual filed Critical Individual
Priority to EP23159683.4A priority patent/EP4234685A3/en
Publication of WO2016168595A1 publication Critical patent/WO2016168595A1/en
Anticipated expiration legal-status Critical
Publication of WO2016168595A8 publication Critical patent/WO2016168595A8/en
Priority to AU2022231783A priority patent/AU2022231783A1/en
Priority to US18/390,604 priority patent/US20240398913A1/en
Priority to AU2025204038A priority patent/AU2025204038A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46Hydrolases (3)
    • A61K38/50Hydrolases (3) acting on carbon-nitrogen bonds, other than peptide bonds (3.5), e.g. asparaginase
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4748Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70517CD8
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y305/00Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
    • C12Y305/01Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in linear amides (3.5.1)
    • C12Y305/01001Asparaginase (3.5.1.1)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/11Antigen recognition domain
    • A61K2239/13Antibody-based
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/59Reproductive system, e.g. uterus, ovaries, cervix or testes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/20Cytokines; Chemokines
    • C12N2501/23Interleukins [IL]
    • C12N2501/2302Interleukin-2 (IL-2)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/20Cytokines; Chemokines
    • C12N2501/23Interleukins [IL]
    • C12N2501/2305Interleukin-5 (IL-5)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/20Cytokines; Chemokines
    • C12N2501/23Interleukins [IL]
    • C12N2501/2307Interleukin-7 (IL-7)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/20Cytokines; Chemokines
    • C12N2501/23Interleukins [IL]
    • C12N2501/2318Interleukin-18 (IL-18)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells

Definitions

  • the present invention relates generally to immune effector cells (e.g., T cells, NK cells) engineered to express a Chimeric Antigen Receptor (CAR), compositions comprising the same, as well as methods of making and using the same.
  • immune effector cells e.g., T cells, NK cells
  • CAR Chimeric Antigen Receptor
  • the present disclosure pertains, at least in part, to methods for improving the efficacy and/or expansion (e.g., ex vivo expansion) of immune effector cells (e.g., T cells, NK cells) for use in cellular therapy.
  • immune effector cells e.g., T cells, NK cells
  • Applicants have discovered a significant benefit to acquiring, e.g., harvesting, immune cells from a subject, e.g., a cancer patient, as early as possible after diagnosis ⁇ e.g., prior to a therapy, or at an earlier time point during the course of a therapy).
  • Some embodiments described herein provide a criterion for evaluating and/or optimizing the suitability of an immune cell for use in cellular therapy, e.g., Chimeric Antigen Receptor (CAR)-therapy.
  • CAR Chimeric Antigen Receptor
  • chemotherapy include a population of less differentiated immune effector cells (e.g., naive and early memory T cells). It is thought that populations of less differentiated immune effector cells have a higher proliferative, self -renewal, and/or survival capacity and thus have a higher expansion capability and/or a higher anti-tumor efficacy.
  • naive and early memory T cells e.g., naive and early memory T cells
  • the methods disclosed herein advantageously improve T cell fitness (e.g., suitability for use in cellular therapy) and efficacy by acquiring cells from subjects early after diagnosis of a cancer, e.g., prior to chemotherapy or prior to
  • the methods disclosed herein utilize cells acquired from a patient prior to a chemotherapeutic cycle containing T cell- depleting drugs (e.g., acquired prior to 2, 3, 4, or 5 cycles of chemotherapy), or acquired prior to delayed intensification or consolidation cycles.
  • the methods optimize expansion capability and/or anti-tumor efficacy of the immune cells by including patient selection, e.g., based on type of malignancy (e.g., leukemia versus lymphoma) or severity of disease (e.g., standard-, high-, or very high-risk).
  • the methods optimize expansion capability and/or anti-tumor efficacy of the immune cells by including cell selection, e.g., selection of cell populations having a higher absolute T cell count, or a higher percentage of less differentiated T cells.
  • the methods disclosed herein can be used to optimize one or more of compositions and methods for cellular therapy, and/or methods of making immune effector cell populations (e.g., CAR-expressing cells).
  • the invention features a method for evaluating the suitability of an immune cell (e.g., an immune effector cell or a population thereof), for use in cellular therapy, e.g., CAR therapy (e.g.., a cancer therapy).
  • the method includes acquiring a value for one, two, three, four or more (all) of the following:
  • a therapy e.g., a chemotherapy, e.g., in relation to the immune cell acquisition (e.g., harvest);
  • the type of therapy e.g., chemotherapy
  • an immune cell e.g., T cell
  • T cell parameter e.g., one or more of T cell number, T cell phenotype or T cell function
  • the value of any of (i)-(v) is indicative of the suitability of the immune cell for use in the cellular therapy, e.g., the CAR therapy.
  • the value of any of (i)-(v) is indicative of one or more of: capability for expansion (e.g., ex-vivo expansion) of the immune cell, the efficacy of the immune cell for therapy, or the yield of the immune cell.
  • the invention features a method of treating, or providing anti-tumor immunity to, a subject having a cancer.
  • the method includes administering to the subject an effective amount of an immune cell (e.g., an immune effector cell or a population thereof) that is capable of expressing a CAR molecule (a "CAR-expressing cell” or a "CAR therapy"), in combination with a therapy, e.g., a chemotherapy.
  • an immune cell e.g., an immune effector cell or a population thereof
  • the immune cell is acquired (e.g., obtained or harvested) by optimizing, one, two, three, four, or more (all) of the following:
  • a therapy e.g., a chemotherapy, e.g., in relation to the immune cell acquisition (e.g., harvest);
  • the type of therapy e.g., chemotherapy
  • an immune cell e.g., T cell
  • T cell parameter e.g., one or more of T cell number, T cell phenotype or T cell function
  • the immune cell is acquired prior to introduction of the CAR molecule. In one embodiment, the acquired immune cell is expanded prior to introduction of the CAR molecule. In other embodiments, the immune cell is acquired after introduction of the CAR molecule. In one embodiment, the acquired immune cell is expanded after introduction of the CAR molecule.
  • the immune cell can be expanded and/or activated according to any of the methods described herein.
  • the immune cell shows an increase in one or more of: expansion (e.g., ex- vivo expansion) of the immune cell population, the efficacy of the immune cell population for therapy, or the yield of the immune cell population, when any of (i)-(v) are optimized.
  • expansion e.g., ex- vivo expansion
  • the method comprises introducing into the acquired immune cell (e.g., cell population) a nucleic acid encoding a CAR, e.g., a CAR molecule described herein, e.g., a CD19 CAR described herein (e.g., CTL019).
  • a CAR e.g., a CAR molecule described herein, e.g., a CD19 CAR described herein (e.g., CTL019).
  • the invention features a method of enriching for, or making, an immune cell population (e.g., an immune effector cell population) suitable for use in a CAR therapy (e.g., a cell that expresses a CAR molecule).
  • the method includes acquiring (e.g., harvesting) the immune cell population, according to one, two, three, four, or more (all) of the following:
  • a therapy e.g., a chemotherapy, e.g., in relation to the immune cell acquisition (e.g., harvest);
  • the type of therapy e.g., chemotherapy
  • an immune cell e.g., T cell
  • T cell parameter e.g., one or more of T cell number, T cell phenotype or T cell function
  • the immune cell population is acquired prior to introduction of the CAR molecule. In one embodiment, the acquired immune cell is expanded prior to introduction of the CAR molecule. In other embodiments, the immune cell is acquired after introduction of the CAR molecule. In one embodiment, the acquired immune cell is expanded after introduction of the CAR molecule.
  • the immune cell can be expanded and/or activated according to any of the methods described herein.
  • the immune cell population shows an increase in one or more of: the expansion (e.g., ex-vivo expansion) of the immune cell population, the efficacy of the immune cell population for therapy, or the yield of the immune cell population, when any of (i)-(v) are optimized.
  • the method further comprises introducing into the immune cell (e.g., cell population) a nucleic acid encoding a CAR, e.g., a CAR molecule described herein, e.g., a CD19 CAR described herein (e.g., CTL019).
  • a CAR e.g., a CAR molecule described herein, e.g., a CD19 CAR described herein (e.g., CTL019).
  • the invention features an immune cell preparation or reaction mixture, e.g., comprising a population of immune effector cells (e.g., comprising a CAR molecule or a nucleic acid encoding a CAR molecule), made according to the methods described herein.
  • a population of immune effector cells e.g., comprising a CAR molecule or a nucleic acid encoding a CAR molecule
  • the subject e.g., the subject from which immune cells are acquired and/or the subject to be treated
  • the subject is 18 years of age of younger (e.g., 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1 or younger (e.g., 12 months, 6 months, 3 months or less)).
  • the subject is a pediatric cancer patient.
  • the subject is an adult, e.g., the subject is older than 18 years of age (e.g., older than 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, or older). In one embodiment, the subject is an adult cancer patient.
  • the subject has a disease associated with expression of a tumor- or cancer associated-antigen, e.g., a disease as described herein.
  • the subject has a cancer, e.g., a cancer as described herein.
  • the subject has a cancer that is chosen from a hematological cancer, a solid tumor, or a metastatic lesion thereof.
  • Exemplary cancers include, but are not limited to, B-cell acute lymphocytic leukemia (B-ALL), T-cell acute lymphocytic leukemia (T-ALL), acute lymphocytic leukemia (ALL), chronic myelogenous leukemia (CML), chronic
  • lymphocytic leukemia B cell promyelocytic leukemia, blastic plasmacytoid dendritic cell neoplasm, Burkitt's lymphoma, diffuse large B cell lymphoma, follicular lymphoma, hairy cell leukemia, small cell- or a large cell-follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma (MCL), marginal zone lymphoma, multiple myeloma, myelodysplasia and myelodysplastic syndrome, non-Hodgkin's lymphoma (NHL),, Hodgkin's lymphoma (HL), plasmablastic lymphoma, plasmacytoid dendritic cell neoplasm, and Waldenstrom macroglobulinemia.
  • the cancer is ALL.
  • the cancer is CLL.
  • the subject has a leukemia, e.g., ALL.
  • the subject has leukemia, e.g., ALL, and is a pediatric patient, e.g., is 18 years of age of younger (e.g., 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1 or younger (e.g., 12 months, 6 months, 3 months or less)).
  • the subject has ALL, e.g., is classified as having standard-risk, high- risk, or very high-risk ALL.
  • the subject has ALL, e.g., is classified as having standard-risk, high-risk, or very high-risk ALL and is a pediatric subject, e.g., is 18 years of age of younger.
  • the subject is classified as having standard-risk ALL.
  • the subject is classified as having standard-risk ALL and is a pediatric subject, e.g., is 18 years of age of younger.
  • the subject is not classified as having high-risk or very high-risk ALL.
  • the subject is not classified as having high-risk or very high-risk ALL and is a pediatric subject, e.g., is 18 years of age of younger.
  • the subject does not have a lymphoma, e.g., the subject does not have Non-Hodgkin lymphoma (NHL).
  • the subject is a pediatric subject, e.g., is 18 years of age of younger and does not have NHL.
  • the subject has a lymphoma, e.g., NHL.
  • the subject is a pediatric subject, e.g., is 18 years of age of younger and has NHL.
  • the subject does not have a relapsed cancer.
  • the subject is a pediatric subject, e.g., is 18 years of age of younger and does not have a relapsed cancer.
  • the subject has a relapsed cancer.
  • the subject is a pediatric subject, e.g., is 18 years of age of younger and has a relapsed cancer.
  • the immune cell (e.g., the population of immune effector cells) is acquired, e.g., obtained, from a subject having a haematological cancer, e.g., a leukemia, e.g., CLL, ALL, or a lymphoma, e.g., MCL, NHL, or HL.
  • a haematological cancer e.g., a leukemia, e.g., CLL, ALL, or a lymphoma, e.g., MCL, NHL, or HL.
  • early timing of immune cell acquisition e.g., harvest (e.g., after diagnosis) is indicative of an increased suitability of the immune cell for use in cellular therapy, e.g., the CAR therapy.
  • early timing of immune cell harvest increases the capability for one or more of: the expansion (e.g., ex-vivo expansion) of the immune cell, the adequacy of immune cell for therapy, or the manufacturing yield of the immune cell.
  • harvesting the immune cell prior to administration of a therapy results in increased suitability of the immune cell for use in cellular therapy, e.g., CAR therapy.
  • a therapy e.g., a chemotherapy
  • harvesting the immune cell early during the course of a therapy e.g., a chemotherapy (e.g., before the subject has undergone 2, 3, 4 or 5 cycles of chemotherapy)
  • results in increased suitability of the immune cell for use in cellular therapy e.g., CAR therapy.
  • the immune cell harvest occurs prior to administration of a therapy, e.g., a chemotherapy, to the subject.
  • a therapy e.g., a chemotherapy
  • the harvest occurs early during the course of a therapy, e.g., a chemotherapy, to the subject.
  • immune cell harvest occurs before the subject has undergone 2, 3, 4 or 5 cycles of chemotherapy.
  • the immune cell harvest occurs after the subject has undergone 1 cycle of chemotherapy, but before the subject has undergone more than 1 cycle (e.g., more than 1, 2, 3, 4, or 5 cycles) of chemotherapy.
  • the chemotherapy or cycle of chemotherapy includes one or more of an induction, a consolidation, an interim maintenance, a delayed intensification, or a maintenance therapy cycle.
  • the immune effector cells are harvested from the subject before the subject has undergone a consolidation cycle of chemotherapy or an induction cycle of chemotherapy.
  • the cells are harvested before the subject has undergone a consolidation cycle of chemotherapy.
  • the subject is classified as having a high-risk or very high-risk cancer (e.g., ALL) and the cells are harvested before the subject has undergone a consolidation cycle.
  • the immune effector cells are harvested from the subject before the subject has undergone a delayed intensification cycle.
  • the subject is classified as having a standard-risk cancer (e.g., ALL) and the cells are harvested before the subject has undergone a delayed
  • the chemotherapy cycle(s) are chosen from Table 8.
  • the chemotherapy comprises a drug chosen from Table 8.
  • the chemotherapy comprises a drug and dosing regimen described in Table 8.
  • the chemotherapy can include vincristine, dexamethasone, PEG-L-asparaginase, daunorubicin, 6-mercaptopurine, cyclophosphamide, cytarabine, methotrexate, doxorubicin, 6- thioguanine, and/or prednisone.
  • the immune effector cells are harvested from the subject before the subject has been administered cyclophosphamide and/or cytarabine.
  • the harvested immune effector cells include a higher number of less differentiated T cells, e.g., a higher number of one or more of naive T cells, stem central memory T cells, and/or central memory T cells, e.g., compared to a reference value (e.g., a sample from the subject at a later time point or after exposure to additional rounds of chemotherapy).
  • the harvested immune effector cells include at least 20% naive T cells, at least 2% stem central memory T cells, and/or at least 4% central memory T cells.
  • an increased absolute T cell count is indicative of increased suitability of the immune cell for use in cellular therapy, e.g., CAR therapy.
  • the harvested immune effector cells comprise an absolute T cell count of at least 400 cells/microliter, an absolute naive T cell count of at least 200 cells/microliter, an absolute stem central memory T cell count of at least 20 cells/microliter, and/or an absolute central memory T cell count of at least 40 cells/microliter.
  • the population of immune effector cells is selected based upon the expression of one or more markers, e.g., CCR7, CD62L, CD45RO, and CD95, e.g., the population of immune effector cells (e.g., T cells) are CCR7+ and CD62L+.
  • the naive T cells are identified based upon an expression pattern of CCR7+, CD62L+, CD45RO-, CD95-, wherein the stem central memory T cells are identified based upon an expression pattern of CCR7+, CD62L+, CD45RO-, CD95+, and wherein the central memory T cells are identified based upon an expression pattern of CCR7+, CD62L+, CD45RO+, CD95+.
  • an immune effector cell e.g., obtained by a method described herein, can be engineered to contain a CAR molecule (also referred to herein as "CAR") that targets one or more cancer associated antigens.
  • CAR CAR molecule
  • the cancer associated antigen is chosen from one or more of: CD19; CD123; CD22; CD30; CD171; CS-1 (also referred to as CD2 subset 1, CRACC, SLAMF7, CD319, and 19A24); C-type lectin-like molecule-1 (CLL-1 or CLECL1); CD33; epidermal growth factor receptor variant III (EGFRvIII); ganglioside G2 (GD2); ganglioside GD3 (aNeu5Ac(2-8)aNeu5Ac(2-3)bDGalp(i-4)bDGlcp(l -l)Cer); TNF receptor family member B cell maturation (BCMA); Tn antigen ((Tn Ag) or (GalNAca- Ser/Thr)); prostate-specific membrane antigen (PSMA); Receptor tyrosine kinase-like orphan receptor 1 (ROR1); Fms-Like Tyrosine Kinase 3 (F
  • tyrosinase ephrin type-A receptor 2 (EphA2); Fucosyl GM1; sialyl Lewis adhesion molecule (sLe); ganglioside GM3 (aNeu5Ac(2-3)bDGalp(l-4)bDGlcp(l-l)Cer); transglutaminase 5 (TGS5); high molecular weight-melanoma-associated antigen (HMWMAA); o-acetyl-GD2 ganglioside (OAcGD2); Folate receptor beta; tumor endothelial marker 1 (TEM1/CD248); tumor endothelial marker 7-related (TEM7R); claudin 6 (CLDN6); thyroid stimulating hormone receptor (TSHR); G protein-coupled receptor class C group 5, member D (GPRC5D); chromosome X open reading frame 61 (CXORF61); CD97; CD179a; anaplastic lymphoma kinase (ALK); Polysia
  • Cancer/testis antigen 2 (LAGE-la); Melanoma- associated antigen 1 (MAGE-A1); ETS translocation-variant gene 6, located on chromosome 12p (ETV6-AML); sperm protein 17 (SPA17); X Antigen Family, Member 1A (XAGEl); angiopoietin-binding cell surface receptor 2 (Tie 2); melanoma cancer testis antigen- 1 (MAD-CT-1); melanoma cancer testis antigen-2 (MAD-CT-2); Fos-related antigen 1; tumor protein p53 (p53); p53 mutant; prostein; surviving; telomerase; prostate carcinoma tumor antigen- 1 (PCTA-1 or Galectin 8), melanoma antigen recognized by T cells 1 (MelanA or MARTI); Rat sarcoma (Ras) mutant; human Telomerase reverse transcriptase (hTERT); sarcoma translocation breakpoints; melanoma inhibitor of a
  • LAIR1 Leukocyte-associated immunoglobulin-like receptor 1
  • FCAR Fc fragment of IgA receptor
  • LILRA2 Leukocyte immunoglobulin-like receptor subfamily A member 2
  • CD300LF CD300 molecule-like family member f
  • CLEC12A C-type lectin domain family 12 member A
  • BST2 bone marrow stromal cell antigen 2
  • LY75 lymphocyte antigen 75
  • Glypican-3 Glypican-3 (GPC3); Fc receptor-like 5 (FCRL5); and immunoglobulin lambda-like polypeptide 1 (IGLL1).
  • the cancer associated antigen targeted by the CAR molecule is CD19, e.g., a CD19 CAR described herein (e.g., CTL019).
  • the CD19 CAR comprises the amino acid, or has the nucleotide sequence shown in Table 4.
  • the cancer associated antigen targeted by the CAR molecule is BCMA, e.g., an anti-BCMA CAR described herein.
  • the anti-BCMA CAR comprises an amino acid, or has a nucleotide sequence shown in Table 11.
  • the cancer associated antigen targeted by the CAR molecule is EGFRvIII, e.g., an anti-EGFRvIII CAR described herein, e.g., described in
  • the anti- EGFRvIII CAR comprises an amino acid, or has a nucleotide sequence shown in US2014/0322275A1, incorporated herein by reference.
  • the cancer associated antigen targeted by the CAR molecule is CD123, e.g., an anti-CD123 CAR described herein, e.g., described in US2014/0322212A1 or US2016/0068601A1, both incorporated herein by reference.
  • the anti-CD123 CAR comprises an amino acid, or has a nucleotide sequence shown in US 2014/0322212A1 or US2016/0068601A1, both incorporated herein by reference.
  • the cancer associated antigen targeted by the CAR molecule is mesothelin, e.g., an anti-mesothelin CAR described herein, e.g., described in WO 2015/090230, incorporated herein by reference.
  • the anti-mesothelin CAR comprises an amino acid, or has a nucleotide sequence shown in WO 2015/090230, incorporated herein by reference.
  • the cancer associated antigen targeted by the CAR molecule is mesothelin, e.g., an anti-CLLl CAR described herein, e.g., described in US2016/0051651A1, incorporated herein by reference.
  • the anti-CLLl CAR comprises an amino acid, or has a nucleotide sequence shown in US2016/0051651A1, incorporated herein by reference.
  • the cancer associated antigen targeted by the CAR molecule is mesothelin, e.g., an anti-CD33 CAR described herein, e.g., described in US2016/0096892A1, incorporated herein by reference.
  • the anti-CD33 CAR comprises an amino acid, or has a nucleotide sequence shown in US2016/0096892A1, incorporated herein by reference.
  • the antigen binding domain of the CAR molecule comprises an antibody, an antibody fragment, an scFv, a Fv, a Fab, a (Fab')2, a single domain antibody (SDAB), a VH or VL domain, or a camelid VHH domain.
  • the transmembrane domain of the CAR molecule comprises a transmembrane domain chosen from the transmembrane domain of an alpha, beta or zeta chain of a T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, KIRDS2, OX40, CD2, CD27, LFA-1 (CDl la, CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), CD160, CD19, IL2R beta, IL2R gamma, IL7R a, ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CDl ld, ITGAE
  • the transmembrane domain of the CAR molecule comprises an amino acid sequence of a CD8 transmembrane domain having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO: 6, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO: 6.
  • the transmembrane domain comprises the sequence of SEQ ID NO: 6.
  • nucleic acid sequence encoding the CD8 transmembrane domain comprises the sequence of SEQ ID NO: 17, or a sequence with 95-99% identity thereof.
  • the antigen binding domain is connected to the transmembrane domain by a hinge region.
  • the hinge region comprises the amino acid sequence of a CD8 hinge, e.g., SEQ ID NO: 2; or the amino acid sequence of an IgG4 hinge, e.g., SEQ ID NO: 36, or a sequence with 95-99% identity to SEQ ID NO:2 or 36.
  • the nucleic acid sequence encoding the hinge region comprises a sequence of SEQ ID NO: 13 or SEQ ID NO: 37, corresponding to a CD8 hinge or an IgG4 hinge, respectively, or a sequence with 95-99% identity to SEQ ID NO: 13 or 37.
  • the CAR comprises an intracellular signaling domain, e.g., a primary signaling domain and/or a costimulatory signaling domain.
  • the intracellular signaling domain comprises a primary signaling domain.
  • the intracellular signaling domain comprises a costimulatory signaling domain.
  • the intracellular signaling domain comprises a primary signaling domain and a costimulatory signaling domain.
  • the primary signaling domain comprises a functional signaling domain of a protein selected from the group consisting of CD3 zeta, CD3 gamma, CD3 delta, CD3 epsilon, common FcR gamma (FCER1G), FcR beta (Fc Epsilon Rib), CD79a, CD79b, Fcgamma Rlla, DAP10, and DAP12.
  • a protein selected from the group consisting of CD3 zeta, CD3 gamma, CD3 delta, CD3 epsilon, common FcR gamma (FCER1G), FcR beta (Fc Epsilon Rib), CD79a, CD79b, Fcgamma Rlla, DAP10, and DAP12.
  • the primary signaling domain of the CAR molecule comprises a functional signaling domain of CD3 zeta.
  • the CD3 zeta primary signaling domain can comprise an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 10, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:9 or SEQ ID NO: 10.
  • the primary signaling domain comprises a sequence of SEQ ID NO:9 or SEQ ID NO: 10.
  • the nucleic acid sequence encoding the primary signaling domain comprises a sequence of SEQ ID NO:20 or SEQ ID NO: 21, or a sequence with 95-99% identity thereof.
  • the intracellular signaling domain of the CAR molecule comprises a costimulatory signaling domain.
  • the intracellular signaling domain can comprise a primary signaling domain and a costimulatory signaling domain.
  • the costimulatory signaling domain comprises a functional signaling domain of a protein chosen from one or more of CD27, CD28, 4-lBB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen- 1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7- H3, a ligand that specifically binds with CD83, CDS, ICAM-1, GITR, BAFFR, HVEM
  • LIGHTR LIGHTR
  • SLAMF7 NKp80
  • CD160 CD19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CDl ld, ITGAE, CD103, ITGAL, CDl la, LFA-1, ITGAM, CDl lb, ITGAX, CD 11c, ITGB 1, CD29, ITGB2, CD 18, LFA-1, ITGB7, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRT AM, Ly9
  • CD229) CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Lyl08), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, NKp44, NKp30, NKp46, or NKG2D.
  • the costimulatory signaling domain of the CAR molecule comprises an amino acid sequence having at least one, two or three modifications but not more than 20, 10 or 5 modifications of an amino acid sequence of SEQ ID NO:7 or SEQ ID NO: 16, or a sequence with 95-99% identity to an amino acid sequence of SEQ ID NO:7 or SEQ ID NO: 16.
  • the costimulatory signaling domain comprises a sequence of SEQ ID NO: 7 or SEQ ID NO: 16.
  • the nucleic acid sequence encoding the costimulatory signaling domain comprises a sequence of SEQ ID NO: 18 or SEQ ID NO: 15, or a sequence with 95-99% identity thereof.
  • the intracellular domain of the CAR molecule comprises the sequence of SEQ ID NO: 9 or SEQ ID NO: 10, and the sequence of SEQ ID NO: 7 or SEQ ID NO: 16, wherein the amino acid sequence(s) comprising the intracellular signaling domain are expressed in the same frame and as a single polypeptide chain.
  • the nucleic acid sequence encoding the intracellular signaling domain comprises a sequence of SEQ ID NO: 18 or SEQ ID NO: 15, or a sequence with 95- 99% identity thereof, and a sequence of SEQ ID NO:20 or SEQ ID NO:21, or a sequence with 95-99% identity thereof.
  • the CAR further comprises a leader sequence.
  • the leader sequence comprises the sequence of SEQ ID NO: 1.
  • the antigen binding domain of the CAR molecule has a binding affinity KD of 10 "4 M to 10 "8 M.
  • the antigen binding domain of the CAR molecule is an antigen binding domain described herein, e.g., an antigen binding domain described herein for a target provided above.
  • the CAR comprises a CD 19 CAR, e.g., a CD 19 CAR described herein.
  • the CD19 CAR comprises an antigen binding domain described herein, e.g., in Table 1 or 4.
  • the method comprises administering to a subject a CAR molecule, or a population of immune effector cells made by a method described herein.
  • the population of immune effector cells is engineered to express a CAR molecule, e.g. a CAR described herein, e.g., a CD19 CAR described herein.
  • the method further comprises administering a therapy, e.g., a chemotherapy described herein, to the subject.
  • composition comprising an immune effector cell ⁇ e.g., a population of immune effector cells) that comprises a CAR molecule (e.g., a CAR molecule as described herein) for use in the treatment of a subject having a disease associated with expression of a tumor antigen, e.g., a disorder as described herein.
  • a CAR molecule e.g., a CAR molecule as described herein
  • the chemotherapy e.g., cycle of chemotherapy
  • the CAR therapy are administered concurrently.
  • the chemotherapy (e.g., cycle of chemotherapy) and the CAR therapy are administered sequentially, e.g., one after the other.
  • the CAR therapy is administered before the chemotherapy, e.g., before a cycle of chemotherapy. In embodiments, the CAR therapy is administered before a first cycle, second cycle, third cycle, fourth cycle, or fifth cycle of chemotherapy. In embodiments, the CAR therapy is administered before an induction cycle, consolidation cycle, interim maintenance cycle, delayed intensification cycle, or maintenance cycle of
  • the CAR therapy is administered before a chemotherapy, e.g., cycle of chemotherapy, comprising a drug described herein, e.g., a drug described in Table 8.
  • administration of the CAR therapy starts before administration of a chemotherapy, e.g., before a cycle of chemotherapy, and then administration of the CAR therapy and the chemotherapy continue concurrently for a period of time.
  • the CAR therapy is administered after the chemotherapy, e.g., after a cycle of chemotherapy. In embodiments, the CAR therapy is administered after a first cycle, second cycle, third cycle, fourth cycle, or fifth cycle of chemotherapy. In embodiments, the
  • CAR therapy is administered after an induction cycle, consolidation cycle, interim maintenance cycle, delayed intensification cycle, or maintenance cycle of chemotherapy.
  • the CAR therapy is administered after a chemotherapy, e.g., cycle of chemotherapy, comprising a drug described herein, e.g., a drug described in Table 8.
  • administration of the CAR therapy starts after administration of a chemotherapy, e.g., after a cycle of
  • the cancer is a hematological cancer such as, e.g., ALL or CLL.
  • the cancer e.g., a hematological cancer described herein, such as, e.g., a leukemia (e.g., ALL or CLL) or a lymphoma (e.g., MCL, HL, or NHL).
  • a disease associated with a tumor antigen is selected from a proliferative disease such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia, or is a non-cancer related indication associated with expression of a tumor antigen described herein.
  • the disease is a cancer described herein, e.g., a cancer described herein as being associated with a target described herein.
  • the hematologic cancer is leukemia.
  • the cancer is selected from the group consisting of one or more acute leukemias including but not limited to B-ALL, T-ALL, ALL; one or more chronic leukemias including but not limited to chronic myelogenous leukemia (CML), chronic lymphocytic leukemia (CLL); additional hematologic cancers or hematologic conditions including, but not limited to B cell prolymphocytic leukemia, blastic plasmacytoid dendritic cell neoplasm, Burkitt's lymphoma, diffuse large B cell lymphoma, follicular lymphoma, hairy cell leukemia, small cell- or a large cell-follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma, Marginal zone lymphoma, multiple myeloma, myelodysplasia and myelodysplastic syndrome, non-Hodgkin lymphoma, Hodgkin lymphoma,
  • a disease associated with expression of a tumor antigen described herein includes, but is not limited to, atypical and/or non-classical cancers, malignancies, precancerous conditions or proliferative diseases expressing a tumor antigen as described herein; and any combination thereof.
  • the disease associated with expression of the tumor antigen is selected from the group consisting of a proliferative disease, a precancerous condition, a cancer, and a non-cancer related indication associated with expression of the tumor antigen.
  • the disease associated with a tumor antigen described herein is a solid tumor.
  • the cancer is chosen from colon cancer, rectal cancer, renal-cell carcinoma, liver cancer, non-small cell carcinoma of the lung, cancer of the small intestine, cancer of the esophagus, melanoma, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular malignant melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, non-Hodgkin's
  • lymphoma cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, solid tumors of childhood, cancer of the bladder, cancer of the kidney or ureter, carcinoma of the renal pelvis, neoplasm of the central nervous system (CNS), primary CNS lymphoma, tumor angio genesis, spinal axis tumor, brain stem glioma, pituitary adenoma, Kaposi's sarcoma, epidermoid cancer, squamous cell cancer, T-cell lymphoma,
  • CNS central nervous system
  • the tumor antigen associated with the disease is chosen from one or more of: CD19, CD123, CD22, CD30, CD171, CS-1, CLL-1 (CLECL1), CD33, EGFRvIII , GD2, GD3, BCMA, Tn Ag, PSMA, ROR1, FLT3, TAG72, CD38, CD44v6, CEA, EPCAM, B7H3, KIT, IL-13Ra2, Mesothelin, IL- URa, PSCA, PRSS21, VEGFR2, LewisY, CD24, PDGFR-beta, SSEA-4, CD20, Folate receptor alpha, ERBB2 (Her2/neu), MUC1, EGFR, NCAM, Prostase, PAP, ELF2M, Ephrin B2, FAP, IGF-I receptor, CAIX, LMP2, gplOO
  • the population of cells are autologous to the subject administered the population. In one embodiment, the population of cells is allogeneic to the subject administered the population. In one embodiment, the subject is a human. In one embodiment, the population of immune effector cells transduced with a nucleic acid encoding a CAR, e.g., a CAR described herein, e.g., a CD 19 CAR described herein, are expanded, e.g., by a method described herein. In one embodiment, the cells are expanded for a period of 8 days or less, e.g., 7, 6 ,5, 4, or 3 days.
  • the cells e.g., a CD19 CAR cell described herein
  • the cells are expanded in culture for 5 days, and the resulting cells are more potent than the same cells expanded in culture for 9 days under the same culture conditions, e.g., as described herein.
  • the subject is administered 10 4 to 10 6 immune effector cells per kg body weight of the subject.
  • the subject receives an initial administration of a population of immune effector cells (e.g., an initial administration of 10 4 to 10 6 immune effector cells per kg body weight of the subject, e.g., 10 4 to 10 5 immune effector cells per kg body weight of the subject), a plurality of which comprise the nucleic acid encoding a CAR, e.g., a CAR described herein, e.g., a CD19 CAR described herein, and one or more subsequent administrations of a population of immune effector cells (e.g., one or more subsequent administration of 10 4 to 10 6 immune effector cells per kg body weight of the subject, e.g., 10 4 to 10 5 immune effector cells per kg body weight of the subject), a plurality of which comprise a nucleic acid encoding a CAR, e.g., a CAR described herein, e.g., a CAR described here
  • administration e.g., less than 4, 3, 2 days after the previous administration.
  • the subject receives a total of about 10 6 immune effector cells per kg body weight of the subject over the course of at least three administrations of a population of immune effector cells, e.g., the subject receives an initial dose of 1 x 10 5 immune effector cells, a second administration of 3 x 10 5 immune effector cells, and a third administration of 6 x 10 5 immune effector cells, and, e.g., each administration is administered less than 4, 3, 2 days after the previous administration.
  • the methods or uses are carried out in combination with an agent that increases the efficacy of the immune effector cell, e.g., an agent as described herein.
  • the method further comprises removing T regulatory cells, e.g., CD25+ T cells, from the immune cell population, e.g., to thereby provide a population of T regulatory-depleted cells, e.g., CD25+ depleted cells, that are suitable for expression of a CAR.
  • T regulatory cells e.g., CD25+ T cells
  • the population of T regulatory-depleted cells contains less than 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells.
  • the immune cell population includes cells of a subject having cancer, e.g., a subject having a CD25 expressing cancer such as, e.g., chronic lymphocytic leukemia (CLL).
  • CLL chronic lymphocytic leukemia
  • the population of T regulatory-depleted cells contains less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of tumor cells.
  • the immune cell population is autologous to the subject who the cells will be administered to for treatment.
  • the population of immune effector cells are allogeneic to the subject who the cells will be administered for treatment.
  • the T regulatory cells e.g., CD25+ T cells
  • the T regulatory cells are removed from the population using an anti-CD25 antibody, or fragment thereof, or a CD25-binding ligand, e.g. IL-2.
  • the anti-CD25 antibody, or fragment thereof, or CD25-binding ligand is conjugated to a substrate, e.g., a bead, or is otherwise coated on a substrate, e.g., a bead.
  • the anti-CD25 antibody, or fragment thereof is conjugated to a substrate as described herein.
  • the T regulatory cells e.g., CD25+ T cells
  • the ratio of cells to CD25 depletion reagent is le7 cells to 20 uL, or le7 cells to 15 uL, or le7 cells to 10 uL, or le7 cells to 5 uL, or le7 cells to 2.5 uL, or le7 cells to 1.25 uL.
  • the population of T regulatory-depleted cells are suitable for expression of a CAR described herein, e.g., a CD19 CAR described herein.
  • the population of T regulatory-depleted cells contains less than 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of the leukemia cells, e.g., CLL cells, ALL cells, or lymphoma cells, e.g., MCL cells, NHL cells, or HL cells.
  • the population of immune effector cells are obtained from a subject having CLL, and the population of T regulatory-depleted cells, e.g., CD25+ depleted cells, contains less than 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of the leukemia cells, e.g., CLL cells and are suitable for expression of a CD19 CAR described herein.
  • T regulatory-depleted cells e.g., CD25+ depleted cells
  • the population of T regulatory-depleted cells contains less than 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 15%, 10%, 5%, 4%, 3%, 2%, 1% of tumor cells, e.g., CD25 expressing tumor cells, e.g., CLL cells. In one embodiment, the population of T regulatory-depleted cells contains less than 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 10%, 5%, 4%, 3%, 2%, 1% of tumor cells, e.g., CD25 expressing tumor cells, e.g., CLL cells.
  • the immune effector cells are harvested from blood, e.g., peripheral blood, of the subject.
  • the population of immune effector cells are T cells isolated from peripheral blood lymphocytes.
  • the population of T cells are obtained by lysing the red blood cells and/or by depleting the monocytes.
  • the population of T cells is isolated from peripheral lymphocytes using, e.g., a method described herein.
  • the population of immune effector cells can be obtained from a blood sample from a subject, e.g., obtained by apheresis.
  • the cells collected by apheresis are washed to remove the plasma fraction and, optionally, the cells are provided in an appropriate buffer or media for subsequent processing steps.
  • the cells are washed with a buffer such as, e.g., phosphate buffered saline (PBS).
  • a buffer such as, e.g., phosphate buffered saline (PBS).
  • the cells are washed in a wash solution that lacks one or more divalent cation such as calcium and magnesium.
  • the cells are washed in a buffer that has substantially no divalent cations.
  • the immune effector cells are harvested from the blood by using density centrifugation.
  • the method of making further comprises removing cells from the population which express a tumor antigen, e.g., a tumor antigen that does not comprise CD25, e.g., CD19, CD30, CD38, CD123, CD20, CD14 or CDl lb, to thereby provide a population of T regulatory depleted, e.g., CD25+ depleted, and tumor antigen depleted cells that are suitable for expression of a CAR, e.g., a CAR described herein.
  • tumor antigen expressing cells are removed simultaneously with the T regulatory, e.g., CD25+ cells.
  • an anti-CD25 antibody, or fragment thereof, and an anti-tumor antigen antibody, or fragment thereof can be attached to the same substrate, e.g., bead, which can be used to remove the cells or an anti-CD25 antibody, or fragment thereof, or the anti-tumor antigen antibody, or fragment thereof, can be attached to separate beads, a mixture of which can be used to remove the cells.
  • the removal of T regulatory cells, e.g., CD25+ cells, and the removal of the tumor antigen expressing cells is sequential, and can occur, e.g., in either order.
  • the method of making further comprises removing cells from the population which express a check point inhibitor, e.g., a check point inhibitor described herein, e.g., one or more of PD1+ cells, LAG3+ cells, and TIM3+ cells, to thereby provide a population of T regulatory depleted, e.g., CD25+ depleted cells, and check point inhibitor depleted cells, e.g., PD1+, LAG3+ and/or TIM3+ depleted cells.
  • check point inhibitor expressing cells are removed simultaneously with the T regulatory, e.g., CD25+ cells.
  • an anti-CD25 antibody, or fragment thereof, and an anti-check point inhibitor antibody, or fragment thereof can be attached to the same bead which can be used to remove the cells, or an anti-CD25 antibody, or fragment thereof, and the anti-check point inhibitor antibody, or fragment there, can be attached to separate beads, a mixture of which can be used to remove the cells.
  • the removal of T regulatory cells, e.g., CD25+ cells, and the removal of the check point inhibitor expressing cells is sequential, and can occur, e.g., in either order.
  • the population of cells to be removed are neither the regulatory T cells or tumor cells, but cells that otherwise negatively affect the expansion and/or function of CART cells, e.g. cells expressing CD14, CDl lb, CD33, CD15, or other markers expressed by potentially immune suppressive cells.
  • such cells are envisioned to be removed concurrently with regulatory T cells and/or tumor cells, or following said depletion, or in another order.
  • the method further comprises removing cells from the population which express CD 14, to thereby provide a population of T regulatory-depleted, e.g., CD25+ depleted cells, and CD 14+ depleted cells.
  • CD 14+ cells are removed simultaneously with the T regulatory, e.g., CD25+ cells.
  • an anti-CD25 antibody, or fragment thereof, and an anti-CD 14 antibody, or fragment thereof can be attached to the same bead which can be used to remove the cells; or an anti-CD25 antibody, or fragment thereof, and the anti-CD 14 antibody, or fragment thereof, can be attached to separate beads, a mixture of which can be used to remove the cells.
  • the removal of T regulatory cells, e.g., CD25+ cells, and the removal of the CD 14+ cells is sequential, and can occur, e.g., in either order.
  • the population of immune effector cells provided have been selected based upon the expression of one or more markers, e.g., CD3, CD28, CD4, CD8, CD27, CD 127, CD45RA, and CD45RO, e.g., the provided population of immune effector cells (e.g., T cells) are CD3+ and/or CD28+.
  • markers e.g., CD3, CD28, CD4, CD8, CD27, CD 127, CD45RA, and CD45RO
  • the provided population of immune effector cells are CD3+ and/or CD28+.
  • the method further comprises obtaining a population of immune effector cells, e.g., T cells, enriched for the expression of one or more markers, e.g., CD3,
  • CD28, CD4, CD8, CD27, CD 127, CD45RA, and CD45RO are enriched for CD3+ and/or CD28+ cells.
  • T cells isolated by incubation with anti-CD3/anti-CD28 conjugated beads are obtained.
  • the method further comprises selecting cells from the population of T regulatory- depleted cells, e.g., CD25+ depleted cells, which express one or more markers, e.g., CD3, CD28, CD4, CD8, CD45RA, and CD45RO.
  • the method further comprises activating the population of T regulatory depleted cells, e.g., CD25+ depleted cells, e.g., by a method described herein.
  • the method further comprises transducing a cell from the immune effector cell population with a vector comprising a nucleic acid encoding a CAR, e.g., a CAR described herein, e.g., a CD19 CAR described herein.
  • the method further comprises expanding the immune effector cell population, e.g., engineered to express a CAR, e.g., a CAR described herein, e.g., a CD19 CAR described herein, e.g., by a method described herein.
  • the population of cells is expanded in the presence a cytokine, e.g., IL-15 and/or IL-7 (e.g., IL-15 and IL-7).
  • the method of making further comprises transducing a cell from the population of T regulatory-depleted cells, e.g., the population of CD25+ depleted cells, with a vector comprising a nucleic acid encoding a CAR, e.g., a CAR described herein, e.g., a CD19 CAR described herein.
  • the vector is selected from the group consisting of a DNA, a RNA, a plasmid, a lentivirus vector, adenoviral vector, or a retrovirus vector.
  • the cell from the population of T regulatory-depleted cells e.g., the population of CD25+ depleted cells
  • the method further comprises generating a population of RNA- engineered cells transiently expressing exogenous RNA from the population of T regulatory- depleted cells, e.g., the population of CD25+ depleted cells.
  • the method comprises introducing an in vitro transcribed RNA or synthetic RNA into a cell from the population, where the RNA comprises a nucleic acid encoding a CAR, e.g., a CAR described herein, e.g., a CD19 CAR described herein.
  • cells transduced with a nucleic acid encoding a CAR are expanded, e.g., by a method described herein.
  • the cells are expanded in culture for a period of several hours (e.g., about 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 18, 21 hours) to about 14 days (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 days).
  • the cells are expanded for a period of 4 to 9 days.
  • the cells are expanded for a period of 8 days or less, e.g., 7, 6 ,5, 4, or 3 days.
  • the cells are expanded in culture for 5 days, and the resulting cells are more potent than the same cells expanded in culture for 9 days under the same culture conditions. Potency can be defined, e.g., by various T cell functions, e.g. proliferation, target cell killing, cytokine production, activation, migration, or combinations thereof.
  • the cells, e.g., a CD 19 CAR cell described herein, expanded for 5 days show at least a one, two, three or four fold increase in cells doublings upon antigen stimulation as compared to the same cells expanded in culture for 9 days under the same culture conditions.
  • the cells e.g., the cells expressing a CD19 CAR described herein, are expanded in culture for 5 days, and the resulting cells exhibit higher proinflammatory cytokine production, e.g., IFN- ⁇ and/or GM-CSF levels, as compared to the same cells expanded in culture for 9 days under the same culture conditions.
  • proinflammatory cytokine production e.g., IFN- ⁇ and/or GM-CSF levels
  • the cells e.g., a CD19 CAR cell described herein, expanded for 5 days show at least a one, two, three, four, five, ten fold or more increase in pg/ml of proinflammatory cytokine production, e.g., IFN- ⁇ and/or GM-CSF levels, as compared to the same cells expanded in culture for 9 days under the same culture conditions.
  • the cells are expanded by culturing the cells in the presence of an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a costimulatory molecule on the surface of the cells, e.g., as described herein.
  • an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a costimulatory molecule on the surface of the cells e.g., as described herein.
  • the agent is a bead conjugated with anti-CD3 antibody, or a fragment thereof, and/or anti-CD28 antibody, or a fragment thereof.
  • the cells are expanded in an appropriate media (e.g., media described herein) that may, optionally, contain one or more factor for proliferation and/or viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN- ⁇ , IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, IL-21, TGFp, and TNF-a or any other additives for the growth of cells.
  • serum e.g., fetal bovine or human serum
  • IL-2 interleukin-2
  • insulin IFN- ⁇
  • IL-4 interleukin-7
  • GM-CSF GM-CSF
  • IL-10 interleukin-12
  • IL-15 IL-21
  • TGFp TNF-a or any other additives for the growth of cells
  • the cells are expanded in an appropriate media (e.g., media described herein) that includes one or more interleukins that result in at least a 200-fold (e.g., 200-fold, 250-fold, 300-fold, 350-fold) increase in cells over a 14 day expansion period, e.g., as measured by a method described herein such as flow cytometry.
  • the cells are expanded in the presence IL-15 and/or IL-7 (e.g., IL-15 and IL-7).
  • the cells are cryopreserved after the appropriate expansion period. In one embodiment, the cells are cryopreserved according to a method described herein. In one embodiment, the expanded cells are cryopreserved in an appropriate media, e.g., an infusible media, e.g., as described herein.
  • an appropriate media e.g., an infusible media, e.g., as described herein.
  • the method of making further comprises contacting the population of immune effector cells with a nucleic acid encoding a telomerase subunit, e.g., hTERT.
  • the nucleic acid is DNA or RNA.
  • the method further comprises, prior to expansion, removing T regulatory cells, e.g., CD25+ T cells, from the population, to thereby provide a population of T regulatory-depleted cells, e.g., CD25+ depleted cells to be expanded.
  • the T regulatory cells e.g., CD25+ cells
  • the method further comprises, prior to expansion, removing T regulatory cells, e.g., CD 14+ cells, from the population, to thereby provide a population of CD14+ depleted cells to be expanded.
  • the T regulatory cells, e.g., CD14+ cells are removed by a method described herein.
  • the method further comprises contacting the population of immune effector cells with a nucleic acid encoding a telomerase subunit, e.g., hTERT.
  • a telomerase subunit e.g., hTERT
  • the nucleic acid is DNA or RNA.
  • the method comprises contacting the population of immune effector cells with a nucleic acid encoding a CAR, and a nucleic acid encoding a telomerase subunit, e.g., hTERT, under conditions that allow for CAR and telomerase expression.
  • the nucleic acid encoding the telomerase subunit is RNA.
  • the nucleic acid encoding the telomerase subunit is DNA.
  • the nucleic acid encoding the telomerase subunit comprises a promoter capable of driving expression of the telomerase subunit.
  • the method of making comprises contacting the population of immune effector cells with a nucleic acid encoding a CAR and an RNA encoding a telomerase subunit, e.g., hTERT, under conditions that allow for CAR and telomerase expression.
  • nucleic acid encoding the CAR and the RNA encoding the telomerase subunit are part of the same nucleic acid molecule. In an embodiment the nucleic acid encoding the CAR and the RNA encoding the telomerase subunit are part of separate nucleic acid molecules.
  • the method comprises contacting the population of immune effector cells with a nucleic acid encoding the CAR and the RNA encoding the telomerase subunit at substantially the same time.
  • the method of making comprises contacting the population of immune effector cells with a nucleic acid encoding the CAR before contacting the population of immune effector cells with the RNA encoding the telomerase subunit.
  • the method comprises contacting the population of immune effector cells with a nucleic acid encoding the CAR after contacting the population of immune effector cells with the RNA encoding the telomerase subunit.
  • the RNA encoding the telomerase subunit is mRNA. In an embodiment, the RNA encoding the telomerase subunit comprises a poly(A) tail. In an embodiment, the RNA encoding the telomerase subunit comprises a 5' cap structure.
  • the method comprises transfecting the immune effector cells with the RNA encoding the telomerase subunit. In an embodiment, the method of making comprises transducing the immune effector cells with the RNA encoding the telomerase subunit. In an embodiment, the method of making comprises electroporating the immune effector cells with the RNA encoding the telomerase subunit, under conditions that allow for CAR and telomerase expression. In embodiments, the method comprises providing a population of immune effector cells
  • telomerase subunit e.g., hTERT
  • the method comprises providing a population of immune effector cells (e.g., T cells or NK cells) that express a nucleic acid encoding a telomerase subunit, e.g., hTERT, and and contacting the population of immune effector cells with a nucleic acid encoding a CAR, under conditions that allow for CAR expression.
  • a population of immune effector cells e.g., T cells or NK cells
  • a nucleic acid encoding a telomerase subunit e.g., hTERT
  • an immune effector cell preparation (e.g., a reaction mixture, or a population of immune effector cells) described herein is made by a method described herein.
  • the immune effector cell preparation (e.g., reaction mixture) is chosen from:
  • the population of immune effector cells comprises at least 20% naive T cells, at least 2% stem central memory T cells, and/or at least 4% central memory T cells, and/or
  • the population of immune effector cells comprises an absolute T cell count of at least 400 cells/microliter, an absolute naive T cell count of at least 200 cells/microliter, an absolute stem central memory T cell count of at least 20 cells/microliter, and/or an absolute central memory T cell count of at least 40 cells/microliter.
  • the population of immune effector cells has been selected based upon the expression of one or more markers, e.g., CCR7, CD62L, CD45RO, and CD95, e.g., the population of immune effector cells (e.g., T cells) are CCR7+ and CD62L+.
  • markers e.g., CCR7, CD62L, CD45RO, and CD95
  • the population of immune effector cells are CCR7+ and CD62L+.
  • the naive T cells are identified based upon an expression pattern of CCR7+, CD62L+, CD45RO-, CD95-, wherein the stem central memory T cells are identified based upon an expression pattern of CCR7+, CD62L+, CD45RO-, CD95+, and wherein the central memory T cells are identified based upon an expression pattern of CCR7+, CD62L+, CD45RO+, CD95+.
  • an immune effector cell preparation described herein comprises a nucleic acid encoding a CAR, e.g., a CAR as described herein.
  • an immune effector cell preparation described herein comprises a nucleic acid encoding an exogenous telomerase subunit, e.g., hTERT.
  • the nucleic acid encoding an exogenous telomerase subunit is RNA, e.g., mRNA.
  • an immune effector cell preparation described herein comprises a CAR, e.g., a CAR as described herein; and an exogenous telomerase subunit, e.g., hTERT.
  • the cell does not comprise DNA encoding the exogenous telomerase subunit.
  • the cell may have been contacted with mRNA encoding the exogenous telomerase subunit.
  • the immune effector cell preparation is a population of T regulatory-depleted cells containing less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells. In one embodiment, the immune effector cell preparation is a population of T regulatory-depleted cells containing less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25 expressing tumor cells, e.g., CLL cells.
  • the immune effector cell preparation contains less than 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 15%, 10%, 5%, 4%, 3%, 2%, 1% of tumor cells, e.g., CD25 expressing tumor cells, e.g., CLL cells. In one embodiment, the immune effector cell preparation contains less than 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 10%, 5%, 4%, 3%, 2%, 1% of tumor cells, e.g., CD25 expressing tumor cells, e.g., CLL cells.
  • the immune effector cell preparation is a population of T regulatory-depleted cells containing less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of a checkpoint inhibitor expressing cells, e.g., a PD1+ cells, LAG3+ cells, or TUVI3+ cells.
  • a checkpoint inhibitor expressing cells e.g., a PD1+ cells, LAG3+ cells, or TUVI3+ cells.
  • the immune effector cell preparation is a population of T regulatory-depleted cells containing less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD14+ cells.
  • the immune effector cell preparation described herein comprises a population of autologous immune effector cells, e.g., a plurality of which are transfected or transduced with a vector comprising a nucleic acid molecule encoding a CAR, e.g., a CAR described herein, e.g., a CD19 CAR described herein, wherein the immune effector cell preparation contains less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of tumor cells, e.g., CLL cells.
  • the immune effector cell preparation contains less than 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 15%, 10%, 5%, 4%, 3%, 2%, 1% of tumor cells, e.g., CD25 expressing tumor cells, e.g., CLL cells. In one embodiment, the immune effector cell preparation contains less than 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 10%, 5%, 4%, 3%, 2%, 1% of tumor cells, e.g., CD25 expressing tumor cells, e.g., CLL cells.
  • the reaction mixture can further comprise an agent that activates and/or expands to cells of the population, e.g., an agent that stimulates a CD3/TCR complex associated signal and/or a ligand that stimulates a costimulatory molecule on the surface of the cells, e.g., as described herein.
  • the agent is a bead conjugated with anti- CD3 antibody, or a fragment thereof, and/or anti-CD28 antibody, or a fragment thereof.
  • a reaction mixture described herein comprises a population of T regulatory-depleted cells containing less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells.
  • the reaction mixture comprises a population of T regulatory-depleted cells containing less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25 expressing tumor cells, e.g., CLL cells.
  • the population of cells contains less than 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 15%, 10%, 5%, 4%, 3%, 2%, 1% of tumor cells, e.g., CD25 expressing tumor cells, e.g., CLL cells. In one embodiment, the population of cells contains less than 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 10%, 5%, 4%, 3%, 2%, 1% of tumor cells, e.g., CD25 expressing tumor cells, e.g., CLL cells.
  • the reaction mixture comprises a population of T regulatory- depleted cells containing less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of a checkpoint inhibitor expressing cells, e.g., a PD1+ cells, LAG3+ cells, or TIM3+ cells.
  • the reaction mixture may further comprise a buffer or other reagent, e.g., a PBS containing solution.
  • the reaction mixture comprises a population of T regulatory- depleted cells containing less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells and less than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD14+ cells.
  • the reaction mixture may further comprise a buffer or other reagent, e.g., a PBS containing solution.
  • the reaction mixture further comprises one or more factor for proliferation and/or viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN- ⁇ , IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, IL-21, TGFp, and TNF-a or any other additives for the growth of cells.
  • serum e.g., fetal bovine or human serum
  • IL-2 interleukin-2
  • insulin IFN- ⁇
  • IL-4 interleukin-7
  • GM-CSF IL-10
  • IL-12 interleukin-12
  • IL-15 IL-21
  • TGFp TNF-a or any other additives for the growth of cells.
  • TGFp TGFp
  • TNF-a TNF-a or any other additives for the growth of cells.
  • the reaction mixture further comprises IL-15 and/or IL-7.
  • a plurality of the cells of the population in the reaction mixture comprise a nucleic acid molecule, e.g., a nucleic acid molecule described herein, that comprises a CAR encoding sequence, e.g., a CD19 CAR encoding sequence, e.g., as described herein.
  • a plurality of the cells of the population in the reaction mixture comprise a vector comprising a nucleic acid sequence encoding a CAR, e.g., a CAR described herein, e.g., a CD19 CAR described herein.
  • the vector is a vector described herein, e.g., a vector selected from the group consisting of a DNA, a RNA, a plasmid, a lentivirus vector, adenoviral vector, or a retrovirus vector.
  • the reaction mixture further comprises a cryoprotectant or stabilizer such as, e.g., a saccharide, an oligosaccharide, a polysaccharide and a polyol (e.g., trehalose, mannitol, sorbitol, lactose, sucrose, glucose and dextran), salts and crown ethers.
  • a cryoprotectant or stabilizer such as, e.g., a saccharide, an oligosaccharide, a polysaccharide and a polyol (e.g., trehalose, mannitol, sorbitol, lactose, sucrose, glucose and dextran), salts and crown ethers.
  • the cryoprotectant is dextran.
  • the reaction mixture comprises a population of immune effector cells wherein a plurality of the cells of the population in the reaction mixture comprise a nucleic acid molecule, e.g., a nucleic acid molecule described herein, that comprises a CAR encoding sequence, e.g., a CD 19 CAR encoding sequence, e.g., as described herein, and IL-7 and/or IL- 15.
  • a nucleic acid molecule e.g., a nucleic acid molecule described herein
  • a CAR encoding sequence e.g., a CD 19 CAR encoding sequence, e.g., as described herein, and IL-7 and/or IL- 15.
  • a plurality of the cells of the population in the reaction mixture comprise a vector comprising a nucleic acid sequence encoding a CAR, e.g., a CAR described herein, e.g., a CD19 CAR described herein.
  • the vector is a vector described herein, e.g., a vector selected from the group consisting of a DNA, a RNA, a plasmid, a lentivirus vector, adenoviral vector, or a retrovirus vector.
  • Figures 1A-1D show the differential effects of y c cytokines and IL-18 on CAR-T cell accumulation.
  • Figure 1A is a schematic diagram of C4-27z CAR vector.
  • Figure IB is a graph showing the overall accumulation of CAR-T cells in response to various cytokines exposure. T cells were transduced and exposed to various exogenous cytokines with final concentrations of lOng/mL from the next day (day 0). The numbers of CAR-T cells were calculated based on the number of T cells and the percentages of CAR expression. The curves are representative of 6 donors. *P ⁇ 0.05, ***P ⁇ 0.001. NC, no cytokine.
  • Figure 1C is a histogram showing the proliferation of T cells in response to various cytokines.
  • T cells in NC group were labeled with CFSE (2.5 ⁇ ), and then exposed to various cytokines. Seven days later, T cells were analyzed for CFSE dilution by flow cytometry.
  • Figures 2A-2F shows the memory T cell subsets of CAR-T cells.
  • Figure 2A shows CD95 expression in CD45RA+CD62L+ subpopulation of T cells before transduction and CAR- T cells 15 days after transduction.
  • Figures 2B and 2C are graphs showing the increase of memory stem T cell (Tscm) proportions in CD4+ ( Figure 2B) and CD8+ T cells ( Figure 2C) after lentiviral transduction.
  • Tscm are defined as CD45RA+CD62L+CD95+CCR7+ T cell subsets.
  • Figure 2E is a graph showing Self-renew and differentiation of different subsets of CAR-T cells.
  • Figure 2F is a histogram plot showing the proliferation of various subsets of CAR-T cells in response to IL-2.
  • FACS-sorted CAR+ Tscm, Tcm, Tern and Temra cells were labeled with CFSE (2.5 ⁇ ), and then cultured exposed to IL-2 (lOng/mL) for 3 days. Three days later, T cells were analyzed for CFSE dilution.
  • Figure 3A-3B show the correlation between CD45 RA expression and CFSE intensity.
  • Figure 3A demonstrates that CD45RAexpression is inversely correlated with CFSE intensity.
  • Figure 3B shows that for all cytokine groups (IL-2, IL-7, IL-15, IL-18 and IL-21), CD45RA+ T cells exhibited much lower CFSE levels than CD45RA dim and negative T cells indicating that CD45RA+ T cells had stronger proliferation activity than CD45RA- T cells.
  • Figure 4 shows the phenotypes of CAR-T cells resulting from exposure to different cytokines.
  • Figure 4 is a series of graphs showing the quantitation of CD45RA, CD62L, CCR7, CD27, CD28 and IL7Ra expression by FACS on the surface of CAR-T cells in indicated cytokine groups. The histograms represent mean value + SEM of expression levels from 6 independent donors. *P ⁇ 0.05, **P ⁇ 0.01 versus IL-2 group.
  • Figures 5A-5D show the functional analysis of CAR-T cells exposed to different cytokines.
  • Lentiviral transduced T cells are exposed to indicated cytokines for 14 days, and then co-cultured with SKOV3 cells for 5 hours before harvested for flow cytometry analysis.
  • Figure 5D is a graph showing the antigen specific cytotoxic activity of CAR-T cells.
  • the CAR-T cells were assessed for cytolytic ability by using a luciferase-based assay after 18-hour coculture with SKOV3 at the indicated E/T ratios. Untransduced T cells (UNT) served as negative effector controls. Data shown are mean value + SEM of six independent cytolytic assays.
  • Figure 6A-6C show the phenotype and function of the CAR-T cells described above in Figure 5.
  • Figures 6A and 6B show that CD62L+ CAR-T cells (Tscm and Tcm) exhibited less cytokine production activity (Figure 6A and 6B) and weaker cytolytic capacity (Figure 6C) when compared with CD62L- CAR-T cells (Tern and Temra).
  • Figures 7A-7B show the expansion and phenotype of CAR-T cells exposed to antigen challenge.
  • Figure 7 A depicts two graphs showing the overall accumulation and viability of CAR-T previously exposed to indicated cytokines upon antigen challenge.
  • FIG. 7B is two graphs showing the distribution of memory T subsets of CD4+ and CD8+ CAR-T cells in various cytokine groups. N.S., no statistical difference.
  • Figures 8A-8C show the antitumor activity of various CAR-T cells with previous cytokine exposure.
  • Figure 8A shows tumor growth curves of mice treated with various cytokine exposed C4-27z CAR-T cells, anti-CD19-27z CAR-T cells and untransduced T cells.
  • the data are presented as mean value + SEM.
  • the arrow indicates the time of T cell infusion.
  • Figure 8B is a graph showing the quantitation of circulating human CD4+ and CD8+ T cell counts in mice peripheral blood 15 days after the first dose of CAR-T cell infusion.
  • Figure 8C is a graph showing the quantitation of CAR expression on circulating human CD4+ and CD8+
  • Figure 9 is a series of FACS plots (top) showing the CD3 and CD19 populations and histograms (bottom) showing CD 14 expression of cells from apheresis, cells selected with anti- CD3/CD28, cells depleted for CD25, and the CD25 enriched cells.
  • Figures 10A, 10B, and IOC show the comparison of proliferation capacity between
  • FIG. 10A is a graph showing the total cell number at the indicated days in culture.
  • Figure 10B is a graph showing the quantified population doublings at each indicated day in culture.
  • Figure IOC shows the percentage of viable cells at the indicated days in culture.
  • Figure 11 is a series of FACs plots showing the distribution of CD3 and CD 19 in unmanipulated PBMCs and CD25-depleted PBMCs after culture with the indicated cytokine supplements, IL-7, IL-15, or IL-7 and IL-15.
  • Figure 12 is a set of graphs showing expansion profile in population doublings (left hand graph) and mean size ( fL)( right hand graph) of PBMCs that have been stimulated with anti-CD3 and CD28 beads, and left either unmanipulated (UTD) or transduced with a CD 19 CAR (CD 19.BB ). de-beaded, and then harvested at Day 5 and D9.
  • Figure 13 is a set of graphs depicting cytotoxicity as a percent lysis of CD 19 expressing K562 cells treated with PMBCs that have been stimulated with anti-CD3 and CD28 beads, and left either unmanipulated ( UTD) or transduced with a CD 19 CAR (CD 19.BB/). de-beaded, and then harvested at Day 5 and D9.
  • Figure 14 is a set of graphs depicting proliferation of PBMCs stimulated with anti-CD3 and CD28 beads (3x28 beads), wild type K562 cells, CD19 expressing K562 cells, ALL cells (Nalm6) or CLL cells (PI 14).
  • the PBMCs have been left either unmanipulated (UTD) or transduced with a CD 19 CAR (CART 19). de-beaded, and then harvested at Day 5 and D9.
  • Figure 15 is a schematic of an exemplary manufacturing scheme.
  • Figure 16 is a schematic of an exemplary manufacturing scheme.
  • Figure 17 is a set of graphs depicting the level of cell proliferation of two different manufacturing batches of donor cells transfected with the CTL019 CAR, CHP959-115 and CHP959-121, expanded over a period of 0 to 9 days.
  • Figure 18 is a set of graphs showing proinflammatory cytokine production, IFN- ⁇ , GM- CSF, TNF-a and IL-4 of two different manufacturing batches of donor cells transfected with either CTL019 CAR, namely CHP959-115, or an ssl-mesoCAR, namely and CHP959-121, and expanded over a period of 0 to 9 days after apheresis.
  • Figure 19 is a set of graphs depicting production levels IFN- ⁇ , TNF-a, IL-6, IL-8, IL-2,
  • IL- ⁇ , GM-CSF and IL-4 in donor cells stimulated with anti-CAR19-idiotype antibody beads or control beads, transfected with CTL019 CAR and expanded for 5 to 9 days. No cytokine or low cytokine levels ( ⁇ 200 pg/ml) were detected with the control beads.
  • Figure 20 is a graph depicting cell killing based upon total lysates using a luciferase assay of Nalm6 (ALL) cells of PBMCs left either unmanipulated ( UTD) or transduced with a CD 19 CAR (CART 19). de-beaded, and then harvested at Day 5 and D9. Various ratios of PMBCs to Nairn 6 cells (effector (E):Target (T)) were cultured. As shown CART19 cells harvested at day 5 posses a better killing capacity.
  • Figure 21 is a graph depicting long term in vivo killing capacity of PBMCs left either unmanipulated (UTD) or transduced with a CD 19 CAR (CART 19), dc- beaded, and then harvested at Day 5 and D9.
  • the PBMCs were introduced into non-obese diabetic/severe combined i m munodeficiency mice inoculated with Nalm6 cells.
  • Figure 22A is a bar graph showing the percentage of peripheral blood samples that passed test expansion from patients with ALL and NHL.
  • Figure 22B is a bar graph showing the percentage of peripheral blood samples that passed test expansion from patients with SR- ALL and HR/VHR ALL.
  • Figure 22C is a bar graph showing the absolute lymphocyte counts from peripheral blood at various times of collection from all patients who expanded more (pass) or less than (fail) the 5-fold in vitro expansion threshold.
  • Figure 22D is a bar graph showing absolute T cell counts from peripheral blood at various times of collection from all patients who passed or failed the 5-fold in vitro expansion threshold.
  • Figure 22E is a bar graph showing absolute lymphocyte counts (in cells per microliter) from peripheral blood at various times of collection from all patients with leukemia or lymphoma.
  • Figure 22F is a bar graph showing absolute T cell counts (in cells per microliter) from peripheral blood at various times of collection from patients with leukemia or lymphoma. Significant differences are denoted with an "*" above each column and represent P ⁇ 0.05. Statistical analysis can be found in Table 12.
  • Figures 23A-230 are bar graphs showing memory phenotypes of T cells harvested from the peripheral blood of patients undergoing chemotherapy. Absolute cell counts are demonstrated from samples who passed and failed the greater than five-fold expansion threshold [column 1, Figure 23 A to Figure 23E], patients with ALL or NHL [column 2, Figure 23F to Figure 23J], and patients with SR- and HR/VHR-ALL [column 3, Figure 23K to Figure 230]. Significant differences are denoted with an "*" above each column and represent P ⁇ 0.05. Statistical analysis can be found in Table 13, and a summary table can be found in Table 9.
  • Figure 24 is a bar graph showing the absolute T cell counts (in cells per microliter) from peripheral blood at various times of collection from all patients with SR- or HR/VHR- ALL. Significant differences are denoted with an "*" above each column and represent P ⁇ 0.05. Statistical analysis can be found in Table 12.
  • Figure 25 A and 25B are bar graphs showing the effect of IL-7 and IL-15 on T cell phenotype and expansion. Collected samples were split into two stimulatory cultures, either with or without IL-7 and IL-15 as described in Example 4.
  • Figure 25A is a bar graph showing the percent change in absolute memory phenotype cell count in patients with leukemia and lymphoma after culture with cytokines.
  • Figure 25B is a bar graph showing percent of samples passing test expansion evaluated after culture with or without cytokines. "All samples” represents every sample expanded without cytokines, some of which were collected before the split-culture protocol. Statistical analysis can be found in table 14.
  • Figure 26 is a set of pie charts showing post-expansion phenotypes of samples passing and failing test expansion. Phenotypes were assessed at the end of test expansion.
  • the invention is based, at least in part, on the discovery that the fitness of immune effector cells (e.g., T cells or NK cells) for use in cellular therapy (e.g., a CAR therapy, e.g., as described herein) is correlated with a number of factors, including timing of chemotherapy relative to acquisition of cells from a subject, type of chemotherapy administered to a subject from which cells are acquired, underlying malignancy of a subject (from which cells are acquired), severity of the malignancy (e.g., standard-risk, high-risk, or very high-risk ALL), percentage of less differentiated T cells (e.g., naive T cells, stem central memory T cells, or central memory T cells), percentage of terminal effector T cells, and number of T cells acquired from a subject (e.g., absolute T cell count).
  • immune effector cells e.g., T cells or NK cells
  • a CAR therapy e.g., as described herein
  • a number of factors including timing of chemotherapy relative to
  • improved T cell expansion (e.g., which can indicate suitability for use in cellular therapy) was seen using cells acquired from a patient earlier during his/her chemotherapy (e.g., before administration of a chemotherapeutic cycle that depleted T cells with high proliferative capacity).
  • a chemotherapeutic cycle that depleted T cells with high proliferative capacity.
  • improved T cell expansion was seen using cells acquired from patients prior to a delayed intensification cycle or consolidation cycle of chemotherapy.
  • the severity of disease affects the deterioration of cells, e.g., cell expansion capability.
  • cells acquired from patients having less severe disease expanded better than cells acquired from patients having more severe disease (e.g., high-risk or very high-risk ALL).
  • patients with more severe disease may require cell acquisition earlier in chemotherapy (e.g., prior to cycle 2 or a consolidation cycle) compared to patients with less severe disease (e.g., standard-risk ALL).
  • cells capable of expansion can be acquired from patients with less severe disease (e.g., standard-risk ALL) later in chemotherapy (e.g., prior to cycle 4 or a delayed intensification cycle) compared to patients with more severe disease.
  • cells acquired from patients with leukemia had a better expansion capability than cells acquired from patients with lymphoma (e.g., NHL, e.g., pediatric NHL).
  • acquired cell populations that contained a higher absolute T cell count also tended to expand better than those with a lower absolute T cell count.
  • Acquired cell populations that contained larger percentages of less differentiated immune effector cells e.g., less differentiated T cells, which tend to have higher proliferative and survival capability, exhibited better expansion capability as well.
  • chemotherapeutic cycles such as cyclophosphamide and cytarabine
  • drugs used in some chemotherapeutic cycles significantly deplete highly proliferative T cells (e.g., less differentiated T cell), and this effect is more pronounced in patients with more severe disease. Longer duration of exposure or higher doses of chemotherapeutic drugs may lead to more depletion of these populations of T cells.
  • a greater population of less differentiated T cells leads to greater T cell expansion capability, persistence, and efficacy as anti-cancer T cell therapy.
  • the methods advantageously improve T cell fitness (suitability for use in cellular therapy) and efficacy by acquiring cells from subjects early after diagnosis of a cancer, e.g., prior to chemotherapy or prior to certain/multiple chemotherapeutic cycles.
  • the methods utilize cells acquired from patients prior to
  • the methods optimize expansion capability and/or anti-tumor efficacy of the immune cells by including patient selection, e.g., based on type of malignancy (e.g., leukemia versus lymphoma) or severity of disease (e.g., standard-, high-, or very high-risk).
  • the methods optimize expansion capability and/or anti-tumor efficacy of the immune cells by including cell selection, e.g., selection of cell populations having a higher absolute T cell count, or a higher percentage of less differentiated T cells.
  • Acquire or “acquiring” as the terms are used herein, refer to obtaining possession of a physical entity (e.g., a sample, a cell or cell population, a polypeptide, a nucleic acid, or a sequence), or a value, e.g., a numerical value, by "directly acquiring” or “indirectly acquiring” the physical entity or value.
  • acquiring refers to obtaining or harvesting a cell or cell population (e.g., an immune effector cell or population as described herein).
  • Directly acquiring means performing a process (e.g., performing a synthetic or analytical or purification method) to obtain the physical entity or value.
  • “Indirectly acquiring” refers to receiving the physical entity or value from another party or source (e.g., a third party laboratory that directly acquired the physical entity or value).
  • Directly acquiring a physical entity includes performing a process that includes a physical change in a physical substance, e.g., a starting material. Exemplary changes include making a physical entity from two or more starting materials, shearing or fragmenting a substance, separating or purifying a substance, combining two or more separate entities into a mixture, performing a chemical reaction that includes breaking or forming a covalent or non-covalent bond.
  • Directly acquiring a value includes performing a process that includes a physical change in a sample or another substance, e.g., performing an analytical process which includes a physical change in a substance, e.g., a sample, analyte, or reagent (sometimes referred to herein as "physical analysis"), performing an analytical method, e.g., a method which includes one or more of the following: separating or purifying a substance, e.g., an analyte, or a fragment or other derivative thereof, from another substance; combining an analyte, or fragment or other derivative thereof, with another substance, e.g., a buffer, solvent, or reactant; or changing the structure of an analyte, or a fragment or other derivative thereof, e.g., by breaking or forming a covalent or non-covalent bond, between a first and a second atom of the analyte; or by changing the structure of a reagent, or a fragment or other derivative
  • bioequivalent refers to an amount of an agent other than the reference compound (e.g., RAD001), required to produce an effect equivalent to the effect produced by the reference dose or reference amount of the reference compound (e.g., RAD001).
  • the effect is the level of mTOR inhibition, e.g., as measured by P70 S6 kinase inhibition, e.g., as evaluated in an in vivo or in vitro assay, e.g., as measured by an assay described herein, e.g., the Boulay assay, or measurement of phosphorylated S6 levels by western blot.
  • the effect is alteration of the ratio of PD-1 positive/PD-1 negative T cells, as measured by cell sorting.
  • a bioequivalent amount or dose of an mTOR inhibitor is the amount or dose that achieves the same level of P70 S6 kinase inhibition as does the reference dose or reference amount of a reference compound. In an embodiment, a bioequivalent amount or dose of an mTOR inhibitor is the amount or dose that achieves the same level of alteration in the ratio of PD-1 positive/PD-1 negative T cells as does the reference dose or reference amount of a reference compound.
  • the term "Chimeric Antigen Receptor” or alternatively a "CAR” refers to a set of polypeptides, typically two in the simplest embodiments, which when in an immune effector cell, provides the cell with specificity for a target cell, typically a cancer cell, and with intracellular signal generation.
  • a CAR comprises at least an extracellular antigen binding domain, a transmembrane domain and a cytoplasmic signaling domain (also referred to herein as "an intracellular signaling domain") comprising a functional signaling domain derived from a stimulatory molecule and/or costimulatory molecule as defined below.
  • the set of polypeptides are contiguous with each other, e.g., are in the same polypeptide chain, e.g., comprise a chimeric fusion protein. In some embodiments, the set of polypeptides are not contiguous with each other, e.g., are in different polypeptide chains.
  • the set of polypeptides include a dimerization switch that, upon the presence of a dimerization molecule, can couple the polypeptides to one another, e.g., can couple an antigen binding domain to an intracellular signaling domain.
  • the stimulatory molecule is the zeta chain associated with the T cell receptor complex.
  • the cytoplasmic signaling domain further comprises one or more functional signaling domains derived from at least one costimulatory molecule as defined below.
  • the costimulatory molecule is chosen from the costimulatory molecules described herein, e.g.,
  • the CAR comprises a chimeric fusion protein comprising an extracellular antigen binding domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from a stimulatory molecule. In one aspect, the CAR comprises a chimeric fusion protein comprising an extracellular antigen binding domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from a costimulatory molecule and a functional signaling domain derived from a stimulatory molecule.
  • the CAR comprises a chimeric fusion protein comprising an extracellular antigen binding domain, a transmembrane domain and an intracellular signaling domain comprising two functional signaling domains derived from one or more costimulatory molecule(s) and a functional signaling domain derived from a stimulatory molecule.
  • the CAR comprises a chimeric fusion protein comprising an extracellular antigen binding domain, a transmembrane domain and an intracellular signaling domain comprising at least two functional signaling domains derived from one or more costimulatory molecule(s) and a functional signaling domain derived from a stimulatory molecule.
  • the CAR comprises an optional leader sequence at the amino-terminus (N-ter) of the CAR fusion protein.
  • the CAR further comprises a leader sequence at the N-terminus of the
  • the leader sequence is optionally cleaved from the antigen binding domain (e.g., a scFv) during cellular processing and localization of the CAR to the cellular membrane.
  • the antigen binding domain e.g., a scFv
  • a CAR that comprises an antigen binding domain (e.g., a scFv, or TCR) that targets a specific tumor antigen X, such as those described herein, is also referred to as XCAR.
  • XCAR a CAR that comprises an antigen binding domain that targets CD 19
  • CD19CAR a CAR that comprises an antigen binding domain that targets CD 19
  • signaling domain refers to the functional portion of a protein which acts by transmitting information within the cell to regulate cellular activity via defined signaling pathways by generating second messengers or functioning as effectors by responding to such messengers.
  • antibody refers to a protein, or polypeptide sequence derived from an immunoglobulin molecule which specifically binds with an antigen.
  • Antibodies can be polyclonal or monoclonal, multiple or single chain, or intact
  • immunoglobulins may be derived from natural sources or from recombinant sources.
  • Antibodies can be tetramers of immunoglobulin molecules.
  • antibody fragment refers to at least one portion of an antibody, that retains the ability to specifically interact with (e.g., by binding, steric hinderance,
  • antibody fragments include, but are not limited to, Fab, Fab', F(ab') 2 , Fv fragments, scFv antibody fragments, disulfide-linked Fvs (sdFv), a Fd fragment consisting of the VH and CHI domains, linear antibodies, single domain antibodies such as sdAb (either VL or VH), camelid VHH domains, multi- specific antibodies formed from antibody fragments such as a bivalent fragment comprising two Fab fragments linked by a disulfide brudge at the hinge region, and an isolated CDR or other epitope binding fragments of an antibody.
  • An antigen binding fragment can also be incorporated into single domain antibodies, maxibodies, minibodies, nanobodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, Nature Biotechnology 23: 1126-1136, 2005).
  • Antigen binding fragments can also be grafted into scaffolds based on polypeptides such as a fibronectin type III (Fn3)(see U.S. Patent No.: 6,703,199, which describes fibronectin polypeptide minibodies).
  • scFv refers to a fusion protein comprising at least one antibody fragment comprising a variable region of a light chain and at least one antibody fragment comprising a variable region of a heavy chain, wherein the light and heavy chain variable regions are contiguously linked, e.g., via a synthetic linker, e.g., a short flexible polypeptide linker, and capable of being expressed as a single chain polypeptide, and wherein the scFv retains the specificity of the intact antibody from which it is derived.
  • a synthetic linker e.g., a short flexible polypeptide linker
  • an scFv may have the VL and VH variable regions in either order, e.g., with respect to the N- terminal and C-terminal ends of the polypeptide, the scFv may comprise VL-linker-VH or may comprise VH-linker-VL.
  • the portion of a CAR comprising an antibody or antibody fragment thereof may exist in a variety of forms where the antigen binding domain is expressed as part of a contiguous polypeptide chain including, for example, a single domain antibody fragment (sdAb), a single chain antibody (scFv) and a humanized antibody (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In:
  • sdAb single domain antibody fragment
  • scFv single chain antibody
  • humanized antibody Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In:
  • the antigen binding domain of a CAR comprises an antibody fragment.
  • the CAR comprises an antibody fragment that comprises a scFv.
  • the precise amino acid sequence boundaries of a given CDR can be determined using any of a number of well-known schemes, including those described by Kabat et al. (1991), "Sequences of Proteins of Immunological Interest," 5th Ed.
  • binding domain refers to a protein, e.g., an immunoglobulin chain or fragment thereof, comprising at least one immunoglobulin variable domain sequence.
  • binding domain or “antibody molecule” encompasses antibodies and antibody fragments.
  • an antibody molecule is a multispecific antibody molecule, e.g., it comprises a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
  • a multispecific antibody molecule is a bispecific antibody molecule.
  • a bispecific antibody has specificity for no more than two antigens.
  • a bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope.
  • the term "complementarity determining region" or "CDR,” as used herein, refers to the sequences of amino acids within antibody variable regions which confer antigen specificity and binding affinity. For example, in general, there are three CDRs in each heavy chain variable region (e.g., HCDR1, HCDR2, and HCDR3) and three CDRs in each light chain variable region (LCDR1, LCDR2, and LCDR3).
  • the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3).
  • the CDR amino acids in the VH are numbered 26-32 (HCDR1), 52-56 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the VL are numbered 26-32 (LCDR1), 50-52 (LCDR2), and 91-96 (LCDR3).
  • the CDRs correspond to the amino acid residues that are part of a Kabat CDR, a Chothia CDR, or both.
  • the CDRs correspond to amino acid residues 26-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3) in a VH, e.g., a mammalian VH, e.g., a human VH; and amino acid residues 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3) in a VL, e.g., a mammalian VL, e.g., a human VL.
  • the portion of the CAR of the invention comprising an antibody or antibody fragment thereof may exist in a variety of forms where the antigen binding domain is expressed as part of a contiguous polypeptide chain including, for example, a single domain antibody fragment (sdAb), a single chain antibody (scFv), a humanized antibody, or bispecific antibody (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, New York; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; Bird et al., 1988, Science 242:423-426).
  • sdAb single domain antibody fragment
  • scFv single chain antibody
  • humanized antibody or bispecific antibody
  • the antigen binding domain of a CAR composition of the invention comprises an antibody fragment.
  • the CAR comprises an antibody fragment that comprises a scFv.
  • antibody heavy chain refers to the larger of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations, and which normally determines the class to which the antibody belongs.
  • antibody light chain refers to the smaller of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations. Kappa ( ⁇ ) and lambda ( ⁇ ) light chains refer to the two major antibody light chain isotypes.
  • recombinant antibody refers to an antibody which is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage or yeast expression system.
  • the term should also be construed to mean an antibody which has been generated by the synthesis of a DNA molecule encoding the antibody and which DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, wherein the DNA or amino acid sequence has been obtained using recombinant DNA or amino acid sequence technology which is available and well known in the art.
  • antigen or "Ag” refers to a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both.
  • antibody production or the activation of specific immunologically-competent cells, or both.
  • any macromolecule including virtually all proteins or peptides, can serve as an antigen.
  • antigens can be derived from recombinant or genomic DNA.
  • any DNA which comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an "antigen" as that term is used herein.
  • an antigen need not be encoded solely by a full length nucleotide sequence of a gene. It is readily apparent that the present invention includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to encode polypeptides that elicit the desired immune response.
  • an antigen need not be encoded by a "gene” at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample, or might be macromolecule besides a polypeptide. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a fluid with other biological components.
  • a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a fluid with other biological components.
  • autologous refers to any material derived from the same individual to whom it is later to be re-introduced into the individual.
  • allogeneic refers to any material derived from a different animal of the same species as the individual to whom the material is introduced. Two or more individuals are said to be allogeneic to one another when the genes at one or more loci are not identical. In some aspects, allogeneic material from individuals of the same species may be sufficiently unlike genetically to interact antigenically
  • xenogeneic refers to any material derived from an animal of a different species.
  • cancer refers to a disease characterized by the uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers are described herein and include but are not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer and the like.
  • tumor and “cancer” are used interchangeably herein, e.g., both terms encompass solid and liquid, e.g., diffuse or circulating, tumors. As used herein, the term “cancer” or “tumor” includes premalignant, as well as malignant cancers and tumors.
  • “Derived from” indicates a relationship between a first and a second molecule. It generally refers to structural similarity between the first molecule and a second molecule and does not conotate or include a process or source limitation on a first molecule that is derived from a second molecule. For example, in the case of an intracellular signaling domain that is derived from a CD3zeta molecule, the intracellular signaling domain retains sufficient CD3zeta structure such that is has the required function, namely, the ability to generate a signal under the appropriate conditions.
  • disease associated with expression of a tumor antigen includes, but is not limited to, a disease associated with expression of a tumor antigen as described herein or condition associated with cells which express a tumor antigen as described herein including, e.g., proliferative diseases such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia; or a noncancer related indication associated with cells which express a tumor antigen as described herein.
  • a cancer associated with expression of a tumor antigen as described herein is a hematological cancer.
  • a cancer associated with expression of a tumor antigen as described herein is a solid cancer.
  • Further diseases associated with expression of a tumor antigen as described herein include, but not limited to, e.g., atypical and/or non-classical cancers, malignancies, precancerous conditions or proliferative diseases associated with expression of a tumor antigen as described herein.
  • Non-cancer related indications associated with expression of a tumor antigen as described herein include, but are not limited to, e.g., autoimmune disease, (e.g., lupus), inflammatory disorders (allergy and asthma) and transplantation.
  • the tumor antigen-expressing cells express, or at any time expressed, mRNA encoding the tumor antigen.
  • the tumor antigen-expressing cells produce the tumor antigen protein (e.g., wild-type or mutant), and the tumor antigen protein may be present at normal levels or reduced levels.
  • the tumor antigen -expressing cells produced detectable levels of a tumor antigen protein at one point, and subsequently produced substantially no detectable tumor antigen protein.
  • CD19 refers to the Cluster of Differentiation 19 protein, which is an antigenic determinant detectable on leukemia precursor cells.
  • the human and murine amino acid and nucleic acid sequences can be found in a public database, such as GenBank, UniProt and Swiss-Prot.
  • the amino acid sequence of human CD19 can be found as UniProt/Swiss-Prot Accession No. P15391 and the nucleotide sequence encoding of the human CD19 can be found at Accession No. NM_001178098.
  • CD19 includes proteins comprising mutations, e.g., point mutations, fragments, insertions, deletions and splice variants of full length wild-type CD19.
  • CD19 is expressed on most B lineage cancers, including, e.g., acute lymphoblastic leukaemia, chronic lymphocyte leukaemia and non-Hodgkin lymphoma. Other cells with express CD 19 are provided below in the definition of "disease associated with expression of CD19.” It is also an early marker of B cell progenitors. See, e.g., Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997).
  • the antigen-binding portion of the CART recognizes and binds an antigen within the extracellular domain of the CD19 protein.
  • the CD19 protein is expressed on a cancer cell.
  • disease associated with expression of CD19 includes, but is not limited to, a disease associated with expression of CD19 (e.g., wild-type or mutant CD19) or condition associated with cells which express, or at any time expressed, CD19 (e.g., wild-type or mutant CD 19) including, e.g., proliferative diseases such as a cancer or malignancy or a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia; or a noncancer related indication associated with cells which express CD19.
  • a disease associated with expression of CD 19 may include a condition associated with cells which do not presently express CD 19, e.g., because CD 19 expression has been
  • a cancer associated with expression of CD19 is a hematological cancer.
  • the hematolical cancer is a leukemia or a lymphoma.
  • a cancer associated with expression of CD 19 includes cancers and malignancies including, but not limited to, e.g., one or more acute leukemias including but not limited to, e.g., B-cell acute Lymphoid Leukemia (BALL), T-cell acute Lymphoid Leukemia (TALL), acute lymphoid leukemia (ALL); one or more chronic leukemias including but not limited to, e.g., chronic myelogenous leukemia (CML), Chronic Lymphoid Leukemia (CLL).
  • BALL B-cell acute Lymphoid Leukemia
  • TALL T-cell acute Lymphoid Leukemia
  • ALL acute lymphoid leukemia
  • chronic leukemias including but not limited to, e.g., chronic myelogenous leukemia (CML), Chronic Lymphoid Leukemia (CLL).
  • Additional cancers or hematologic conditions associated with expression of CD 19 comprise, but are not limited to, e.g., B cell prolymphocytic leukemia, blastic plasmacytoid dendritic cell neoplasm, Burkitt's lymphoma, diffuse large B cell lymphoma, Follicular lymphoma, Hairy cell leukemia, small cell- or a large cell-follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma (MCL), Marginal zone lymphoma, multiple myeloma, myelodysplasia and myelodysplastic syndrome, non-Hodgkin lymphoma, Hodgkin lymphoma, plasmablastic lymphoma, plasmacytoid dendritic cell neoplasm, Waldenstrom macroglobulinemia, and "preleukemia" which are a diverse collection of hematological conditions united by ineffective production (or dysplasia)
  • CD19 expression includes, but not limited to, e.g., atypical and/or non-classical cancers, malignancies, precancerous conditions or proliferative diseases associated with expression of CD19.
  • Non-cancer related indications associated with expression of CD19 include, but are not limited to, e.g., autoimmune disease, (e.g., lupus), inflammatory disorders (allergy and asthma) and transplantation.
  • the CD19-expressing cells express, or at any time expressed, CD19 mRNA.
  • the CD19-expressing cells produce a CD19 protein (e.g., wild-type or mutant), and the CD 19 protein may be present at normal levels or reduced levels.
  • the CD19-expressing cells produced detectable levels of a CD 19 protein at one point, and subsequently produced substantially no detectable CD 19 protein.
  • conservative sequence modifications refers to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody or antibody fragment containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody or antibody fragment of the invention by standard techniques known in the art, such as site- directed mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine
  • beta-branched side chains e.g., threonine, valine, isoleucine
  • aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
  • stimulation refers to a primary response induced by binding of a stimulatory molecule (e.g., a TCR/CD3 complex or CAR) with its cognate ligand (or tumor antigen in the case of a CAR) thereby mediating a signal transduction event, such as, but not limited to, signal transduction via the TCR/CD3 complex or signal transduction via the appropriate NK receptor or signaling domains of the CAR.
  • a stimulatory molecule e.g., a TCR/CD3 complex or CAR
  • its cognate ligand or tumor antigen in the case of a CAR
  • Stimulation can mediate altered expression of certain molecules.
  • the term "stimulatory molecule,” refers to a molecule expressed by an immune cell (e.g., T cell, NK cell, B cell) that provides the cytoplasmic signaling sequence(s) that regulate activation of the immune cell in a stimulatory way for at least some aspect of the immune cell signaling pathway.
  • the signal is a primary signal that is initiated by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, and which leads to mediation of a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
  • a primary cytoplasmic signaling sequence (also referred to as a "primary signaling domain") that acts in a stimulatory manner may contain a signaling motif which is known as immunoreceptor tyrosine-based activation motif or ⁇ .
  • a signaling motif which is known as immunoreceptor tyrosine-based activation motif or ⁇ .
  • an ⁇ containing cytoplasmic signaling sequence that is of particular use in the invention includes, but is not limited to, those derived from CD3 zeta, common FcR gamma (FCER1G), Fc gamma RIIa réelle FcR beta (Fc Epsilon Rib), CD3 gamma, CD3 delta , CD3 epsilon, , CD79a, CD79b, DAP10, and DAP12.
  • the intracellular signaling domain in any one or more CARS of the invention comprises an intracellular signaling sequence, e.g., a primary signaling sequence of CD3-zeta.
  • the primary signaling sequence of CD3-zeta is the sequence provided as SEQ ID NO:9, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
  • the primary signaling sequence of CD3-zeta is the sequence as provided in SEQ ID NO: 10, or the equivalent residues from a non- human species, e.g., mouse, rodent, monkey, ape and the like.
  • an antigen presenting cell refers to an immune system cell such as an accessory cell (e.g., a B-cell, a dendritic cell, and the like) that displays a foreign antigen complexed with major histocompatibility complexes (MHC's) on its surface. T-cells may recognize these complexes using their T-cell receptors (TCRs). APCs process antigens and present them to T-cells.
  • the intracellular signaling domain is the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact chain as long as it transduces the effector function signal.
  • intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
  • the intracellular signaling domain can comprise a primary intracellular signaling domain.
  • Exemplary primary intracellular signaling domains include those derived from the molecules responsible for primary stimulation, or antigen dependent simulation.
  • the intracellular signaling domain can comprise a costimulatory intracellular domain.
  • Exemplary costimulatory intracellular signaling domains include those derived from molecules responsible for costimulatory signals, or antigen independent stimulation.
  • a primary intracellular signaling domain can comprise a cytoplasmic sequence of a T cell receptor
  • a costimulatory intracellular signaling domain can comprise cytoplasmic sequence from co-receptor or costimulatory molecule.
  • a primary intracellular signaling domain can comprise a signaling motif which is known as an immunoreceptor tyrosine-based activation motif or IT AM.
  • IT AM immunoreceptor tyrosine-based activation motif
  • ⁇ containing primary cytoplasmic signaling sequences include, but are not limited to, those derived from CD3 zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d, CD278 (“ICOS”), FceRI, CD66d, CD32, DAP10 and DAP12.
  • zeta or alternatively “zeta chain”, “CD3-zeta” or “TCR-zeta” is defined as the protein provided as GenBan Acc. No. BAG36664.1, or the equivalent residues from a non- human species, e.g., mouse, rodent, monkey, ape and the like, and a "zeta stimulatory domain” or alternatively a "CD3-zeta stimulatory domain” or a “TCR-zeta stimulatory domain” is defined as the amino acid residues from the cytoplasmic domain of the zeta chain that are sufficient to functionally transmit an initial signal necessary for T cell activation.
  • the cytoplasmic domain of zeta comprises residues 52 through 164 of GenBank Acc. No.
  • the "zeta stimulatory domain” or a "CD3-zeta stimulatory domain” is the sequence provided as SEQ ID NO:9. In one aspect, the "zeta stimulatory domain” or a “CD3-zeta stimulatory domain” is the sequence provided as SEQ ID NO: 10.
  • costimulatory molecule refers to the cognate binding partner on a T cell that specifically binds with a costimulatory ligand, thereby mediating a costimulatory response by the T cell, such as, but not limited to, proliferation.
  • Costimulatory molecules are cell surface molecules other than antigen receptors or their ligands that are contribute to an efficient immune response.
  • Costimulatory molecules include, but are not limited to an MHC class I molecule, a TNF receptor protein, an Immunoglobulin-like protein, a cytokine receptor, an integrins, a signalling lymphocytic activation molecule (SLAM protein), an activating NK cell receptor, BTLA, a Toll ligand receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, CDS, ICAM-1, LFA-1 (CDl la/CD18), 4-lBB (CD137), B7-H3, CDS, ICAM-1, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD 19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49
  • a costimulatory intracellular signaling domain refers to the intracellular portion of a costimulatory intracellular signaling domain
  • the intracellular signaling domain can comprise the entire
  • 4- IBB refers to a member of the TNFR superfamily with an amino acid sequence provided as GenBank Acc. No. AAA62478.2, or the equivalent residues from a non- human species, e.g., mouse, rodent, monkey, ape and the like; and a "4-lBB costimulatory domain” is defined as amino acid residues 214-255 of GenBank Acc. No. AAA62478.2, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
  • the "4-lBB costimulatory domain” is the sequence provided as SEQ ID NO:7 or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
  • Immuno effector cell refers to a cell that is involved in an immune response, e.g., in the promotion of an immune effector response.
  • immune effector cells include T cells, e.g., alpha/beta T cells and gamma/delta T cells, B cells, natural killer (NK) cells, natural killer T (NKT) cells, mast cells, and myeloic-derived phagocytes.
  • T cells e.g., alpha/beta T cells and gamma/delta T cells
  • B cells natural killer (NK) cells, natural killer T (NKT) cells, mast cells, and myeloic-derived phagocytes.
  • NK natural killer
  • NKT natural killer T
  • an immune effector function or response refers a property of a T or NK cell that promotes killing or the inhibition of growth or proliferation, of a target cell.
  • primary stimulation and co-stimulation are examples of immune effector function or response.
  • encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (e.g., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
  • a gene, cDNA, or RNA encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
  • Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non- coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
  • nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
  • the phrase nucleotide sequence that encodes a protein or a RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
  • endogenous refers to any material from or produced inside an organism, cell, tissue or system.
  • exogenous refers to any material introduced from or produced outside an organism, cell, tissue or system.
  • expression refers to the transcription and/or translation of a particular nucleotide sequence driven by a promoter.
  • transfer vector refers to a composition of matter which comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell.
  • Numerous vectors are known in the art including, but not limited to, linear polynucleotides, polynucleotides associated with ionic or amphiphilic compounds, plasmids, and viruses.
  • the term "transfer vector” includes an autonomously replicating plasmid or a virus.
  • the term should also be construed to further include non-plasmid and non-viral compounds which facilitate transfer of nucleic acid into cells, such as, for example, a polylysine compound, liposome, and the like.
  • Examples of viral transfer vectors include, but are not limited to, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, lentiviral vectors, and the like.
  • expression vector refers to a vector comprising a recombinant
  • polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed.
  • An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system.
  • Expression vectors include all those known in the art, including cosmids, plasmids (e.g., naked or contained in liposomes) and viruses (e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the recombinant polynucleotide.
  • lentivirus refers to a genus of the Retroviridae family.
  • Lentiviruses are unique among the retroviruses in being able to infect non-dividing cells; they can deliver a significant amount of genetic information into the DNA of the host cell, so they are one of the most efficient methods of a gene delivery vector. HIV, SIV, and FIV are all examples of lentiviruses.
  • the term "lentiviral vector" refers to a vector derived from at least a portion of a lentivirus genome, including especially a self-inactivating lentiviral vector as provided in Milone et al., Mol. Ther. 17(8): 1453-1464 (2009).
  • lentivirus vectors that may be used in the clinic, include but are not limited to, e.g., the LENTIVECTOR® gene delivery technology from Oxford BioMedica, the LENTIMAXTM vector system from Lentigen and the like. Nonclinical types of lentiviral vectors are also available and would be known to one skilled in the art.
  • homologous refers to the subunit sequence identity between two polymeric molecules, e.g., between two nucleic acid molecules, such as, two DNA molecules or two RNA molecules, or between two polypeptide molecules.
  • two nucleic acid molecules such as, two DNA molecules or two RNA molecules
  • polypeptide molecules between two polypeptide molecules.
  • a subunit position in both of the two molecules is occupied by the same monomeric subunit; e.g., if a position in each of two DNA molecules is occupied by adenine, then they are homologous or identical at that position.
  • the homology between two sequences is a direct function of the number of matching or homologous positions; e.g., if half (e.g., five positions in a polymer ten subunits in length) of the positions in two sequences are homologous, the two sequences are 50% homologous; if 90% of the positions (e.g., 9 of 10), are matched or homologous, the two sequences are 90% homologous.
  • Humanized forms of non-human (e.g., murine) antibodies are chimeric
  • humanized antibodies and antibody fragments thereof are human immunoglobulins (recipient antibody or antibody fragment) in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity, and capacity.
  • CDR complementary-determining region
  • donor antibody such as mouse, rat or rabbit having the desired specificity, affinity, and capacity.
  • Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • a humanized antibody/antibody fragment can comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences.
  • the humanized antibody or antibody fragment thereof will comprise substantially all of at least one, and typically two, variable domains, in which all or
  • substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or a significant portion of the FR regions are those of a human immunoglobulin sequence.
  • the humanized antibody or antibody fragment can also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • Fully human refers to an immunoglobulin, such as an antibody or antibody fragment, where the whole molecule is of human origin or consists of an amino acid sequence identical to a human form of the antibody or immunoglobulin.
  • isolated means altered or removed from the natural state.
  • a nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.”
  • An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
  • A refers to adenosine
  • C refers to cytosine
  • G refers to guanosine
  • T refers to thymidine
  • U refers to uridine.
  • operably linked refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter.
  • a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
  • a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
  • Operably linked DNA sequences can be contiguous with each other and, e.g., where necessary to join two protein coding regions, are in the same reading frame.
  • parenteral administration of an immunogenic composition includes, e.g., subcutaneous (s.c), intravenous (i.v.), intramuscular (i.m.), or intrasternal injection, intratumoral, or infusion techniques.
  • nucleic acid refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double- stranded form.
  • nucleic acid includes a gene, cDNA, or an mRNA.
  • the nucleic acid molecule is synthetic (e.g., chemically synthesized) or recombinant. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides.
  • nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated.
  • degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell.
  • peptide refers to a compound comprised of amino acid residues covalently linked by peptide bonds.
  • a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence.
  • Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds.
  • polypeptides include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others.
  • a polypeptide includes a natural peptide, a recombinant peptide, or a combination thereof.
  • promoter refers to a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence.
  • promoter/regulatory sequence refers to a nucleic acid sequence which is required for expression of a gene product operably linked to the promoter/regulatory sequence. In some instances, this sequence may be the core promoter sequence and in other instances, this sequence may also include an enhancer sequence and other regulatory elements which are required for expression of the gene product.
  • the promoter/regulatory sequence may, for example, be one which expresses the gene product in a tissue specific manner.
  • constitutive promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell under most or all physiological conditions of the cell.
  • inducible promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide which encodes or specifies a gene product, causes the gene product to be produced in a cell substantially only when an inducer which corresponds to the promoter is present in the cell.
  • tissue-specific promoter refers to a nucleotide sequence which, when operably linked with a polynucleotide encodes or specified by a gene, causes the gene product to be produced in a cell substantially only if the cell is a cell of the tissue type corresponding to the promoter.
  • cancer associated antigen or “tumor antigen” interchangeably refers to a molecule (typically protein, carbohydrate or lipid) that is preferentially expressed on the surface of a cancer cell, either entirely or as a fragment (e.g., MHC/peptide), in comparison to a normal cell, and which is useful for the preferential targeting of a pharmacological agent to the cancer cell.
  • a cancer-associated antigen is a cell surface molecule that is overexpressed in a cancer cell in comparison to a normal cell, for instance, 1-fold over expression, 2-fold overexpression, 3-fold overexpression or more in comparison to a normal cell.
  • a cancer-associated antigen is a cell surface molecule that is inappropriately synthesized in the cancer cell, for instance, a molecule that contains deletions, additions or mutations in comparison to the molecule expressed on a normal cell.
  • a cancer-associated antigen will be expressed exclusively on the cell surface of a cancer cell, entirely or as a fragment (e.g., MHC/peptide), and not synthesized or expressed on the surface of a normal cell.
  • the CARs of the present invention includes CARs comprising an antigen binding domain (e.g., antibody or antibody fragment) that binds to a MHC presented peptide.
  • MHC class I molecules Major histocompatibility complex (MHC) class I molecules, and are recognized by T cell receptors (TCRs) on CD8 + T lymphocytes.
  • TCRs T cell receptors
  • virus -specific and/or tumor- specific peptide/MHC complexes represent a unique class of cell surface targets for
  • TCR-like antibodies targeting peptides derived from viral or tumor antigens in the context of human leukocyte antigen (HLA)-Al or HLA-A2 have been described (see, e.g., Sastry et al., J Virol.
  • TCR-like antibody can be identified from screening a library, such as a human scFv phage displayed library.
  • flexible polypeptide linker or "linker” as used in the context of a scFv refers to a peptide linker that consists of amino acids such as glycine and/or serine residues used alone or in combination, to link variable heavy and variable light chain regions together.
  • the flexible polypeptide linkers include, but are not limited to, (Gly4 Ser)4 (SEQ ID NO:27) or (Gly4 Ser)3 (SEQ ID NO:28).
  • the linkers include multiple repeats of (Gly2Ser), (GlySer) or (Gly3Ser) (SEQ ID NO:29).
  • the linker is GSTSGSGKPGSGEGSTKG (SEQ ID NO: 104) Also included within the scope of the invention are linkers described in WO2012/138475, incorporated herein by reference).
  • a 5' cap (also termed an RNA cap, an RNA 7-methylguanosine cap or an RNA m G cap) is a modified guanine nucleotide that has been added to the "front" or 5' end of a eukaryotic messenger RNA shortly after the start of transcription.
  • the 5' cap consists of a terminal group which is linked to the first transcribed nucleotide. Its presence is critical for recognition by the ribosome and protection from RNases. Cap addition is coupled to transcription, and occurs co-transcriptionally, such that each influences the other. Shortly after the start of transcription, the 5' end of the mRNA being synthesized is bound by a cap- synthesizing complex associated with RNA polymerase.
  • in vitro transcribed RNA refers to RNA, preferably mRNA, that has been synthesized in vitro. Generally, the in vitro transcribed RNA is generated from an in vitro transcription vector. The in vitro transcription vector comprises a template that is used to generate the in vitro transcribed RNA.
  • a "poly(A)” is a series of adenosines attached by polyadenylation to the mRNA.
  • the polyA is between 50 and 5000 (SEQ ID NO: 30), preferably greater than 64, more preferably greater than 100, most preferably greater than 300 or 400 poly(A) sequences can be modified chemically or enzymatically to modulate mRNA functionality such as localization, stability or efficiency of translation.
  • polyadenylation refers to the covalent linkage of a polyadenylyl moiety, or its modified variant, to a messenger RNA molecule.
  • mRNA messenger RNA
  • 3' poly(A) tail is a long sequence of adenine nucleotides (often several hundred) added to the pre-mRNA through the action of an enzyme, polyadenylate polymerase.
  • polyadenylate polymerase an enzyme that catalyzes the adenine nucleotide
  • the poly(A) tail is added onto transcripts that contain a specific sequence, the polyadenylation signal.
  • the poly(A) tail and the protein bound to it aid in protecting mRNA from degradation by exonucleases. Polyadenylation is also important for transcription termination, export of the mRNA from the nucleus, and translation.
  • Polyadenylation occurs in the nucleus immediately after transcription of DNA into RNA, but additionally can also occur later in the cytoplasm.
  • the mRNA chain is cleaved through the action of an endonuclease complex associated with RNA polymerase.
  • the cleavage site is usually characterized by the presence of the base sequence AAUAAA near the cleavage site.
  • adenosine residues are added to the free 3' end at the cleavage site.
  • transient refers to expression of a non-integrated transgene for a period of hours, days or weeks, wherein the period of time of expression is less than the period of time for expression of the gene if integrated into the genome or contained within a stable plasmid replicon in the host cell.
  • Apheresis is the process in which whole blood is removed from an individual, separated into select components, and the remainder returned to circulation.
  • separation of blood components centrifugal and non-centrifugal.
  • Leukapheresis results in the active selection and removal of the patient's white blood cells.
  • the terms “treat”, “treatment” and “treating” refer to the reduction or amelioration of the progression, severity and/or duration of a proliferative disorder, or the amelioration of one or more symptoms (preferably, one or more discernible symptoms) of a proliferative disorder resulting from the administration of one or more therapies (e.g., one or more therapeutic agents such as a CAR of the invention).
  • the terms “treat”, “treatment” and “treating” refer to the amelioration of at least one measurable physical parameter of a proliferative disorder, such as growth of a tumor, not necessarily discernible by the patient.
  • the terms “treat”, “treatment” and “treating” -refer to the inhibition of the progression of a proliferative disorder, either physically by, e.g., stabilization of a discernible symptom, physiologically by, e.g., stabilization of a physical parameter, or both.
  • the terms “treat”, “treatment” and “treating” refer to the reduction or stabilization of tumor size or cancerous cell count. Treatment need not be 100%, and in some embodiments a reduction or delay in at least one symptom of the disease or disorder by at least 50%, 60%, 70%, 80%, 90%, 95%, or 99% is sufficient to be considered within these terms.
  • Refractory refers to a disease, e.g., cancer, that does not respond to a treatment.
  • a refractory cancer can be resistant to a treatment before or at the beginning of the treatment. In other embodiments, the refractory cancer can become refractory during a treatment.
  • relapse refers to reappearance of a disease (e.g., cancer) after an initial period of responsiveness (e.g., complete response or partial response).
  • the initial period of responsiveness may involve the level of cancer cells falling below a certain threshold, e.g., below 20%, 1%, 10%, 5%, 4%, 3%, 2%, or 1%.
  • the reappearance may involve the level of cancer cells rising above a certain threshold, e.g., above 20%, 1%, 10%, 5%, 4%, 3%, 2%, or 1%.
  • Relapse may be identified, e.g., using the Cheson criteria as described in Cheson et al, J Clin Oncol 17: 1244 (1999) and Cheson et al., "Revised Response Criteria for Malignant Lymphoma", J Clin Oncol 25:579-586 (2007) (both of which are incorporated by reference herein in their entireties).
  • the reappearance may involve, e.g., a reappearance of blasts in the blood, bone marrow (> 5%), or any extramedullary site, after a complete response.
  • a complete response in this context, may involve ⁇ 5% BM blast.
  • a response can involve the absence of detectable MRD (minimal residual disease).
  • MRD minimal residual disease
  • the initial period of responsiveness lasts at least 1, 2, 3, 4, 5, or 6 days; at least 1, 2, 3, or 4 weeks; at least 1, 2, 3, 4, 6, 8, 10, or 12 months; or at least 1, 2, 3, 4, or 5 years.
  • signal transduction pathway refers to the biochemical relationship between a variety of signal transduction molecules that play a role in the transmission of a signal from one portion of a cell to another portion of a cell.
  • cell surface receptor includes molecules and complexes of molecules capable of receiving a signal and transmitting signal across the membrane of a cell.
  • a substantially purified cell refers to a cell that is essentially free of other cell types.
  • a substantially purified cell also refers to a cell which has been separated from other cell types with which it is normally associated in its naturally occurring state.
  • a population of substantially purified cells refers to a homogenous population of cells. In other instances, this term refers simply to cell that have been separated from the cells with which they are naturally associated in their natural state.
  • the cells are cultured in vitro. In other aspects, the cells are not cultured in vitro.
  • tumor antigen or “hyperproliferative disorder antigen” or “antigen associated with a hyperproliferative disorder” refers to antigens that are common to specific hyperproliferative disorders.
  • the tumor antigen is derived from a cancer including but not limited to primary or metastatic melanoma, thymoma, lymphoma, sarcoma, lung cancer, liver cancer, non-Hodgkin lymphoma, Hodgkin lymphoma, leukemias, uterine cancer, cervical cancer, bladder cancer, kidney cancer and adenocarcinomas such as breast cancer, prostate cancer, ovarian cancer, pancreatic cancer, and the like.
  • transfected or “transformed” or “transduced” refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
  • a “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid.
  • the cell includes the primary subject cell and its progeny.
  • the term “specifically binds,” refers to an antibody, or a ligand, which recognizes and binds with a cognate binding partner (e.g., a stimulatory and/or costimulatory molecule present on a T cell) protein present in a sample, but which antibody or ligand does not substantially recognize or bind other molecules in the sample.
  • a cognate binding partner e.g., a stimulatory and/or costimulatory molecule present on a T cell
  • ranges throughout this disclosure, various aspects of the invention can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6.
  • a range such as 95-99% identity includes something with 95%, 96%, 97%, 98% or 99% identity, and includes subranges such as 96-99%, 96-98%, 96-97%, 97-99%, 97-98% and 98-99% identity. This applies regardless of the breadth of the range.
  • the disclosure provides methods for treating a disease associated with expression of a tumor antigen described herein.
  • the present disclosure provides methods of treating cancer (e.g., a hematological cancer such as ALL and CLL) by providing to the subject in need thereof immune effector cells (e.g., T cells, NK cells) that are engineered to express a CAR, e.g., a CAR described herein.
  • cancer e.g., a hematological cancer such as ALL and CLL
  • immune effector cells e.g., T cells, NK cells
  • a CAR e.g., a CAR described herein.
  • the cancer to be treated is a B cell malignancy.
  • the cancer to be treated is ALL (acute lymphoblastic leukemia), CLL
  • MM multiple myeloma
  • the disclosure provides methods of treating cancer (e.g., a hematological cancer such as ALL and CLL) by providing to the subject in need thereof immune effector cells (e.g., T cells, NK cells) that are engineered to express a CAR, e.g., a CAR as described herein, e.g., CD19 CAR, wherein the cancer cells express CD19.
  • cancer e.g., a hematological cancer such as ALL and CLL
  • immune effector cells e.g., T cells, NK cells
  • a CAR e.g., a CAR as described herein, e.g., CD19 CAR
  • the cancer to be treated is a B cell malignancy.
  • the cancer to be treated is ALL (acute lymphoblastic leukemia), CLL (chronic lymphocytic leukemia), DLBCL (diffuse large B-cell lymphoma), MCL (Mantle cell lymphoma), Hodgkin's lymphoma, or MM (multiple myeloma).
  • ALL acute lymphoblastic leukemia
  • CLL chronic lymphocytic leukemia
  • DLBCL diffuse large B-cell lymphoma
  • MCL Mantle cell lymphoma
  • Hodgkin's lymphoma Hodgkin's lymphoma
  • MM multiple myeloma
  • the disclosure includes a type of cellular therapy where immune effector cells (e.g., T cells, NK cells) are genetically modified (e.g., via transduction of a lentiviral vector) to express a CAR and the CAR-expressing cell is infused to a recipient in need thereof.
  • the infused cell is able to kill tumor cells in the recipient.
  • CAR-modified immune effector cells e.g., T cells, NK cells
  • CAR-expressing cells e.g., T cells or NK cells
  • generated using lentiviral vectors will have stable CAR expression.
  • the immune effector cells e.g., T cells, NK cells
  • the immune effector cells persist in the patient for at least four months, five months, six months, seven months, eight months, nine months, ten months, eleven months, twelve months, thirteen months, fourteen month, fifteen months, sixteen months, seventeen months, eighteen months, nineteen months, twenty months, twenty-one months, twenty-two months, twenty-three months, two years, three years, four years, or five years after administration of the T cell to the patient.
  • the invention also includes a type of cellular therapy where immune effector cells (e.g., T cells, NK cells) are modified, e.g., by in vitro transcribed RNA, to transiently express a CAR and the CAR-expressing cell is infused to a recipient in need thereof.
  • CAR-expressing cells e.g., T cells, NK cells
  • CAR RNA e.g., by transfection or electroporation
  • the infused cell is able to kill tumor cells in the recipient.
  • the immune effector cells e.g., T cells, NK cells
  • the present disclosure provides methods of treating cancer (e.g., a hematological cancer such as ALL and CLL) by providing to the subject in need thereof immune effector cells (e.g., T cells, NK cells) that are engineered to express a CAR that specifically targets or binds to a tumor antigen (or cancer associated antigen) described herein.
  • the method of treatment includes altering the manufacturing of a CAR-expressing cell to enrich for naive T cells, e.g., as described herein.
  • the immune effector cells are engineered to express CD 19 CAR, for treating a subject having cancer (e.g., a hematological cancer such as ALL and CLL), wherein the cancer cells express CD 19.
  • the cancer to be treated is ALL or CLL.
  • the CD 19 CAR molecules to be expressed in an immune effector cell can comprise any anti-CD 19 antigen binding domain in the art (e.g., those provided in Table 1 or 4) in combination with any of the CAR domains described herein to generate a full CAR construct.
  • the full CAR construct is a CAR listed in Table 4.
  • Table 4 provides the exemplary full CD19 CAR constructs generated using the various CAR domains (e.g., transmembrane and intracellular signaling domains) described herein, and the anti-CD 19 antigen binding domains listed in Table 1 or 4.
  • Amino acid sequences are designated (aa) and nucleic acid sequences are designated (nt).
  • the disclosure provides methods for treating cancer, e.g., a cancer associated with CD19 expression, with a CAR-expressing cell (e.g., T cell, NK cell) therapy.
  • Exemplary cancers include, but are not limited to e.g., one or more acute leukemias including but not limited to, e.g., B-ALL, T-ALL, ALL; one or more chronic leukemias including but not limited to, e.g., chronic myelogenous leukemia (CML), chronic lymphocytic leukemia (CLL).
  • one or more acute leukemias including but not limited to, e.g., B-ALL, T-ALL, ALL
  • one or more chronic leukemias including but not limited to, e.g., chronic myelogenous leukemia (CML), chronic lymphocytic leukemia (CLL).
  • CML chronic myelogenous leukemia
  • CLL chronic lymphocytic leukemia
  • Additional cancers or hematological conditions that can be treated with the methods described herein include, but are not limited to, e.g., B cell promyelocytic leukemia, blastic plasmacytoid dendritic cell neoplasm, Burkitt's lymphoma, diffuse large B cell lymphoma, follicular lymphoma, hairy cell leukemia, small cell- or a large cell-follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma (MCL), marginal zone lymphoma, multiple myeloma, myelodysplasia and myelodysplastic syndrome, non-Hodgkin's lymphoma, Hodgkin's lymphoma, plasmablastic lymphoma, plasmacytoid dendritic cell neoplasm, Waldenstrom macroglobulinemia, and "preleukemia" which are a diverse collection of hematological conditions united by ineffective
  • hematological conditions can be associated with expression of CD19.
  • a disease associated with CD19 expression include, but not limited to, e.g., atypical and/or non-classical cancers, malignancies, precancerous conditions or proliferative diseases associated with expression of CD19.
  • the disclosure provides methods for treating CLL.
  • the disclosure provides methods for treating ALL.
  • the disclosure provides methods for treating B-cell ALL.
  • the disclosure provides methods of treating a subject having cancer (e.g., a hematological cancer such as ALL and CLL) with a CAR-expressing cell (e.g., T cell, NK cell) (e.g., a CD19 CAR-expressing cell (e.g., T cell, NK cell) as described herein, such as, e.g., CTL019).
  • a CAR-expressing cell e.g., T cell, NK cell
  • a CD19 CAR-expressing cell e.g., T cell, NK cell
  • the disclosure provides methods of treating a subject with a CAR-expressing cell (e.g., T cell, NK cell) in combination with another therapeutic agent, e.g., another therapeutic agent described herein (e.g., another CAR, e.g., another CAR described herein, an inhibitory CAR, e.g., an inhibitory CAR described herein; a chemotherapy; a kinase inhibitor (e.g., a kinase inhibitor described herein, e.g., an mTOR inhibitor, a BTK inhibitor), a checkpoint inhibitor, e.g., a checkpoint inhibitor described herein, a standard of care therapy, etc.).
  • the combination can be, e.g., with any agent described herein.
  • treatment of a cancer in a subject comprises administering a CAR therapy as described herein, in combination with one or more cycles of chemotherapy.
  • exemplary cycles of chemotherapy include induction, consolidation, interim maintenance, delayed intensification, and maintenance.
  • a first cycle of chemotherapy is induction, in which the goal is to eliminate as many cancerous cells as possible.
  • an induction cycle comprises treatment with one or more drugs, such as vincristine, dexamethasone, and/or polyethylene glycol (PEG)-L-asparaginase.
  • an induction cycle comprises treatment with vincristine, dexamethasone, and PEG-L-asparaginase, e.g., at doses of 6 mg/m 2 , 6 mg/m 2 , and 2500 U/m 2 , respectively.
  • an induction cycle comprises treatment with vincristine, dexamethasone, PEG-L-asparaginase, and daunorubicin, e.g., at doses of 6 mg/m 2 , 6 mg/m 2 , and 2500 U/m 2 , and 100 mg/m 2 , respectively.
  • a further cycle of chemotherapy is consolidation, in which the goal is to destroy any remaining cancerous cells.
  • consolidation cycle is given to a subject after remission is achieved after the induction cycle.
  • a consolidation cycle comprises treatment with one or more drugs, such as vincristine, 6-mercaptopurine, cyclophosphamide, cytarabine, and/or PEG- L-asparaginase.
  • a consolidation cycle comprises treatment with vincristine and 6- mercaptopurine, e.g., at doses of 1.5 mg/m 2 and 75 mg/m 2 , respectively.
  • a consolidation cycle comprises treatment with vincristine, 6-mercaptopurine, cyclophosphamide, cytarabine, and
  • PEG-L-asparaginase e.g., at doses of 1.5 mg/m 2 , 60 mg/m 2 , 1 g/m 2 , 75 mg/m 2 , and 2500 mg/m , respectively.
  • a further cycle of chemotherapy comprises a maintenance cycle, in which the goal is to reduce the long-term risk of cancer relapse, or interim maintenance cycle, in which the goal is to provide a break from intensive treatment.
  • an interim maintenance cycle is performed after induction, and, in some cases, after consolidation.
  • an interim maintenance cycle is performed before a delayed intensification cycle.
  • an interim maintenance cycle is performed after a delayed intensification cycle.
  • a maintenance cycle is the last cycle of chemotherapy, e.g., after induction, consolidation, interim maintenance, and/or delayed intensification.
  • an interim maintenance cycle comprises treatment with vincristine and methotrexate, e.g., at doses of 7.5 mg/m 2 and 500 mg/m 2 , respectively.
  • an interim maintenance cycle comprises treatment with vincristine, methotrexate, and 6-mercaptopurine, e.g., at doses of 7.5 mg/m , 20 mg/m 2 , and 25 mg/m 2 , respectively.
  • a maintenance cycle comprises treatment with vincristine, dexamethasone, 6-mercaptopurine, and methotrexate, e.g., at doses of 1.5 mg/m 2 , 6 mg/m 2 , 75 mg/m 2 , and 20 mg/m 2 , respectively.
  • a maintenance cycle comprises treatment with vincristine, prednisone, 6-mercaptopurine, and methotrexate, e.g., at doses of 1.5 mg/m 2 , 40 mg/m 2 , 75 mg/m 2 , and 20 mg/m 2 , respectively.
  • a further cycle of chemotherapy comprises a delayed intensification cycle, in which the goal is to eliminate any remaining cancerous cells.
  • a delayed intensification cycle is performed after a consolidation cycle, and, e.g., after an interim maintenance cycle.
  • a delayed intensification cycle comprises treatment with vincristine, dexamethasone, doxorubicin, PEG-L-asparginase, cyclophosphamide, cytarabine, and 6- thioguanine, e.g., at doses of 4.5 mg/m 2 , 10 mg/m 2 , 75 mg/m 2 , 2500 U/m 2 , 1 g/m 2 , 60 mg/m 2 , and 60 mg/m , respectively.
  • a delayed intensification cycle comprises treatment with vincristine, dexamethasone, doxorubicin, PEG-L-asparginase, cyclophosphamide, cytarabine, and 6- thioguanine, e.g., at doses of 7.5 mg/m 2 , 10 mg/m 2 , 75 mg/m 2 , 5000 U/m 2 , 1 g/m 2 , 60 mg/m 2 , and 60 mg/m , respectively.
  • a subject is treated with varying intensities of chemotherapeutic regimens based on risk measurements, e.g., to maximize survival while minimizing toxicity.
  • a subject e.g., with ALL (e.g., pediatric ALL)
  • ALL e.g., pediatric ALL
  • a standard risk or high-risk group e.g., based on white blood cell counts and age, e.g., based on the National Cancer Institute (NCI) risk group classification.
  • NCI National Cancer Institute
  • a subject is categorized into a standard risk group if the white blood cell count is less than 50,000 cells per microliter and the subject is 1 to 10 years old.
  • a subject is categorized into a high risk group if the white blood cell count is 50,000 cells per microliter or greater and/or the subject is 10 years of age or older.
  • a subject e.g., with ALL (e.g., pediatric ALL), is categorized into a very high-risk group, as described in Moriche et al. Blood 111.9(2008):4477-89; and Pui et al. Blood 92.2(1998):411-5.
  • ALL subjects who have one or more of the following characteristics are classified as very high-risk ALL: a subject that is an infant; a subject with adverse cytogenetic abnormalities (e.g., t(9;22), MLL gene rearrangements, and low hypodiploidy ( ⁇ 44
  • chromosomes a subject having a slow early response to initial therapy; a subject having a high minimal residual disease (MRD) level at the end of an induction cycle or in later cycles; a subject with morphologically persistent disease after an induction cycle.
  • MRD minimal residual disease
  • standard of care for CLL includes, but is not limited to exemplary therapies described herein, e.g., described in Table 5, and combinations thereof.
  • standard of care for CLL includes (1) radiation therapy, (2) chemotherapy, (3) surgery (e.g., removal of the spleen), (4) targeted therapy, (5) stem cell transplantation, and combinations thereof.
  • the standard of care comprises external radiation therapy.
  • the standard of care comprises internal radiation therapy (e.g., a radioactive substance sealed in needles, wires or catheters, for example, that are placed directly into or near the cancer).
  • standard of care for ALL includes, but is not limited to exemplary therapies described herein, e.g., described in Table 6, and combinations thereof.
  • Table 6 Exemplary therapies for ALL
  • standard of care for ALL includes (1) chemotherapy, (2) radiation therapy, (3) stem cell transplantation, (4) biological therapy, (5) targeted therapy, and combinations thereof.
  • the standard of care includes, but is not limited to, fludarabine with cyclophosphamide (FC); fludarabine with rituximab (FR); fludarabine, cyclophosphamide, and rituximab (FCR); cyclophosphamide, doxorubicin, vincristine and prednisone (CHOP); and combinations thereof.
  • General chemotherapeutic agents considered for use include, but are not limited to anastrozole (Arimidex®), bicalutamide (Casodex®), bleomycin sulfate
  • Gemcitabine (difluorodeoxycitidine), hydroxyurea (Hydrea®), Idarubicin (Idamycin®), ifosfamide (IFEX®), irinotecan (Camptosar®), L-asparaginase (ELSPAR®), leucovorin calcium, melphalan (Alkeran®), 6-mercaptopurine (Purinethol®), methotrexate (Folex®), mitoxantrone (Novantrone®), mylotarg, paclitaxel (Taxol®), phoenix (Yttrium90/MX-DTPA), pentostatin, polifeprosan 20 with carmustine implant (Gliadel®), tamoxifen citrate
  • Nolvadex® teniposide (Vumon®), 6-thioguanine, thiotepa, tirapazamine (Tirazone®), topotecan hydrochloride for injection
  • Hycamptin® vinblastine (Velban®), vincristine (Oncovin®), vinorelbine (Navelbine®), and combinations thereof.
  • chemotherapy comprises an antimetabolite, including, but not limited to, folic acid antagonists (also referred to herein as antifolates), pyrimidine analogs, purine analogs and adenosine deaminase inhibitors): methotrexate (Rheumatrex®, Trexall®), 5-f uorouracil (Adrucil®, Efudex®, Fluoroplex®), floxuridine (FUDF®), cytarabine (Cytosar- U®, Tarabine PFS), 6-mercaptopurine (Puri-Nethol®)), 6-thioguanine (Thioguanine
  • Preferred antimetabolites include, e.g., 5-fluorouracil (Adrucil®, Efudex®, Fluoroplex®), floxuridine (FUDF®), capecitabine (Xeloda®), pemetrexed (Alimta®), raltitrexed (Tomudex®) and gemcitabine (Gemzar®), and
  • the purine analogue is fludarabine.
  • chemotherapy comprises an alkylating agent including, but not limited to nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes, uracil mustard (Aminouracil Mustard®, Chlorethaminacil®, Demethyldopan®, Desmethyldopan®, Haemanthamine®, Nordopan®, Uracil nitrogen mustard®, Uracillost®, Uracilmostaza®, Uramustin®, Uramustine®), chlormethine (Mustargen®), cyclophosphamide (Cytoxan®, Neosar®, Clafen®, Endoxan®, Procytox®, RevimmuneTM), ifosfamide
  • alkylating agent including, but not limited to nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes
  • uracil mustard Amouracil Must
  • Temozolomide Temodar®
  • thiotepa Thioplex®
  • busulfan Busulfan
  • Busulfan Busulfan
  • alkylating agents include, without limitation, Oxaliplatin (Eloxatin®);
  • Temozolomide Temodar® and Temodal®
  • Dactinomycin also known as actinomycin-D, Cosmegen®
  • Melphalan also known as L-PAM, L-sarcolysin, and phenylalanine mustard
  • Alkeran® Altretamine (also known as hexamethylmelamine (HMM), Hexalen®); Carmustine (BiCNU®); Bendamustine (Treanda®); Busulfan (Busulfex® and Myleran®); Carboplatin (Paraplatin®); Lomustine (also known as CCNU, CeeNU®); Cisplatin (also known as CDDP, Platinol® and Platinol®-AQ); Chlorambucil (Leukeran®); Cyclophosphamide (Cytoxan® and Neosar®); dacarbazine (also known as DTIC, DIC and imidazole carboxamide, DTIC- Dome®); Altretamine (also known as hexamethylmelamine (HMM), Hexalen®); Ifosfamide (Ifex®); Prednumustine; Procarbazine (Matulane®); Mechlorethamine (also known as nitrogen mustard, mustine and mech
  • Bendamustine HC1 (Treanda®) and combinations thereof.
  • the alkylating agent is bendamustine.
  • the alkylating agent is cyclophosphamide.
  • the chemotherapeutic agent is a kinase inhibitor, e.g., a tyrosine kinase inhibitor including, but not limited to, erlotinib hydrochloride (Tarceva®); linifanib (N- [4-(3-amino-lH-indazol-4-yl)phenyl]-N'-(2-fluoro-5-methylphenyl)urea, also known as ABT 869, available from Genentech); sunitinib malate (Sutent®); bosutinib (4-[(2,4-dichloro-5- methoxyphenyl)amino]-6-methoxy-7-[3-(4-methylpiperazin-l-yl)propoxy]quinoline-3- carbonitrile, also known as SKI-606, and described in US Patent No.
  • erlotinib hydrochloride Tarceva®
  • linifanib N- [4-(3-amino-l
  • the kinase inhibitor is a BTK inhibitor selected from ibrutinib (PCI-32765); GDC-0834; RN-486; CGI-560; CGI- 1764; HM- 71224; CC-292; ONO-4059; CNX-774; and LFM-A13.
  • the kinase inhibitor is a CDK4 inhibitor selected from aloisine A; flavopiridol or HMR-1275, 2-(2- chlorophenyl)-5,7-dihydroxy-8-[(3S,4R)-3-hydroxy-l-methyl-4-piperidinyl]-4-chromenone; crizotinib (PF-02341066; 2-(2-Chlorophenyl)-5,7-dihydroxy-8-[(2 ?,3S)-2-(hydroxymethyl)-l- methyl-3-pyrrolidinyl]- 4H-l-benzopyran-4-one, hydrochloride (P276-00); l-methyl-5-[[2-[5- (trifluoromethyl)- lH-imidazol-2-yl]-4-pyridinyl]oxy]-N-[4-(trifluoromethyl)phenyl]- 1H- benzimidazol-2- amine (RAF265); indisulam
  • the kinase inhibitor is an MNK inhibitor selected from CGP052088; 4-amino-3-(p-fluorophenylamino)- pyrazolo [3,4- ] pyrimidine (CGP57380); cercosporamide; ETC- 1780445-2; and 4-amino-5-(4- fluoroanilino)-pyrazolo [3,4- ⁇ i] pyrimidine.
  • targeted therapy includes, but is not limited to an anti-CD20 antibody or functional fragment thereof, such as, e.g., rituximab (Riuxan® and MabThera®); tositumomab (Bexxar®); and ofatumumab (Arzerra®), and combinations thereof.
  • the targeted therapy includes, but is not limited to, an anti-CD52 antibody or functional fragment thereof such as, e.g., alemtuzumab (Campath®).
  • biologic therapy comprises immunotherapy.
  • immunotherapy comprises immunotherapy.
  • anthracyclines include, without limitation, doxorubicin (Adriamycin® and Rubex®);
  • bleomycin lenoxane®
  • daunorubicin daunorubicin hydrochloride, daunomycin, and rubidomycin hydrochloride, Cerubidine®
  • daunorubicin liposomal daunorubicin citrate liposome, DaunoXome®
  • mitoxantrone DHAD, Novantrone®
  • epirubicin EllenceTM
  • idarubicin Idamycin®, Idamycin PES®
  • mitomycin C Metamycin®
  • geldanamycin geldanamycin
  • stem cell transplantation comprises an autogeneic stem cell transplant.
  • stem cell transplantation comprises an allogenic stem cell transplant.
  • stem cell transplantation comprises allogeneic bone marrow transplantation.
  • stem cell transplantation comprises a hematopoietic stem cell transplantation (HSCT).
  • hematopoietic stem cells are derived from various tissues including, but not limited to bone marrow, peripheral blood, umbilical cord blood, and combinations thereof.
  • the disclosure provides methods for treating a disease associated with
  • the invention provides methods for treating a disease wherein part of the tumor is negative for CD19 and part of the tumor is positive for CD19.
  • provided methods are useful for treating subjects that have undergone treatment for a disease associated with elevated expression of CD19, wherein the subject that has undergone treatment for elevated levels of CD 19 exhibits a disease associated with elevated levels of CD19.
  • provided methods comprise a vector comprising CD 19 CAR operably linked to promoter for expression in mammalian cells (e.g., T cells or NK cells).
  • provided methods comprise a recombinant cell (e.g., T cell or NK cell) expressing a CD 19 CAR for use in treating CD19-expressing tumors, wherein the recombinant T cell expressing the CD 19 CAR is termed a CD 19 CAR-expressing cell.
  • a CD 19 CAR- expressing cell e.g., T cell, NK cell administered according to provided methods is capable of contacting a tumor cell with at least one CD 19 CAR expressed on its surface such that the CAR-expressing cell targets the tumor cell and growth of the tumor is inhibited.
  • the disclosure features to a method of inhibiting growth of a CD 19- expressing tumor cell, comprising contacting the tumor cell with a CD 19 CAR-expressing cell (e.g., T cell, NK cell) described herein such that the CAR-expressing cell is activated in response to the antigen and targets the cancer cell, wherein the growth of the tumor is inhibited.
  • a CD 19 CAR-expressing cell e.g., T cell, NK cell
  • the disclosure includes a type of cellular therapy where T cells are genetically modified to express a CAR and the CAR-expressing cell (e.g., T cell, NK cell) is infused to a recipient in need thereof.
  • the infused cell is able to kill tumor cells in the recipient.
  • CAR- modified cells e.g., T cells or NK cells
  • the cells administered to the patient, or their progeny persist in the patient for at least four months, five months, six months, seven months, eight months, nine months, ten months, eleven months, twelve months, thirteen months, fourteen month, fifteen months, sixteen months, seventeen months, eighteen months, nineteen months, twenty months, twenty- one months, twenty-two months, twenty-three months, two years, three years, four years, or five years after administration of the cell to the patient.
  • the disclosure also includes a type of cellular therapy where cells (e.g., T cells, NK cells) are modified, e.g., by in vitro transcribed RNA, to transiently express a chimeric antigen receptor (CAR) and the CAR-expressing cell (e.g., T cell, NK cell) is infused to a recipient in need thereof.
  • the infused cell is able to kill tumor cells in the recipient.
  • the cells administered to the patient are present for less than one month, e.g., three weeks, two weeks, one week, after administration of the cell (e.g., T cell, NK cell) to the patient.
  • the anti-tumor immunity response elicited by the CAR-modified cells may be an active or a passive immune response, or alternatively may be due to a direct vs indirect immune response.
  • the CAR transduced T cells exhibit specific proinflammatory cytokine secretion and potent cytolytic activity in response to human cancer cells expressing the CD 19, resist soluble CD 19 inhibition, mediate bystander killing and mediate regression of an established human tumor.
  • antigen-less tumor cells within a heterogeneous field of CD19- expressing tumor may be susceptible to indirect destruction by CD19-redirected T cells that has previously reacted against adjacent antigen-positive cancer cells.
  • the fully-human CAR-modified cells e.g., T cells, NK cells
  • the fully-human CAR-modified cells may be a type of vaccine for ex vivo immunization and/or in vivo therapy in a mammal.
  • the mammal is a human.
  • ex vivo immunization at least one of the following occurs in vitro prior to administering the cell into a subject: i) expansion of the cells, ii) introducing a nucleic acid encoding a CAR to the cells or iii) cryopreservation of the cells.
  • Ex vivo procedures are known in the art and are discussed more fully below. Briefly, cells are isolated from a subject (e.g., a human) and genetically modified (i.e., transduced or transfected in vitro) with a vector expressing a CAR disclosed herein. The CAR-modified cell can be administered to a mammalian recipient to provide a therapeutic benefit.
  • a subject e.g., a human
  • genetically modified i.e., transduced or transfected in vitro
  • the CAR-modified cell can be administered to a mammalian recipient to provide a therapeutic benefit.
  • mammalian recipient may be a human and the CAR-modified cell can be autologous with respect to the recipient.
  • the cells can be allogeneic, syngeneic or xenogeneic with respect to the recipient.
  • Hematological cancer conditions are types of cancer such as leukemia and malignant lymphoproliferative conditions that affect blood, bone marrow and the lymphatic system.
  • Leukemia can be classified as acute leukemia and chronic leukemia.
  • Acute leukemia can be further classified as acute myelogenous leukemia (AML) and acute lymphoid leukemia (ALL).
  • Chronic leukemia includes chronic myelogenous leukemia (CML) and chronic lymphoid leukemia (CLL).
  • MDS myelodysplastic syndromes
  • preleukemia myelodysplastic syndromes
  • the cancer is a hematologic cancer including but is not limited to a leukemia or a lymphoma.
  • the CAR-expressing cells (e.g., T cells, NK cells) of the invention may be used to treat cancers and malignancies such as, but not limited to, e.g., acute leukemias including but not limited to, e.g., B-ALL, T-ALL, ALL; one or more chronic leukemias including but not limited to, e.g., CML, CLL; additional hematologic cancers or hematologic conditions including, but not limited to, e.g., B cell promyelocytic leukemia, blastic
  • plasmacytoid dendritic cell neoplasm Burkitt's lymphoma, diffuse large B cell lymphoma, follicular lymphoma, hairy cell leukemia, small cell- or a large cell-follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma (MCL), marginal zone lymphoma, multiple myeloma, myelodysplasia and myelodysplastic syndrome, non-Hodgkin's lymphoma, Hodgkin's lymphoma , plasmablastic lymphoma, plasmacytoid dendritic cell neoplasm, Waldenstrom macroglobulinemia, and "preleukemia" which are a diverse collection of hematological conditions united by ineffective production (or dysplasia) of myeloid blood cells, and the like.
  • the present disclosure also provides methods for inhibiting the proliferation or reducing a CD19-expressing cell population, the methods comprising contacting a population of cells comprising a CD19-expressing cell with a CD19 CAR-expressing cell (e.g., T cell, NK cell) described herein that binds to the CD19-expressing cell.
  • a CD19 CAR-expressing cell e.g., T cell, NK cell
  • the disclosure provides methods for inhibiting the proliferation or reducing the population of cancer cells expressing CD 19, the methods comprising contacting the CD19-expressing cancer cell population with a CD19 CAR-expressing cell (e.g., T cell, NK cell) described herein that binds to the CD19-expressing cell.
  • the present disclosure provides methods for inhibiting the proliferation or reducing the population of cancer cells expressing CD19, the methods comprising contacting the CD19-expressing cancer cell population with a CD19 CAR- expressing cell (e.g., T cell, NK cell) described herein that binds to the CD19-expressing cell.
  • a CD19 CAR- expressing cell e.g., T cell, NK cell
  • the anti-CD19 CAR-expressing cell reduces the quantity, number, amount or percentage of cells and/or cancer cells by at least 25%, at least 30%, at least 40%, at least 50%, at least 65%, at least 75%, at least 85%, at least 95%, or at least 99% in a subject with or animal model for myeloid leukemia or another cancer associated with CD19-expressing cells relative to a negative control.
  • the subject is a human.
  • the present disclosure also provides methods for preventing, treating and/or managing a disease associated with CD19-expressing cells (e.g., a hematologic cancer or atypical cancer expressing CD19), the methods comprising administering to a subject in need a CAR- expressing cell (e.g., T cell, NK cell) described herein that binds to the CD19-expressing cell.
  • a CAR- expressing cell e.g., T cell, NK cell
  • the subject is a human.
  • disorders associated with CD19-expressing cells include autoimmune disorders (such as lupus), inflammatory disorders (such as allergies and asthma) and cancers (such as hematological cancers or atypical cancers expressing CD 19).
  • the present disclosure also provides methods for preventing, treating and/or managing a disease associated with CD19-expressing cells, the methods comprising administering to a subject in need a CD19 CAR-expressing cell (e.g., T cell, NK cell) described herein that binds to the CD19-expressing cell.
  • a CD19 CAR-expressing cell e.g., T cell, NK cell
  • the subject is a human.
  • the present disclosure provides methods for preventing relapse of cancer associated with CD19-expressing cells (e.g., a hematological cancer such as ALL and CLL), the methods comprising administering to a subject in need thereof a CD19 CAR-expressing cell (e.g., T cell, NK cell) described herein that binds to the CD19-expressing cell.
  • the methods comprise administering to the subject in need thereof an effective amount of a CD 19 CAR- expressing cell (e.g., T cell, NK cell) described herein that binds to the CD19-expressing cell in combination with an effective amount of another therapy.
  • a CD 19 CAR- expressing cell e.g., T cell, NK cell
  • any cancer therapy as described above and herein can be administered in combination with one or more additional therapies to treat and/or reduce the symptoms of cancer described herein.
  • the pharmaceutical compositions can be administered concurrently with, prior to, or subsequent to, one or more other additional therapies or therapeutic agents.
  • a CAR-expressing cell described herein may be used in combination with other known agents and therapies.
  • Administered "in combination”, as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated or treatment has ceased for other reasons.
  • the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as “simultaneous" or “concurrent delivery”.
  • the delivery of one treatment ends before the delivery of the other treatment begins.
  • the treatment is more effective because of combined administration.
  • the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment or the analogous situation is seen with the first treatment.
  • delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other.
  • the effect of the two treatments can be partially additive, wholly additive, or greater than additive.
  • the delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
  • a CAR-expressing cell described herein and the at least one additional therapeutic agent can be administered simultaneously, in the same or in separate compositions, or sequentially.
  • the CAR-expressing cell described herein can be administered first, and the additional agent can be administered second, or the order of administration can be reversed.
  • a CAR-expressing cell described herein may be used in a treatment regimen in combination with surgery, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228, cytokines, and irradiation peptide vaccine, such as that described in Izumoto et al. 2008 J NEUROSURG 108:963-971.
  • immunosuppressive agents such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies
  • immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludarabine, cyclosporin, FK506, rap
  • a CAR-expressing cell described herein can be used in combination with a chemotherapeutic agent.
  • chemotherapeutic agents include an anthracycline (e.g., doxorubicin (e.g., liposomal doxorubicin)), a vinca alkaloid (e.g., vinblastine, vincristine, vindesine, vinorelbine), an alkylating agent (e.g., bendamustine, cyclophosphamide, decarbazine, melphalan, ifosfamide, temozolomide), an immune cell antibody (e.g., alemtuzamab, gemtuzumab, rituximab, tositumomab), an antimetabolite (including, e.g., folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors (e.g., fludara
  • chemotherapeutic agents considered for use in combination therapies include anastrozole (Arimidex®), bicalutamide (Casodex®), bleomycin sulfate (Blenoxane®), busulfan (Myleran®), busulfan injection (Busulfex®), capecitabine (Xeloda®), N4-pentoxycarbonyl-5- deoxy-5-fluorocytidine, carboplatin (Paraplatin®), carmustine (BiCNU®), chlorambucil (Leukeran®), cisplatin (Platinol®), cladribine (Leustatin®), cyclophosphamide (Cytoxan® or Neosar®), cytarabine, cytosine arabinoside (Cytosar-U®), cytarabine liposome injection (DepoCyt®), dacarbazine (DTIC-Dome®), dactinomycin
  • IFEX® irinotecan
  • Camptosar® L-asparaginase
  • ESPAR® leucovorin calcium
  • melphalan Alkeran®
  • 6-mercaptopurine Purinethol®
  • methotrexate Folex®
  • mitoxantrone Novantrone®
  • mylotarg paclitaxel
  • phoenix Yttrium90/MX-DTPA
  • pentostatin polifeprosan 20 with carmustine implant (Gliadel®), tamoxifen citrate (Nolvadex®), teniposide (Vumon®), 6-thioguanine, thiotepa, tirapazamine (Tirazone®), topotecan hydrochloride for injection (Hycamptin®), vinblastine (Velban®), vincristine (Oncovin®), and vinorelbine (Navelbine®).
  • alkylating agents include, without limitation, nitrogen mustards,
  • ethylenimine derivatives ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes, uracil mustard
  • Dactinomycin also known as actinomycin-D, Cosmegen®
  • Melphalan also known as L- PAM, L-sarcolysin, and phenylalanine mustard, Alkeran®
  • Altretamine also known as hexamethylmelamine (HMM), Hexalen®
  • Carmustine BiCNU®
  • Bendamustine Teanda®
  • Busulfan Busulfan
  • Carboplatin Paraaplatin®
  • Lomustine also known as CCNU, CeeNU®
  • Cisplatin also known as CDDP, Platinol® and Platinol®-AQ
  • Chlorambucil (Leukeran®); Cyclophosphamide (Cytoxan® and Neosar®); dacarbazine (also known as DTIC, DIC and imidazole carboxamide, DTIC-Dome®); Altretamine (also known as hexamethylmelamine (HMM), Hexalen®); Ifosfamide (Hex®); Prednumustine; Procarbazine (Matulane®); Mechlorethamine (also known as nitrogen mustard, mustine and
  • mechloroethamine hydrochloride Mustargen®
  • Streptozocin Zanosar®
  • Thiotepa also known as thiophosphoamide, TESPA and TSPA, Thioplex®
  • Cyclophosphamide Endoxan®, Cytoxan®, Neosar®, Procytox®, Revimmune®
  • Bendamustine HC1 Bendamustine HC1 (Treanda®) and combinations thereof.
  • Exemplary mTOR inhibitors include, without limitation, RAD001, temsirolimus;
  • ridaforolimus (formally known as deferolimus, (lR,2R,4S)-4-[(2R)-2
  • IRX-2 mixture of human cytokines including interleukin 1, interleukin 2, and interferon ⁇ , CAS 951209-71-5, available from IRX Therapeutics) and combinations thereof.
  • anthracyclines include, without limitation, doxorubicin (Adriamycin® and Rubex®); bleomycin (lenoxane®); daunorubicin (dauorubicin hydrochloride, daunomycin, and rubidomycin hydrochloride, Cerubidine®); daunorubicin liposomal (daunorubicin citrate liposome, DaunoXome®); mitoxantrone (DHAD, Novantrone®); epirubicin (EllenceTM);
  • idarubicin (Idamycin®, Idamycin PFS®); mitomycin C (Mutamycin®); geldanamycin;
  • vinca alkaloids include, without limitation, vinorelbine tartrate
  • Vincristine Vincristine (Oncovin®), Vindesine (Eldisine®)
  • vinblastine also known as vinblastine sulfate, vincaleukoblastine and VLB, Alkaban-AQ® and Velban®
  • vinorelbine Vinelbine®
  • proteosome inhibitors include, without limitation, bortezomib (Velcade®); carfilzomib (PX-171-007, (S)-4-Methyl-N-((S)-l-(((S)-4-methyl-l-(( ?)-2-methyloxiran-2-yl)-l- oxopentan-2-yl)amino)-l-oxo-3-phenylpropan-2-yl)-2-((S)-2-(2-morpholinoacetamido)-4- phenylbutanamido)-pentanamide); marizomib (NPI-0052); ixazomib citrate (MLN-9708); delanzomib (CEP-18770); 0-Methyl-N-[(2-methyl-5-thiazolyl)carbonyl]-L-seryl-0-methyl-N- [( 1 S)-2- [(2tf )-2-methyl-2-oxirany
  • Exemplary GITR agonists include, without limitation, GITR fusion proteins and anti- GITR antibodies (e.g., bivalent anti-GITR antibodies) such as, e.g., a GITR fusion protein described in U.S. Patent No.: 6,111,090, European Patent No.: 090505B 1, U.S Patent No.: 8,586,023, PCT Publication Nos.: WO 2010/003118 and 2011/090754, or an anti-GITR antibody described, e.g., in U.S. Patent No.: 7,025,962, European Patent No.: 1947183B 1, U.S. Patent No.: 7,812,135, U.S. Patent No.: 8,388,967, U.S. Patent No.: 8,591,886, European Patent No.: EP 1866339, PCT Publication No.: WO 2011/028683, PCT Publication No.:WO
  • a CAR expressing cell described herein such as, e.g., a CD19 CAR- expressing cell (e.g., T cell, NK cell), e.g., CTL019 is administered to a subject, e.g., a subject identified as a partial responder or non-responder, in combination with an mTOR inhibitor, e.g., an mTOR inhibitor described herein, e.g., a target of the rapamycin signaling pathway such as RADOOl.
  • the mTOR inhibitor is administered prior to the CAR-expressing cell.
  • the mTOR inhibitor can be administered prior to apheresis of the cells.
  • the subject has cancer (e.g., a hematological cancer such as ALL and CLL).
  • the subject has ALL.
  • the subject has CLL.
  • a CAR expressing cell described herein such as, e.g., a CD19 CAR- expressing cell (e.g., T cell, NK cell), e.g., CTL019, is administered to a subject, e.g., a subject identified as a partial responder or non-responder, in combination with a GITR agonist, e.g., a GITR agonist described herein.
  • a GITR agonist is administered prior to the CAR-expressing cell.
  • the GITR agonist can be
  • the subject has cancer (e.g., a hematological cancer such as ALL and CLL).
  • cancer e.g., a hematological cancer such as ALL and CLL.
  • the subject has ALL.
  • the subject has CLL.
  • a CAR-expressing cell described herein may be used in a treatment regimen in combination with a kinase inhibitor, e.g., a CDK4 inhibitor, a BTK inhibitor, an MNK inhibitor, an mTOR inhibitor, an ⁇ inhibitor, etc.
  • a kinase inhibitor e.g., a CDK4 inhibitor, a BTK inhibitor, an MNK inhibitor, an mTOR inhibitor, an ⁇ inhibitor, etc.
  • the subject is a complete responder, and the subject is administered a treatment regimen that includes administration of a CAR-expressing cell described herein in combination with a kinase inhibitor, e.g., a kinase inhibitor described herein, e.g., at a dose or dosing schedule described herein.
  • the subject is a partial responder or a non- responder, and the subject is administered a treatment regimen that includes administration of a CAR-expressing cell described herein in combination with a kinase inhibitor, e.g., a kinase inhibitor described herein, e.g., at a dose or dosing schedule described herein.
  • a kinase inhibitor e.g., a kinase inhibitor described herein, e.g., at a dose or dosing schedule described herein.
  • the kinase inhibitor is a CDK4 inhibitor, e.g., a CDK4 inhibitor described herein, e.g., a CDK4/6 inhibitor, such as, e.g., 6-Acetyl-8-cyclopentyl-5-methyl-2-(5- piperazin-l-yl-pyridin-2-ylamino)-8H-pyrido[2,3- ⁇ i]pyrimidin-7-one, hydrochloride (also referred to as palbociclib or PD0332991).
  • the kinase inhibitor is a BTK inhibitor, e.g., a BTK inhibitor described herein, such as, e.g., ibrutinib.
  • the kinase inhibitor is an mTOR inhibitor, e.g., an mTOR inhibitor described herein, such as, e.g., rapamycin, a rapamycin analog, OSI-027.
  • the mTOR inhibitor can be, e.g., an mTORCl inhibitor and/or an mTORC2 inhibitor, e.g., an mTORCl inhibitor and/or mTORC2 inhibitor described herein.
  • the kinase inhibitor is a MNK inhibitor, e.g., a MNK inhibitor described herein, such as, e.g., 4-amino-5-(4-fluoroanilino)-pyrazolo [3,4- ⁇ i] pyrimidine.
  • the MNK inhibitor can be, e.g., a MNK la, MNKlb, MNK2a and/or MNK2b inhibitor.
  • the kinase inhibitor is a CDK4 inhibitor selected from aloisine A; flavopiridol or HMR-1275, 2-(2-chlorophenyl)-5,7-dihydroxy-8-[(3S,4R)-3-hydroxy-l-methyl- 4-piperidinyl]-4-chromenone; crizotinib (PF-02341066; 2-(2-Chlorophenyl)-5,7-dihydroxy-8- [(2 ?,3S)-2-(hydroxymethyl)-l-methyl-3-pyrrolidinyl]- 4H-l-benzopyran-4-one, hydrochloride (P276-00); l-methyl-5-[[2-[5-(trifluoromethyl)-lH-imidazol-2-yl]-4-pyridinyl]oxy]-N-[4- (trifluoromethyl)phenyl]-lH-benzimidazol-2-amine (RAF265); indisulam (E70)
  • the kinase inhibitor is a CDK4 inhibitor, e.g., palbociclib
  • the palbociclib is administered at a dose of about 50 mg, 60 mg, 70 mg, 75 mg, 80 mg, 90 mg, 100 mg, 105 mg, 110 mg, 115 mg, 120 mg, 125 mg, 130 mg, 135 mg (e.g., 75 mg, 100 mg or 125 mg) daily for a period of time, e.g., daily for 14-21 days of a 28 day cycle, or daily for 7-12 days of a 21 day cycle. In one embodiment, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more cycles of palbociclib are administered.
  • the kinase inhibitor is a BTK inhibitor selected from ibrutinib (PCI- 32765); GDC-0834; RN-486; CGI-560; CGI- 1764; HM-71224; CC-292; ONO-4059; CNX- 774; and LFM-A13.
  • the kinase inhibitor is a BTK inhibitor, e.g., ibrutinib (PCI-32765), and the ibrutinib is administered at a dose of about 250 mg, 300 mg, 350 mg, 400 mg, 420 mg, 440 mg, 460 mg, 480 mg, 500 mg, 520 mg, 540 mg, 560 mg, 580 mg, 600 mg (e.g., 250 mg, 420 mg or 560 mg) daily for a period of time, e.g., daily for 21 day cycle, or daily for 28 day cycle. In one embodiment, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more cycles of ibrutinib are administered.
  • ibrutinib PCI-32765
  • the kinase inhibitor is an mTOR inhibitor selected from
  • ridaforolimus (lR,2R,45)-4-[(2R)-2 [(1R,95,125,15R,16E,18R,19R,21R, 23S,24E,26E,28Z,30S,32S,35 ?)-l,18-dihydroxy-19,30-dimethoxy-15,17,21,23, 29,35- hexamethyl-2,3,10,14,20-pentaoxo-l l,36-dioxa-4-azatricyclo[30.3.1.0 4 ' 9 ] hexatriaconta-
  • the kinase inhibitor is an mTOR inhibitor, e.g., rapamycin, and the rapamycin is administered at a dose of about 3 mg, 4 mg, 5 mg, 6 mg, 7 mg, 8 mg, 9 mg, 10 mg (e.g., 6 mg) daily for a period of time, e.g., daily for 21 day cycle, or daily for 28 day cycle.
  • rapamycin is administered at a dose of about 3 mg, 4 mg, 5 mg, 6 mg, 7 mg, 8 mg, 9 mg, 10 mg (e.g., 6 mg) daily for a period of time, e.g., daily for 21 day cycle, or daily for 28 day cycle.
  • 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more cycles of rapamycin are examples of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more cycles of rapamycin.
  • the kinase inhibitor is an mTOR inhibitor, e.g., everolimus and the everolimus is administered at a dose of about 2 mg, 2.5 mg, 3 mg, 4 mg, 5 mg, 6 mg, 7 mg, 8 mg, 9 mg, 10 mg, 11 mg, 12 mg, 13 mg, 14 mg, 15 mg (e.g., 10 mg) daily for a period of time, e.g., daily for 28 day cycle. In one embodiment, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more cycles of everolimus are administered.
  • the kinase inhibitor is an MNK inhibitor selected from CGP052088; 4-amino-3-(p-fluorophenylamino)-pyrazolo [3,4-d] pyrimidine (CGP57380); cercosporamide; ETC-1780445-2; and 4-amino-5-(4-fluoroanilino)-pyrazolo [3,4- ⁇ i] pyrimidine.
  • Methods described herein can use a low, immune enhancing, dose of an mTOR inhibitor e.g., an allosteric mTOR inhibitor, including rapalogs such as RAD001.
  • Administration of a low, immune enhancing, dose of an mTOR inhibitor e.g., a dose that is insufficient to completely suppress the immune system, but sufficient to improve immune function
  • immune effector cells e.g., T cells or CAR-expressing cells
  • administration of a low, immune enhancing, dose of an mTOR inhibitor can result in one or more of the following:
  • KLRG1 a decrease in the expression of KLRG1, e.g., on memory T cells, e.g., memory T cell precursors;
  • an increase in the number of memory T cell precursors e.g., cells with any one or combination of the following characteristics: increased CD62L hlgh , increased CD127 hlgh , increased CD27 + , decreased KLRG1, and increased BCL2;
  • any of the foregoing, e.g., i), ii), iii), iv), v), vi), or vii), occurs e.g., at least transiently, e.g., as compared to a non-treated subject.
  • administration of a low, immune enhancing, dose of an mTOR inhibitor results in increased or prolonged proliferation of CAR-expressing cells, e.g., in culture or in a subject, e.g., as compared to non-treated CAR-expressing cells or a non-treated subject.
  • increased proliferation is associated with in an increase in the number of CAR-expressing cells.
  • administration of a low, immune enhancing, dose of an mTOR inhibitor results in increased killing of cancer cells by CAR-expressing cells, e.g., in culture or in a subject, e.g., as compared to non-treated CAR-expressing cells or a non-treated subject.
  • increased killing of cancer cells is associated with in a decrease in tumor volume.
  • the cells expressing a CAR molecule are administered in combination with a low, immune enhancing dose of an mTOR inhibitor, e.g., an allosteric mTOR inhibitor, e.g., RADOOl, or a catalytic mTOR inhibitor.
  • an mTOR inhibitor e.g., an allosteric mTOR inhibitor, e.g., RADOOl, or a catalytic mTOR inhibitor.
  • administration of the low, immune enhancing, dose of the mTOR inhibitor can be initiated prior to administration of a CAR-expressing cell described herein; completed prior to administration of a CAR-expressing cell described herein; initiated at the same time as administration of a CAR-expressing cell described herein; overlapping with administration of a CAR-expressing cell described herein; or continuing after administration of a CAR-expressing cell described herein.
  • administration of a low, immune enhancing, dose of an mTOR inhibitor can optimize immune effector cells to be engineered to express a CAR molecule described herein.
  • administration of a low, immune enhancing, dose of an mTOR inhibitor e.g., an allosteric inhibitor, e.g., RADOOl, or a catalytic inhibitor, is initiated or completed prior to harvest of immune effector cells, e.g., T cells or NK cells, to be engineered to express a CAR molecule described herein, from a subject.
  • immune effector cells e.g., T cells or NK cells
  • CAR-expressing immune effector cells e.g., T cells or NK cells, e.g., prior to administration to a subject
  • administering to the subject a low, immune enhancing, dose of an mTOR inhibitor comprises administering, e.g., once per week, e.g., in an immediate release dosage form, 0.1 to 20, 0.5 to 10, 2.5 to 7.5, 3 to 6, or about 5, mgs of RADOOl, or a bioequivalent dose thereof.
  • administering to the subject a low, immune enhancing, dose of an mTOR inhibitor comprises administering, e.g., once per week, e.g., in a sustained release dosage form, 0.3 to 60, 1.5 to 30, 7.5 to 22.5, 9 to 18, or about 15 mgs of RADOOl, or a bioequivalent dose thereof.
  • a dose of an mTOR inhibitor is associated with, or provides, mTOR inhibition of at least 5 but no more than 90%, at least 10 but no more than 90%, at least 15, but no more than 90%, at least 20 but no more than 90%, at least 30 but no more than 90%, at least 40 but no more than 90%, at least 50 but no more than 90%, at least 60 but no more than 90%, at least 70 but no more than 90%, at least 5 but no more than 80%, at least 10 but no more than 80%, at least 15, but no more than 80%, at least 20 but no more than 80%, at least 30 but no more than 80%, at least 40 but no more than 80%, at least 50 but no more than 80%, at least 60 but no more than 80%, at least 5 but no more than 70%, at least 10 but no more than 70%, at least 15, but no more than 70%, at least 20 but no more than 70%, at least 30 but no more than 70%, at least 40 but no more than 70%, at least 50 but no more than 70%, at least 50 but no more than 70%,
  • the extent of mTOR inhibition can be conveyed as, or corresponds to, the extent of P70 S6 kinase inhibition, e.g., the extent of mTOR inhibition can be determined by the level of decrease in P70 S6 kinase activity, e.g., by the decrease in phosphorylation of a P70 S6 kinase substrate.
  • the level of mTOR inhibition can be evaluated by various methods, such as measuring P70 S6 kinase activity by the Boulay assay, as described in U.S. Patent Application No. 2015/01240036, hereby incorporated by reference, or as described in U.S. Patent No. 7,727,950, hereby incorporated by reference; measuring the level of phosphorylated S6 by western blot; or evaluating a change in the ratio of PD1 negative immune effector cells to PD1 positive immune effector cells.
  • mTOR inhibitor refers to a compound or ligand, or a
  • an mTOR inhibitor is an allosteric inhibitor.
  • Allosteric mTOR inhibitors include the neutral tricyclic compound rapamycin (sirolimus), rapamycin-related compounds, that is compounds having structural and functional similarity to rapamycin including, e.g., rapamycin derivatives, rapamycin analogs (also referred to as rapalogs) and other macrolide compounds that inhibit mTOR activity.
  • an mTOR inhibitor is a catalytic inhibitor.
  • Rapamycin is a known macrolide antibiotic produced by Streptomyces hygroscopicus having the structure shown in Formula A.
  • Rapamycin analogs useful in the invention are, for example, O-substituted analogs in which the hydroxyl group on the cyclohexyl ring of rapamycin is replaced by ORj in which Rj is hydroxyalkyl, hydroxyalkoxyalkyl, acylaminoalkyl, or aminoalkyl; e.g. RAD001, also known as, everolimus as described in US 5,665,772 and WO94/09010 the contents of which are incorporated by reference.
  • Other suitable rapamycin analogs include those substituted at the 26- or 28-position.
  • the rapamycin analog may be an epimer of an analog mentioned above, particularly an epimer of an analog substituted in position 40, 28 or 26, and may optionally be further hydrogenated, e.g. as described in US 6,015,815, WO95/14023 and WO99/15530 the contents of which are incorporated by reference, e.g. ABT578 also known as zotarolimus or a rapamycin analog described in US 7,091,213, WO98/02441 and
  • WO01/14387 the contents of which are incorporated by reference, e.g. AP23573 also known as ridaforolimus.
  • rapamycin analogs suitable for use in the present invention from US 5,665,772 include, but are not limited to, 40-O-benzyl -rapamycin, 40-O-(4'-hydroxymethyl)benzyl-rapamycin, 40- 0-[4'-(l,2-dihydroxyethyl)]benzyl-rapamycin, 40-O-allyl-rapamycin, 40-O-[3'-(2,2-dimethyl-l,3- dioxolan-4(S)-yl)-prop-2'-en-l'-yl]-rapamycin, (2'E,4'S)-40-O-(4',5'-dihydroxypent-2'-en-l'-yl)- rapamycin, 40-O-(2-hydroxy)ethoxycarbonylmethyl-rapamycin, 40-O-(2-hydroxy)ethyl-rapamycin , 40- 0-(3 -hydroxy )propyl-rapamycin, 40-O-(
  • rapamycin analogs useful in the present invention are analogs where the hydroxyl group on the cyclohexyl ring of rapamycin and/or the hydroxy group at the 28 position is replaced with an hydroxyester group are known, for example, rapamycin analogs found in US RE44,768, e.g.
  • rapamycin analogs useful in the preset invention include those wherein the methoxy group at the 16 position is replaced with another substituent, preferably (optionally hydroxy-substituted) alkynyloxy, benzyl, orthomethoxybenzyl or chlorobenzyl and/or wherein the mexthoxy group at the 39 position is deleted together with the 39 carbon so that the cyclohexyl ring of rapamycin becomes a cyclopentyl ring lacking the 39 position methyoxy group; e.g. as described in W095/16691 and WO96/41807 the contents of which are incorporated by reference.
  • the analogs can be further modified such that the hydroxy at the 40-position of rapamycin is alkylated and/or the 32-carbonyl is reduced.
  • Rapamycin analogs from W095/16691 include, but are not limited to, 16-demthoxy- 16-(pent-2- ynyl)oxy-rapamycin, 16-demthoxy- 16-(but-2-ynyl)oxy-rapamycin, 16-demthoxy- 16-(propargyl)oxy- rapamycin, 16-demethoxy- 16-(4-hydroxy-but-2-ynyl)oxy-rapamycin, 16-demthoxy- 16-benzyloxy-40- 0-(2-hydroxyethyl)-rapamycin, 16-demthoxy-l 6-benzyloxy-rapamycin, 16-demethoxy- 16-ortho- methoxybenzyl -rapamycin, 16-demethoxy-40-O-(2-methoxy ethyl)- 16-pent-2-ynyl)oxy -rapamycin, 39- demethoxy-40-desoxy-39-formyl-42-nor-rapamycin,
  • Rapamycin analogs from WO96/41807 include, but are not limited to, 32-deoxo-rapamycin, 16- 0-pent-2-ynyl-32-deoxo-rapamycin, 16-O-pent-2-ynyl-32-deoxo-40-O-(2-hydroxy-ethyl)-rapamycin, 16-O-pent-2-ynyl-32-(S)-dihydro-40-O-(2-hydroxyethyl)-rapamycin, 32(S)-dihydro-40-O-(2- methoxy)ethyl-rapamycin and 32(S)-dihydro-40-O-(2-hydroxyethyl)-rapamycin.
  • rapamycin analog is umirolimus as described in US2005/0101624 the contents of which are incorporated by reference.
  • RAD001 otherwise known as everolimus (Afinitor®), has the chemical name
  • allosteric mTOR inhibitors include sirolimus (rapamycin, AY-22989), 40-
  • catalytic, ATP-competitive mTOR inhibitors have been found to target the mTOR kinase domain directly and target both mTORCl and mTORC2. These are also more effective inhibitors of mTORCl than such allosteric mTOR inhibitors as rapamycin, because they modulate rapamycin-resistant mTORCl outputs such as 4EBP1-T37/46 phosphorylation and cap- dependent translation.
  • Catalytic inhibitors include: BEZ235 or 2-methyl-2-[4-(3-methyl-2-oxo-8-quinolin-3-yl-2,3- dihydro-imidazo[4,5-c]quinolin-l-yl)-phenyl]-propionitrile, or the monotosylate salt form, the synthesis of BEZ235 is described in WO2006/122806; CCG168 (otherwise known as AZD-8055, Chresta, CM., et al., Cancer Res, 2010, 70(1), 288-298) which has the chemical name ⁇ 5-[2,4-bis-((S)-3-methyl- mo holin-4-yl)-pyrido[2,3d]pyrirnidin-7-yl]-2-methoxy-phenyl ⁇ -methanol; 3-[2,4-bis[(3S)-3- methylmorpholin-4-yl]pyrido[2,3-d]pyrimidin-7-yl]-N-methylbenzamide (
  • catalytic mTOR inhibitors include 8-(6-methoxy-pyridin-3-yl)-3-methyl-l- (4-piper azin- 1 -yl-3 -trifluoromethyl -phenyl) - 1 ,3 -dihydro-imidazo [4, 5 -c] quinolin-2-one
  • Ku-0063794 is a specific inhibitor of the mammalian target of rapamycin (mTOR).
  • WYE-354 is another example of a catalytic mTor inhibitor (Yu K, et al. (2009). Biochemical, Cellular, and In vivo Activity of Novel ATP-Competitive and Selective Inhibitors of the Mammalian Target of Rapamycin. Cancer Res. 69(15): 6232-6240).
  • mTOR inhibitors useful according to the present invention also include prodrugs, derivatives, pharmaceutically acceptable salts, or analogs thereof of any of the foregoing.
  • mTOR inhibitors such as RAD001
  • RAD001 may be formulated for delivery based on well-established methods in the art based on the particular dosages described herein.
  • US Patent 6,004,973 (incorporated herein by reference) provides examples of formulations useable with the mTOR inhibitors described herein.
  • composition therapies may include anti-allergenic agents, anti-emetics, analgesics, adjunct therapies,
  • Suitable anti-allergic agents include corticosteroids, such as dexamethasone (e.g., Decadron®), beclomethasone (e.g., Beclovent®), hydrocortisone (also known as cortisone, hydrocortisone sodium succinate, hydrocortisone sodium phosphate, and sold under the tradenames Ala-Cort®, hydrocortisone phosphate, Solu-Cortef®, Hydrocort Acetate® and Lanacort®), prednisolone (sold under the tradenames Delta-Cortel®, Orapred®, Pediapred® and Prelone®), prednisone (sold under the tradenames Deltasone®, Liquid Red®, Meticorten® and Orasone®), methylpredni
  • corticosteroids such as dexamethasone (e.g., Decadron®), beclomethasone (e.g., Beclovent®), hydrocortisone (
  • antihistamines such as diphenhydramine (e.g., Benadryl®), hydroxyzine, and cyproheptadine
  • bronchodilators such as the beta-adrenergic receptor agonists, albuterol (e.g., Proventil®), and terbutaline (Brethine®).
  • anti-emetics are used in preventing nausea (upper stomach) and vomiting.
  • Suitable anti-emetics include aprepitant (Emend®), ondansetron (Zofran®), granisetron HC1 (Kytril®), lorazepam (Ativan®, dexamethasone (Decadron®), prochlorperazine (Compazine®), casopitant (Rezonic® and Zunrisa®), and combinations thereof. Medication to alleviate the pain experienced during the treatment period is often prescribed to make the patient more comfortable. Common over-the-counter analgesics, such Tylenol®, are often used. However, opioid analgesic drugs such as hydrocodone/paracetamol or
  • hydrocodone/acetaminophen e.g., Vicodin®
  • morphine e.g., Astramorph® or Avinza®
  • oxycodone e.g., OxyContin® or Percocet®
  • OxyContin® or Percocet® oxymorphone hydrochloride
  • fentanyl e.g.,
  • Duragesic® are also useful for moderate or severe pain.
  • cytoprotective agents such as neuroprotectants, free-radical scavengers, cardioprotectors, anthracycline extravasation neutralizers, nutrients and the like
  • Suitable cytoprotective agents include Amifostine (Ethyol®), glutamine, dimesna (Tavocept®), mesna
  • leucovorin also known as calcium leucovorin, citrovorum factor and folinic acid.
  • the present invention provides pharmaceutical compositions comprising at least one compound of the present invention (e.g., a compound of the present invention) or a pharmaceutically acceptable salt thereof together with a pharmaceutically acceptable carrier suitable for administration to a human or animal subject, either alone or together with other anti-cancer agents.
  • a pharmaceutically acceptable carrier suitable for administration to a human or animal subject, either alone or together with other anti-cancer agents.
  • the present invention provides methods of treating human or animal subjects suffering from a cellular proliferative disease, such as cancer.
  • the present invention provides methods of treating a human or animal subject in need of such treatment, comprising administering to the subject a therapeutically effective amount of a compound of the present invention (e.g., a compound of the present invention) or a pharmaceutically acceptable salt thereof, either alone or in combination with other anti-cancer agents.
  • a compound of the present invention e.g., a compound of the present invention
  • a pharmaceutically acceptable salt thereof either alone or in combination with other anti-cancer agents.
  • compositions will either be formulated together as a combination therapeutic or administered separately.
  • the compound of the present invention and other anti-cancer agent(s) may be administered either simultaneously, concurrently or sequentially with no specific time limits, wherein such administration provides therapeutically effective levels of the two compounds in the body of the patient.
  • the compound of the present invention and the other anti-cancer agent(s) is generally administered sequentially in any order by infusion or orally.
  • the dosing regimen may vary depending upon the stage of the disease, physical fitness of the patient, safety profiles of the individual drugs, and tolerance of the individual drugs, as well as other criteria well-known to the attending physician and medical practitioner(s) administering the combination.
  • the compound of the present invention and other anti-cancer agent(s) may be administered within minutes of each other, hours, days, or even weeks apart depending upon the particular cycle being used for treatment.
  • the cycle could include administration of one drug more often than the other during the treatment cycle and at different doses per administration of the drug.
  • kits that include one or more compound of the present invention and a combination partner as disclosed herein are provided.
  • Representative kits include (a) a compound of the present invention or a pharmaceutically acceptable salt thereof, (b) at least one combination partner, e.g., as indicated above, whereby such kit may comprise a package insert or other labeling including directions for administration.
  • a compound of the present invention may also be used to advantage in combination with known therapeutic processes, for example, the administration of hormones or especially radiation.
  • a compound of the present invention may in particular be used as a radiosensitizer, especially for the treatment of tumors which exhibit poor sensitivity to radiotherapy.
  • immune effector cells e.g., T cells, NK cells
  • a CAR e.g., a CAR described herein
  • reaction mixtures and compositions comprising such cells e.g., T cells, NK cells
  • the disclosure features an immune effector cell (e.g., T cell, NK cell) engineered to express a CAR, wherein the engineered immune effector cell exhibits an antitumor property.
  • a preferred antigen is a cancer associated antigen (i.e., tumor antigen) described herein.
  • a cell is transformed with the CAR and the CAR is expressed on the cell surface.
  • the cell e.g., T cell, NK cell
  • the cell is transduced with a viral vector encoding a CAR.
  • the viral vector is a retroviral vector.
  • the viral vector is a lentiviral vector.
  • the cell may stably express the CAR.
  • the cell e.g., T cell, NK cell
  • a nucleic acid e.g., mRNA, cDNA, DNA, encoding a CAR.
  • the cell may transiently express the CAR.
  • the present invention provides CART compositions and their use in medicaments or methods for treating, among other diseases, cancer or any malignancy or autoimmune diseases involving cells or tissues which express a tumor antigen as described herein.
  • the CAR of the invention can be used to eradicate a normal cell that express a tumor antigen as described herein, thereby applicable for use as a cellular
  • a source of cells e.g., T cells or natural killer (NK) cells, e.g., a population of T cells or NK cells
  • T cells or natural killer (NK) cells e.g., a population of T cells or NK cells
  • NK cells natural killer cells
  • subject is intended to include living organisms in which an immune response can be elicited (e.g., mammals). Examples of subjects include humans, monkeys, chimpanzees, dogs, cats, mice, rats, and transgenic species thereof.
  • T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
  • a cell population e.g., a harvested cell population, comprises a T cell or population of T cells, e.g., at various stages of differentiation. Stages of T cell differentiation include naive T cells, stem central memory T cells, central memory T cells, effector memory T cells, and terminal effector T cells, from least to most differentiated. After antigen exposure, naive T cells proliferate and differentiate into memory T cells, e.g., stem central memory T cells and central memory T cells, which then differentiate into effector memory T cells. Upon receiving appropriate T cell receptor, costimulatory, and inflammatory signals, memory T cells further differentiate into terminal effector T cells. See, e.g., Restifo. Blood.
  • Naive T cells are characterized by the following expression pattern of cell surface markers: CCR7+, CD62L+, CD45RO-, CD95-.
  • Stem central memory T cells are characterized by the following expression pattern of cell surface markers: CCR7+, CD62L+, CD45RO-, CD95+.
  • Central memory T cells are characterized by the following expression pattern of cell surface markers: CCR7+, CD62L+, CD45RO+, CD95+.
  • Effector memory T cells are characterized by the following expression pattern of cell surface markers: CCR7-, CD62L-, CD45RO+, CD95+.
  • Terminal effector T cells are characterized by the following expression pattern of cell surface markers: CCR7-, CD62L-, CD45RO-, CD95+. See, e.g., Gattinoni et al. Nat. Med. 17(2011): 1290-7; and Flynn et al. Clin. Translat. Immunol. 3(2014):e20.
  • immune effector cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as FicollTM separation.
  • cells from the circulating blood of an individual are obtained by apheresis.
  • the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
  • the cells collected by apheresis may be washed to remove the plasma fraction and, optionally, to place the cells in an appropriate buffer or media for subsequent processing steps.
  • the cells are washed with phosphate buffered saline (PBS).
  • the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations.
  • a washing step may be accomplished by methods known to those in the art, such as by using a semi- automated "flow-through” centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the
  • the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS, PlasmaLyte A, or other saline solution with or without buffer.
  • buffers such as, for example, Ca-free, Mg-free PBS, PlasmaLyte A, or other saline solution with or without buffer.
  • the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
  • the methods of the application can utilize culture media conditions comprising 5% or less, for example 2%, human AB serum, and employ known culture media conditions and compositions, for example those described in Smith et al., "Ex vivo expansion of human T cells for adoptive immunotherapy using the novel Xeno-free CTS Immune Cell Serum Replacement” Clinical & Translational Immunology (2015) 4, e31;
  • T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a
  • the methods described herein can include, e.g., selection of a specific subpopulation of immune effector cells, e.g., T cells, that are a T regulatory cell-depleted population, CD25+ depleted cells, using, e.g., a negative selection technique, e.g., described herein.
  • the population of T regulatory-depleted cells contains less than 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% of CD25+ cells.
  • T regulatory cells e.g., CD25+ T cells
  • T regulatory cells are removed from the population using an anti-CD25 antibody, or fragment thereof, or a CD25-binding ligand, e.g. IL-2.
  • the anti-CD25 antibody, or fragment thereof, or CD25-binding ligand is conjugated to a substrate, e.g., a bead, or is otherwise coated on a substrate, e.g., a bead.
  • the anti-CD25 antibody, or fragment thereof is conjugated to a substrate as described herein.
  • the T regulatory cells are removed from the population using CD25 depleting reagent from MiltenyiTM.
  • the ratio of cells to CD25 depletion reagent is le7 cells to 20 uL, or le7 cells to 15 uL, or le7 cells to 10 uL, or le7 cells to 5 uL, or le7 cells to 2.5 uL, or le7 cells to 1.25 uL.
  • for T regulatory cells, e.g., CD25+ depletion greater than 500 million cells/ml is used.
  • a concentration of cells of 600, 700, 800, or 900 million cells/ml is used.
  • the population of immune effector cells to be depleted includes about 6 x 10 9 CD25+ T cells. In other aspects, the population of immune effector cells to be depleted include about 1 x 10 9 to lx 10 10 CD25+ T cell, and any integer value in between. In one embodiment, the resulting population T regulatory-depleted cells has 2 x 10 9 T regulatory cells, e.g., CD25+ cells, or less (e.g., 1 x 10 9 , 5 x 10 8 , 1 x 10 8 , 5 x 10 7 , 1 x 10 7 , or less CD25+ cells).
  • the T regulatory cells e.g., CD25+ cells
  • a depletion tubing set such as, e.g., tubing 162-01.
  • the CliniMAC system is run on a depletion setting such as, e.g.,
  • decreasing the level of negative regulators of immune cells e.g., decreasing the number of unwanted immune cells, e.g., T REG cells
  • T REG cells e.g., decreasing the number of unwanted immune cells, e.g., T REG cells
  • methods of depleting T REG cells are known in the art.
  • Methods of decreasing T REG cells include, but are not limited to, cyclophosphamide, anti-GITR antibody (an anti-GITR antibody described herein), CD25- depletion, and combinations thereof.
  • the manufacturing methods comprise reducing the number of (e.g., depleting) T REG cells prior to manufacturing of the CAR-expressing cell.
  • manufacturing methods comprise contacting the sample, e.g., the apheresis sample, with an anti-GITR antibody and/or an anti-CD25 antibody (or fragment thereof, or a CD25-binding ligand), e.g., to deplete T REG cells prior to manufacturing of the CAR-expressing cell (e.g., T cell, NK cell) product.
  • a subject is pre-treated with one or more therapies that reduce T REG cells prior to collection of cells for CAR-expressing cell product manufacturing, thereby reducing the risk of subject relapse to CAR-expressing cell treatment.
  • methods of decreasing T REG cells include, but are not limited to, administration to the subject of one or more of cyclophosphamide, anti-GITR antibody, CD25-depletion, or a combination thereof. Administration of one or more of cyclophosphamide, anti-GITR antibody, CD25- depletion, or a combination thereof, can occur before, during or after an infusion of the CAR- expressing cell product.
  • a subject is pre-treated with cyclophosphamide prior to collection of cells for CAR-expressing cell product manufacturing, thereby reducing the risk of subject relapse to CAR-expressing cell treatment.
  • a subject is pre-treated with an anti-GITR antibody prior to collection of cells for CAR-expressing cell product manufacturing, thereby reducing the risk of subject relapse to CAR-expressing cell treatment.
  • the population of cells to be removed are neither the regulatory T cells or tumor cells, but cells that otherwise negatively affect the expansion and/or function of CART cells, e.g. cells expressing CD14, CDl lb, CD33, CD15, or other markers expressed by potentially immune suppressive cells.
  • such cells are envisioned to be removed concurrently with regulatory T cells and/or tumor cells, or following said depletion, or in another order.
  • the CAR-expressing cell (e.g., T cell, NK cell) manufacturing process is modified to deplete T REG cells prior to manufacturing of the CAR-expressing cell (e.g., T cell, NK cell) product (e.g., a CTL019 product).
  • CD25-depletion is used to deplete T REG cells prior to manufacturing of the CAR-expressing cell (e.g., T cell, NK cell) product (e.g., a CTL019 product).
  • the methods described herein can include more than one selection step, e.g., more than one depletion step. Enrichment of a T cell population by negative selection can be
  • a monoclonal antibody cocktail can include antibodies to CD 14, CD20, CDl lb, CD16, HLA-DR, and CD8.
  • the methods described herein can further include removing cells from the population which express a tumor antigen, e.g., a tumor antigen that does not comprise CD25, e.g., CD19, CD30, CD38, CD123, CD20, CD14 or CDl lb, to thereby provide a population of T regulatory- depleted, e.g., CD25+ depleted, and tumor antigen depleted cells that are suitable for expression of a CAR, e.g., a CAR described herein.
  • tumor antigen expressing cells are removed simultaneously with the T regulatory, e.g., CD25+ cells.
  • an anti-CD25 antibody, or fragment thereof, and an anti-tumor antigen antibody, or fragment thereof can be attached to the same substrate, e.g., bead, which can be used to remove the cells or an anti-CD25 antibody, or fragment thereof, or the anti-tumor antigen antibody, or fragment thereof, can be attached to separate beads, a mixture of which can be used to remove the cells.
  • the removal of T regulatory cells, e.g., CD25+ cells, and the removal of the tumor antigen expressing cells is sequential, and can occur, e.g., in either order.
  • check point inhibitor expressing cells are removed simultaneously with the T regulatory, e.g., CD25+ cells.
  • the T regulatory e.g., CD25+ cells.
  • an anti-CD25 antibody, or fragment thereof, and an anti-check point inhibitor antibody, or fragment thereof can be attached to the same bead which can be used to remove the cells, or an anti-CD25 antibody, or fragment thereof, and the anti-check point inhibitor antibody, or fragment there, can be attached to separate beads, a mixture of which can be used to remove the cells.
  • the removal of T regulatory cells, e.g., CD25+ cells, and the removal of the check point inhibitor expressing cells is sequential, and can occur, e.g., in either order.
  • T cells can isolated by incubation with anti-CD3/anti-CD28 (e.g., 3x28)-conjugated beads, such as
  • the time period is about 30 minutes. In a further embodiment, the time period ranges from 30 minutes to 36 hours or longer and all integer values there between. In a further embodiment, the time period is at least 1, 2, 3, 4, 5, or 6 hours. In yet another embodiment, the time period is 10 to 24 hours, e.g., 24 hours. Longer incubation times may be used to isolate T cells in any situation where there are few T cells as compared to other cell types, such in isolating tumor infiltrating lymphocytes (TIL) from tumor tissue or from immunocompromised individuals.
  • TIL tumor infiltrating lymphocytes
  • T cells can be preferentially selected for or against at culture initiation or at other time points during the process.
  • subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points.
  • a T cell population can be selected that expresses one or more of lFN- , TNFa, IL-17A, IL-2, IL-3, IL-4, GM-CSF, IL-10, IL-13, granzyme B, and perforin, or other appropriate molecules, e.g., other cytokines.
  • Methods for screening for cell expression can be determined, e.g., by the methods described in PCT Publication No.: WO 2013/126712.
  • the concentration of cells and surface can be varied.
  • it may be desirable to significantly decrease the volume in which beads and cells are mixed together e.g., increase the concentration of cells, to ensure maximum contact of cells and beads.
  • a concentration of 10 billion cells/ml, 9 billion/ml, 8 billion/ml, 7 billion/ml, 6 billion/ml, or 5 billion/ml is used.
  • a concentration of 1 billion cells/ml is used.
  • a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used.
  • concentrations of 125 or 150 million cells/ml can be used.
  • Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (e.g., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression. In a related aspect, it may be desirable to use lower concentrations of cells. By significantly diluting the mixture of T cells and surface (e.g., particles such as beads), interactions between the particles and cells is minimized.
  • target antigens of interest such as CD28-negative T cells
  • CD4+ T cells express higher levels of CD28 and are more efficiently captured than CD8+ T cells in dilute concentrations.
  • the concentration of cells used is 5 x 10 6 /ml. In other aspects, the concentration used can be from about 1 x 10 5 /ml to 1 x 10 6 /ml, and any integer value in between.
  • the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10°C or at room temperature.
  • a plurality of the immune effector cells of the population do not express diaglycerol kinase (DGK), e.g., is DGK-deficient.
  • DGK diaglycerol kinase
  • a plurality of the immune effector cells of the population do not express Ikaros, e.g., is Ikaros-deficient.
  • a plurality of the immune effector cells of the population do not express DGK and Ikaros, e.g., is both DGK and Ikaros-deficient.
  • T cells for stimulation can also be frozen after a washing step.
  • the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population.
  • the cells may be suspended in a freezing solution.
  • one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% Dextrose 5%, 0.45% NaCl, 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin, and 7.5% DMSO or other suitable cell freezing media containing for example, Hespan and PlasmaLyte A, the cells then are frozen to -80°C at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at -20° C or in liquid nitrogen.
  • cryopreserved cells are thawed and washed as described herein and allowed to rest for one hour at room temperature prior to activation using the methods of the present invention.
  • a blood sample or an apheresis product is taken from a generally healthy subject.
  • a blood sample or an apheresis is taken from a generally healthy subject who is at risk of developing a disease, but who has not yet developed a disease, and the cells of interest are isolated and frozen for later use.
  • the T cells may be expanded, frozen, and used at a later time.
  • samples are collected from a patient shortly after diagnosis of a particular disease as described herein but prior to any treatments.
  • the cells are isolated from a blood sample or an apheresis from a subject prior to any number of relevant treatment modalities, including but not limited to treatment with agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies, Cytoxan, fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228, and irradiation.
  • agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3
  • T cells are obtained from a patient directly following treatment that leaves the subject with functional T cells.
  • the quality of T cells obtained may be optimal or improved for their ability to expand ex vivo.
  • these cells may be in a preferred state for enhanced engraftment and in vivo expansion.
  • mobilization for example, mobilization with GM-CSF
  • conditioning regimens can be used to create a condition in a subject wherein repopulation, recirculation, regeneration, and/or expansion of particular cell types is favored, especially during a defined window of time following therapy.
  • Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system.
  • the immune effector cells expressing a CAR molecule are obtained from a subject that has received a low, immune enhancing dose of an mTOR inhibitor.
  • the population of immune effector cells, e.g., T cells, to be engineered to express a CAR are harvested after a sufficient time, or after sufficient dosing of the low, immune enhancing, dose of an mTOR inhibitor, such that the level of PDl negative immune effector cells, e.g., T cells, or the ratio of PDl negative immune effector cells, e.g., T cells/ PDl positive immune effector cells, e.g., T cells, in the subject or harvested from the subject has been, at least transiently, increased.
  • population of immune effector cells e.g., T cells, which have, or will be engineered to express a CAR
  • population of immune effector cells can be treated ex vivo by contact with an amount of an mTOR inhibitor that increases the number of PDl negative immune effector cells, e.g., T cells or increases the ratio of PDl negative immune effector cells, e.g., T cells/ PDl positive immune effector cells, e.g., T cells.
  • the methods of the application can utilize culture media conditions comprising 5% or less, for example 2%, human AB serum, and employ known culture media conditions and compositions, for example those described in Smith et al., "Ex vivo expansion of human T cells for adoptive immunotherapy using the novel Xeno-free CTS Immune Cell Serum Replacement” Clinical & Translational Immunology (2015) 4, e31;
  • a T cell population is diaglycerol kinase (DGK)-deficient.
  • DGK- deficient cells include cells that do not express DGK RNA or protein, or have reduced or inhibited DGK activity.
  • DGK-deficient cells can be generated by genetic approaches, e.g., administering RNA-interfering agents, e.g., siRNA, shRNA, miRNA, to reduce or prevent DGK expression.
  • RNA-interfering agents e.g., siRNA, shRNA, miRNA
  • DGK-deficient cells can be generated by treatment with DGK inhibitors described herein.
  • a T cell population is Ikaros-deficient.
  • Ikaros -deficient cells include cells that do not express Ikaros RNA or protein, or have reduced or inhibited Ikaros activity
  • Ikaros-deficient cells can be generated by genetic approaches, e.g., administering RNA-interfering agents, e.g., siRNA, shRNA, miRNA, to reduce or prevent Ikaros expression.
  • RNA-interfering agents e.g., siRNA, shRNA, miRNA
  • Ikaros-deficient cells can be generated by treatment with Ikaros inhibitors, e.g., lenalidomide.
  • a T cell population is DGK-deficient and Ikaros-deficient, e.g., does not express DGK and Ikaros, or has reduced or inhibited DGK and Ikaros activity.
  • DGK and Ikaros-deficient cells can be generated by any of the methods described herein.
  • the NK cells are obtained from the subject.
  • the NK cells are an NK cell line, e.g., NK-92 cell line (Conkwest).
  • the immune effector cell can be an allogeneic immune effector cell, e.g., T cell or NK cell.
  • the cell can be an allogeneic T cell, e.g., an allogeneic T cell lacking expression of a functional T cell receptor (TCR) and/or human leukocyte antigen (HLA), e.g., HLA class I and/or HLA class II.
  • TCR T cell receptor
  • HLA human leukocyte antigen
  • a T cell lacking a functional TCR can be, e.g., engineered such that it does not express any functional TCR on its surface, engineered such that it does not express one or more subunits that comprise a functional TCR (e.g., engineered such that it does not express (or exhibits reduced expression) of TCR alpha, TCR beta, TCR gamma, TCR delta, TCR epsilon, and/or TCR zeta) or engineered such that it produces very little functional TCR on its surface.
  • the T cell can express a substantially impaired TCR, e.g., by expression of mutated or truncated forms of one or more of the subunits of the TCR.
  • substantially impaired TCR means that this TCR will not elicit an adverse immune reaction in a host.
  • a T cell described herein can be, e.g., engineered such that it does not express a functional HLA on its surface.
  • a T cell described herein can be engineered such that cell surface expression HLA, e.g., HLA class 1 and/or HLA class II, is downregulated.
  • HLA e.g., HLA class 1 and/or HLA class II
  • downregulation of HLA may be accomplished by reducing or eliminating expression of beta- 2 microglobulin (B2M).
  • the T cell can lack a functional TCR and a functional HLA, e.g., HLA class I and/or HLA class II.
  • a functional TCR e.g., HLA class I and/or HLA class II.
  • Modified T cells that lack expression of a functional TCR and/or HLA can be obtained by any suitable means, including a knock out or knock down of one or more subunit of TCR or HLA.
  • the T cell can include a knock down of TCR and/or HLA using siRNA, shRNA, clustered regularly interspaced short palindromic repeats (CRISPR) transcription- activator like effector nuclease (TALEN), or zinc finger endonuclease (ZFN).
  • siRNA siRNA
  • shRNA clustered regularly interspaced short palindromic repeats
  • CRISPR clustered regularly interspaced short palindromic repeats
  • TALEN clustered regularly interspaced short palindromic repeats
  • ZFN zinc finger endonuclease
  • the allogeneic cell can be a cell which does not express or expresses at low levels an inhibitory molecule, e.g. by any mehod described herein.
  • the cell can be a cell that does not express or expresses at low levels an inhibitory molecule, e.g., that can decrease the ability of a CAR-expressing cell to mount an immune effector response.
  • inhibitory molecules include PD1, PD-L1, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIRl, CD160, 2B4 and TGFR beta.
  • an inhibitory nucleic acid e.g., an inhibitory nucleic acid, e.g., a dsRNA, e.g., an siRNA or shRNA, a clustered regularly interspaced short palindromic repeats (CRISPR), a transcription-activator like effector nuclease (TALEN), or a zinc finger endonuclease (ZFN), e.g., as described herein, can be used.
  • an inhibitory nucleic acid e.g., an inhibitory nucleic acid, e.g., a dsRNA, e.g., an siRNA or shRNA, a clustered regularly interspaced short palindromic repeats (CRISPR), a transcription-activator like effector nuclease (TALEN), or a zinc finger endonuclease (ZFN), e.g., as described herein, can be used.
  • CRISPR clustered regularly interspaced short palindromic repeat
  • TCR expression and/or HLA expression can be inhibited using siRNA or shRNA that targets a nucleic acid encoding a TCR and/or HLA and/or an inhibitory molecule described herein (e.g., PD1, PD-L1, PD-L2, CTLA4, TIM3, CEACAM (e.g.,
  • CEACAM-1, CEACAM-3 and/or CEACAM-5 LAG3, VISTA, BTLA, TIGIT, LAIRl, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, and TGFR beta), in a cell, e.g., T cell.
  • Expression systems for siRNA and shRNAs, and exemplary shRNAs are described, e.g., in paragraphs 649 and 650 of International Application WO2015/142675, filed March 13, 2015, which is incorporated by reference in its entirety.
  • CRISPR or “CRISPR to TCR and/or HLA” or “CRISPR to inhibit TCR and/or HLA” as used herein refers to a set of clustered regularly interspaced short palindromic repeats, or a system comprising such a set of repeats.
  • Cas refers to a CRIS PR- associated protein.
  • CRISPR/Cas refers to a system derived from CRISPR and Cas which can be used to silence or mutate a TCR and/or HLA gene and/or an inhibitory molecule described herein (e.g., PD1, PD-L1, PD-L2, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIRl, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCNl), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, and TGFR beta), in a cell, e.g., T cell.
  • an inhibitory molecule described herein e.g., PD1, PD-L1, PD-L2, CTLA4, TIM3, CEACAM
  • TALEN or "TALEN to HLA and/or TCR” or “TALEN to inhibit HLA and/or TCR” refers to a transcription activator-like effector nuclease, an artificial nuclease which can be used to edit the HLA and/or TCR gene, and/or an inhibitory molecule described herein (e.g., PD1, PD-Ll, PD-L2, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM- 5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7- H4 (VTCNl), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, and TGFR beta), in a cell, e.g., T cell.
  • TALENs and uses thereof, are described, e.g., in paragraphs 659-665 of International Application WO2015/142675, filed March 13, 2015, which is incorporated by reference in its entirety.
  • Zinc finger nuclease to inhibit HLA and/or TCR
  • ZFN Zinc Finger Nuclease or “ZFN to HLA and/or TCR” or “ZFN to inhibit HLA and/or TCR” refer to a zinc finger nuclease, an artificial nuclease which can be used to edit the HLA and/or TCR gene, and/or an inhibitory molecule described herein (e.g., PD1, PD- LI, PD-L2, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCNl), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, and TGFR beta), in a cell, e.g., T cell.
  • Telomeres play a crucial role in somatic cell persistence, and their length is maintained by telomerase (TERT). Telomere length in CLL cells may be very short (Roth et al.,
  • telomeres in T-cells of patients with ZAP-70+/CD38 chronic lymphocytic leukaemia British Journal of Haematology, 143, 383-386., August 28 2008
  • CAR-expressing cells e.g., CART19 cells
  • Telomerase expression can rescue CAR-expressing cells from replicative exhaustion.
  • a therapeutic T cell has short term persistence in a patient, due to shortened telomeres in the T cell; accordingly, transfection with a telomerase gene can lengthen the telomeres of the T cell and improve persistence of the T cell in the patient.
  • an immune effector cell e.g., a T cell
  • ectopically expresses a telomerase subunit, e.g., the catalytic subunit of telomerase, e.g., TERT, e.g., hTERT.
  • this disclosure provides a method of producing a CAR-expressing cell, comprising contacting a cell with a nucleic acid encoding a telomerase subunit, e.g., the catalytic subunit of telomerase, e.g., TERT, e.g., hTERT.
  • the cell may be contacted with the nucleic acid before, simultaneous with, or after being contacted with a construct encoding a CAR.
  • Telomerase expression may be stable (e.g., the nucleic acid may integrate into the cell's genome) or transient (e.g., the nucleic acid does not integrate, and expression declines after a period of time, e.g., several days).
  • Stable expression may be accomplished by transfecting or transducing the cell with DNA encoding the telomerase subunit and a selectable marker, and selecting for stable integrants.
  • stable expression may be accomplished by site-specific recombination, e.g., using the Cre/Lox or FLP/FRT system.
  • Transient exprsesion may involve transfection or transduction wtih a nucleic acid, e.g., DNA or RNA such as mRNA.
  • transient mRNA transfection avoids the genetic instability sometimes associated with stable transfection with TERT.
  • Transient expression of exogenous telomerase activity is described, e.g., in International Application WO2014/130909, which is incorporated by reference herein in its entirety.
  • mRNA-based transfection of a telomerase subunit is performed according to the messenger RNA TherapeuticsTM platform commercialized by Moderna Therapeutics.
  • the method may be a method described in US Pat. No. 8710200, 8822663, 8680069, 8754062, 8664194, or 8680069.
  • hTERT has the amino acid sequence of GenBank Protein ID
  • AAC51724.1 (Meyerson et al., "hEST2, the Putative Human Telomerase Catalytic Subunit Gene, Is Up-Regulated in Tumor Cells and during Immortalization" Cell Volume 90, Issue 4, 22 August 1997, Pages 785-795):
  • the hTERT has a sequence at least 80%, 85%, 90%, 95%, 96 A , 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 5. In an embodiment, the hTERT has a sequence of SEQ ID NO: 5. In an embodiment, the hTERT comprises a deletion (e.g., of no more than 5, 10, 15, 20, or 30 amino acids) at the N-terminus, the C-terminus, or both. In an embodiment, the hTERT comprises a transgenic amino acid sequence (e.g., of no more than 5, 10, 15, 20, or 30 amino acids) at the N-terminus, the C-terminus, or both.
  • the hTERT is encoded by the nucleic acid sequence of GenBank Accession No. AF018167 (Meyerson et al., "hEST2, the Putative Human Telomerase Catalytic Subunit Gene, Is Up-Regulated in Tumor Cells and during Immortalization” Cell Volume 90, Issue 4, 22 August 1997, Pages 785-795):
  • the hTERT is encoded by a nucleic acid having a sequence at least 80%, 85%, 90%, 95%, 96 A , 97%, 98%, or 99% identical to the sequence of SEQ ID NO: 8. In an embodiment, the hTERT is encoded by a nucleic acid of SEQ ID NO: 8.
  • the present invention provides immune effector cells (e.g., T cells, NK cells) that are engineered to contain one or more CARs that direct the immune effector cells to cancer. This is achieved through an antigen binding domain on the CAR that is specific for a cancer associated antigen.
  • cancer associated antigens tumor antigens
  • MHC major histocompatibility complex
  • an immune effector cell e.g., obtained by a method described herein, can be engineered to contain a CAR that target one of the following cancer associated antigens (tumor antigens): CD19; CD123; CD22; CD30; CD171; CS-1 (also referred to as CD2 subset 1, CRACC, SLAMF7, CD319, and 19A24); C-type lectin-like molecule-1 (CLL-1 or CLECL1); CD33; epidermal growth factor receptor variant III (EGFRvIII); ganglioside G2 (GD2); ganglioside GD3 (aNeu5Ac(2-8)aNeu5Ac(2-3)bDGalp(l-4)bDGlcp(l-l)Cer); TNF receptor family member B cell maturation (BCMA); Tn antigen ((Tn Ag) or (GalNAca- Ser/Thr)); prostate-specific membrane antigen (PSMA); Receptor tyrosine kinase
  • tyrosinase ephrin type-A receptor 2 (EphA2); Fucosyl GM1; sialyl Lewis adhesion molecule (sLe); ganglioside GM3 (aNeu5Ac(2-3)bDGalp(l-4)bDGlcp(l-l)Cer); transglutaminase 5 (TGS5); high molecular weight-melanoma-associated antigen (HMWMAA); o-acetyl-GD2 ganglioside (OAcGD2); Folate receptor beta; tumor endothelial marker 1 (TEM1/CD248); tumor endothelial marker 7-related (TEM7R); claudin 6 (CLDN6); thyroid stimulating hormone receptor (TSHR); G protein-coupled receptor class C group 5, member D (GPRC5D); chromosome X open reading frame 61 (CXORF61); CD97; CD179a; anaplastic lymphoma kinase (ALK); Polysia
  • pannexin 3 pannexin 3
  • G protein-coupled receptor 20 GPR20
  • lymphocyte antigen 6 complex locus K 9
  • OR51E2 Olfactory receptor 51E2
  • TCR Gamma Alternate Reading Frame Protein TCR
  • WT1 Wilms tumor protein
  • Cancer/testis antigen 1 NY-ESO-1
  • Cancer/testis antigen 2 (LAGE-la); Melanoma- associated antigen 1 (MAGE-A1); ETS translocation-variant gene 6, located on chromosome 12p (ETV6-AML); sperm protein 17 (SPA17); X Antigen Family, Member 1A (XAGE1); angiopoietin-binding cell surface receptor 2 (Tie 2); melanoma cancer testis antigen- 1 (MAD-CT-1); melanoma cancer testis antigen-2 (MAD-CT-2); Fos-related antigen 1; tumor protein p53 (p53); p53 mutant; prostein; surviving; telomerase; prostate carcinoma tumor antigen- 1 (PCTA-1 or Galectin 8), melanoma antigen recognized by T cells 1 (MelanA or MARTI); Rat sarcoma (Ras) mutant; human Telomerase reverse transcriptase (hTERT); sarcoma translocation breakpoints; melanoma inhibitor of a
  • LAIR1 Leukocyte-associated immunoglobulin-like receptor 1
  • FCAR Fc fragment of IgA receptor
  • LILRA2 Leukocyte immunoglobulin-like receptor subfamily A member 2
  • CD300LF CD300 molecule-like family member f
  • CLEC12A C-type lectin domain family 12 member A
  • BST2 bone marrow stromal cell antigen 2
  • LY75 lymphocyte antigen 75
  • Glypican-3 Glypican-3 (GPC3); Fc receptor-like 5 (FCRL5); and immunoglobulin lambda-like polypeptide 1 (IGLL1).
  • a multispecific antibody molecule is a bispecific antibody molecule.
  • a bispecific antibody has specificity for no more than two antigens.
  • a bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope.
  • the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein).
  • the first and second epitopes overlap.
  • the first and second epitopes do not overlap.
  • first and second epitopes are on different antigens, e.g., different proteins (or different subunits of a multimeric protein).
  • a bispecific antibody molecule comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope.
  • a bispecific antibody molecule comprises a half antibody having binding specificity for a first epitope and a half antibody having binding specificity for a second epitope.
  • a bispecific antibody molecule comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope.
  • a bispecific antibody molecule comprises a scFv, or fragment thereof, have binding specificity for a first epitope and a scFv, or fragment thereof, have binding specificity for a second epitope.
  • the antibody molecule is a multi- specific (e.g., a bispecific or a trispecific) antibody molecule.
  • bispecific antibody molecule is characterized by a first
  • immunoglobulin variable domain sequence e.g., a scFv, which has binding specificity for CD 19, e.g., comprises a scFv as described herein, or comprises the light chain CDRs and/or heavy chain CDRs from a scFv described herein, and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope on a different antigen.
  • the antibodies and antibody fragments of the present invention can be grafted to one or more constant domain of a T cell receptor (“TCR") chain, for example, a TCR alpha or TCR beta chain, to create a chimeric TCR.
  • TCR T cell receptor
  • an scFv as disclosed herein can be grafted to the constant domain, e.g., at least a portion of the extracellular constant domain, the transmembrane domain and the cytoplasmic domain, of a TCR chain, for example, the TCR alpha chain and/or the TCR beta chain.
  • an antibody fragment for example a VL domain as described herein, can be grafted to the constant domain of a TCR alpha chain
  • an antibody fragment for example a VH domain as described herein, can be grafted to the constant domain of a TCR beta chain
  • a VL domain may be grafted to the constant domain of the TCR beta chain
  • a VH domain may be grafted to a TCR alpha chain
  • the CDRs of an antibody or antibody fragment may be grafted into a TCR alpha and/or beta chain to create a chimeric TCR.
  • the LCDRs disclosed herein may be grafted into the variable domain of a TCR alpha chain and the HCDRs disclosed herein may be grafted to the variable domain of a TCR beta chain, or vice versa.
  • Such chimeric TCRs may be produced, e.g., by methods known in the art (For example, Willemsen RA et al, Gene Therapy 2000; 7: 1369-1377; Zhang T et al, Cancer Gene Ther 2004; 11: 487-496; Aggen et al, Gene Ther. 2012 Apr;19(4):365-74).
  • the antigen binding domain comprises a non-antibody scaffold, e.g., a fibronectin, ankyrin, domain antibody, lipocalin, small modular immuno-pharmaceutical, maxybody, Protein A, or affilin.
  • the non-antibody scaffold has the ability to bind to target antigen on a cell.
  • the antigen binding domain is a polypeptide or fragment thereof of a naturally occurring protein expressed on a cell.
  • the antigen binding domain comprises a non-antibody scaffold.
  • a wide variety of non-antibody scaffolds can be employed so long as the resulting polypeptide includes at least one binding region which specifically binds to the target antigen on a target cell.
  • Non-antibody scaffolds include: fibronectin (Novartis, MA), ankyrin (Molecular Partners AG, Zurich, Switzerland), domain antibodies (Domantis, Ltd., Cambridge, MA, and Ablynx nv, Zwijnaarde, Belgium), lipocalin (Pieris Proteolab AG, Freising, Germany), small modular immuno-pharmaceuticals (Trubion Pharmaceuticals Inc., Seattle, WA), maxybodies (Avidia, Inc., Mountain View, CA), Protein A (Affibody AG, Sweden), and affilin (gamma- crystallin or ubiquitin) (Scil Proteins GmbH, Halle, Germany).
  • the antigen binding domain comprises the extracellular domain, or a counter-ligand binding fragment thereof, of molecule that binds a counterligand on the surface of a target cell.
  • the immune effector cells can comprise a recombinant DNA construct comprising sequences encoding a CAR, wherein the CAR comprises an antigen binding domain (e.g., antibody or antibody fragment, TCR or TCR fragment) that binds specifically to a tumor antigen, e.g., an tumor antigen described herein, and an intracellular signaling domain.
  • the intracellular signaling domain can comprise a costimulatory signaling domain and/or a primary signaling domain, e.g., a zeta chain.
  • the costimulatory signaling domain refers to a portion of the CAR comprising at least a portion of the intracellular domain of a costimulatory molecule.
  • the methods described herein can include transducing a cell, e.g., from the population of T regulatory-depleted cells, with a nucleic acid encoding a CAR, e.g., a CAR described herein.
  • a CAR comprises a scFv domain, wherein the scFv may be preceded by an optional leader sequence such as provided in SEQ ID NO: 1, and followed by an optional hinge sequence such as provided in SEQ ID NO:2 or SEQ ID NO:36 or SEQ ID NO:23, a transmembrane region such as provided in SEQ ID NO:6, an intracellular signalling domain that includes SEQ ID NO:7 or SEQ ID NO: 16 and a CD3 zeta sequence that includes SEQ ID NO:9 or SEQ ID NO: 10, e.g., wherein the domains are contiguous with and in the same reading frame to form a single fusion protein.
  • an optional leader sequence such as provided in SEQ ID NO: 1
  • an optional hinge sequence such as provided in SEQ ID NO:2 or SEQ ID NO:36 or SEQ ID NO:23
  • a transmembrane region such as provided in SEQ ID NO:6
  • an intracellular signalling domain that includes SEQ ID NO:7 or SEQ ID
  • an exemplary CAR constructs comprise an optional leader sequence (e.g., a leader sequence described herein), an extracellular antigen binding domain (e.g., an antigen binding domain described herein), a hinge (e.g., a hinge region described herein), a
  • an exemplary CAR construct comprises an optional leader sequence (e.g., a leader sequence described herein), an extracellular antigen binding domain (e.g., an antigen binding domain described herein), a hinge (e.g., a hinge region described herein), a transmembrane domain (e.g., a transmembrane domain described herein), an intracellular costimulatory signaling domain (e.g., a costimulatory signaling domain described herein) and/or an intracellular primary signaling domain (e.g., a primary signaling domain described herein).
  • leader sequence e.g., a leader sequence described herein
  • an extracellular antigen binding domain e.g., an antigen binding domain described herein
  • a hinge e.g., a hinge region described herein
  • a transmembrane domain e.g., a transmembrane domain described herein
  • an intracellular costimulatory signaling domain e.g., a costimulatory
  • An exemplary leader sequence is provided as SEQ ID NO: 1.
  • An exemplary leader sequence is provided as SEQ ID NO: 1.
  • SEQ ID NO: 2 amino acid sequence of the hinge/spacer sequence is provided as SEQ ID NO: 2 or SEQ ID NO:36 or SEQ ID NO:23.
  • An exemplary transmembrane domain sequence is provided as SEQ ID NO:6.
  • An exemplary sequence of the intracellular signaling domain of the 4- IBB protein is provided as SEQ ID NO: 7.
  • An exemplary sequence of the intracellular signaling domain of CD27 is provided as SEQ ID NO: 16.
  • An exemplary CD3zeta domain sequence is provided as SEQ ID NO: 9 or SEQ ID NO: 10.
  • the immune effector cell comprises a recombinant nucleic acid construct comprising a nucleic acid molecule encoding a CAR, wherein the nucleic acid molecule comprises a nucleic acid sequence encoding an antigen binding domain, wherein the sequence is contiguous with and in the same reading frame as the nucleic acid sequence encoding an intracellular signaling domain.
  • An exemplary intracellular signaling domain that can be used in the CAR includes, but is not limited to, one or more intracellular signaling domains of, e.g., CD3-zeta, CD28, CD27, 4- IBB, and the like.
  • the CAR can comprise any combination of CD3-zeta, CD28, 4- IBB, and the like.
  • nucleic acid sequences coding for the desired molecules can be obtained using recombinant methods known in the art, such as, for example by screening libraries from cells expressing the nucleic acid molecule, by deriving the nucleic acid molecule from a vector known to include the same, or by isolating directly from cells and tissues containing the same, using standard techniques.
  • the nucleic acid of interest can be produced synthetically, rather than cloned.
  • Nucleic acids encoding a CAR can be introduced into the immune effector cells using, e.g., a retroviral or lentiviral vector construct.
  • Nucleic acids encoding a CAR can also be introduced into the immune effector cell using, e.g., an RNA construct that can be directly transfected into a cell.
  • a method for generating mRNA for use in transfection involves in vitro transcription (IVT) of a template with specially designed primers, followed by polyA addition, to produce a construct containing 3' and 5' untranslated sequence ("UTR") (e.g., a 3' and/or 5' UTR described herein), a 5' cap (e.g., a 5' cap described herein) and/or Internal Ribosome Entry Site (IRES) (e.g., an IRES described herein), the nucleic acid to be expressed, and a polyA tail, typically 50-2000 bases in length (e.g., described herein, e.g., SEQ ID NO:35).
  • UTR 3' and 5' untranslated sequence
  • IRES Internal Ribosome Entry Site
  • RNA so produced can efficiently transfect different kinds of cells.
  • the template includes sequences for the CAR.
  • an RNA CAR vector is transduced into a cell, e.g., a T cell by electroporation. Antigen binding domain
  • a plurality of the immune effector cells include a nucleic acid encoding a CAR that comprises a target- specific binding element otherwise referred to as an antigen binding domain.
  • the choice of binding element depends upon the type and number of ligands that define the surface of a target cell.
  • the antigen binding domain may be chosen to recognize a ligand that acts as a cell surface marker on target cells associated with a particular disease state.
  • examples of cell surface markers that may act as ligands for the antigen binding domain in a CAR described herein include those associated with viral, bacterial and parasitic infections, autoimmune disease and cancer cells.
  • the portion of the CAR comprising the antigen binding domain comprises an antigen binding domain that targets a tumor antigen, e.g., a tumor antigen described herein.
  • the antigen binding domain can be any domain that binds to the antigen including but not limited to a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody, and a functional fragment thereof, including but not limited to a single-domain antibody such as a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain (VHH) of camelid derived nanobody, and to an alternative scaffold known in the art to function as antigen binding domain, such as a recombinant fibronectin domain, a T cell receptor (TCR), or a fragment there of, e.g., single chain TCR, and the like.
  • VH heavy chain variable domain
  • VL light chain variable domain
  • VHH variable domain of camelid derived nanobody
  • an alternative scaffold known in the art to function as antigen binding domain such as a recombinant fibronectin domain, a T cell receptor (TCR), or a fragment there of,
  • the antigen binding domain it is beneficial for the antigen binding domain to be derived from the same species in which the CAR will ultimately be used in.
  • the antigen binding domain of the CAR it may be beneficial for the antigen binding domain of the CAR to comprise human or humanized residues for the antigen binding domain of an antibody or antibody fragment.
  • the antigen binding domain comprises an anti-CD 19 antibody, or fragment thereof, e.g., an scFv.
  • the antigen binding domain comprises a variable heavy chain and a variable light chain listed in Table 1.
  • the linker sequence joining the variable heavy and variable light chains can be, e.g., any of the linker sequences described herein, or alternatively, can be GSTSGSGKPGSGEGSTKG (SEQ ID NO: 104).
  • CD 19 CAR constructs containing humanized anti-CD 19 scFv domains are described in PCT publication WO 2014/153270, incorporated herein by reference.
  • any known CD19 CAR e.g., the CD19 antigen binding domain of any known CD19 CAR, in the art can be used in accordance with the present disclosure.
  • CD19 CAR described in the US Pat. No. 8,399,645; US Pat. No. 7,446,190; Xu et al., Leuk Lymphoma. 2013 54(2):255-260(2012); Cruz et al., Blood 122(17):2965-2973 (2013);
  • the antigen binding domain comprises an anti-BCMA antibody, or fragment thereof, e.g., an scFv.
  • the antigen binding domain comprises a variable heavy chain and a variable light chain listed in Table 11.
  • the linker sequence joining the variable heavy and variable light chains can be, e.g., any of the linker sequences described herein.
  • Anti-BCMA CAR constructs containing anti-BCMA scFv domains are described herein, e.g., in Table 11, or in US2016/0046724A 1 , incorporated herein by reference.
  • the antigen binding domain comprises an EGFRvIII antibody, or fragment thereof, e.g., an scFv.
  • the antigen binding domain comprises a variable heavy chain and a variable light chain described in US2014/0322275A1.
  • Anti-EGFRvIII CAR constructs containing anti-EGFRvIII scFv domains are described herein, e.g., in
  • the antigen binding domain comprises a CD123 antibody, or fragment thereof, e.g., an scFv.
  • the antigen binding domain comprises a variable heavy chain and a variable light chain described in US2014/0322212A1 or US2016/0068601A1.
  • Anti-CD123 CAR constructs containing anti- CD123 scFv domains are described herein, e.g., in US2014/0322212A1 or
  • the antigen binding domain comprises an anti-mesothelin antibody, or fragment thereof, e.g., an scFv.
  • the antigen binding domain comprises a variable heavy chain and a variable light chain described in WO 2015/090230.
  • Anti-mesothelin CAR constructs containing anti-mesothelin scFv domains are described herein, e.g., in WO
  • the antigen binding domain comprises an anti-CLLl antibody, or fragment thereof, e.g., an scFv.
  • the antigen binding domain comprises a variable heavy chain and a variable light chain described in US2016/0051651A1.
  • Anti-CLLl CAR constructs containing anti-CLLl scFv domains are described herein, e.g., in
  • the antigen binding domain comprises an anti-CD33 antibody, or fragment thereof, e.g., an scFv.
  • the antigen binding domain comprises a variable heavy chain and a variable light chain described in US2016/0096892A1.
  • Anti-CD33 CAR constructs containing anti-CD33 scFv domains are described herein, e.g., in
  • the antigen binding domain comprises one, two three (e.g., all three) heavy chain CDRs, HC CDRl, HC CDR2 and HC CDR3, from an antibody listed above, and/or one, two, three (e.g., all three) light chain CDRs, LC CDRl, LC CDR2 and LC CDR3, from an antibody listed above.
  • the antigen binding domain comprises a heavy chain variable region and/or a variable light chain region of an antibody listed or described above.
  • the anti-tumor antigen binding domain is a fragment, e.g., a single chain variable fragment (scFv).
  • the anti-a cancer associate antigen as described herein binding domain is a Fv, a Fab, a (Fab')2, or a bi-functional (e.g. bi-specific) hybrid antibody (e.g., Lanzavecchia et al., Eur. J. Immunol. 17, 105 (1987)).
  • the antibodies and fragments thereof of the invention binds a cancer associate antigen as described herein protein with wild-type or enhanced affinity.
  • scFvs can be prepared according to method known in the art (see, for example, Bird et al., (1988) Science 242:423-426 and Huston et al., (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
  • ScFv molecules can be produced by linking VH and VL regions together using flexible polypeptide linkers.
  • the scFv molecules comprise a linker (e.g., a Ser- Gly linker) with an optimized length and/or amino acid composition. The linker length can greatly affect how the variable regions of a scFv fold and interact.
  • WO2007/024715 is incorporated herein by reference.
  • An scFv can comprise a linker of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, or more amino acid residues between its VL and VH regions.
  • the linker sequence may comprise any naturally occurring amino acid.
  • the linker sequence comprises amino acids glycine and serine.
  • the linker sequence comprises sets of glycine and serine repeats such as
  • the linker can be (Gly 4 Ser) 4 (SEQ ID NO:27) or (Gly 4 Ser) 3 (SEQ ID NO:28). Variation in the linker length may retain or enhance activity, giving rise to superior efficacy in activity studies.
  • the antigen binding domain is a T cell receptor ("TCR"), or a fragment thereof, for example, a single chain TCR (scTCR).
  • TCR T cell receptor
  • scTCR single chain TCR
  • scTCR can be engineered that contains the Va and ⁇ genes from a T cell clone linked by a linker (e.g., a flexible peptide).
  • a linker e.g., a flexible peptide
  • a CAR can be designed to comprise a transmembrane domain that is attached to the extracellular domain of the CAR.
  • a transmembrane domain can include one or more additional amino acids adjacent to the transmembrane region, e.g., one or more amino acid associated with the extracellular region of the protein from which the transmembrane was derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 up to 15 amino acids of the extracellular region) and/or one or more additional amino acids associated with the intracellular region of the protein from which the transmembrane protein is derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 up to 15 amino acids of the intracellular region).
  • the transmembrane domain is one that is associated with one of the other domains of the CAR.
  • the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins, e.g., to minimize interactions with other members of the receptor complex.
  • the transmembrane domain is capable of homodimerization with another CAR on the cell surface of a CAR-expressing cell.
  • the amino acid sequence of the transmembrane domain may be modified or substituted so as to minimize interactions with the binding domains of the native binding partner present in the same CART.
  • the transmembrane domain may be derived either from a natural or from a recombinant source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. In one aspect the transmembrane domain is capable of signaling to the intracellular domain(s) whenever the CAR has bound to a target.
  • a transmembrane domain of particular use in this invention may include at least the transmembrane region(s) of e.g., the alpha, beta or zeta chain of the T-cell receptor, CD28, CD27, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.
  • a transmembrane domain may include at least the transmembrane region(s) of, e.g., KIR2DS2, OX40, CD2, CD27, LFA-1 (CDl la, CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD 160, CD 19, IL2R beta, IL2R gamma, IL7R a, ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD1 Id, ITGAE, CD103, ITGAL, CDl la, LFA-1, ITGAM, CDl lb, ITGAX, CDl lc, ITGB 1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, DNA
  • the transmembrane domain can be attached to the extracellular region of the CAR, e.g., the antigen binding domain of the CAR, via a hinge, e.g., a hinge from a human protein.
  • the hinge can be a human Ig
  • the hinge or spacer comprises (e.g., consists of) the amino acid sequence of SEQ ID NO:2.
  • the transmembrane domain comprises (e.g., consists of) a transmembrane domain of SEQ ID NO: 6.
  • the hinge or spacer comprises an IgG4 hinge.
  • the hinge or spacer comprises a hinge of the amino acid sequence
  • the hinge or spacer comprises a hinge encoded by a nucleotide sequence of
  • the hinge or spacer comprises an IgD hinge.
  • the hinge or spacer comprises a hinge of the amino acid sequence
  • the hinge or spacer comprises a hinge encoded by a nucleotide sequence of
  • the transmembrane domain may be recombinant, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
  • a triplet of phenylalanine, tryptophan and valine can be found at each end of a recombinant
  • a short oligo- or polypeptide linker may form the linkage between the transmembrane domain and the cytoplasmic region of the CAR.
  • a glycine- serine doublet provides a particularly suitable linker.
  • the linker comprises the amino acid sequence of GGGGSGGGGS (SEQ ID NO: 14).
  • the linker is encoded by a nucleotide sequence of
  • the hinge or spacer comprises a KIR2DS2 hinge.
  • the cytoplasmic domain or region of the CAR includes an intracellular signaling domain.
  • An intracellular signaling domain is generally responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR has been introduced.
  • effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
  • intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain.
  • intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
  • intracellular signaling domains for use in a CAR described herein include the cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any recombinant sequence that has the same functional capability.
  • TCR T cell receptor
  • T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation through the TCR (primary intracellular signaling domains) and those that act in an antigen-independent manner to provide a secondary or costimulatory signal (secondary cytoplasmic domain, e.g., a costimulatory domain).
  • primary signaling domain regulates primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way.
  • Primary intracellular signaling domains that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
  • ITAM containing primary intracellular signaling domains that are of particular use in the invention include those of TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta , CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d.
  • a CAR of the invention comprises an intracellular signaling domain, e.g., a primary signaling domain of CD3-zeta, e.g., a CD3-zeta sequence described herein.
  • a primary signaling domain comprises a modified ITAM domain, e.g., a mutated ITAM domain which has altered (e.g., increased or decreased) activity as compared to the native ITAM domain.
  • a primary signaling domain comprises a modified ITAM-containing primary intracellular signaling domain, e.g., an optimized and/or truncated ITAM-containing primary intracellular signaling domain.
  • a primary signaling domain comprises one, two, three, four or more ITAM motifs.
  • the intracellular signalling domain of the CAR can comprise the CD3-zeta signaling domain by itself or it can be combined with any other desired intracellular signaling domain(s) useful in the context of a CAR of the invention.
  • the intracellular signaling domain of the CAR can comprise a CD3 zeta chain portion and a costimulatory signaling domain.
  • the costimulatory signaling domain refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
  • a costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that is required for an efficient response of lymphocytes to an antigen.
  • CD27 costimulation has been demonstrated to enhance expansion, effector function, and survival of human CART cells in vitro and augments human T cell persistence and antitumor activity in vivo (Song et al. Blood. 2012; 119(3):696-706).
  • costimulatory molecules include CDS, ICAM-1, GITR, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), NKp30, NKp44, NKp46, CD160, CD19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLAl, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CDl ld, ITGAE, CD103, ITGAL, CDl la, LFA-1, ITGAM, CDl lb, ITGAX, CD 11c, ITGB 1, CD29, ITGB2, CD 18, LFA-1, ITGB7, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRT AM, Ly9
  • CD229) CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Lyl08), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, NKG2D, NKG2C and PAG/Cbp.
  • the intracellular signaling sequences within the cytoplasmic portion of the CAR may be linked to each other in a random or specified order.
  • a short oligo- or polypeptide linker for example, between 2 and 10 amino acids (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids) in length may form the linkage between intracellular signaling sequence.
  • a glycine-serine doublet can be used as a suitable linker.
  • a single amino acid e.g., an alanine, a glycine, can be used as a suitable linker.
  • the intracellular signaling domain is designed to comprise two or more, e.g., 2, 3, 4, 5, or more, costimulatory signaling domains.
  • the two or more, e.g., 2, 3, 4, 5, or more, costimulatory signaling domains are separated by a linker molecule, e.g., a linker molecule described herein.
  • the intracellular signaling domain comprises two costimulatory signaling domains.
  • the linker molecule is a glycine residue.
  • the linker is an alanine residue.
  • the intracellular signaling domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of CD28.
  • the intracellular signaling domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of 4- IBB.
  • the signaling domain of 4- IBB is a signaling domain of SEQ ID NO: 7.
  • the signaling domain of CD3-zeta is a signaling domain of SEQ ID NO: 9.
  • the intracellular signaling domain is designed to comprise the signaling domain of CD3-zeta and the signaling domain of CD27.
  • the signaling domain of CD27 comprises an amino acid sequence of
  • the signalling domain of CD27 is encoded by a nucleic acid sequence of
  • the CAR-expressing cell described herein can further comprise a second CAR, e.g., a second CAR that includes a different antigen binding domain, e.g., to the same target (e.g., CD19) or a different target (e.g., a target other than a cancer associated antigen described herein, e.g., CD19 or a different cancer associated antigen described herein).
  • the second CAR includes an antigen binding domain to a target expressed the same cancer cell type as the cancer associated antigen.
  • the CAR- expressing cell comprises a first CAR that targets a first antigen and includes an intracellular signaling domain having a costimulatory signaling domain but not a primary signaling domain, and a second CAR that targets a second, different, antigen and includes an intracellular signaling domain having a primary signaling domain but not a costimulatory signaling domain.
  • a costimulatory signaling domain e.g., 4-1BB, CD28, CD27, ICOS, or OX-40
  • the CAR expressing cell comprises a first cancer associated antigen CAR that includes an antigen binding domain that binds a target antigen described herein, a transmembrane domain and a costimulatory domain and a second CAR that targets a different target antigen (e.g., an antigen expressed on that same cancer cell type as the first target antigen) and includes an antigen binding domain, a transmembrane domain and a primary signaling domain.
  • a target antigen e.g., an antigen expressed on that same cancer cell type as the first target antigen
  • the CAR expressing cell comprises a first CAR that includes an antigen binding domain that binds a target antigen described herein, a transmembrane domain and a primary signaling domain and a second CAR that targets an antigen other than the first target antigen (e.g., an antigen expressed on the same cancer cell type as the first target antigen) and includes an antigen binding domain to the antigen, a transmembrane domain and a costimulatory signaling domain.
  • the CAR-expressing cell comprises an XCAR described herein and an inhibitory CAR.
  • the inhibitory CAR comprises an antigen binding domain that binds an antigen found on normal cells but not cancer cells, e.g., normal cells that also express X. In one embodiment, the inhibitory CAR comprises the antigen binding domain, a transmembrane domain and an intracellular domain of an inhibitory molecule.
  • the intracellular domain of the inhibitory CAR can be an intracellular domain of PD1, PD-L1, PD-L2, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, or TGFR (e.g., TGFRbeta).
  • CEACAM e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5
  • LAG3, VISTA e.g., VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H
  • the antigen binding domains of the different CARs can be such that the antigen binding domains do not interact with one another.
  • a cell expressing a first and second CAR can have an antigen binding domain of the first CAR, e.g., as a fragment, e.g., an scFv, that does not form an association with the antigen binding domain of the second CAR, e.g., the antigen binding domain of the second CAR is a VHH.
  • the antigen binding domain comprises a single domain antigen binding (SDAB) molecules include molecules whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain variable domains, binding molecules naturally devoid of light chains, single domains derived from conventional 4-chain antibodies, engineered domains and single domain scaffolds other than those derived from antibodies. SDAB molecules may be any of the art, or any future single domain molecules. SDAB molecules may be derived from any species including, but not limited to mouse, human, camel, llama, lamprey, fish, shark, goat, rabbit, and bovine. This term also includes naturally occurring single domain antibody molecules from species other than Camelidae and sharks.
  • SDAB single domain antigen binding
  • an SDAB molecule can be derived from a variable region of the immunoglobulin found in fish, such as, for example, that which is derived from the
  • an immunoglobulin isotype known as Novel Antigen Receptor (NAR) found in the serum of shark.
  • NAR Novel Antigen Receptor
  • Methods of producing single domain molecules derived from a variable region of NAR (“IgNARs") are described in WO 03/014161 and Streltsov (2005) Protein Sci. 14:2901-2909.
  • an SDAB molecule is a naturally occurring single domain antigen binding molecule known as heavy chain devoid of light chains.
  • Such single domain molecules are disclosed in WO 9404678 and Hamers-Casterman, C. et al. (1993) Nature 363:446-448, for example.
  • variable domain derived from a heavy chain molecule naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins.
  • a VHH molecule can be derived from Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco.
  • Camelidae species for example in camel, llama, dromedary, alpaca and guanaco.
  • Other species besides Camelidae may produce heavy chain molecules naturally devoid of light chain; such VHHs are within the scope of the invention.
  • the SDAB molecules can be recombinant, CDR-grafted, humanized, camelized, de- immunized and/or in vitro generated (e.g., selected by phage display).
  • cells having a plurality of chimeric membrane embedded receptors comprising an antigen binding domain that interactions between the antigen binding domain of the receptors can be undesirable, e.g., because it inhibits the ability of one or more of the antigen binding domains to bind its cognate antigen.
  • cells having a first and a second non-naturally occurring chimeric membrane embedded receptor comprising antigen binding domains that minimize such interactions are also disclosed herein.
  • nucleic acids encoding a first and a second non-naturally occurring chimeric membrane embedded receptor comprising an antigen binding domains that minimize such interactions, as well as methods of making and using such cells and nucleic acids.
  • the antigen binding domain of one of the first and the second non- naturally occurring chimeric membrane embedded receptor comprises an scFv, and the other comprises a single VH domain, e.g., a camelid, shark, or lamprey single VH domain, or a single VH domain derived from a human or mouse sequence.
  • the cell comprises a first and second CAR, wherein the antigen binding domain of one of the first CAR and the second CAR does not comprise a variable light domain and a variable heavy domain.
  • the antigen binding domain of one of the first CAR and the second CAR is an scFv, and the other is not an scFv.
  • the antigen binding domain of one of the first CAR and the second CAR comprises a single VH domain, e.g., a camelid, shark, or lamprey single VH domain, or a single VH domain derived from a human or mouse sequence.
  • the antigen binding domain of one of the first CAR and the second CAR comprises a nanobody.
  • the antigen binding domain of one of the first CAR and the second CAR comprises a camelid VHH domain.
  • the antigen binding domain of one of the first CAR and the second CAR comprises an scFv, and the other comprises a single VH domain, e.g., a camelid, shark, or lamprey single VH domain, or a single VH domain derived from a human or mouse sequence.
  • the antigen binding domain of one of the first CAR and the second CAR comprises an scFv, and the other comprises a nanobody.
  • the antigen binding domain of one of the first CAR and the second CAR comprises an scFv, and the other comprises a camelid VHH domain.
  • binding of the antigen binding domain of the first CAR to its cognate antigen is not substantially reduced by the presence of the second CAR. In some embodiments, binding of the antigen binding domain of the first CAR to its cognate antigen in the presence of the second CAR is 85%, 90%, 95%, 96%, 97%, 98% or 99% of binding of the antigen binding domain of the first CAR to its cognate antigen in the absence of the second CAR.
  • the antigen binding domains of the first CAR and the second CAR when present on the surface of a cell, associate with one another less than if both were scFv antigen binding domains. In some embodiments, the antigen binding domains of the first CAR and the second CAR, associate with one another 85%, 90%, 95%, 96%, 97%, 98% or 99% less than if both were scFv antigen binding domains.
  • the CAR-expressing cell described herein can further express another agent, e.g., an agent which enhances the activity of a CAR-expressing cell.
  • the agent can be an agent which inhibits a molecule that modulates or regulates, e.g., inhibits, T cell function.
  • the agent can be an agent which inhibits an inhibitory molecule.
  • Inhibitory molecules, e.g., PD1 can, in some embodiments, decrease the ability of a CAR-expressing cell to mount an immune effector response.
  • inhibitory molecules include PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, or TGFR beta.
  • an inhibitory nucleic acid e.g., an inhibitory nucleic acid, e.g., a dsRNA, e.g., an siRNA or shRNA, a clustered regularly interspaced short palindromic repeats (CRISPR), a transcription-activator like effector nuclease (TALEN), or a zinc finger endonuclease (ZFN), e.g., as described herein, can be used to inhibit expression of a molecule that modulates or regulates, e.g., inhibits, T-cell function in the CAR-expressing cell.
  • the agent is an shRNA, e.g., an shRNA described herein.
  • the agent that modulates or regulates, e.g., inhibits, T-cell function is inhibited within a CAR- expressing cell.
  • a dsRNA molecule that inhibits expression of a molecule that modulates or regulates, e.g., inhibits, T-cell function is linked to the nucleic acid that encodes a component, e.g., all of the components, of the CAR.
  • a nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function is operably linked to a promoter, e.g., a HI- or a U6-derived promoter such that the dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function is expressed, e.g., is expressed within a CAR-expressing cell. See e.g., Tiscornia G.,
  • nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function is present on the same vector, e.g., a lentiviral vector, that comprises a nucleic acid molecule that encodes a component, e.g., all of the components, of the CAR.
  • the nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function is located on the vector, e.g., the lentiviral vector, 5'- or 3'- to the nucleic acid that encodes a component, e.g., all of the components, of the CAR.
  • the nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function can be transcribed in the same or different direction as the nucleic acid that encodes a component, e.g., all of the components, of the CAR.
  • nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function is present on a vector other than the vector that comprises a nucleic acid molecule that encodes a component, e.g., all of the components, of the CAR.
  • nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function it transiently expressed within a CAR- expressing cell.
  • the nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function is stably integrated into the genome of a CAR-expressing cell.
  • the molecule that modulates or regulates, e.g., inhibits, T-cell function is PD-1.
  • the agent which inhibits an inhibitory molecule comprises a first polypeptide, e.g., an inhibitory molecule, associated with a second polypeptide that provides a positive signal to the cell, e.g., an intracellular signaling domain described herein.
  • the agent comprises a first polypeptide, e.g., of an inhibitory molecule such as PDl, PD-Ll, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD 160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, or TGFR beta, or a fragment of any of these (e.g., at least a portion of an extracellular domain of any of these), and a second polypeptide which is an intracellular signaling domain described herein (e.g., comprising a costimulatory domain (e.g., 41BB, CD27 or CD28, e.g., as described herein) and/or a primary signaling domain (e.g., a CD3 zeta signaling domain
  • the agent comprises a first polypeptide of PDl or a fragment thereof (e.g., at least a portion of an extracellular domain of PDl), and a second polypeptide of an intracellular signaling domain described herein (e.g., a CD28 signaling domain described herein and/or a CD3 zeta signaling domain described herein).
  • PDl is an inhibitory member of the CD28 family of receptors that also includes CD28, CTLA-4, ICOS, and BTLA.
  • PD-1 is expressed on activated B cells, T cells and myeloid cells (Agata et al. 1996 Int. Immunol 8:765-75).
  • PD-Ll Two ligands for PDl, PD-Ll and PD-L2 have been shown to downregulate T cell activation upon binding to PDl (Freeman et a. 2000 J Exp Med 192: 1027-34; Latchman et al. 2001 Nat Immunol 2:261-8; Carter et al. 2002 Eur J Immunol 32:634-43).
  • PD-Ll is abundant in human cancers (Dong et al. 2003 J Mol Med 81:281-7; Blank et al. 2005 Cancer Immunol. Immunother 54:307-314; Konishi et al. 2004 Clin Cancer Res 10:5094). Immune suppression can be reversed by inhibiting the local interaction of PDl with PD-Ll.
  • the agent comprises the extracellular domain (ECD) of an inhibitory molecule, e.g., Programmed Death 1 (PD1), fused to a transmembrane domain and intracellular signaling domains such as 4 IBB and CD3 zeta (also referred to herein as a PD1 CAR).
  • ECD extracellular domain
  • PD1 CAR when used in combination with a XCAR described herein, improves the persistence of the T cell.
  • the CAR is a PD1 CAR comprising the extracellular domain of PD1 indicated as underlined in SEQ ID NO: 105.
  • the PD1 CAR comprises the amino acid sequence of SEQ ID NO: 105.
  • the PD1 CAR comprises the amino acid sequence provided below (SEQ ID NO: 106). pgwfldspdrpwnpptfspallvvtegdnatftcsfsntsesfylnwyrmspsnqtdklaafpedrsqpgqdcrfrvtqlp ngrdfhmsvyrarmdsgtylcgaislapkaqikeslraelrvterra ⁇
  • the agent comprises a nucleic acid sequence encoding the PD1
  • the nucleic acid sequence for the PD1 CAR is shown below, with the PD1 ECD underlined below in SEQ ID NO: 103 atggccctccctgtcactgccctgcttctcccctcgcactcctgctccacgccgctagaccacccggatggtttctggactctc cggatcgcccgtggaatcccccaaccttctcaccggcactcttggttgtgactgagggcgataatgcgaccttcacgtgctcgttctccaa cacctccgaatcattcgtgctgaactggtaccgcatgagcccgtcaaaccagaccgacaagctccccgcgtttcggaagatcgggg
  • the inhibitor of an inhibitory signal can be, e.g., an antibody or antibody fragment that binds to an inhibitory molecule.
  • the agent can be an antibody or antibody fragment that binds to PDl, PD-Ll, PD-L2 or CTLA4 (e.g., ipilimumab (also referred to as MDX-010 and MDX-101, and marketed as Yervoy®; Bristol-Myers
  • the agent is an antibody or antibody fragment that binds to THVI3. In an embodiment, the agent is an antibody or antibody fragment that binds to LAG3. In an embodiment, the agent is an antibody or antibody fragment that binds to CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5).
  • CEACAM e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5
  • the agent that enhances the activity of a CAR-expressing cell e.g., inhibitor of an inhibitory molecule
  • an allogeneic CAR e.g., an allogeneic CAR described herein (e.g., described in the Allogeneic CAR section herein).
  • PDl is an inhibitory member of the CD28 family of receptors that also includes CD28, CTLA-4, ICOS, and BTLA. PDl is expressed on activated B cells, T cells and myeloid cells (Agata et al. 1996 Int. Immunol 8:765-75). Two ligands for PDl, PD-Ll and PD-L2 have been shown to downregulate T cell activation upon binding to PDl (Freeman et al. 2000 J Exp Med 192: 1027-34; Latchman et al. 2001 Nat Immunol 2:261-8; Carter et al. 2002 Eur J Immunol 32:634-43).
  • PD-Ll is abundant in human cancers (Dong et al. 2003 J Mol Med 81:281-7; Blank et al. 2005 Cancer Immunol. Immunother 54:307-314; Konishi et al. 2004 Clin Cancer Res 10:5094). Immune suppression can be reversed by inhibiting the local interaction of PDl with PD-Ll.
  • Antibodies, antibody fragments, and other inhibitors of PDl, PD-Ll and PD-L2 are known and may be used combination with a CD 19 CAR described herein.
  • nivolumab also referred to as BMS-936558 or MDX1106; Bristol-Myers Squibb
  • nivolumab is a fully human IgG4 monoclonal antibody which specifically blocks PDl.
  • Nivolumab (clone 5C4) and other human monoclonal antibodies that specifically bind to PDl are disclosed in US 8,008,449 and WO2006/121168.
  • Pidilizumab (CT-011; Cure Tech) is a humanized IgGlk monoclonal antibody that binds to PDl.
  • Pidilizumab and other humanized anti-PDl monoclonal antibodies are disclosed in WO2009/101611.
  • Pembrolizumab (formerly known as lambrolizumab, and also referred to as Keytruda, MK03475; Merck) is a humanized IgG4 monoclonal antibody that binds to PDl.
  • Pembrolizumab and other humanized anti-PDl antibodies are disclosed in US 8,354,509 and WO2009/114335.
  • MEDI4736 Medimmune
  • MDPL3280A (Genentech / Roche) is a human Fc optimized IgGl monoclonal antibody that binds to PD-L1.
  • MDPL3280A and other human monoclonal antibodies to PD-L1 are disclosed in U.S. Patent No.: 7,943,743 and U.S Publication No.: 20120039906.
  • Other anti-PD-Ll binding agents include
  • YW243.55.S70 (heavy and light chain variable regions are shown in SEQ ID NOs 20 and 21 in WO2010/077634) and MDX-1 105 (also referred to as BMS-936559, and, e.g., anti-PD-Ll binding agents disclosed in WO2007/005874).
  • AMP-224 (B7-DCIg; Amplimmune; e.g., disclosed in WO2010/027827 and WO2011/066342), is a PD-L2 Fc fusion soluble receptor that blocks the interaction between PDl and B7-H1.
  • Other anti-PDl antibodies include AMP 514 (Amplimmune), among others, e.g., anti-PDl antibodies disclosed in US 8,609,089, US 2010028330, and/or US 20120114649.
  • a PDl inhibitor described herein e.g., a PDl antibody, e.g., a PDl antibody described herein
  • a CD 19 CAR described herein to treat a disease associated with expression of CD19.
  • a PD-L1 inhibitor described herein e.g., a PD-L1 antibody, e.g., a PD-L1 antibody described herein
  • the disease may be, e.g., a lymphoma such as DLBCL including primary DLBCL or secondary DLBCL.
  • the subject has, or is identified as having, at least 5%, 6%, 7%, 8%, 9%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of cancer cells, e.g., DLBCL cells, which are CD3+/PD1+.
  • cancer cells e.g., DLBCL cells, which are CD3+/PD1+.
  • the subject has, or is identified as having, substantially non-overlapping populations of CD19+ cells and PD-L1+ cells in a cancer, e.g., the cancer microenvironment.
  • the subject is treated with a combination of a CD19 CAR, a PDl inhibitor, and a PD-Ll inhibitor.
  • the subject is treated with a combination of a CD 19 CAR, a PDl inhibitor, and a CD3 inhibitor.
  • the subject is treated with a combination of a CD19 CAR, a PDl inhibitor, a PD-Ll inhibitor, and a CD3 inhibitor.
  • the methods herein include a step of assaying cells in a biological sample, e.g., a sample comprising DLBCL cells, for CD3 and/or PD-1 (e.g., CD3 and/or PD-1 expression). In some embodiments, the methods include a step of assaying cells in a biological sample, e.g., a sample comprising DLBCL cells, for CD19 and/or PD-Ll (e.g., CD19 and/or PD-Ll expression).
  • the methods include, e.g., providing a sample comprising cancer cells and performing a detection step, e.g., by immunohistochemistry, for one or more of CD3, PD-1, CD 19, or PD-Ll.
  • the methods may comprise a further step of recommending or administering a treatment, e.g., a treatment comprising a CD19 CAR.
  • the anti-PD-1 antibody or fragment thereof is an anti-PD-1 antibody molecule as described in US 2015/0210769, entitled “Antibody Molecules to PD-1 and Uses Thereof," incorporated by reference in its entirety.
  • the anti-PD-1 antibody molecule includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region from an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-
  • the anti-PD-1 antibody molecule comprises at least one, two, three or four variable regions from an antibody described herein, e.g., an antibody chosen from any of BAP049-hum01, BAP049-hum02, BAP049-hum03, BAP049-hum04, BAP049-hum05, BAP049-hum06, BAP049-hum07, BAP049-hum08, BAP049-hum09, BAP049-humlO, BAP049-huml l, BAP049-huml2, BAP049-huml3, BAP049-huml4, BAP049-huml5, BAP049-huml6, BAP049-Clone-A, BAP049-Clone-B, BAP049-Clone-C, BAP049-Clone-D, or BAP049-Clone-E; or as described in Table 1 of US 2015/0210769, or encoded by the nucleotide
  • TIM3 (T cell immunoglobulin-3) also negatively regulates T cell function, particularly in IFN-g- secreting CD4+ T helper 1 and CD8+ T cytotoxic 1 cells, and plays a critical role in T cell exhaustion. Inhibition of the interaction between TIM3 and its ligands, e.g., galectin-9 (Gal9), phosphatidylserine (PS), and HMGB 1, can increase immune response.
  • ligands e.g., galectin-9 (Gal9), phosphatidylserine (PS), and HMGB 1
  • Antibodies, antibody fragments, and other inhibitors of TIM3 and its ligands are available in the art and may be used combination with a CD 19 CAR described herein.
  • antibodies, antibody fragments, small molecules, or peptide inhibitors that target TIM3 binds to the IgV domain of TIM3 to inhibit interaction with its ligands.
  • Antibodies and peptides that inhibit TEVI3 are disclosed in WO2013/006490 and US20100247521.
  • Other anti-TIM3 antibodies include humanized versions of RMT3-23 (disclosed in Ngiow et al., 2011, Cancer Res, 71:3540-3551), and clone 8B.2C12 (disclosed in Monney et al., 2002, Nature, 415:536-541).
  • Bi-specific antibodies that inhibit TIM3 and PD-1 are disclosed in US20130156774.
  • the anti-TIM3 antibody or fragment thereof is an anti-TIM3 antibody molecule as described in US 2015/0218274, entitled "Antibody Molecules to TIM3 and Uses Thereof," incorporated by reference in its entirety.
  • the anti- TEVI3 antibody molecule includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region from an antibody chosen from any of ABTIM3, ABTIM3-hum01, ABTIM3-hum02, ABTIM3-hum03, ABTIM3- hum04, ABTIM3-hum05, ABTIM3-hum06, ABTIM3-hum07, ABTIM3-hum08, ABTIM3- hum09, ABTIM3-huml0, ABTIM3-huml l, ABTIM3-huml2, ABTIM3-huml3, ABTIM3- huml4, ABTIM3-huml5, ABTIM3-huml6,
  • the anti-TIM3 antibody molecule comprises at least one, two, three or four variable regions from an antibody described herein, e.g., an antibody chosen from any of ABTIM3, ABTIM3-hum01, ABTIM3-hum02, ABTIM3-hum03, ABTIM3-hum04, ABTIM3-hum05, ABTIM3-hum06, ABTIM3-hum07, ABTIM3-hum08, ABTIM3-hum09, ABTIM3-huml0, ABTIM3-huml l, ABTIM3-huml2, ABTIM3-huml3, ABTIM3-huml4, ABTIM3-huml5, ABTIM3-huml6, ABTIM3-huml7, ABTIM3-huml8, ABTIM3-huml9, ABTIM3-hum20, ABTIM3-hum21, ABTIM3-hum22, ABTIM3-hum23; or as described in Tables 1-4 of US 2015/0218274; or
  • the agent which enhances the activity of a CAR-expressing cell is a CEACAM inhibitor (e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5 inhibitor).
  • the inhibitor of CEACAM is an anti-CEACAM antibody molecule.
  • anti-CEACAM- 1 antibodies are described in WO 2010/125571, WO 2013/082366 WO 2014/059251 and WO 2014/022332, e.g., a monoclonal antibody 34B 1, 26H7, and 5F4; or a recombinant form thereof, as described in, e.g., US 2004/0047858, US 7,132,255 and WO 99/052552.
  • the anti-CEACAM antibody binds to CEACAM-5 as described in, e.g., Zheng et al. PLoS One. 2010 Sep 2;5(9). pii: el2529
  • CEACAM carcinoembryonic antigen cell adhesion molecules
  • CEACAM-1 has been described as a heterophilic ligand for TIM-3 and as playing a role in TIM-3-mediated T cell tolerance and exhaustion (see e.g., WO 2014/022332; Huang, et al. (2014) Nature doi: 10.1038/naturel3848).
  • co-blockade of CEACAM-1 and TIM-3 has been shown to enhance an anti-tumor immune response in xenograft colorectal cancer models (see e.g., WO 2014/022332; Huang, et al. (2014), supra).
  • WO 2014/022332 Huang, et al. (2014), supra.
  • co-blockade of CEACAM-1 and PD-1 reduce T cell tolerance as described, e.g., in WO 2014/059251.
  • CEACAM inhibitors can be used with the other
  • immunomodulators described herein e.g., anti-PD-1 and/or anti-TIM-3 inhibitors
  • a cancer e.g., a melanoma, a lung cancer (e.g., NSCLC), a bladder cancer, a colon cancer an ovarian cancer, and other cancers as described herein.
  • LAG3 lymphocyte activation gene-3 or CD223
  • BMS- 986016 Bristol-Myers Squib
  • Bristol-Myers Squib is a monoclonal antibody that targets LAG3.
  • LAG3 antibody is an antagonist LAG3 antibody and IMP731 (Immutep and GlaxoSmithKline) is a depleting LAG3 antibody.
  • Other LAG3 inhibitors include IMP321 (Immutep), which is a recombinant fusion protein of a soluble portion of LAG3 and Ig that binds to MHC class II molecules and activates antigen presenting ceils (APC).
  • IMP321 Immutep
  • APC antigen presenting ceils
  • Other antibodies are disclosed, e.g., in WO2010/019570.
  • the anti-LAG3 antibody or fragment thereof is an anti-LAG3 antibody molecule as described in US 2015/0259420, entitled “Antibody Molecules to LAG3 and Uses Thereof," incorporated by reference in its entirety.
  • the anti- LAG3 antibody molecule includes at least one, two, three, four, five or six CDRs (or collectively all of the CDRs) from a heavy and light chain variable region from an antibody chosen from any of BAP050-hum01, BAP050-hum02, BAP050-hum03, BAP050-hum04, BAP050-hum05, BAP050-hum06, BAP050-hum07, BAP050-hum08, BAP050-hum09, BAP050-huml0, BAP050-huml l, BAP050-huml2, BAP050-huml3, BAP050-huml4, BAP050-huml5, BAP050-huml6, BAP050-huml7, BAP050-huml8, BAP050-huml9
  • CDRs which are identical or which have at least one amino acid alteration, but not
  • the anti- LAG3 antibody molecule comprises at least one, two, three or four variable regions from an antibody described herein, e.g., an antibody chosen from any of BAP050-hum01, BAP050-hum02, BAP050-hum03, BAP050-hum04, BAP050- hum05, BAP050-hum06, BAP050-hum07, BAP050-hum08, BAP050-hum09, BAP050-huml0, BAP050-huml l, BAP050-huml2, BAP050-huml3, BAP050-huml4, BAP050-huml5, BAP050-huml6, BAP050-huml7, BAP050-huml8, BAP050-huml9, BAP050-hum20, huBAP050(Ser) (e.g., BAP050-hum01-Ser, BAP050-hum02-Ser, BAP050-hum03-Ser, BAP050-hum04-Ser, BAP050-hum05-
  • BAP050-hum08-Ser BAP050-hum09-Ser, BAP050-huml0-Ser, BAP050-huml l-Ser,
  • BAP050-huml2-Ser BAP050-huml3-Ser, BAP050-huml4-Ser, BAP050-huml5-Ser,
  • the agent which enhances the activity of a CAR-expressing cell can be a costimulatory molecule or costimulatory molecule ligand.
  • costimulatory molecules include an MHC class I molecule, a TNF receptor protein, an Immunoglobulin-like protein, a cytokine receptor, an integrins, a signalling lymphocytic activation molecule (SLAM protein), an activating NK cell receptor, BTLA, a Toll ligand receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, CDS, ICAM-1, LFA-1 (CDl la/CD18), 4-1BB (CD137), B7-H3, CDS, ICAM-1, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD 19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, V
  • costimulatory molecule ligands examples include CD80, CD86, CD40L, ICOSL, CD70, OX40L, 4- IBBL, GITRL, and LIGHT.
  • the costimulatory molecule ligand is a ligand for a costimulatory molecule different from the costimulatory molecule domain of the CAR.
  • the costimulatory molecule ligand is a ligand for a costimulatory molecule that is the same as the costimulatory molecule domain of the CAR.
  • the costimulatory molecule ligand is a ligand for a costimulatory molecule that is the same as the costimulatory molecule domain of the CAR.
  • costimulatory molecule ligand is 4-1BBL. In an embodiment, the costimulatory ligand is CD80 or CD86. In an embodiment, the costimulatory molecule ligand is CD70. In
  • a CAR-expressing immune effector cell described herein can be further engineered to express one or more additional costimulatory molecules or costimulatory molecule ligands.
  • the disclosure features a population of CAR-expressing cells, e.g., CART cells.
  • the population of CAR-expressing cells comprises a mixture of cells expressing different CARs.
  • the population of CART cells can include a first cell expressing a CAR having an antigen binding domain to a cancer associated antigen described herein, and a second cell expressing a CAR having a different antigen binding domain, e.g., an antigen binding domain to a different a cancer associated antigen described herein, e.g., an antigen binding domain to a cancer associated antigen described herein that differs from the cancer associate antigen bound by the antigen binding domain of the CAR expressed by the first cell.
  • the population of CAR-expressing cells can include a first cell expressing a CAR that includes an antigen binding domain to a cancer associated antigen described herein, and a second cell expressing a CAR that includes an antigen binding domain to a target other than a cancer associate antigen as described herein.
  • the population of CAR-expressing cells includes, e.g., a first cell expressing a CAR that includes a primary intracellular signaling domain, and a second cell expressing a CAR that includes a secondary signaling domain.
  • the disclosure features a population of cells wherein at least one cell in the population expresses a CAR having an antigen binding domain to a cancer associated antigen described herein, and a second cell expressing another agent, e.g., an agent which enhances the activity of a CAR-expressing cell.
  • the agent can be an agent which inhibits an inhibitory molecule.
  • Inhibitory molecules e.g., PD-1, can, in some embodiments, decrease the ability of a CAR-expressing cell to mount an immune effector response.
  • inhibitory molecules examples include PD-1, PD-L1, CTLA4, TEVI3, CEACAM (CEACAM- 1, CEACAM-3, and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD 160, 2B4 and TGFR beta.
  • the agent which inhibits an inhibitory molecule comprises a first polypeptide, e.g., an inhibitory molecule, associated with a second polypeptide that provides a positive signal to the cell, e.g., an intracellular signaling domain described herein.
  • the agent comprises a first polypeptide, e.g., of an inhibitory molecule such as PD-1, PD-L1, CTLA4, TIM3, CEACAM (CEACAM-1,
  • CEACAM-3, and/or CEACAM-5 LAG3, VISTA, BTLA, TIGIT, LAIR1, CD 160, 2B4 and TGFR beta, or a fragment of any of these, and a second polypeptide which is an intracellular signaling domain described herein (e.g., comprising a costimulatory domain (e.g., 41BB, CD27, OX40 or CD28, e.g., as described herein) and/or a primary signaling domain (e.g., a CD3 zeta signaling domain described herein).
  • a costimulatory domain e.g., 41BB, CD27, OX40 or CD28, e.g., as described herein
  • a primary signaling domain e.g., a CD3 zeta signaling domain described herein.
  • the agent comprises a first polypeptide of PD- 1 or a fragment thereof, and a second polypeptide of an intracellular signaling domain described herein (e.g., a CD28 signaling domain described herein and/or a CD3 zeta signaling domain described herein).
  • a second polypeptide of an intracellular signaling domain described herein e.g., a CD28 signaling domain described herein and/or a CD3 zeta signaling domain described herein.
  • the present invention also provides an immune effector cell, e.g., made by a method described herein, that includes a nucleic acid molecules encoding one or more CAR constructs described herein.
  • the nucleic acid molecule is provided as a messenger RNA transcript.
  • the nucleic acid molecule is provided as a DNA construct.
  • the nucleic acid molecules described herein can be a DNA molecule, an RNA molecule, or a combination thereof.
  • the nucleic acid molecule is a vector that includes any of the aforesaid nucleic acid molecules.
  • the antigen binding domain of a CAR of the invention is encoded by a nucleic acid molecule whose sequence has been codon optimized for expression in a mammalian cell.
  • entire CAR construct of the invention is encoded by a nucleic acid molecule whose entire sequence has been codon optimized for expression in a mammalian cell. Codon optimization refers to the discovery that the frequency of occurrence of synonymous codons (i.e., codons that code for the same amino acid) in coding DNA is biased in different species. Such codon degeneracy allows an identical polypeptide to be encoded by a variety of nucleotide sequences. A variety of codon optimization methods is known in the art, and include, e.g., methods disclosed in at least US Patent Numbers 5,786,464 and 6,114,148.
  • an immune effector cell e.g., made by a method described herein, includes a nucleic acid molecule encoding a chimeric antigen receptor (CAR), wherein the CAR comprises an antigen binding domain that binds to a tumor antigen described herein, a transmembrane domain (e.g., a transmembrane domain described herein), and an intracellular signaling domain (e.g., an intracellular signaling domain described herein) comprising a stimulatory domain, e.g., a costimulatory signaling domain (e.g., a costimulatory signaling domain described herein) and/or a primary signaling domain (e.g., a primary signaling domain described herein, e.g., a zeta chain described herein).
  • CAR chimeric antigen receptor
  • the present invention also provides vectors in which a nucleic acid molecule encoding a CAR, e.g., a nucleic acid molecule described herein, is inserted.
  • Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells.
  • Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of low immunogenicity.
  • a retroviral vector may also be, e.g., a gammaretroviral vector.
  • a gammaretroviral vector may include, e.g., a promoter, a packaging signal ( ⁇ ), a primer binding site (PBS), one or more (e.g., two) long terminal repeats (LTR), and a transgene of interest, e.g., a gene encoding a CAR.
  • a promoter e.g., a promoter, a packaging signal ( ⁇ ), a primer binding site (PBS), one or more (e.g., two) long terminal repeats (LTR), and a transgene of interest, e.g., a gene encoding a CAR.
  • packaging signal
  • PBS primer binding site
  • LTR long terminal repeats
  • transgene of interest e.g., a gene encoding a CAR.
  • gammaretroviral vector may lack viral structural gens such as gag, pol, and env.
  • Exemplary gammaretroviral vectors include Murine Leukemia Virus (MLV), Spleen-Focus Forming Virus (SFFV), and Myeloproliferative Sarcoma Virus (MPSV), and vectors derived therefrom.
  • MMV Murine Leukemia Virus
  • SFFV Spleen-Focus Forming Virus
  • MPSV Myeloproliferative Sarcoma Virus
  • Other gammaretroviral vectors are described, e.g., in Tobias Maetzig et al., "Gammaretroviral Vectors: Biology, Technology and Application” Viruses. 2011 Jun; 3(6): 677-713.
  • the vector comprising the nucleic acid encoding the desired
  • CAR is an adenoviral vector (A5/35).
  • expression of nucleic acids encoding CARs can be accomplished using of transposons such as sleeping beauty, crisper, CAS9, and zinc finger nucleases. See below June et al. 2009Nature Reviews Immunology 9.10: 704-716, is incorporated herein by reference.
  • a vector may also include, e.g., a signal sequence to facilitate secretion, a
  • polyadenylation signal and transcription terminator e.g., from Bovine Growth Hormone (BGH) gene
  • BGH Bovine Growth Hormone
  • an element allowing episomal replication and replication in prokaryotes e.g. SV40 origin and ColEl or others known in the art
  • elements to allow selection e.g., ampicillin resistance gene and/or zeocin marker
  • the expression of natural or synthetic nucleic acids encoding CARs is typically achieved by operably linking a nucleic acid encoding the CAR polypeptide or portions thereof to a promoter, and incorporating the construct into an expression vector.
  • the vectors can be suitable for replication and integration eukaryotes.
  • Typical cloning vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
  • the nucleic acid can be cloned into a number of types of vectors.
  • the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid.
  • Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
  • the expression vector may be provided to a cell in the form of a viral vector.
  • Viruses which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno- associated viruses, herpes viruses, and lentiviruses.
  • a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).
  • retroviruses provide a convenient platform for gene delivery systems.
  • a selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art.
  • the recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo.
  • retroviral systems are known in the art.
  • adenovirus vectors are used.
  • a number of adenovirus vectors are known in the art.
  • lentivirus vectors are used.
  • promoter elements e.g., enhancers
  • promoters regulate the frequency of transcriptional initiation.
  • these are located in the region 30-110 bp upstream of the start site, although a number of promoters have been shown to contain functional elements downstream of the start site as well.
  • the spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another.
  • tk thymidine kinase
  • the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
  • individual elements can function either cooperatively or independently to activate transcription.
  • promoters include the CMV IE gene, EF-la, ubiquitin C, or phosphoglycerokinase (PGK) promoters.
  • the promoter is a PGK promoter, e.g., a truncated PGK promoter as described herein.
  • the native EFla promoter drives expression of the alpha subunit of the elongation factor- 1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome.
  • the EFla promoter has been extensively used in mammalian expression plasmids and has been shown to be effective in driving CAR expression from nucleic acid molecules cloned into a lentiviral vector. See, e.g., Milone et al., Mol. Ther. 17(8): 1453-1464 (2009).
  • the EFla promoter comprises the sequence provided in the Examples.
  • Another example of a promoter is the immediate early cytomegalovirus (CMV) promoter sequence.
  • CMV immediate early cytomegalovirus
  • This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto.
  • constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the elongation factor- la promoter, the hemoglobin promoter, and the creatine kinase promoter. Further, the invention should not be limited to the use of constitutive promoters.
  • inducible promoters are also contemplated as part of the invention.
  • the use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired.
  • inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
  • PGK phosphoglycerate kinase
  • a truncated PGK promoter e.g., a PGK promoter with one or more, e.g., 1, 2, 5, 10, 100, 200, 300, or 400, nucleotide deletions when compared to the wild-type PGK promoter sequence
  • a truncated PGK promoter e.g., a PGK promoter with one or more, e.g., 1, 2, 5, 10, 100, 200, 300, or 400, nucleotide deletions when compared to the wild-type PGK promoter sequence
  • the nucleotide sequences of exemplary PGK promoters are provided below.
  • PGK400 ACCCCTCTCTCCAGCCACTAAGCCAGTTGCTCCCTCGGCTGACGGCTGCACGCGAG GCCTCCGAACGTCTTACGCCTTGTGGCGCGCCCGTCCTTGTCCCGGGTGTGATGGC GGGGTGTGGGGCGGAGGGCGTGGCGGGGAAGGGCCGGCGACGAGAGCCGCGCGG GACGACTCGTCGGCGATAACCGGTGTCGGGTAGCGCCAGCCGCGCGACGGTAACG AGGGACCGCGACAGGCAGACGCTCCCATGATCACTCTGCACGCCGAAGGCAAATA GTGCAGGCCGTGCGGCGCTTGGCGTTCCTTGGAAGGGCTGAATCCCCGCCTCGTCC TTCGCAGCGGCCCCCCGGGTGTTCCCATCGCCGCTTCTAGGCCCACTGCGACGCTT GCCTGCACTTCTTACACGCTCTGGGTCCCAGCCG (SEQ ID NO:361)
  • a vector may also include, e.g., a signal sequence to facilitate secretion, a polyadenylation signal and transcription terminator (e.g., from Bovine Growth Hormone (BGH) gene), an element allowing episomal replication and replication in prokaryotes (e.g. SV40 origin and ColEl or others known in the art) and/or elements to allow selection (e.g., ampicillin resistance gene and/or zeocin marker).
  • BGH Bovine Growth Hormone
  • the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors.
  • the selectable marker may be carried on a separate piece of DNA and used in a co- transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells.
  • Useful selectable markers include, for example, antibiotic -resistance genes, such as neo and the like.
  • Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences.
  • a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells.
  • Suitable reporter genes may include genes encoding luciferase, beta- galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tei et al., 2000 FEBS Letters 479: 79-82).
  • Suitable expression systems are well known and may be prepared using known techniques or obtained commercially.
  • the construct with the minimal 5' flanking region showing the highest level of expression of reporter gene is identified as the promoter.
  • Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter- driven transcription.
  • the vector may comprise two or more nucleic acid sequences encoding a CAR, e.g., a CAR described herein, e.g., a CD19 CAR, and a second CAR, e.g., an inhibitory CAR or a CAR that specifically binds to an antigen other than CD 19.
  • a CAR e.g., a CAR described herein, e.g., a CD19 CAR
  • a second CAR e.g., an inhibitory CAR or a CAR that specifically binds to an antigen other than CD 19.
  • the two or more nucleic acid sequences encoding the CAR are encoded by a single nucleic molecule in the same frame and as a single polypeptide chain.
  • the two or more CARs can, e.g., be separated by one or more peptide cleavage sites, (e.g., an auto-cleavage site or a substrate for an intracellular protease).
  • peptide cleavage sites include T2A, P2A, E2A, or F2A sites.
  • Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al., 2012, MOLECULAR CLONING: A LABORATORY MANUAL, volumes 1 -4, Cold Spring Harbor Press, NY). A preferred method for the introduction of a polynucleotide into a host cell is calcium phosphate transfection
  • Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors.
  • Viral vectors, and especially retroviral vectors have become the most widely used method for inserting genes into mammalian, e.g., human cells.
  • Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and
  • Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g. , an artificial membrane vesicle).
  • Other methods of state-of-the-art targeted delivery of nucleic acids are available, such as delivery of polynucleotides with targeted nanoparticles or other suitable sub-micron sized delivery system.
  • an exemplary delivery vehicle is a liposome.
  • lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo).
  • the nucleic acid may be associated with a lipid.
  • the nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the
  • Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution. For example, they may be present in a bilayer structure, as micelles, or with a "collapsed" structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape. Lipids are fatty substances which may be naturally occurring or synthetic lipids.
  • lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
  • Lipids suitable for use can be obtained from commercial sources.
  • DMPC dimyristyl phosphatidylcholine
  • DCP dicetyl phosphate
  • Choi cholesterol
  • DMPG DMPG
  • other lipids may be obtained from Avanti Polar Lipids, Inc. (Birmingham, AL.). Stock solutions of lipids in chloroform or chloroform/methanol can be stored at about - 20°C. Chloroform is used as the only solvent since it is more readily evaporated than methanol.
  • "Liposome” is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium.
  • compositions that have different structures in solution than the normal vesicular structure are also encompassed.
  • the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules.
  • lipofectamine-nucleic acid complexes are also contemplated.
  • assays include, for example, "molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR;
  • biochemical assays such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention.
  • a regulatable CAR where the CAR activity can be controlled is desirable to optimize the safety and efficacy of a CAR therapy.
  • CAR activities can be regulated. For example, inducible apoptosis using, e.g., a caspase fused to a dimerization domain (see, e.g., Di Stasa et al., N Egnl. J. Med. 2011 Nov. 3;
  • the cells e.g., T cells or NK cells
  • a CAR of the present invention further comprise an inducible apoptosis switch, wherein a human caspase (e.g., caspase 9) or a modified version is fused to a modification of the human FKB protein that allows conditional dimerization.
  • a human caspase e.g., caspase 9
  • a modified version is fused to a modification of the human FKB protein that allows conditional dimerization.
  • the inducible caspase (e.g., caspase 9) is activated and leads to the rapid apoptosis and death of the cells (e.g., T cells or NK cells) expressing a CAR of the present invention.
  • a caspase-based inducible apoptosis switch (or one or more aspects of such a switch) have been described in, e.g., US2004040047; US20110286980;
  • the iCaspase-9 molecule contains a chemical inducer of dimerization (CID) binding domain that mediates dimerization in the presence of a CID. This results in inducible and selective depletion of CAR-expressing cells.
  • the iCaspase-9 molecule is encoded by a nucleic acid molecule separate from the CAR-encoding vector(s).
  • the iCaspase-9 molecule is encoded by the same nucleic acid molecule as the CAR-encoding vector.
  • the iCaspase-9 can provide a safety switch to avoid any toxicity of CAR-expressing cells. See, e.g., Song et al. Cancer Gene Ther. 2008;
  • Alternative strategies for regulating the CAR therapy of the instant invention include utilizing small molecules or antibodies that deactivate or turn off CAR activity, e.g., by deleting CAR-expressing cells, e.g., by inducing antibody dependent cell-mediated cytotoxicity
  • CAR-expressing cells described herein may also express an antigen that is recognized by molecules capable of inducing cell death, e.g., ADCC or complement-induced cell death.
  • CAR expressing cells described herein may also express a receptor capable of being targeted by an antibody or antibody fragment.
  • receptors examples include EpCAM, VEGFR, integrins (e.g., integrins ⁇ 3, ⁇ 4, ⁇ 3 ⁇ 4 ⁇ 3, ⁇ 4 ⁇ 7, ⁇ 5 ⁇ 1, ⁇ 3, ⁇ ), members of the TNF receptor superfamily (e.g., TRAIL-R1 , TRAIL-R2), PDGF Receptor, interferon receptor, folate receptor, GPNMB, ICAM-1 , HLA-DR, CEA, CA-125, MUC1 , TAG-72, IL-6 receptor, 5T4, GD2, GD3, CD2, CD3, CD4, CD5, CD1 1 , CD1 1 a/LFA-1 , CD15, CD18/ITGB2, CD19, CD20, CD22, CD23/lgE Receptor, CD25, CD28, CD30, CD33, CD38, CD40, CD41 , CD44, CD51 , CD52, CD62L, CD74, CD80, CD125, CD147/basigin, CD152/CT
  • a CAR-expressing cell described herein may also express a truncated epidermal growth factor receptor (EGFR) which lacks signaling capacity but retains the epitope that is recognized by molecules capable of inducing ADCC, e.g., cetuximab (ERBITUX®), such that administration of cetuximab induces ADCC and subsequent depletion of the CAR- expressing cells (see, e.g., WO2011/056894, and Jonnalagadda et al., Gene Ther. 2013;
  • EGFR epidermal growth factor receptor
  • Another strategy includes expressing a highly compact marker/suicide gene that combines target epitopes from both CD32 and CD20 antigens in the CAR-expressing cells described herein, which binds rituximab, resulting in selective depletion of the CAR-expressing cells, e.g., by ADCC (see, e.g., Philip et al., Blood. 2014; 124(8)1277-1287).
  • Other methods for depleting CAR-expressing cells described herein include administration of CAMPATH, a monoclonal anti-CD52 antibody that selectively binds and targets mature lymphocytes, e.g., CAR-expressing cells, for destruction, e.g., by inducing ADCC.
  • the CAR-expressing cell can be selectively targeted using a CAR ligand, e.g., an anti-idiotypic antibody.
  • the anti-idiotypic antibody can cause effector cell activity, e.g., ADCC or ADC activities, thereby reducing the number of CAR-expressing cells.
  • the CAR ligand, e.g., the anti-idiotypic antibody can be coupled to an agent that induces cell killing, e.g., a toxin, thereby reducing the number of CAR-expressing cells.
  • the CAR molecules themselves can be configured such that the activity can be regulated, e.g., turned on and off, as described below.
  • a CAR-expressing cell described herein may also express a target protein recognized by the T cell depleting agent.
  • the target protein is CD20 and the T cell depleting agent is an anti-CD20 antibody, e.g., rituximab.
  • the T cell depleting agent is administered once it is desirable to reduce or eliminate the CAR-expressing cell, e.g., to mitigate the CAR induced toxicity.
  • the T cell depleting agent is an anti-CD52 antibody, e.g., alemtuzumab.
  • a RCAR comprises a set of polypeptides, typically two in the simplest embodiments, in which the components of a standard CAR described herein, e.g., an antigen binding domain and an intracellular signaling domain, are partitioned on separate polypeptides or members.
  • the set of polypeptides include a dimerization switch that, upon the presence of a dimerization molecule, can couple the polypeptides to one another, e.g., can couple an antigen binding domain to an intracellular signaling domain.
  • a CAR of the present invention utilizes a dimerization switch as those described in, e.g., WO2014127261, which is incorporated by reference herein. Additional description and exemplary configurations of such regulatable CARs are provided herein and in, e.g., paragraphs 527-551 of International Publication No. WO 2015/090229 filed March 13, 2015, which is incorporated by reference in its entirety. Dimerization switches
  • Dimerization switches can be non-covalent or covalent.
  • the dimerization molecule promotes a non-covalent interaction between the switch domains.
  • the dimerization molecule promotes a covalent interaction between the switch domains.
  • the RCAR comprises a FKBP/FRAP, or FKBP/FRB, -based dimerization switch.
  • FKBP12 FKBP, or FK506 binding protein
  • rapamycin Rapamycin binds to FKBP and to the large PI3K homolog FRAP (RAFT, mTOR).
  • FRB is a 93 amino acid portion of FRAP, that is sufficient for binding the FKBP- rapamycin complex (Chen, J., Zheng, X. F., Brown, E. J. & Schreiber, S. L. (1995)
  • an FKBP/FRAP e.g., an FKBP/FRB
  • a dimerization molecule e.g., rapamycin or a rapamycin analog.
  • amino acid sequence of FKBP is as follows:
  • an FKBP switch domain can comprise a fragment of FKBP having the ability to bind with FRB, or a fragment or analog thereof, in the presence of rapamycin or a rapalog, e.g., the underlined portion of SEQ ID NO: 131, which is:
  • amino acid sequence of FRB is as follows:
  • FKBP/FRAP e.g., an FKBP/FRB, based switch
  • a dimerization switch comprising: a first switch domain, which comprises an FKBP fragment or analog thereof having the ability to bind with FRB, or a fragment or analog thereof, in the presence of rapamycin or a rapalog, e.g., RAD001, and has at least 70, 75, 80, 85, 90, 95, 96, 97, 98, or 99% identity with, or differs by no more than 30, 25, 20, 15, 10, 5, 4, 3, 2, or 1 amino acid residues from, the FKBP sequence of SEQ ID NO: 131 or 132; and a second switch domain, which comprises an FRB fragment or analog thereof having the ability to bind with FRB, or a fragment or analog thereof, in the presence of rapamycin or a rapalog, and has at least 70, 75, 80, 85, 90, 95, 96, 97, 98, or
  • the FKBP/FRB dimerization switch comprises a modified FRB switch domain that exhibits altered, e.g., enhanced, complex formation between an FRB-based switch domain, e.g., the modified FRB switch domain, a FKBP-based switch domain, and the dimerization molecule, e.g., rapamycin or a rapalogue, e.g., RAD001.
  • an FRB-based switch domain e.g., the modified FRB switch domain, a FKBP-based switch domain
  • the dimerization molecule e.g., rapamycin or a rapalogue, e.g., RAD001.
  • the modified FRB switch domain comprises one or more mutations, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10 or more, selected from mutations at amino acid position(s) L2031, E2032, S2035, R2036, F2039, G2040, T2098, W2101, D2102, Y2105, and F2108, where the wild-type amino acid is mutated to any other naturally-occurring amino acid.
  • mutations e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10 or more, selected from mutations at amino acid position(s) L2031, E2032, S2035, R2036, F2039, G2040, T2098, W2101, D2102, Y2105, and F2108, where the wild-type amino acid is mutated to any other naturally-occurring amino acid.
  • a mutant FRB comprises a mutation at E2032, where E2032 is mutated to phenylalanine (E2032F), methionine (E2032M), arginine (E2032R), valine (E2032V), tyrosine (E2032Y), isoleucine (E2032I), e.g., SEQ ID NO: 134, or leucine (E2032L), e.g., SEQ ID NO: 135.
  • a mutant FRB comprises a mutation at T2098, where T2098 is mutated to phenylalanine (T2098F) or leucine (T2098L), e.g., SEQ ID NO: 136.
  • a mutant FRB comprises a mutation at E2032 and at T2098, where E2032 is mutated to any amino acid, and where T2098 is mutated to any amino acid, e.g., SEQ ID NO: 137.
  • a mutant FRB comprises an E2032I and a T2098L mutation, e.g., SEQ ID NO: 138.
  • a mutant FRB comprises an E2032L and a T2098L mutation, e.g., SEQ ID NO: 139.
  • the CAR molecule described herein comprises one or more components of a natural killer cell receptor (NKR), thereby forming an NKR-CAR.
  • the NKR component can be a transmembrane domain, a hinge domain, or a cytoplasmic domain from any of the following natural killer cell receptors: killer cell immunoglobulin-like receptor (KIR), e.g., KIR2DL1, KIR2DL2/L3, KIR2DL4, KIR2DL5A, KIR2DL5B, KIR2DS 1,
  • KIR killer cell immunoglobulin-like receptor
  • the NKR-CAR molecules described herein may interact with an adaptor molecule or intracellular signaling domain, e.g., DAP12.
  • the CAR-expressing cell uses a split CAR.
  • the split CAR approach is described in more detail in publications WO2014/055442 and WO2014/055657.
  • a split CAR system comprises a cell expressing a first CAR having a first antigen binding domain and a costimulatory domain (e.g., 4 IBB), and the cell also expresses a second CAR having a second antigen binding domain and an intracellular signaling domain (e.g., CD3 zeta).
  • the costimulatory domain is activated, and the cell proliferates.
  • the intracellular signaling domain is activated and cell-killing activity begins.
  • the CAR-expressing cell is only fully activated in the presence of both antigens.
  • cells which contain a CAR molecule described herein or a nucleic acid encoding a CAR as described herein are also described herein. Also described herein are cells which have been transfected or transformed with a nucleic acid described herein, e.g., a nucleic acid encoding a CAR, e.g., as described herein.
  • the cell is a cell described herein, e.g., a human T cell, e.g., a human T cell described herein, or a human NK cell, e.g., a human NK cell described herein.
  • the human T cell is a CD8+ T cell.
  • the cell is autologous to the subject to be treated with the cell.
  • the cell is allogeneic to the subject to be treated with the cell.
  • the CAR-expressing cell described herein can further comprise a second CAR, e.g., a second CAR that includes a different antigen binding domain, e.g., to the same target or a different target (e.g., a target other than a tumor antigen described herein or a different tumor antigen described herein).
  • the second CAR includes an antigen binding domain to a target expressed the same cancer cell type as the tumor antigen.
  • the CAR-expressing cell comprises a first CAR that targets a first antigen and includes an intracellular signaling domain having a costimulatory signaling domain but not a primary signaling domain, and a second CAR that targets a second, different, antigen and includes an intracellular signaling domain having a primary signaling domain but not a costimulatory signaling domain.
  • a costimulatory signaling domain e.g., 4- IBB, CD28, ICOS, CD27 or OX-40
  • the primary signaling domain e.g., CD3 zeta
  • the CAR expressing cell comprises a first tumor antigen CAR that includes an antigen binding domain that binds a target antigen described herein, a transmembrane domain and a costimulatory domain and a second CAR that targets a different target antigen (e.g., an antigen expressed on that same cancer cell type as the first target antigen) and includes an antigen binding domain, a transmembrane domain and a primary signaling domain.
  • a different target antigen e.g., an antigen expressed on that same cancer cell type as the first target antigen
  • the CAR expressing cell comprises a first CAR that includes an antigen binding domain that binds a target antigen described herein, a transmembrane domain and a primary signaling domain and a second CAR that targets an antigen other than the first target antigen (e.g., an antigen expressed on the same cancer cell type as the first target antigen) and includes an antigen binding domain to the antigen, a transmembrane domain and a costimulatory signaling domain.
  • a first CAR that includes an antigen binding domain that binds a target antigen described herein, a transmembrane domain and a primary signaling domain
  • a second CAR that targets an antigen other than the first target antigen e.g., an antigen expressed on the same cancer cell type as the first target antigen
  • the present invention provides a population of CAR-expressing cells, e.g., at least one or more of which comprises a nucleic acid molecule described herein.
  • the population of CAR-expressing cells comprises a mixture of cells expressing different CARs.
  • the population of CART cells can include a first cell expressing a CAR having an antigen binding domain to a tumor antigen described herein, and a second cell expressing a CAR having a different antigen binding domain, e.g., an antigen binding domain to a different tumor antigen described herein, e.g., an antigen binding domain to a tumor antigen described herein that differs from the tumor antigen bound by the antigen binding domain of the CAR expressed by the first cell.
  • the population of CAR-expressing cells can include a first cell expressing a CAR that includes an antigen binding domain to a tumor antigen described herein, and a second cell expressing a CAR that includes an antigen binding domain to a target other than a tumor antigen as described herein.
  • the population of CAR- expressing cells includes, e.g., a first cell expressing a CAR that includes a primary
  • intracellular signaling domain and a second cell expressing a CAR that includes a secondary signaling domain.
  • the present invention provides a population of cells wherein at least one cell in the population expresses a CAR having an antigen binding domain to a tumor antigen described herein, and a second cell expressing another agent, e.g., an agent which enhances the activity of a CAR-expressing cell.
  • the agent can be an agent which inhibits an inhibitory molecule.
  • Inhibitory molecules e.g., PD-1, can, in some embodiments, decrease the ability of a CAR-expressing cell to mount an immune effector response.
  • inhibitory molecules include PD-1, PD-L1, PD-L2, CTLA4, TUVI3, CEACAM (CEACAM-1, CEACAM-3, and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIRI, CD160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCNl), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, and TGFR (e.g.,
  • the agent which inhibits an inhibitory molecule comprises a first polypeptide, e.g., an inhibitory molecule, associated with a second polypeptide that provides a positive signal to the cell, e.g., an intracellular signaling domain described herein.
  • the agent comprises a first polypeptide, e.g., of an inhibitory molecule such as PD1, PD-L1, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 or TGFR beta, or a fragment of any of these, and a second polypeptide which is an intracellular signaling domain described herein (e.g., comprising a costimulatory domain (e.g., 41BB, CD27, OX40 or CD28, e.g., as described herein) and/or a primary signaling domain (e.g., a CD3 zeta signaling domain described herein).
  • an inhibitory molecule such as PD1, PD-L1, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5), LAG3, VISTA,
  • the agent comprises a first polypeptide of PD-1 or a fragment thereof, and a second polypeptide of an intracellular signaling domain described herein (e.g., a CD28 signaling domain described herein and/or a CD3 zeta signaling domain described herein).
  • a second polypeptide of an intracellular signaling domain described herein e.g., a CD28 signaling domain described herein and/or a CD3 zeta signaling domain described herein.
  • RNA so produced can efficiently transfect different kinds of cells.
  • the template includes sequences for the CAR.
  • An immune effector cell can include a CAR encoded by a messenger RNA (mRNA).
  • mRNA messenger RNA
  • the mRNA encoding a CAR described herein is introduced into an immune effector cell, e.g., made by a method described herein, for production of a CAR-expressing cell.
  • the in vitro transcribed RNA CAR can be introduced to a cell as a form of transient transfection.
  • the RNA is produced by in vitro transcription using a polymerase chain reaction (PCR)-generated template. DNA of interest from any source can be directly converted by PCR into a template for in vitro mRNA synthesis using appropriate primers and RNA polymerase.
  • PCR polymerase chain reaction
  • the source of the DNA can be, for example, genomic DNA, plasmid DNA, phage DNA, cDNA, synthetic DNA sequence or any other appropriate source of DNA.
  • the desired temple for in vitro transcription is a CAR described herein.
  • the template for the RNA CAR comprises an extracellular region comprising a single chain variable domain of an antibody to a tumor associated antigen described herein; a hinge region (e.g., a hinge region described herein), a transmembrane domain (e.g., a transmembrane domain described herein such as a transmembrane domain of CD8a); and a cytoplasmic region that includes an intracellular signaling domain, e.g., an intracellular signaling domain described herein, e.g., comprising the signaling domain of CD3-zeta and the signaling domain of 4- IBB.
  • an intracellular signaling domain e.g., an intracellular signaling domain described herein, e.g., comprising the signaling domain of CD
  • the DNA to be used for PCR contains an open reading frame.
  • the DNA can be from a naturally occurring DNA sequence from the genome of an organism.
  • the nucleic acid can include some or all of the 5' and/or 3' untranslated regions (UTRs).
  • the nucleic acid can include exons and introns.
  • the DNA to be used for PCR is a human nucleic acid sequence.
  • the DNA to be used for PCR is a human nucleic acid sequence including the 5' and 3' UTRs.
  • the DNA can alternatively be an artificial DNA sequence that is not normally expressed in a naturally occurring organism.
  • An exemplary artificial DNA sequence is one that contains portions of genes that are ligated together to form an open reading frame that encodes a fusion protein. The portions of DNA that are ligated together can be from a single organism or from more than one organism.
  • PCR is used to generate a template for in vitro transcription of mRNA which is used for transfection.
  • Methods for performing PCR are well known in the art.
  • Primers for use in PCR are designed to have regions that are substantially complementary to regions of the DNA to be used as a template for the PCR.
  • “Substantially complementary,” as used herein, refers to sequences of nucleotides where a majority or all of the bases in the primer sequence are complementary, or one or more bases are non-complementary, or mismatched. Substantially complementary sequences are able to anneal or hybridize with the intended DNA target under annealing conditions used for PCR.
  • the primers can be designed to be substantially
  • the primers can be designed to amplify the portion of a nucleic acid that is normally transcribed in cells (the open reading frame), including 5' and 3' UTRs.
  • the primers can also be designed to amplify a portion of a nucleic acid that encodes a particular domain of interest.
  • the primers are designed to amplify the coding region of a human cDNA, including all or portions of the 5' and 3' UTRs. Primers useful for PCR can be generated by synthetic methods that are well known in the art.
  • Forward primers are primers that contain a region of nucleotides that are substantially complementary to nucleotides on the DNA template that are upstream of the DNA sequence that is to be amplified.
  • Upstream is used herein to refer to a location 5, to the DNA sequence to be amplified relative to the coding strand.
  • reverse primers are primers that contain a region of nucleotides that are substantially complementary to a double-stranded DNA template that are downstream of the DNA sequence that is to be amplified.
  • Downstream is used herein to refer to a location 3' to the DNA sequence to be amplified relative to the coding strand.
  • the RNA preferably has 5' and 3' UTRs.
  • the 5' UTR is between one and 3000 nucleotides in length.
  • the length of 5' and 3' UTR sequences to be added to the coding region can be altered by different methods, including, but not limited to, designing primers for PCR that anneal to different regions of the UTRs. Using this approach, one of ordinary skill in the art can modify the 5' and 3' UTR lengths required to achieve optimal translation efficiency following transfection of the transcribed RNA.
  • the 5' and 3' UTRs can be the naturally occurring, endogenous 5' and 3' UTRs for the nucleic acid of interest.
  • UTR sequences that are not endogenous to the nucleic acid of interest can be added by incorporating the UTR sequences into the forward and reverse primers or by any other modifications of the template.
  • the use of UTR sequences that are not endogenous to the nucleic acid of interest can be useful for modifying the stability and/or translation efficiency of the RNA. For example, it is known that AU-rich elements in 3' UTR sequences can decrease the stability of mRNA. Therefore, 3' UTRs can be selected or designed to increase the stability of the transcribed RNA based on properties of UTRs that are well known in the art.
  • the 5' UTR can contain the Kozak sequence of the endogenous nucleic acid.
  • a consensus Kozak sequence can be redesigned by adding the 5' UTR sequence.
  • Kozak sequences can increase the efficiency of translation of some RNA transcripts, but does not appear to be required for all RNAs to enable efficient translation. The requirement for Kozak sequences for many mRNAs is known in the art.
  • the 5' UTR can be 5'UTR of an RNA virus whose RNA genome is stable in cells.
  • various nucleotide analogues can be used in the 3' or 5' UTR to impede exonuclease degradation of the mRNA.
  • a promoter of transcription should be attached to the DNA template upstream of the sequence to be transcribed.
  • the RNA polymerase promoter becomes incorporated into the PCR product upstream of the open reading frame that is to be transcribed.
  • the promoter is a T7 polymerase promoter, as described elsewhere herein.
  • Other useful promoters include, but are not limited to, T3 and SP6 RNA polymerase promoters.
  • Consensus nucleotide sequences for T7, T3 and SP6 promoters are known in the art.
  • the mRNA has both a cap on the 5' end and a 3' poly(A) tail which determine ribosome binding, initiation of translation and stability mRNA in the cell.
  • RNA polymerase produces a long concatameric product which is not suitable for expression in eukaryotic cells.
  • the transcription of plasmid DNA linearized at the end of the 3' UTR results in normal sized mRNA which is not effective in eukaryotic transfection even if it is polyadenylated after transcription.
  • phage T7 RNA polymerase can extend the 3' end of the transcript beyond the last base of the template (Schenborn and Mierendorf, Nuc Acids Res., 13:6223-36 (1985); Nacheva and Berzal-Herranz, Eur. J. Biochem., 270: 1485-65 (2003).
  • the polyA/T segment of the transcriptional DNA template can be produced during PCR by using a reverse primer containing a polyT tail, such as 100T tail (SEQ ID NO: 31) (size can be 50-5000 T (SEQ ID NO: 32)), or after PCR by any other method, including, but not limited to, DNA ligation or in vitro recombination.
  • Poly(A) tails also provide stability to RNAs and reduce their degradation. Generally, the length of a poly(A) tail positively correlates with the stability of the transcribed RNA.
  • the poly(A) tail is between 100 and 5000 adenosines (e.g., SEQ ID NO: 30).
  • Poly(A) tails of RNAs can be further extended following in vitro transcription with the use of a poly(A) polymerase, such as E. coli polyA polymerase (E-PAP).
  • E-PAP E. coli polyA polymerase
  • increasing the length of a poly(A) tail from 100 nucleotides to between 300 and 400
  • nucleotides results in about a two-fold increase in the translation efficiency of the RNA.
  • attachment of different chemical groups to the 3' end can increase mRNA stability.
  • Such attachment can contain modified/artificial nucleotides, aptamers and other compounds.
  • ATP analogs can be incorporated into the poly(A) tail using poly(A) polymerase. ATP analogs can further increase the stability of the RNA.
  • RNAs produced by the methods disclosed herein include a 5' cap.
  • the 5' cap is provided using techniques known in the art and described herein (Cougot, et al., Trends in Biochem. Sci., 29:436-444 (2001); Stepinski, et al., RNA, 7: 1468-95 (2001); Elango, et al., Biochim. Biophys. Res. Commun., 330:958-966 (2005)).
  • RNAs produced by the methods disclosed herein can also contain an internal ribosome entry site (IRES) sequence.
  • IRES sequence may be any viral, chromosomal or artificially designed sequence which initiates cap-independent ribosome binding to mRNA and facilitates the initiation of translation. Any solutes suitable for cell electroporation, which can contain factors facilitating cellular permeability and viability such as sugars, peptides, lipids, proteins, antioxidants, and surfactants can be included.
  • RNA can be introduced into target cells using any of a number of different methods, for instance, commercially available methods which include, but are not limited to, electroporation (Amaxa Nucleofector-II (Amaxa Biosystems, Cologne, Germany)), (ECM 830 (BTX) (Harvard Instruments, Boston, Mass.) or the Gene Pulser II (BioRad, Denver, Colo.), Multiporator (Eppendort, Hamburg Germany), cationic liposome mediated transfection using lipofection, polymer encapsulation, peptide mediated transfection, or biolistic particle delivery systems such as "gene guns” (see, for example, Nishikawa, et al. Hum Gene Ther., 12(8):861-70 (2001).
  • Non-viral delivery methods include, but are not limited to, electroporation (Amaxa Nucleofector-II (Amaxa Biosystems, Cologne, Germany)), (ECM 830 (BTX) (Harvard Instrument
  • non-viral methods can be used to deliver a nucleic acid encoding a CAR described herein into a cell or tissue or a subject.
  • the non-viral method includes the use of a transposon (also called a transposable element).
  • a transposon is a piece of DNA that can insert itself at a location in a genome, for example, a piece of DNA that is capable of self- replicating and inserting its copy into a genome, or a piece of DNA that can be spliced out of a longer nucleic acid and inserted into another place in a genome.
  • a transposon comprises a DNA sequence made up of inverted repeats flanking genes for transposition.
  • Exemplary methods of nucleic acid delivery using a transposon include a Sleeping Beauty transposon system (SBTS) and a piggyBac (PB) transposon system. See, e.g., SBTS and a piggyBac (PB) transposon system. See, e.g., SBTS and a piggyBac (PB) transposon system. See, e.g., SBTS and a piggyBac (PB) transposon system. See, e.g., SBTS) and a piggyBac (PB) transposon system. See, e.g., SBTS) and a piggyBac (PB) transposon system. See, e.g., SBTS) and a piggyBac (PB) transposon system. See, e.g., SBTS) and a piggyBac (PB) transposon system. See, e.g., SBTS) and a
  • the SBTS includes two components: 1) a transposon containing a transgene and 2) a source of transposase enzyme.
  • the transposase can transpose the transposon from a carrier plasmid (or other donor DNA) to a target DNA, such as a host cell chromosome/genome.
  • a target DNA such as a host cell chromosome/genome.
  • the transposase binds to the carrier plasmid/donor DNA, cuts the transposon
  • Exemplary transposons include a pT2-based transposon. See, e.g., Grabundzija et al. Nucleic Acids Res. 41.3(2013): 1829-47; and Singh et al. Cancer Res. 68.8(2008): 2961-2971, all of which are incorporated herein by reference.
  • Exemplary transposases include a
  • Tel /mariner- type transposase e.g., the SB 10 transposase or the SB 11 transposase (a hyperactive transposase which can be expressed, e.g., from a cytomegalovirus promoter).
  • a transgene e.g., a nucleic acid encoding a CAR described herein.
  • nucleic acids e.g., plasmids, containing the SBTS components are delivered to a cell (e.g., T or NK cell).
  • the nucleic acid(s) are delivered by standard methods of nucleic acid (e.g., plasmid DNA) delivery, e.g., methods described herein, e.g., electroporation, transfection, or lipofection.
  • the nucleic acid contains a transposon comprising a transgene, e.g., a nucleic acid encoding a CAR described herein. In some embodiments, the nucleic acid contains a transposon comprising a transgene (e.g., a nucleic acid encoding a CAR described herein) as well as a nucleic acid sequence encoding a transposase enzyme.
  • a system with two nucleic acids e.g., a dual-plasmid system, e.g., where a first plasmid contains a transposon comprising a transgene, and a second plasmid contains a nucleic acid sequence encoding a transposase enzyme.
  • the first and the second nucleic acids are co-delivered into a host cell.
  • cells e.g., T or NK cells
  • a CAR described herein by using a combination of gene insertion using the SBTS and genetic editing using a nuclease (e.g., Zinc finger nucleases (ZFNs), Transcription Activator-Like Effector Nucleases (TALENs), the CRISPR/Cas system, or engineered meganuclease re-engineered homing endonucleases).
  • ZFNs Zinc finger nucleases
  • TALENs Transcription Activator-Like Effector Nucleases
  • CRISPR/Cas system or engineered meganuclease re-engineered homing endonucleases
  • use of a non-viral method of delivery permits reprogramming of cells, e.g., T or NK cells, and direct infusion of the cells into a subject.
  • Advantages of non- viral vectors include but are not limited to the ease and relatively low cost of producing sufficient amounts required to meet a patient population, stability during storage, and lack of immunogenicity .
  • Immune Effector Cells e.g., T cells
  • Immune effector cells such as T cells may be activated and expanded generally using methods as described, for example, in U.S. Patents 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and U.S. Patent Application
  • a population of immune effector cells may be expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a costimulatory molecule on the surface of the T cells.
  • T cell populations may be stimulated as described herein, such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore.
  • a protein kinase C activator e.g., bryostatin
  • a ligand that binds the accessory molecule is used for co-stimulation of an accessory molecule on the surface of the T cells.
  • a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
  • an anti-CD3 antibody and an anti-CD28 antibody can be used.
  • an anti-CD28 antibody include 9.3, B-T3, XR-CD28
  • the primary stimulatory signal and the costimulatory signal for the T cell may be provided by different protocols.
  • the agents providing each signal may be in solution or coupled to a surface. When coupled to a surface, the agents may be coupled to the same surface (i.e., in "cis” formation) or to separate surfaces (i.e., in "trans” formation). Alternatively, one agent may be coupled to a surface and the other agent in solution.
  • the agent providing the costimulatory signal is bound to a cell surface and the agent providing the primary activation signal is in solution or coupled to a surface. In certain aspects, both agents can be in solution.
  • the agents may be in soluble form, and then cross- linked to a surface, such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents. In this regard, see for example, U.S. Patent Application
  • the two agents are immobilized on beads, either on the same bead, i.e., "cis,” or to separate beads, i.e., "trans.”
  • the agent providing the primary activation signal is an anti-CD3 antibody or an antigen-binding fragment thereof and the agent providing the costimulatory signal is an anti-CD28 antibody or antigen-binding fragment thereof; and both agents are co -immobilized to the same bead in equivalent molecular amounts.
  • a 1 : 1 ratio of each antibody bound to the beads for CD4+ T cell expansion and T cell growth is used.
  • a ratio of anti CD3:CD28 antibodies bound to the beads is used such that an increase in T cell expansion is observed as compared to the expansion observed using a ratio of 1: 1.
  • an increase of from about 1 to about 3 fold is observed as compared to the expansion observed using a ratio of 1: 1.
  • the ratio of CD3:CD28 antibody bound to the beads ranges from 100: 1 to 1: 100 and all integer values there between.
  • more anti-CD28 antibody is bound to the particles than anti-CD3 antibody, i.e., the ratio of CD3:CD28 is less than one.
  • the ratio of anti CD28 antibody to anti CD3 antibody bound to the beads is greater than 2: 1.
  • a 1: 100 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1:75 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1:50 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1:30 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1: 10 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1:3 CD3:CD28 ratio of antibody bound to the beads is used.
  • a 3: 1 CD3:CD28 ratio of antibody bound to the beads is used.
  • Ratios of particles to cells from 1:500 to 500: 1 and any integer values in between may be used to stimulate T cells or other target cells.
  • the ratio of particles to cells may depend on particle size relative to the target cell. For example, small sized beads could only bind a few cells, while larger beads could bind many.
  • the ratio of cells to particles ranges from 1: 100 to 100: 1 and any integer values in-between and in further aspects the ratio comprises 1:9 to 9: 1 and any integer values in between, can also be used to stimulate T cells.
  • the ratio of anti-CD3- and anti-CD28- coupled particles to T cells that result in T cell stimulation can vary as noted above, however certain preferred values include 1: 100, 1:50, 1:40, 1:30, 1:20, 1: 10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1: 1, 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, and 15: 1 with one preferred ratio being at least 1: 1 particles per T cell.
  • a ratio of particles to cells of 1: 1 or less is used.
  • a preferred particle: cell ratio is 1:5.
  • the ratio of particles to cells can be varied depending on the day of stimulation.
  • the ratio of particles to cells is from 1: 1 to 10: 1 on the first day and additional particles are added to the cells every day or every other day thereafter for up to 10 days, at final ratios of from 1: 1 to 1: 10 (based on cell counts on the day of addition).
  • the ratio of particles to cells is 1: 1 on the first day of stimulation and adjusted to 1:5 on the third and fifth days of stimulation.
  • particles are added on a daily or every other day basis to a final ratio of 1: 1 on the first day, and 1:5 on the third and fifth days of stimulation.
  • the ratio of particles to cells is 2: 1 on the first day of stimulation and adjusted to 1: 10 on the third and fifth days of stimulation.
  • particles are added on a daily or every other day basis to a final ratio of 1 : 1 on the first day, and 1 : 10 on the third and fifth days of stimulation.
  • ratios will vary depending on particle size and on cell size and type.
  • the most typical ratios for use are in the neighborhood of 1: 1, 2: 1 and 3: 1 on the first day.
  • the cells such as T cells
  • the cells are combined with agent-coated beads, the beads and the cells are subsequently separated, and then the cells are cultured.
  • the agent-coated beads and cells are not separated but are cultured together.
  • the beads and cells are first concentrated by application of a force, such as a magnetic force, resulting in increased ligation of cell surface markers, thereby inducing cell stimulation.
  • cell surface proteins may be ligated by allowing paramagnetic beads to which anti-CD3 and anti-CD28 are attached (3x28 beads) to contact the T cells.
  • the cells for example, 10 4 to 10 9 T cells
  • beads for example, DYNABEADS® M- 450 CD3/CD28 T paramagnetic beads at a ratio of 1: 1
  • a buffer for example PBS (without divalent cations such as, calcium and magnesium).
  • the target cell may be very rare in the sample and comprise only 0.01% of the sample or the entire sample (i.e., 100%) may comprise the target cell of interest.
  • any cell number is within the context of the present invention.
  • it may be desirable to significantly decrease the volume in which particles and cells are mixed together i.e., increase the concentration of cells, to ensure maximum contact of cells and particles.
  • a concentration of about 10 billion cells/ml, 9 billion/ml, 8 billion/ml, 7 billion/ml, 6 billion/ml, 5 billion/ml, or 2 billion cells/ml is used.
  • greater than 100 million cells/ml is used.
  • a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
  • a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further aspects, concentrations of 125 or 150 million cells/ml can be used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells. Such populations of cells may have therapeutic value and would be desirable to obtain in certain aspects. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
  • cells transduced with a nucleic acid encoding a CAR are expanded, e.g., by a method described herein.
  • the cells are expanded in culture for a period of several hours (e.g., about 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 18, 21 hours) to about 14 days (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 days).
  • the cells are expanded for a period of 4 to 9 days.
  • the cells are expanded for a period of 8 days or less, e.g., 7, 6 or 5 days.
  • the cells are expanded in culture for 5 days, and the resulting cells are more potent than the same cells expanded in culture for 9 days under the same culture conditions. Potency can be defined, e.g., by various T cell functions, e.g. proliferation, target cell killing, cytokine production, activation, migration, or combinations thereof.
  • the cells e.g., a CD19 CAR cell described herein, expanded for 5 days show at least a one, two, three or four fold increase in cells doublings upon antigen stimulation as compared to the same cells expanded in culture for 9 days under the same culture conditions.
  • the cells e.g., the cells expressing a CD19 CAR described herein, are expanded in culture for 5 days, and the resulting cells exhibit higher proinflammatory cytokine production, e.g., IFN- ⁇ and/or GM-CSF levels, as compared to the same cells expanded in culture for 9 days under the same culture conditions.
  • proinflammatory cytokine production e.g., IFN- ⁇ and/or GM-CSF levels
  • the cells e.g., a CD 19 CAR cell described herein, expanded for 5 days show at least a one, two, three, four, five, ten fold or more increase in pg/ml of proinflammatory cytokine production, e.g., IFN- ⁇ and/or GM-CSF levels, as compared to the same cells expanded in culture for 9 days under the same culture conditions.
  • proinflammatory cytokine production e.g., IFN- ⁇ and/or GM-CSF levels
  • cycles of stimulation may also be desired such that culture time of T cells can be 60 days or more.
  • Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 15, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN- ⁇ , IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGFp, and TNF-a or any other additives for the growth of cells known to the skilled artisan.
  • Other additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl-cysteine and 2-mercaptoethanol.
  • Media can include RPMI 1640, AIM-V, DMEM, MEM, a-MEM, F-12, X-Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum- free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells.
  • Antibiotics e.g., penicillin and streptomycin, are included only in experimental cultures, not in cultures of cells that are to be infused into a subject.
  • the target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C) and atmosphere (e.g., air plus 5% C0 2 ).
  • the cells are expanded in an appropriate media (e.g., media described herein) that includes one or more interleukin that result in at least a 200-fold (e.g., 200-fold, 250-fold, 300-fold, 350-fold) increase in cells over a 14 day expansion period, e.g., as measured by a method described herein such as flow cytometry.
  • the cells are expanded in the presence IL-15 and/or IL-7 (e.g., IL-15 and IL-7).
  • T cells that have been exposed to varied stimulation times may exhibit different characteristics.
  • typical blood or apheresed peripheral blood mononuclear cell products have a helper T cell population (TH, CD4+) that is greater than the cytotoxic or suppressor T cell population (TC, CD8+).
  • TH, CD4+ helper T cell population
  • TC cytotoxic or suppressor T cell population
  • Ex vivo expansion of T cells by stimulating CD3 and CD28 receptors produces a population of T cells that prior to about days 8-9 consists predominately of TH cells, while after about days 8-9, the population of T cells comprises an increasingly greater population of TC cells. Accordingly, depending on the purpose of treatment, infusing a subject with a T cell population comprising predominately of TH cells may be advantageous.
  • an antigen-specific subset of TC cells may be beneficial to expand this subset to a greater degree.
  • other phenotypic markers vary significantly, but in large part, reproducibly during the course of the cell expansion process. Thus, such reproducibility enables the ability to tailor an activated T cell product for specific purposes.
  • various assays can be used to evaluate the activity of the molecule, such as but not limited to, the ability to expand T cells following antigen stimulation, sustain T cell expansion in the absence of re- stimulation, and anti-cancer activities in appropriate in vitro and animal models.
  • T cells (1: 1 mixture of CD4 + and CD8 + T cells) expressing the CARs are expanded in vitro for more than 10 days followed by lysis and SDS-PAGE under reducing conditions.
  • CARs containing the full length TCR- ⁇ cytoplasmic domain and the endogenous TCR- ⁇ chain are detected by western blotting using an antibody to the TCR- ⁇ chain.
  • the same T cell subsets are used for SDS-PAGE analysis under non-reducing conditions to permit evaluation of covalent dimer formation.
  • CAR + T cells following antigen stimulation can be measured by flow cytometry.
  • a mixture of CD4 + and CD8 + T cells are stimulated with aCD3/aCD28 aAPCs followed by transduction with lentiviral vectors expressing GFP under the control of the promoters to be analyzed.
  • promoters include the CMV IE gene, EF-la, ubiquitin C, or phosphoglycerokinase (PGK) promoters.
  • GFP fluorescence is evaluated on day 6 of culture in the CD4 + and/or CD8 + T cell subsets by flow cytometry. See, e.g., Milone et al., Molecular Therapy 17(8): 1453-1464 (2009).
  • a mixture of CD4 + and CD8 + T cells are stimulated with aCD3/aCD28 coated magnetic beads on day 0, and transduced with CAR on day 1 using a bicistronic lentiviral vector expressing CAR along with eGFP using a 2A ribosomal skipping sequence.
  • Cultures are re-stimulated with either a cancer associated antigen as described herein "1" K562 cells (K562-expressing a cancer associated antigen as described herein), wild-type K562 cells (K562 wild type) or K562 cells expressing hCD32 and 4-1BBL in the presence of antiCD3 and anti-CD28 antibody (K562-BBL-3/28) following washing.
  • Exogenous IL-2 is added to the cultures every other day at 100 IU/ml.
  • GFP + T cells are enumerated by flow cytometry using bead-based counting. See, e.g., Milone et al., Molecular Therapy 17(8): 1453-1464 (2009).
  • Sustained CAR + T cell expansion in the absence of re- stimulation can also be measured. See, e.g., Milone et ah, Molecular Therapy 17(8): 1453-1464 (2009). Briefly, mean T cell volume (fl) is measured on day 8 of culture using a Coulter Multisizer III particle counter following stimulation with aCD3/aCD28 coated magnetic beads on day 0, and transduction with the indicated CAR on day 1.
  • Animal models can also be used to measure a a CAR-expressing cell activity, e.g., as described in paragraph 698 of International Application WO2015/142675, filed March 13, 2015, which is herein incorporated by reference in its entirety.
  • Dose dependent CAR treatment response can be evaluated, e.g., as described in paragraph 699 of International Application WO2015/142675, filed March 13, 2015, which is herein incorporated by reference in its entirety.
  • Imaging technologies can be used to evaluate specific trafficking and proliferation of CARs in tumor-bearing animal models, e.g., as described in paragraph 702 of International Application WO2015/142675, filed March 13, 2015, which is herein incorporated by reference in its entirety.
  • Other assays including those described in the Example section herein as well as those that are known in the art can also be used to evaluate the CARs described herein.
  • the CAR ligand is an antibody that binds to the CAR molecule, e.g., binds to the extracellular antigen binding domain of CAR (e.g., an antibody that binds to the antigen binding domain, e.g., an anti-idiotypic antibody; or an antibody that binds to a constant region of the extracellular binding domain).
  • the CAR ligand is a CAR antigen molecule (e.g., a CAR antigen molecule as described herein).
  • a method for detecting and/or quantifying CAR-expressing cells is disclosed.
  • the CAR ligand can be used to detect and/or quantify CAR-expressing cells in vitro or in vivo (e.g., clinical monitoring of CAR-expressing cells in a patient, or dosing a patient).
  • the method includes:
  • CAR ligand (optionally, a labelled CAR ligand, e.g., a CAR ligand that includes a tag, a bead, a radioactive or fluorescent label);
  • acquiring the CAR-expressing cell e.g., acquiring a sample containing CAR-expressing cells, such as a manufacturing sample or a clinical sample
  • a method of expanding and/or activating cells e.g., immune effector cells. The method includes:

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biomedical Technology (AREA)
  • Cell Biology (AREA)
  • Wood Science & Technology (AREA)
  • Toxicology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Hematology (AREA)
  • Microbiology (AREA)
  • Oncology (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
PCT/US2016/027751 2015-04-17 2016-04-15 Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells Ceased WO2016168595A1 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
AU2016249005A AU2016249005B2 (en) 2015-04-17 2016-04-15 Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
EP16720247.2A EP3283619B1 (en) 2015-04-17 2016-04-15 Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
ES16720247T ES2948133T3 (es) 2015-04-17 2016-04-15 Métodos para mejorar la eficacia y expansión de células que expresan un receptor de antígeno quimérico
CN201680035218.8A CN108473957B (zh) 2015-04-17 2016-04-15 改善嵌合抗原受体表达细胞的功效和扩增的方法
US15/567,156 US11896614B2 (en) 2015-04-17 2016-04-15 Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
CA2982996A CA2982996A1 (en) 2015-04-17 2016-04-15 Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
JP2018505581A JP7114457B2 (ja) 2015-04-17 2016-04-15 キメラ抗原受容体発現細胞の有効性および増殖を改善するための方法
CN202410855992.XA CN118726268A (zh) 2015-04-17 2016-04-15 改善嵌合抗原受体表达细胞的功效和扩增的方法
EP23159683.4A EP4234685A3 (en) 2015-04-17 2016-04-15 Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
SG11201708516YA SG11201708516YA (en) 2015-04-17 2016-04-15 Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
AU2022231783A AU2022231783A1 (en) 2015-04-17 2022-09-16 Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
US18/390,604 US20240398913A1 (en) 2015-04-17 2023-12-20 Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
AU2025204038A AU2025204038A1 (en) 2015-04-17 2025-05-30 Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562149249P 2015-04-17 2015-04-17
US62/149,249 2015-04-17

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/567,156 A-371-Of-International US11896614B2 (en) 2015-04-17 2016-04-15 Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
US18/390,604 Division US20240398913A1 (en) 2015-04-17 2023-12-20 Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells

Publications (2)

Publication Number Publication Date
WO2016168595A1 true WO2016168595A1 (en) 2016-10-20
WO2016168595A8 WO2016168595A8 (en) 2018-02-01

Family

ID=55910367

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/027751 Ceased WO2016168595A1 (en) 2015-04-17 2016-04-15 Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells

Country Status (9)

Country Link
US (2) US11896614B2 (cg-RX-API-DMAC7.html)
EP (2) EP4234685A3 (cg-RX-API-DMAC7.html)
JP (3) JP7114457B2 (cg-RX-API-DMAC7.html)
CN (2) CN108473957B (cg-RX-API-DMAC7.html)
AU (3) AU2016249005B2 (cg-RX-API-DMAC7.html)
CA (1) CA2982996A1 (cg-RX-API-DMAC7.html)
ES (1) ES2948133T3 (cg-RX-API-DMAC7.html)
SG (1) SG11201708516YA (cg-RX-API-DMAC7.html)
WO (1) WO2016168595A1 (cg-RX-API-DMAC7.html)

Cited By (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018132695A1 (en) * 2017-01-13 2018-07-19 Celdara Medical, Llc Chimeric antigen receptors targeting tim-1
WO2019060425A1 (en) 2017-09-19 2019-03-28 Massachusetts Institute Of Technology COMPOSITIONS FOR CHIMERIC ANTIGENIC RECEPTOR T CELL THERAPY AND USES THEREOF
US10273300B2 (en) 2014-12-29 2019-04-30 The Trustees Of The University Of Pennsylvania Methods of making chimeric antigen receptor-expressing cells
CN109971718A (zh) * 2017-12-28 2019-07-05 上海细胞治疗研究院 获得高阳性率car-t细胞的方法
JP2019536786A (ja) * 2016-11-30 2019-12-19 イントレキソン コーポレーション ステロイドの投与および免疫療法
WO2019241315A1 (en) 2018-06-12 2019-12-19 Obsidian Therapeutics, Inc. Pde5 derived regulatory constructs and methods of use in immunotherapy
WO2020068261A1 (en) 2018-09-28 2020-04-02 Massachusetts Institute Of Technology Collagen-localized immunomodulatory molecules and methods thereof
WO2020047449A3 (en) * 2018-08-31 2020-04-09 Novartis Ag Methods of making chimeric antigen receptor-expressing cells
JP2020511115A (ja) * 2016-12-21 2020-04-16 オートラス リミテッド Carおよび転写因子を発現する細胞、ならびにその使用
WO2020185632A1 (en) 2019-03-08 2020-09-17 Obsidian Therapeutics, Inc. Human carbonic anhydrase 2 compositions and methods for tunable regulation
WO2020185628A1 (en) 2019-03-08 2020-09-17 Obsidian Therapeutics, Inc. Cd40l compositions and methods for tunable regulation
US10829735B2 (en) 2015-07-21 2020-11-10 The Trustees Of The University Of Pennsylvania Methods for improving the efficacy and expansion of immune cells
EP3737695A1 (en) * 2018-01-10 2020-11-18 The Board of Trustees of the Leland Stanford Junior University Compositions and methods of expansion of t cell populations
WO2020252404A1 (en) 2019-06-12 2020-12-17 Obsidian Therapeutics, Inc. Ca2 compositions and methods for tunable regulation
WO2020252405A1 (en) 2019-06-12 2020-12-17 Obsidian Therapeutics, Inc. Ca2 compositions and methods for tunable regulation
WO2020263399A1 (en) 2019-06-26 2020-12-30 Massachusetts Institute Of Technology Immunomodulatory fusion protein-metal hydroxide complexes and methods thereof
WO2021040736A1 (en) 2019-08-30 2021-03-04 Obsidian Therapeutics, Inc. Tandem cd19 car-based compositions and methods for immunotherapy
WO2021050789A1 (en) 2019-09-10 2021-03-18 Obsidian Therapeutics, Inc. Ca2-il15 fusion proteins for tunable regulation
WO2021061648A1 (en) 2019-09-23 2021-04-01 Massachusetts Institute Of Technology Methods and compositions for stimulation of endogenous t cell responses
WO2021092097A1 (en) * 2019-11-05 2021-05-14 Juno Therapeutics, Inc. Methods of determining attributes of therapeutic t cell compositions
WO2021108613A1 (en) 2019-11-26 2021-06-03 Novartis Ag Cd19 and cd22 chimeric antigen receptors and uses thereof
WO2021142376A1 (en) 2020-01-08 2021-07-15 Obsidian Therapeutics, Inc. Compositions and methods for tunable regulation of transcription
WO2021150919A1 (en) 2020-01-23 2021-07-29 The Children's Medical Center Corporation Stroma-free t cell differentiation from human pluripotent stem cells
JP2021518121A (ja) * 2018-03-21 2021-08-02 イマティクス ユーエス,アイエヌシー. 養子注入されたt細胞の持続性を増強する方法
WO2021183207A1 (en) 2020-03-10 2021-09-16 Massachusetts Institute Of Technology COMPOSITIONS AND METHODS FOR IMMUNOTHERAPY OF NPM1c-POSITIVE CANCER
WO2021183675A2 (en) 2020-03-10 2021-09-16 Massachusetts Institute Of Technology Methods for generating engineered memory-like nk cells and compositions thereof
WO2021221782A1 (en) 2020-05-01 2021-11-04 Massachusetts Institute Of Technology Chimeric antigen receptor-targeting ligands and uses thereof
WO2021221783A1 (en) 2020-05-01 2021-11-04 Massachusetts Institute Of Technology Methods for identifying chimeric antigen receptor-targeting ligands and uses thereof
EP3773918A4 (en) * 2019-03-05 2022-01-05 Nkarta, Inc. ANTI-CD19 CHEMERIC ANTIGEN RECEPTORS AND THEIR USE IN IMMUNOTHERAPY
EP3829605A4 (en) * 2018-08-01 2022-10-19 ImmunityBio, Inc. QUADRICISTRONIC SYSTEM COMPRISING A homing or CYTOKINE RECEPTOR, AND CHIMERIC ANTIGEN RECEPTOR FOR GENETIC MODIFICATION OF IMMUNOTHERAPIES
WO2022254337A1 (en) 2021-06-01 2022-12-08 Novartis Ag Cd19 and cd22 chimeric antigen receptors and uses thereof
WO2023081715A1 (en) 2021-11-03 2023-05-11 Viracta Therapeutics, Inc. Combination of car t-cell therapy with btk inhibitors and methods of use thereof
US11851659B2 (en) 2017-03-22 2023-12-26 Novartis Ag Compositions and methods for immunooncology
US11859208B2 (en) 2016-04-08 2024-01-02 Emory University Methods of treating cancer using cell based therapies
US11883432B2 (en) 2020-12-18 2024-01-30 Century Therapeutics, Inc. Chimeric antigen receptor system with adaptable receptor specificity
US11896614B2 (en) 2015-04-17 2024-02-13 Novartis Ag Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
US12037583B2 (en) 2015-12-04 2024-07-16 Novartis Ag Compositions and methods for immunooncology
US12269859B2 (en) 2016-12-02 2025-04-08 Angeles Therapeutics, Inc. Synthetic immune receptors and methods of use thereof
US12365874B2 (en) 2020-01-28 2025-07-22 Immunitybio, Inc. Chimeric antigen receptor-modified NK-92 cells targeting EGFR super-family receptors
US12444491B2 (en) 2019-08-30 2025-10-14 Juno Therapeutics, Inc. Machine learning methods for classifying cells

Families Citing this family (58)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2958942B1 (en) 2013-02-20 2020-06-03 Novartis AG Effective targeting of primary human leukemia using anti-cd123 chimeric antigen receptor engineered t cells
ES2760023T3 (es) 2013-02-20 2020-05-12 Univ Pennsylvania Tratamiento del cáncer utilizando receptor de antígeno quimérico anti-EGFRvIII humanizado
EP2970426B1 (en) 2013-03-15 2019-08-28 Michael C. Milone Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
UY35468A (es) 2013-03-16 2014-10-31 Novartis Ag Tratamiento de cáncer utilizando un receptor quimérico de antígeno anti-cd19
KR101947053B1 (ko) 2013-10-18 2019-02-12 도이체스 크렙스포르슝스첸트룸 전립선 특이적 막 항원(psma)의 표지된 억제제, 조영제로서의 이의 용도 및 전립선암 치료용 약제
RU2714902C2 (ru) 2013-12-19 2020-02-20 Новартис Аг Химерные рецепторы антигена против мезотелина человека и их применение
EP3087101B1 (en) 2013-12-20 2024-06-05 Novartis AG Regulatable chimeric antigen receptor
EP4303229A3 (en) 2014-01-21 2024-04-17 Novartis AG Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules
ES2876263T3 (es) 2014-04-07 2021-11-12 Novartis Ag Tratamiento del cáncer usando receptor de antígeno quimérico anti-cd19
SG11201700416TA (en) 2014-07-21 2017-02-27 Novartis Ag Treatment of cancer using a cd33 chimeric antigen receptor
EP3171882A1 (en) 2014-07-21 2017-05-31 Novartis AG Treatment of cancer using a cll-1 chimeric antigen receptor
US11542488B2 (en) 2014-07-21 2023-01-03 Novartis Ag Sortase synthesized chimeric antigen receptors
US10174095B2 (en) 2014-07-21 2019-01-08 Novartis Ag Nucleic acid encoding a humanized anti-BCMA chimeric antigen receptor
DK3183268T3 (da) 2014-08-19 2020-05-11 Univ Pennsylvania Behandling af cancer ved anvendelse af en cd123-kimær antigenreceptor
KR20210149228A (ko) 2014-09-17 2021-12-08 노파르티스 아게 입양 면역요법을 위한 키메라 수용체에 의한 세포독성 세포의 표적화
US10774388B2 (en) 2014-10-08 2020-09-15 Novartis Ag Biomarkers predictive of therapeutic responsiveness to chimeric antigen receptor therapy and uses thereof
US11459390B2 (en) 2015-01-16 2022-10-04 Novartis Ag Phosphoglycerate kinase 1 (PGK) promoters and methods of use for expressing chimeric antigen receptor
WO2016126608A1 (en) 2015-02-02 2016-08-11 Novartis Ag Car-expressing cells against multiple tumor antigens and uses thereof
HUE059218T2 (hu) 2015-04-08 2022-11-28 Novartis Ag CD20-terápiák, CD22-terápiák és kombinációs terápiák CD19 kiméra antigénreceptort (CAR-t) expresszáló sejttel
EP3286211A1 (en) 2015-04-23 2018-02-28 Novartis AG Treatment of cancer using chimeric antigen receptor and protein kinase a blocker
WO2017027392A1 (en) 2015-08-07 2017-02-16 Novartis Ag Treatment of cancer using chimeric cd3 receptor proteins
CN108780084B (zh) 2015-09-03 2022-07-22 诺华股份有限公司 预测细胞因子释放综合征的生物标志物
EP4643874A2 (en) 2015-12-22 2025-11-05 Novartis AG Mesothelin chimeric antigen receptor (car) and antibody against pd-l1 inhibitor for combined use in anticancer therapy
WO2017165683A1 (en) 2016-03-23 2017-09-28 Novartis Ag Cell secreted minibodies and uses thereof
CA3039646A1 (en) 2016-10-07 2018-04-12 Novartis Ag Chimeric antigen receptors for the treatment of cancer
CA3040533A1 (en) * 2016-12-02 2018-06-07 Cartesian Therapeutics, Inc. Cancer immunotherapy with highly enriched cd8+ chimeric antigen receptor t cells
EP3574005B1 (en) 2017-01-26 2021-12-15 Novartis AG Cd28 compositions and methods for chimeric antigen receptor therapy
CA3079407A1 (en) 2017-10-18 2019-04-25 Novartis Ag Compositions and methods for selective protein degradation
MY208825A (en) 2018-06-13 2025-05-30 Novartis Ag Bcma chimeric antigen receptors and uses thereof
US20210268027A1 (en) * 2018-06-22 2021-09-02 The General Hospital Corporation Chimeric antigen receptors targeting cd37 and cd19
US12331320B2 (en) 2018-10-10 2025-06-17 The Research Foundation For The State University Of New York Genome edited cancer cell vaccines
CA3116345A1 (en) * 2018-10-31 2020-05-07 Bellicum Pharmaceuticals, Inc. T cells with suicide switch
JP2022512968A (ja) 2018-11-01 2022-02-07 グレイセル・バイオテクノロジーズ(シャンハイ)カンパニー・リミテッド T細胞操作のための組成物および方法
WO2020106621A1 (en) * 2018-11-19 2020-05-28 Board Of Regents, The University Of Texas System A modular, polycistronic vector for car and tcr transduction
EP3886877A4 (en) * 2018-11-26 2022-08-24 Nkarta, Inc. Methods for the simultaneous expansion of multiple immune cell types, related compositions and uses of same in cancer immunotherapy
EP3886876A1 (en) * 2018-11-30 2021-10-06 Celularity Inc. Placenta-derived allogeneic car-t cells and uses thereof
JP7648530B2 (ja) * 2019-02-08 2025-03-18 バイオエヌテック セル アンド ジーン セラピーズ ゲーエムベーハー Car操作されたt細胞およびサイトカインを含む治療
WO2020223470A1 (en) * 2019-04-30 2020-11-05 Memorial Sloan-Kettering Cancer Center Combination therapies
US20220233593A1 (en) * 2019-06-04 2022-07-28 Nkarta, Inc. Combinations of engineered natural killer cells and engineered t cells for immunotherapy
CN110305906B (zh) * 2019-07-18 2021-11-12 山东大学第二医院 一种靶向pdl1的car嵌合受体的慢病毒载体及pdl1-car-t细胞
CN112300997A (zh) * 2019-08-01 2021-02-02 上海赛比曼生物科技有限公司 通用型car-t细胞及其制备和应用
WO2021044373A2 (en) * 2019-09-06 2021-03-11 Avectas Limited Engineering of immune cells for ex vivo cell therapy applications
CN112779223B (zh) * 2019-11-08 2024-06-11 浙江煦顼技术有限公司 偶联嵌合抗原受体细胞及其用途
US20240376428A1 (en) * 2019-11-25 2024-11-14 KSQ Therapeutics, Inc. Methods for activation and expansion of tumor infiltrating lymphocytes
PH12022551291A1 (en) 2019-11-26 2023-11-20 Novartis Ag Chimeric antigen receptors binding bcma and cd19 and uses thereof
IL293462A (en) * 2019-12-04 2022-07-01 Celularity Inc Placenta-derived allogeneic car-t cells and uses thereof
US20220169694A1 (en) * 2020-02-20 2022-06-02 Kite Pharma, Inc. Chimeric antigen receptor t cell therapy
CA3158133A1 (en) 2020-04-28 2021-11-04 Lyell Immunopharma, Inc. Methods for culturing cells
WO2022098797A1 (en) * 2020-11-04 2022-05-12 Fred Hutchinson Cancer Research Center Therapeutic targeting of mesothelin in acute myeloid leukemia with chimeric antigen receptor t cell therapy
CN117157390A (zh) * 2021-02-24 2023-12-01 杭州启函生物科技有限公司 用于增强的免疫疗法的系统和组合物及其方法
US12144827B2 (en) 2021-02-25 2024-11-19 Lyell Immunopharma, Inc. ROR1 targeting chimeric antigen receptor
CN114246986B (zh) * 2021-12-29 2022-08-23 中国人民解放军陆军军医大学 一种基于原位调控免疫反应的心血管植入物及其制备方法
WO2023150544A1 (en) * 2022-02-01 2023-08-10 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Simplified method of preparing cells for patient administration
WO2023217067A1 (zh) * 2022-05-09 2023-11-16 上海先博生物科技有限公司 工程化免疫效应细胞及其与CBL-b抑制剂联用的应用
WO2024102954A1 (en) 2022-11-10 2024-05-16 Massachusetts Institute Of Technology Activation induced clipping system (aics)
WO2025011575A1 (zh) * 2023-07-10 2025-01-16 科济生物医药(上海)有限公司 细胞免疫疗法的组合物和方法
WO2025059162A1 (en) 2023-09-11 2025-03-20 Dana-Farber Cancer Institute, Inc. Car-engager containing il-2 variants to enhance the functionality of car t cells
WO2025235801A1 (en) 2024-05-08 2025-11-13 City Of Hope Antibodies targeted to osteopontin and uses thereof for reducing resistance of solid tumors immune cell therapy

Citations (134)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3929992A (en) 1972-09-29 1975-12-30 Ayerst Mckenna & Harrison Rapamycin and process of preparation
EP0090505B1 (en) 1982-03-03 1990-08-08 Genentech, Inc. Human antithrombin iii, dna sequences therefor, expression vehicles and cloning vectors containing such sequences and cell cultures transformed thereby, a process for expressing human antithrombin iii, and pharmaceutical compositions comprising it
WO1994004678A1 (en) 1992-08-21 1994-03-03 Casterman Cecile Immunoglobulins devoid of light chains
WO1994009010A1 (en) 1992-10-09 1994-04-28 Sandoz Ltd. O-alkylated rapamycin derivatives and their use, particularly as immunosuppressants
US5350674A (en) 1992-09-04 1994-09-27 Becton, Dickinson And Company Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof
WO1995014023A1 (en) 1993-11-19 1995-05-26 Abbott Laboratories Semisynthetic analogs of rapamycin (macrolides) being immunomodulators
WO1995016691A1 (en) 1993-12-17 1995-06-22 Sandoz Ltd. Rapamycin derivatives useful as immunosuppressants
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
WO1996041807A1 (en) 1995-06-09 1996-12-27 Novartis Ag Rapamycin derivatives
WO1997031899A1 (en) 1996-02-28 1997-09-04 Ariad Gene Therapeutics, Inc. Synthetic derivatives of rapamycin as multimerising agents for chimeric proteins with immunophilin derived domains
WO1998002441A2 (en) 1996-07-12 1998-01-22 Ariad Pharmaceuticals, Inc. Non immunosuppressive antifungal rapalogs
US5786464A (en) 1994-09-19 1998-07-28 The General Hospital Corporation Overexpression of mammalian and viral proteins
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
WO1999015530A1 (en) 1997-09-26 1999-04-01 Abbott Laboratories Tetrazole-containing rapamycin analogs with shortened half-lives
WO1999020758A1 (en) 1997-10-21 1999-04-29 Human Genome Sciences, Inc. Human tumor necrosis factor receptor-like proteins tr11, tr11sv1, and tr11sv2
WO1999040196A1 (en) 1998-02-09 1999-08-12 Genentech, Inc. Novel tumor necrosis factor receptor homolog and nucleic acids encoding the same
WO1999052552A1 (en) 1998-04-15 1999-10-21 Brigham & Women's Hospital, Inc. T cell inhibitory receptor compositions and uses thereof
US6004973A (en) 1995-07-14 1999-12-21 Novartis Ag Pharmaceutical compositions comprising rafamycin coprecipitates
US6015815A (en) 1997-09-26 2000-01-18 Abbott Laboratories Tetrazole-containing rapamycin analogs with shortened half-lives
US6111090A (en) 1996-08-16 2000-08-29 Schering Corporation Mammalian cell surface antigens; related reagents
US6114148A (en) 1996-09-20 2000-09-05 The General Hospital Corporation High level expression of proteins
US6120766A (en) 1991-12-04 2000-09-19 Hale; Geoffrey CDW52-specific antibody for treatment of multiple sclerosis
WO2001003720A2 (en) 1999-07-12 2001-01-18 Genentech, Inc. Promotion or inhibition of angiogenesis and cardiovascularization by tumor necrosis factor ligand/receptor homologs
WO2001014387A1 (en) 1999-08-24 2001-03-01 Ariad Gene Therapeutics, Inc. 28-epirapalogs
WO2001029058A1 (en) 1999-10-15 2001-04-26 University Of Massachusetts Rna interference pathway genes as tools for targeted genetic interference
US6326193B1 (en) 1999-11-05 2001-12-04 Cambria Biosciences, Llc Insect control agent
WO2001096584A2 (en) 2000-06-12 2001-12-20 Akkadix Corporation Materials and methods for the control of nematodes
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
WO2003014161A2 (en) 2001-08-10 2003-02-20 Aberdeen University Antigen binding domains from fish
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
WO2003064383A2 (en) 2002-02-01 2003-08-07 Ariad Gene Therapeutics, Inc. Phosphorus-containing compounds & uses thereof
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US20040040047A1 (en) 1998-03-30 2004-02-26 Spencer David M. Regulated apoptosis using chemically induced dimerization of apoptosis factors
US6703199B1 (en) 1997-06-12 2004-03-09 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US20040047858A1 (en) 2002-09-11 2004-03-11 Blumberg Richard S. Therapeutic anti-BGP(C-CAM1) antibodies and uses thereof
US20040101519A1 (en) 2002-01-03 2004-05-27 The Trustees Of The University Of Pennsylvania Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool
US6780996B2 (en) 2002-04-30 2004-08-24 Wyeth Holdings Corporation Process for the preparation of 7-substituted-3 quinolinecarbonitriles
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
WO2005007190A1 (en) 2003-07-11 2005-01-27 Schering Corporation Agonists or antagonists of the clucocorticoid-induced tumour necrosis factor receptor (gitr) or its ligand for the treatment of immune disorders, infections and cancer
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20050101624A1 (en) 2003-11-12 2005-05-12 Betts Ronald E. 42-O-alkoxyalkyl rapamycin derivatives and compositions comprising same
US20050100543A1 (en) 2003-07-01 2005-05-12 Immunomedics, Inc. Multivalent carriers of bi-specific antibodies
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
WO2005055808A2 (en) 2003-12-02 2005-06-23 Genzyme Corporation Compositions and methods to diagnose and treat lung cancer
US20050175606A1 (en) 2001-04-11 2005-08-11 Hua-Liang Huang Cyclic single-chain trispecific antibody
WO2005115451A2 (en) 2004-04-30 2005-12-08 Isis Innovation Limited Methods for generating improved immune response
US20060034810A1 (en) 2004-05-27 2006-02-16 The Trustees Of The University Of Pennsylvania Novel artificial antigen presenting cells and uses therefor
WO2006020258A2 (en) 2004-07-17 2006-02-23 Imclone Systems Incorporated Novel tetravalent bispecific antibody
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
WO2006083289A2 (en) 2004-06-04 2006-08-10 Duke University Methods and compositions for enhancement of immunity by in vivo depletion of immunosuppressive cell activity
WO2006121168A1 (en) 2005-05-09 2006-11-16 Ono Pharmaceutical Co., Ltd. Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics
WO2006122806A2 (en) 2005-05-20 2006-11-23 Novartis Ag 1,3-dihydro-imidazo [4,5-c] quinolin-2-ones as lipid kinase inhibitors
WO2007005874A2 (en) 2005-07-01 2007-01-11 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (pd-l1)
US20070014794A1 (en) 1995-03-01 2007-01-18 Genentech, Inc. Method for making heteromultimeric polypeptides
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
WO2007024715A2 (en) 2005-08-19 2007-03-01 Abbott Laboratories Dual variable domain immunoglobin and uses thereof
WO2007044729A2 (en) 2005-10-07 2007-04-19 Exelixis, Inc. N- (3-amino-quinoxalin-2-yl) -sulfonamide derivatives and their use as phosphatidylinositol 3-kinase inhibitors
WO2007133822A1 (en) 2006-01-19 2007-11-22 Genzyme Corporation Gitr antibodies for the treatment of cancer
EP1866339A2 (en) 2005-03-25 2007-12-19 TolerRx, Inc Gitr binding molecules and uses therefor
US7446190B2 (en) 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
WO2009101611A1 (en) 2008-02-11 2009-08-20 Curetech Ltd. Monoclonal antibodies for tumor treatment
WO2009104019A1 (en) 2008-02-21 2009-08-27 Astrazeneca Ab Combination therapy 238
WO2009114335A2 (en) 2008-03-12 2009-09-17 Merck & Co., Inc. Pd-1 binding proteins
US7618632B2 (en) 2003-05-23 2009-11-17 Wyeth Method of treating or ameliorating an immune cell associated pathology using GITR ligand antibodies
WO2010003118A1 (en) 2008-07-02 2010-01-07 Trubion Pharmaceuticals, Inc. Tgf-b antagonist multi-target binding proteins
US20100028330A1 (en) 2002-12-23 2010-02-04 Medimmune Limited Methods of upmodulating adaptive immune response using anti-pd1 antibodies
WO2010019570A2 (en) 2008-08-11 2010-02-18 Medarex, Inc. Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof
WO2010027827A2 (en) 2008-08-25 2010-03-11 Amplimmune, Inc. Targeted costimulatory polypeptides and methods of use to treat cancer
WO2010051043A1 (en) 2008-11-03 2010-05-06 Intellikine, Inc. Benzoxazole kinase inhibitors and methods of use
US7727950B2 (en) 2002-04-09 2010-06-01 The University Of Dundee Methods and reagents for assaying protein kinase activity
WO2010077634A1 (en) 2008-12-09 2010-07-08 Genentech, Inc. Anti-pd-l1 antibodies and their use to enhance t-cell function
US20100247521A1 (en) 2007-10-26 2010-09-30 Jones Richard B Therapeutic and Diagnostic Methods Using TIM-3
WO2010114484A1 (en) 2009-04-03 2010-10-07 S*Bio Pte Ltd Pyrimidine substituted purine compounds as kinase (s) inhibitors
WO2010125571A1 (en) 2009-04-30 2010-11-04 Tel Hashomer Medical Research Infrastructure And Services Ltd. Anti ceacam1 antibodies and methods of using same
WO2011028683A1 (en) 2009-09-03 2011-03-10 Schering Corporation Anti-gitr antibodies
WO2011051726A2 (en) 2009-10-30 2011-05-05 Isis Innovation Ltd Treatment of obesity
WO2011056894A2 (en) 2009-11-03 2011-05-12 Jensen Michael C TRUNCATED EPIDERIMAL GROWTH FACTOR RECEPTOR (EGFRt) FOR TRANSDUCED T CELL SELECTION
WO2011066342A2 (en) 2009-11-24 2011-06-03 Amplimmune, Inc. Simultaneous inhibition of pd-l1/pd-l2
WO2011090754A1 (en) 2009-12-29 2011-07-28 Emergent Product Development Seattle, Llc Polypeptide heterodimers and uses thereof
US20110286980A1 (en) 2010-05-21 2011-11-24 Brenner Malcolm K Methods for inducing selective apoptosis
WO2012006552A1 (en) 2010-07-09 2012-01-12 Exelixis, Inc. Combinations of kinase inhibitors for the treatment of cancer
WO2012007926A1 (en) 2010-07-16 2012-01-19 Piramal Life Sciences Limited Substituted imidazoquinoline derivatives as kinase inhibitors
US20120039906A1 (en) 2009-02-09 2012-02-16 INSER (Institut National de la Recherche Medicale) PD-1 Antibodies and PD-L1 Antibodies and Uses Thereof
US20120114649A1 (en) 2008-08-25 2012-05-10 Amplimmune, Inc. Delaware Compositions of pd-1 antagonists and methods of use
WO2012138475A1 (en) 2011-04-08 2012-10-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer
WO2013006490A2 (en) 2011-07-01 2013-01-10 Cellerant Therapeutics, Inc. Antibodies that specifically bind to tim3
US8354509B2 (en) 2007-06-18 2013-01-15 Msd Oss B.V. Antibodies to human programmed death receptor PD-1
WO2013023184A1 (en) 2011-08-11 2013-02-14 Intellikine, Llc Kinase inhibitor polymorphs
US8399645B2 (en) 2003-11-05 2013-03-19 St. Jude Children's Research Hospital, Inc. Chimeric receptors with 4-1BB stimulatory signaling domain
WO2013039954A1 (en) 2011-09-14 2013-03-21 Sanofi Anti-gitr antibodies
WO2013054331A1 (en) 2011-10-11 2013-04-18 Tel Hashomer Medical Research Infrastructure And Services Ltd. Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
WO2013082366A1 (en) 2011-12-01 2013-06-06 The Brigham And Women's Hospital, Inc. Anti-ceacam1 recombinant antibodies for cancer therapy
US20130156774A1 (en) 2010-06-18 2013-06-20 The Brigham And Women's Hospital, Inc. Bi-specific antibodies against tim-3 and pd-1 for immunotherapy in chronic immune conditions
EP1947183B1 (en) 1996-08-16 2013-07-17 Merck Sharp & Dohme Corp. Mammalian cell surface antigens; related reagents
WO2013126712A1 (en) 2012-02-22 2013-08-29 The Trustees Of The University Of Pennsylvania Compositions and methods for generating a persisting population of t cells useful for the treatment of cancer
US8586023B2 (en) 2008-09-12 2013-11-19 Mie University Cell capable of expressing exogenous GITR ligand
US8591886B2 (en) 2007-07-12 2013-11-26 Gitr, Inc. Combination therapies employing GITR binding molecules
WO2014022332A1 (en) 2012-07-31 2014-02-06 The Brigham And Women's Hospital, Inc. Modulation of the immune response
USRE44768E1 (en) 1994-04-18 2014-02-18 Wyeth Llc Rapamycin hydroxyesters
US8664194B2 (en) 2011-12-16 2014-03-04 Moderna Therapeutics, Inc. Method for producing a protein of interest in a primate
WO2014055771A1 (en) * 2012-10-05 2014-04-10 The Trustees Of The University Of Pennsylvania Human alpha-folate receptor chimeric antigen receptor
WO2014055442A2 (en) 2012-10-01 2014-04-10 The Trustees Of The University Of Pennsylvania Compositions and methods for targeting stromal cells for the treatment of cancer
WO2014055657A1 (en) 2012-10-05 2014-04-10 The Trustees Of The University Of Pennsylvania Use of a trans-signaling approach in chimeric antigen receptors
WO2014059251A1 (en) 2012-10-12 2014-04-17 The Brigham And Women's Hospital, Inc. Enhancement of the immune response
US8710200B2 (en) 2011-03-31 2014-04-29 Moderna Therapeutics, Inc. Engineered nucleic acids encoding a modified erythropoietin and their expression
WO2014110591A1 (en) 2013-01-14 2014-07-17 Fred Hutchinson Cancer Research Center Compositions and methods for delivery of immune cells to treat un-resectable or non-resected tumor cells and tumor relapse
WO2014127261A1 (en) 2013-02-15 2014-08-21 The Regents Of The University Of California Chimeric antigen receptor and methods of use thereof
WO2014130909A1 (en) 2013-02-22 2014-08-28 The Board Of Trustees Of The Leland Stanford Junior University Compounds, compositions, methods, and kits relating to telomere extension
US8822663B2 (en) 2010-08-06 2014-09-02 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
US20140255360A1 (en) 2013-03-10 2014-09-11 Bellicum Pharmaceuticals, Inc. Modified caspase polypeptides and uses thereof
WO2014145252A2 (en) 2013-03-15 2014-09-18 Milone Michael C Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
WO2014151960A2 (en) 2013-03-14 2014-09-25 Bellicum Pharmaceuticals, Inc. Methods for controlling t cell proliferation
WO2014153270A1 (en) 2013-03-16 2014-09-25 Novartis Ag Treatment of cancer using humanized anti-cd19 chimeric antigen receptor
US20140322212A1 (en) 2013-02-20 2014-10-30 Jennifer Brogdon Effective targeting of primary human leukemia using anti-cd123 chimeric antigen receptor engineered t cells
US20140322275A1 (en) 2013-02-20 2014-10-30 Jennifer Brogdon TREATMENT OF CANCER USING HUMANIZED ANTI-EGFRvIII CHIMERIC ANTIGEN RECEPTOR
WO2014190273A1 (en) 2013-05-24 2014-11-27 Board Of Regents, The University Of Texas System Chimeric antigen receptor-targeting monoclonal antibodies
WO2014197638A2 (en) 2013-06-05 2014-12-11 Bellicum Pharmaceuticals, Inc. Methods for inducing partial apoptosis using caspase polypeptides
US20150124036A1 (en) 2011-11-28 2015-05-07 Brother Kogyo Kabushiki Kaisha Ink-Jet Recording Apparatus
US20150140036A1 (en) 2013-11-13 2015-05-21 Novartis Institutes For Biomedical Research, Inc. Low, immune enhancing, dose mtor inhibitors and uses thereof
WO2015090230A1 (en) 2013-12-19 2015-06-25 Novartis Ag Human mesothelin chimeric antigen receptors and uses thereof
WO2015090229A1 (en) 2013-12-20 2015-06-25 Novartis Ag Regulatable chimeric antigen receptor
US20150210769A1 (en) 2014-01-24 2015-07-30 Novartis Ag Antibody molecules to pd-1 and uses thereof
US20150218274A1 (en) 2014-01-31 2015-08-06 Novartis Ag Antibody molecules to tim-3 and uses thereof
US20150259420A1 (en) 2014-03-14 2015-09-17 Novartis Ag Antibody molecules to lag-3 and uses thereof
WO2015142675A2 (en) 2014-03-15 2015-09-24 Novartis Ag Treatment of cancer using chimeric antigen receptor
WO2015157252A1 (en) * 2014-04-07 2015-10-15 BROGDON, Jennifer Treatment of cancer using anti-cd19 chimeric antigen receptor
WO2016019300A1 (en) 2014-07-31 2016-02-04 Novartis Ag Subset-optimized chimeric antigen receptor-containing t-cells
US20160046724A1 (en) 2014-07-21 2016-02-18 The Trustees Of The University Of Pennsylvania Treatment of cancer using humanized anti-bcma chimeric antigen receptor
WO2016028896A1 (en) * 2014-08-19 2016-02-25 Novartis Ag Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment
US20160051651A1 (en) 2014-07-21 2016-02-25 The Trustees Of The University Of Pennsylvania Treatment of cancer using a cll-1 chimeric antigen receptor
US20160096892A1 (en) 2014-07-21 2016-04-07 The Trustees Of The University Of Pennsylvania Treatment of cancer using a cd33 chimeric antigen receptor
WO2016057705A1 (en) * 2014-10-08 2016-04-14 Novartis Ag Biomarkers predictive of therapeutic responsiveness to chimeric antigen receptor therapy and uses thereof

Family Cites Families (165)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US1863276A (en) 1931-02-18 1932-06-14 John A Mcgrew Rail joint
FR901228A (fr) 1943-01-16 1945-07-20 Deutsche Edelstahlwerke Ag Système d'aimant à entrefer annulaire
US5906936A (en) 1988-05-04 1999-05-25 Yeda Research And Development Co. Ltd. Endowing lymphocytes with antibody specificity
US6303121B1 (en) 1992-07-30 2001-10-16 Advanced Research And Technology Method of using human receptor protein 4-1BB
US6319494B1 (en) 1990-12-14 2001-11-20 Cell Genesys, Inc. Chimeric chains for receptor-associated signal transduction pathways
AU643109B2 (en) 1990-12-14 1993-11-04 Cell Genesys, Inc. Chimeric chains for receptor-associated signal transduction pathways
US6004811A (en) 1991-03-07 1999-12-21 The Massachussetts General Hospital Redirection of cellular immunity by protein tyrosine kinase chimeras
IL101147A (en) 1991-03-07 2004-06-20 Gen Hospital Corp Redirection of cellular immunity by receptor chimeras
US7049136B2 (en) 1991-03-07 2006-05-23 The General Hospital Corporation Redirection of cellular immunity by receptor chimeras
IL104570A0 (en) 1992-03-18 1993-05-13 Yeda Res & Dev Chimeric genes and cells transformed therewith
US8211422B2 (en) 1992-03-18 2012-07-03 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Chimeric receptor genes and cells transformed therewith
US7211259B1 (en) 1993-05-07 2007-05-01 Immunex Corporation 4-1BB polypeptides and DNA encoding 4-1BB polypeptides
NZ285395A (en) 1994-05-02 1998-10-28 Novartis Ag Chimeric antibody, cancer treatment
US5712149A (en) 1995-02-03 1998-01-27 Cell Genesys, Inc. Chimeric receptor molecules for delivery of co-stimulatory signals
US6103521A (en) 1995-02-06 2000-08-15 Cell Genesys, Inc. Multispecific chimeric receptors
KR100490099B1 (ko) 1995-02-24 2005-11-28 더 제너럴 하스피털 코포레이션 수용체키메라에의한세포면역성의방향전환
GB9526131D0 (en) 1995-12-21 1996-02-21 Celltech Therapeutics Ltd Recombinant chimeric receptors
US5874240A (en) 1996-03-15 1999-02-23 Human Genome Sciences, Inc. Human 4-1BB receptor splicing variant
EP0937095A4 (en) 1996-10-25 1999-12-22 Cell Genesys Inc TARGETED CYTOLYSIS OF CANCER CELLS
AU7499498A (en) 1997-05-21 1998-12-11 Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services, The Methods and compositions for making dendritic cells from expanded populations ofmonocytes and for activating t cells
GB9713473D0 (en) 1997-06-25 1997-09-03 Celltech Therapeutics Ltd Biological products
US20030060444A1 (en) 1997-06-25 2003-03-27 Celltech Therapeutics, Ltd. Cell activation process and reagents therefor
US6475481B2 (en) 1997-11-18 2002-11-05 Canji Inc Purging of stem cell products
GB9809658D0 (en) 1998-05-06 1998-07-01 Celltech Therapeutics Ltd Biological products
JP2002524081A (ja) 1998-09-04 2002-08-06 スローン − ケッタリング インスティチュート フォー キャンサー リサーチ 前立腺−特異的膜抗原に特異的な融合受容体およびその使用
US6410319B1 (en) 1998-10-20 2002-06-25 City Of Hope CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies
EP1171596A1 (en) 1999-04-16 2002-01-16 Celltech Therapeutics Limited Synthetic transmembrane components
DE19930335A1 (de) 1999-07-02 2001-01-18 Henkel Kgaa Kompositmaterialien aus Calciumverbindungen und Proteinkomponenten
GB9925848D0 (en) 1999-11-01 1999-12-29 Celltech Therapeutics Ltd Biological products
IL136511A0 (en) 2000-06-01 2001-06-14 Gavish Galilee Bio Appl Ltd Genetically engineered mhc molecules
GB0025307D0 (en) 2000-10-16 2000-11-29 Celltech Chiroscience Ltd Biological products
CA2427858A1 (en) 2000-11-03 2002-05-10 University Of Vermont And State Agricultural College Compositions for inhibiting grb7
JP5312721B2 (ja) 2000-11-07 2013-10-09 シティ・オブ・ホープ Cd19特異的再指向免疫細胞
US7070995B2 (en) 2001-04-11 2006-07-04 City Of Hope CE7-specific redirected immune cells
US20090257994A1 (en) 2001-04-30 2009-10-15 City Of Hope Chimeric immunoreceptor useful in treating human cancers
US7514537B2 (en) 2001-04-30 2009-04-07 City Of Hope Chimeric immunoreceptor useful in treating human gliomas
EP1392818A4 (en) 2001-04-30 2005-01-05 Hope City FOR THE TREATMENT OF CANCER DISEASES IN HUMAN CERTAIN IMMUNE RECEPTOR
US20030148982A1 (en) 2001-11-13 2003-08-07 Brenner Malcolm K. Bi-spcific chimeric T cells
US7638326B2 (en) 2002-01-03 2009-12-29 The Trustees Of The University Of Pennsylvania Activation and expansion of T-cells using an engineered multivalent signaling platform
AU2003202908A1 (en) 2002-01-03 2003-07-24 The Trustees Of The University Of Pennsylvania Activation and expansion of t-cells using an engineered multivalent signaling platform
US20050129671A1 (en) 2003-03-11 2005-06-16 City Of Hope Mammalian antigen-presenting T cells and bi-specific T cells
WO2005019429A2 (en) 2003-08-22 2005-03-03 Potentia Pharmaceuticals, Inc. Compositions and methods for enhancing phagocytosis or phagocyte activity
US20050113564A1 (en) 2003-11-05 2005-05-26 St. Jude Children's Research Hospital Chimeric receptors with 4-1BB stimulatory signaling domain
US7994298B2 (en) 2004-09-24 2011-08-09 Trustees Of Dartmouth College Chimeric NK receptor and methods for treating cancer
EP1827604B1 (en) 2004-12-10 2019-11-20 Peter MacCallum Cancer Institute Methods and compositions for adoptive immunotherapy
ES2374504T3 (es) 2005-08-08 2012-02-17 Fondazione Centro San Raffaele Del Monte Tabor Uso de il-7 e il-15 para la modificación de los linfocitos t de memoria.
US20070036773A1 (en) 2005-08-09 2007-02-15 City Of Hope Generation and application of universal T cells for B-ALL
WO2007060918A1 (ja) 2005-11-24 2007-05-31 Dainippon Sumitomo Pharma Co., Ltd. 新規なメモリーctl誘導増強剤
US20100105136A1 (en) 2006-10-09 2010-04-29 The General Hospital Corporation Chimeric t-cell receptors and t-cells targeting egfrviii on tumors
US20080131415A1 (en) 2006-11-30 2008-06-05 Riddell Stanley R Adoptive transfer of cd8 + t cell clones derived from central memory cells
PT2856876T (pt) 2007-03-30 2018-03-28 Memorial Sloan Kettering Cancer Center Expressão constitutiva de ligantes co-estimulatórios em linfócitos t adotivamente transferidos
WO2009097140A1 (en) 2008-01-30 2009-08-06 Memorial Sloan-Kettering Cancer Center Methods for off -the -shelf tumor immunotherapy using allogeneic t-cell precursors
US8379824B2 (en) 2008-03-06 2013-02-19 At&T Intellectual Property I, Lp Methods and apparatus to provide a network-based caller identification service in a voice over internet protocol network
JP2012501180A (ja) 2008-08-26 2012-01-19 シティ・オブ・ホープ T細胞の抗腫瘍エフェクター機能増進のための方法および組成物
EP2389443B1 (en) 2009-01-23 2018-11-14 Roger Williams Hospital Retroviral vectors encoding multiple highly homologous non-viral polypeptides and the use of same
US8465743B2 (en) 2009-10-01 2013-06-18 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-vascular endothelial growth factor receptor-2 chimeric antigen receptors and use of same for the treatment of cancer
US9273283B2 (en) 2009-10-29 2016-03-01 The Trustees Of Dartmouth College Method of producing T cell receptor-deficient T cells expressing a chimeric receptor
US9181527B2 (en) 2009-10-29 2015-11-10 The Trustees Of Dartmouth College T cell receptor-deficient T cell compositions
EP2531216B1 (en) 2010-02-04 2019-03-27 The Trustees Of The University Of Pennsylvania Icos critically regulates the expansion and function of inflammatory human th17 cells
AU2011319727B2 (en) 2010-10-27 2016-06-30 Baylor College Of Medicine Chimeric CD27 receptors for redirecting T cells to CD70-positive malignancies
PH12013501201A1 (en) 2010-12-09 2013-07-29 Univ Pennsylvania Use of chimeric antigen receptor-modified t cells to treat cancer
EP2651442B1 (en) 2010-12-14 2020-04-22 University of Maryland, Baltimore Universal anti-tag chimeric antigen receptor-expressing t cells and methods of treating cancer
US9402865B2 (en) 2011-01-18 2016-08-02 The Trustees Of The University Of Pennsylvania Compositions and methods for treating cancer
WO2012127464A2 (en) 2011-03-23 2012-09-27 Gavish-Galilee Bio Applications Ltd Constitutively activated t cells for use in adoptive cell therapy
BR112013024395B1 (pt) 2011-03-23 2021-10-26 Fred Hutchinson Cancer Research Center Composições adotivas de imunoterapia celular e método para fabricação da dita composição
EP3323833B1 (en) 2011-04-01 2019-12-04 Memorial Sloan-Kettering Cancer Center T cell receptor-like bispecific antibodies specific for a wt1 peptide presented by hla-a2
ES2649967T3 (es) 2011-04-08 2018-01-16 Baylor College Of Medicine Inversión de los efectos del microentorno tumoral utilizando receptores quiméricos de citocinas
US20130071414A1 (en) 2011-04-27 2013-03-21 Gianpietro Dotti Engineered cd19-specific t lymphocytes that coexpress il-15 and an inducible caspase-9 based suicide gene for the treatment of b-cell malignancies
EP2736539B1 (en) 2011-07-25 2017-08-23 Nationwide Children's Hospital, Inc. Recombinant virus products and methods for inhibition of expression of dux4
EA201490364A1 (ru) 2011-07-29 2014-08-29 Дзе Трастиз Оф Дзе Юниверсити Оф Пенсильвания Костимулирующие рецепторы-переключатели
US9833476B2 (en) 2011-08-31 2017-12-05 The Trustees Of Dartmouth College NKP30 receptor targeted therapeutics
MX351226B (es) * 2011-09-08 2017-10-05 Yeda Res & Dev Celulas t con memoria central anti tercera parte, metodos para producirlas y uso de las mismas en transplante y tratamiento de enfermedades.
AU2012308205A1 (en) 2011-09-16 2014-03-13 The Trustees Of The University Of Pennsylvania RNA engineered T cells for the treatment of cancer
WO2013040371A2 (en) 2011-09-16 2013-03-21 Baylor College Of Medicine Targeting the tumor microenvironment using manipulated nkt cells
US9708384B2 (en) 2011-09-22 2017-07-18 The Trustees Of The University Of Pennsylvania Universal immune receptor expressed by T cells for the targeting of diverse and multiple antigens
RU2644243C2 (ru) 2011-10-20 2018-02-08 Дзе Юнайтед Стейтс Оф Америка, Эз Репрезентед Бай Дзе Секретари, Департмент Оф Хелс Энд Хьюман Сёрвисез Химерные антигенные рецепторы к cd22
US9272002B2 (en) 2011-10-28 2016-03-01 The Trustees Of The University Of Pennsylvania Fully human, anti-mesothelin specific chimeric immune receptor for redirected mesothelin-expressing cell targeting
WO2013067492A1 (en) 2011-11-03 2013-05-10 The Trustees Of The University Of Pennsylvania Isolated b7-h4 specific compositions and methods of use thereof
WO2013074916A1 (en) 2011-11-18 2013-05-23 Board Of Regents, The University Of Texas System Car+ t cells genetically modified to eliminate expression of t- cell receptor and/or hla
EP2817331B1 (en) 2012-02-22 2023-08-30 The Trustees of the University of Pennsylvania Use of the cd2 signaling domain in second-generation chimeric antigen receptors
SG11201404769UA (en) 2012-02-22 2014-11-27 Univ Pennsylvania Use of icos-based cars to enhance antitumor activity and car persistence
CA2868121C (en) 2012-03-23 2021-06-01 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-mesothelin chimeric antigen receptors
AU2013289979A1 (en) 2012-07-13 2015-01-22 The Trustees Of The University Of Pennsylvania Methods of assessing the suitability of transduced T cells for administration
EP2872617A4 (en) 2012-07-13 2015-12-09 Univ Pennsylvania EPITOP SPREADING IN CONNECTION WITH CAR T CELLS
CN104884095A (zh) 2012-07-13 2015-09-02 宾夕法尼亚大学董事会 Cart19用于耗减正常b细胞以诱导耐受的用途
KR20150029714A (ko) 2012-07-13 2015-03-18 더 트러스티스 오브 더 유니버시티 오브 펜실바니아 이중특이적 항체의 공-도입에 의한 car 세포의 활성 증강
MX2015000438A (es) 2012-07-13 2016-04-25 Univ Pennsylvania Manejo de toxicidad para actividad antitumoral de cars.
EP2872218A4 (en) 2012-07-13 2016-07-06 Univ Pennsylvania COMPOSITIONS AND METHOD FOR REGULATING HAIR GROWTH
SMT202100005T1 (it) 2012-08-20 2021-05-07 Hutchinson Fred Cancer Res Metodo e composizioni per immunoterapia cellulare
US9937205B2 (en) 2012-09-04 2018-04-10 The Trustees Of The University Of Pennsylvania Inhibition of diacylglycerol kinase to augment adoptive T cell transfer
WO2014039044A1 (en) * 2012-09-06 2014-03-13 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Methods of producing t memory stem cell populations
EP2899221B1 (en) 2012-09-19 2017-08-16 Sumitomo Seika Chemicals CO. LTD. Method for manufacturing polyrotaxane
EP2903637B1 (en) 2012-10-02 2019-06-12 Memorial Sloan-Kettering Cancer Center Compositions and methods for immunotherapy
EP2953634B1 (en) 2013-02-07 2021-05-26 The General Hospital Corporation Methods for expansion or depletion of t-regulatory cells
CN105339498A (zh) 2013-03-07 2016-02-17 贝勒医学院 癌症中靶向cd138
US9446105B2 (en) 2013-03-15 2016-09-20 The Trustees Of The University Of Pennsylvania Chimeric antigen receptor specific for folate receptor β
US9629877B2 (en) 2013-05-14 2017-04-25 Board Of Regents, The University Of Texas System Human application of engineered chimeric antigen receptor (CAR) T-cells
EP4303229A3 (en) 2014-01-21 2024-04-17 Novartis AG Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules
WO2015142661A1 (en) 2014-03-15 2015-09-24 Novartis Ag Regulatable chimeric antigen receptor
RU2763795C2 (ru) * 2014-04-23 2022-01-11 Джуно Терапьютикс, Инк. Способы выделения, культивирования и генетической инженерии популяций клеток иммунной системы для адоптивной терапии
ES2708584T3 (es) 2014-04-24 2019-04-10 Miltenyi Biotec Gmbh Método para la generación automatizada de células T modificadas genéticamente
AU2015249376C1 (en) 2014-04-25 2019-10-31 2Seventy Bio, Inc. Improved methods for manufacturing adoptive cell therapies
EP3194585A1 (en) 2014-07-21 2017-07-26 Novartis AG Sortase molecules and uses thereof
US20170274014A1 (en) 2014-07-21 2017-09-28 Jennifer Brogdon Combinations of low, immune enhancing, doses of mtor inhibitors and cars
US11542488B2 (en) 2014-07-21 2023-01-03 Novartis Ag Sortase synthesized chimeric antigen receptors
EP3193915A1 (en) 2014-07-21 2017-07-26 Novartis AG Combinations of low, immune enhancing. doses of mtor inhibitors and cars
AU2015301460B2 (en) 2014-08-14 2021-04-08 Novartis Ag Treatment of cancer using GFR alpha-4 chimeric antigen receptor
KR20210149228A (ko) 2014-09-17 2021-12-08 노파르티스 아게 입양 면역요법을 위한 키메라 수용체에 의한 세포독성 세포의 표적화
WO2016061368A1 (en) 2014-10-15 2016-04-21 The Children's Hospital Of Philadelphia Compositions and methods for treating b-lymphoid malignancies
RU2751362C2 (ru) 2014-12-29 2021-07-13 Новартис Аг Способы получения экспрессирующих химерный антигенный рецептор клеток
US11459390B2 (en) 2015-01-16 2022-10-04 Novartis Ag Phosphoglycerate kinase 1 (PGK) promoters and methods of use for expressing chimeric antigen receptor
WO2016126608A1 (en) 2015-02-02 2016-08-11 Novartis Ag Car-expressing cells against multiple tumor antigens and uses thereof
US20180140602A1 (en) 2015-04-07 2018-05-24 Novartis Ag Combination of chimeric antigen receptor therapy and amino pyrimidine derivatives
HUE059218T2 (hu) 2015-04-08 2022-11-28 Novartis Ag CD20-terápiák, CD22-terápiák és kombinációs terápiák CD19 kiméra antigénreceptort (CAR-t) expresszáló sejttel
US11896614B2 (en) 2015-04-17 2024-02-13 Novartis Ag Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
EP3286211A1 (en) 2015-04-23 2018-02-28 Novartis AG Treatment of cancer using chimeric antigen receptor and protein kinase a blocker
CN105158466B (zh) 2015-05-05 2017-12-22 中国科学院广州生物医药与健康研究院 一种检测抗cd19的嵌合抗原受体t细胞对白血病细胞抑制作用的方法
SG10201912978PA (en) 2015-07-21 2020-02-27 Novartis Ag Methods for improving the efficacy and expansion of immune cells
WO2017027392A1 (en) 2015-08-07 2017-02-16 Novartis Ag Treatment of cancer using chimeric cd3 receptor proteins
CN108780084B (zh) 2015-09-03 2022-07-22 诺华股份有限公司 预测细胞因子释放综合征的生物标志物
EP3350320A1 (en) 2015-09-17 2018-07-25 Novartis AG Car t cell therapies with enhanced efficacy
AU2016341966A1 (en) 2015-10-20 2018-05-10 Kite Pharma, Inc. Methods of preparing T cells for T cell therapy
EP4643874A2 (en) 2015-12-22 2025-11-05 Novartis AG Mesothelin chimeric antigen receptor (car) and antibody against pd-l1 inhibitor for combined use in anticancer therapy
US20190269727A1 (en) 2015-12-28 2019-09-05 Novartis Ag Methods of making chimeric antigen receptor-expressing cells
EP4219689A3 (en) 2015-12-30 2023-12-20 Novartis AG Immune effector cell therapies with enhanced efficacy
US20200281973A1 (en) 2016-03-04 2020-09-10 Novartis Ag Cells expressing multiple chimeric antigen receptor (car) molecules and uses therefore
WO2017165683A1 (en) 2016-03-23 2017-09-28 Novartis Ag Cell secreted minibodies and uses thereof
SI3443096T1 (sl) 2016-04-15 2023-07-31 Novartis Ag Sestavki in postopki za selektivno izražanje himerni antigenskih receptorjev
WO2017210617A2 (en) 2016-06-02 2017-12-07 Porter, David, L. Therapeutic regimens for chimeric antigen receptor (car)- expressing cells
US20190336504A1 (en) 2016-07-15 2019-11-07 Novartis Ag Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor
CN110214150A (zh) 2016-07-28 2019-09-06 诺华股份有限公司 嵌合抗原受体和pd-1抑制剂的组合疗法
JP2019527696A (ja) 2016-08-01 2019-10-03 ノバルティス アーゲー プロm2マクロファージ分子の阻害剤と組み合わせてキメラ抗原受容体を用いる癌の処置
EP3523290A4 (en) 2016-09-30 2020-07-29 Novartis AG IMPROVED EFFICIENCY IMMUNE EFFICIENT CELL THERAPIES
CA3039646A1 (en) 2016-10-07 2018-04-12 Novartis Ag Chimeric antigen receptors for the treatment of cancer
EP3574005B1 (en) 2017-01-26 2021-12-15 Novartis AG Cd28 compositions and methods for chimeric antigen receptor therapy
CN110582509A (zh) 2017-01-31 2019-12-17 诺华股份有限公司 使用具有多特异性的嵌合t细胞受体蛋白治疗癌症
EP3589647A1 (en) 2017-02-28 2020-01-08 Novartis AG Shp inhibitor compositions and uses for chimeric antigen receptor therapy
KR20190127892A (ko) 2017-03-22 2019-11-13 노파르티스 아게 바이오마커 및 효능이 증진된 car t 세포 요법
US20200179511A1 (en) 2017-04-28 2020-06-11 Novartis Ag Bcma-targeting agent, and combination therapy with a gamma secretase inhibitor
EP3615055A1 (en) 2017-04-28 2020-03-04 Novartis AG Cells expressing a bcma-targeting chimeric antigen receptor, and combination therapy with a gamma secretase inhibitor
CA3079407A1 (en) 2017-10-18 2019-04-25 Novartis Ag Compositions and methods for selective protein degradation
KR20200069358A (ko) 2017-10-25 2020-06-16 노파르티스 아게 키메라 항원 수용체 발현 세포의 제조 방법
TW201922774A (zh) 2017-11-15 2019-06-16 瑞士商諾華公司 標靶bcma嵌合抗原受體、標靶cd19嵌合抗原受體及組合療法
AU2018375738A1 (en) 2017-11-30 2020-06-11 Novartis Ag BCMA-targeting chimeric antigen receptor, and uses thereof
CN112218651A (zh) 2018-01-08 2021-01-12 诺华公司 用于与嵌合抗原受体疗法组合的免疫增强rna
WO2019160956A1 (en) 2018-02-13 2019-08-22 Novartis Ag Chimeric antigen receptor therapy in combination with il-15r and il15
US20200061113A1 (en) 2018-04-12 2020-02-27 Novartis Ag Chimeric antigen receptor therapy characterization assays and uses thereof
WO2019210153A1 (en) 2018-04-27 2019-10-31 Novartis Ag Car t cell therapies with enhanced efficacy
US20210396739A1 (en) 2018-05-01 2021-12-23 Novartis Ag Biomarkers for evaluating car-t cells to predict clinical outcome
WO2019213276A1 (en) 2018-05-02 2019-11-07 Novartis Ag Regulators of human pluripotent stem cells and uses thereof
US20200085869A1 (en) 2018-05-16 2020-03-19 Novartis Ag Therapeutic regimens for chimeric antigen receptor therapies
WO2019227003A1 (en) 2018-05-25 2019-11-28 Novartis Ag Combination therapy with chimeric antigen receptor (car) therapies
US20210214459A1 (en) 2018-05-31 2021-07-15 Novartis Ag Antibody molecules to cd73 and uses thereof
MY208825A (en) 2018-06-13 2025-05-30 Novartis Ag Bcma chimeric antigen receptors and uses thereof
CN112639083A (zh) 2018-08-31 2021-04-09 诺华股份有限公司 制备表达嵌合抗原受体的细胞的方法
US20210171909A1 (en) 2018-08-31 2021-06-10 Novartis Ag Methods of making chimeric antigen receptor?expressing cells
US20220047633A1 (en) 2018-09-28 2022-02-17 Novartis Ag Cd22 chimeric antigen receptor (car) therapies
EP3856782A1 (en) 2018-09-28 2021-08-04 Novartis AG Cd19 chimeric antigen receptor (car) and cd22 car combination therapies
TW202045207A (zh) 2019-02-25 2020-12-16 瑞士商諾華公司 用於病毒遞送之介孔二氧化矽顆粒組成物
US20230074800A1 (en) 2019-03-21 2023-03-09 Novartis Ag Car-t cell therapies with enhanced efficacy
US20220168389A1 (en) 2019-04-12 2022-06-02 Novartis Ag Methods of making chimeric antigen receptor-expressing cells
WO2020219742A1 (en) 2019-04-24 2020-10-29 Novartis Ag Compositions and methods for selective protein degradation
IL292924A (en) 2019-11-26 2022-07-01 Novartis Ag Cd19 and cd22 chimeric antigen receptors and uses thereof
PH12022551291A1 (en) 2019-11-26 2023-11-20 Novartis Ag Chimeric antigen receptors binding bcma and cd19 and uses thereof
WO2021163618A1 (en) 2020-02-14 2021-08-19 Novartis Ag Method of predicting response to chimeric antigen receptor therapy

Patent Citations (156)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3929992A (en) 1972-09-29 1975-12-30 Ayerst Mckenna & Harrison Rapamycin and process of preparation
EP0090505B1 (en) 1982-03-03 1990-08-08 Genentech, Inc. Human antithrombin iii, dna sequences therefor, expression vehicles and cloning vectors containing such sequences and cell cultures transformed thereby, a process for expressing human antithrombin iii, and pharmaceutical compositions comprising it
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US7232566B2 (en) 1988-11-23 2007-06-19 The United States As Represented By The Secretary Of The Navy Methods for treating HIV infected subjects
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US7144575B2 (en) 1988-11-23 2006-12-05 The Regents Of The University Of Michigan Methods for selectively stimulating proliferation of T cells
US6887466B2 (en) 1988-11-23 2005-05-03 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US5883223A (en) 1988-11-23 1999-03-16 Gray; Gary S. CD9 antigen peptides and antibodies thereto
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US6120766A (en) 1991-12-04 2000-09-19 Hale; Geoffrey CDW52-specific antibody for treatment of multiple sclerosis
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
WO1994004678A1 (en) 1992-08-21 1994-03-03 Casterman Cecile Immunoglobulins devoid of light chains
US5350674A (en) 1992-09-04 1994-09-27 Becton, Dickinson And Company Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof
US5665772A (en) 1992-10-09 1997-09-09 Sandoz Ltd. O-alkylated rapamycin derivatives and their use, particularly as immunosuppressants
WO1994009010A1 (en) 1992-10-09 1994-04-28 Sandoz Ltd. O-alkylated rapamycin derivatives and their use, particularly as immunosuppressants
WO1995014023A1 (en) 1993-11-19 1995-05-26 Abbott Laboratories Semisynthetic analogs of rapamycin (macrolides) being immunomodulators
WO1995016691A1 (en) 1993-12-17 1995-06-22 Sandoz Ltd. Rapamycin derivatives useful as immunosuppressants
USRE44768E1 (en) 1994-04-18 2014-02-18 Wyeth Llc Rapamycin hydroxyesters
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6905681B1 (en) 1994-06-03 2005-06-14 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US5786464C1 (en) 1994-09-19 2012-04-24 Gen Hospital Corp Overexpression of mammalian and viral proteins
US5786464A (en) 1994-09-19 1998-07-28 The General Hospital Corporation Overexpression of mammalian and viral proteins
US20070014794A1 (en) 1995-03-01 2007-01-18 Genentech, Inc. Method for making heteromultimeric polypeptides
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US7172869B2 (en) 1995-05-04 2007-02-06 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
WO1996041807A1 (en) 1995-06-09 1996-12-27 Novartis Ag Rapamycin derivatives
US6004973A (en) 1995-07-14 1999-12-21 Novartis Ag Pharmaceutical compositions comprising rafamycin coprecipitates
WO1997031899A1 (en) 1996-02-28 1997-09-04 Ariad Gene Therapeutics, Inc. Synthetic derivatives of rapamycin as multimerising agents for chimeric proteins with immunophilin derived domains
WO1998002441A2 (en) 1996-07-12 1998-01-22 Ariad Pharmaceuticals, Inc. Non immunosuppressive antifungal rapalogs
US7025962B1 (en) 1996-08-16 2006-04-11 Schering Corporation Mammalian cell surface antigens; related reagents
US6111090A (en) 1996-08-16 2000-08-29 Schering Corporation Mammalian cell surface antigens; related reagents
EP1947183B1 (en) 1996-08-16 2013-07-17 Merck Sharp & Dohme Corp. Mammalian cell surface antigens; related reagents
US6114148A (en) 1996-09-20 2000-09-05 The General Hospital Corporation High level expression of proteins
US6114148C1 (en) 1996-09-20 2012-05-01 Gen Hospital Corp High level expression of proteins
US6703199B1 (en) 1997-06-12 2004-03-09 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US6015815A (en) 1997-09-26 2000-01-18 Abbott Laboratories Tetrazole-containing rapamycin analogs with shortened half-lives
WO1999015530A1 (en) 1997-09-26 1999-04-01 Abbott Laboratories Tetrazole-containing rapamycin analogs with shortened half-lives
WO1999020758A1 (en) 1997-10-21 1999-04-29 Human Genome Sciences, Inc. Human tumor necrosis factor receptor-like proteins tr11, tr11sv1, and tr11sv2
WO1999040196A1 (en) 1998-02-09 1999-08-12 Genentech, Inc. Novel tumor necrosis factor receptor homolog and nucleic acids encoding the same
US20040040047A1 (en) 1998-03-30 2004-02-26 Spencer David M. Regulated apoptosis using chemically induced dimerization of apoptosis factors
US7132255B2 (en) 1998-04-15 2006-11-07 The Brigham And Women's Hospital, Inc. Identification of compounds that bind biliary glycoprotein and affect cytotoxic T lymphocyte activity
WO1999052552A1 (en) 1998-04-15 1999-10-21 Brigham & Women's Hospital, Inc. T cell inhibitory receptor compositions and uses thereof
WO2001003720A2 (en) 1999-07-12 2001-01-18 Genentech, Inc. Promotion or inhibition of angiogenesis and cardiovascularization by tumor necrosis factor ligand/receptor homologs
WO2001014387A1 (en) 1999-08-24 2001-03-01 Ariad Gene Therapeutics, Inc. 28-epirapalogs
WO2001029058A1 (en) 1999-10-15 2001-04-26 University Of Massachusetts Rna interference pathway genes as tools for targeted genetic interference
US6326193B1 (en) 1999-11-05 2001-12-04 Cambria Biosciences, Llc Insect control agent
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
WO2001096584A2 (en) 2000-06-12 2001-12-20 Akkadix Corporation Materials and methods for the control of nematodes
US20050175606A1 (en) 2001-04-11 2005-08-11 Hua-Liang Huang Cyclic single-chain trispecific antibody
WO2003014161A2 (en) 2001-08-10 2003-02-20 Aberdeen University Antigen binding domains from fish
US20040101519A1 (en) 2002-01-03 2004-05-27 The Trustees Of The University Of Pennsylvania Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool
WO2003064383A2 (en) 2002-02-01 2003-08-07 Ariad Gene Therapeutics, Inc. Phosphorus-containing compounds & uses thereof
US7091213B2 (en) 2002-02-01 2006-08-15 Ariad Gene Therapeutics, Inc. Phosphorus-containing compounds and uses thereof
US7727950B2 (en) 2002-04-09 2010-06-01 The University Of Dundee Methods and reagents for assaying protein kinase activity
US6780996B2 (en) 2002-04-30 2004-08-24 Wyeth Holdings Corporation Process for the preparation of 7-substituted-3 quinolinecarbonitriles
US7446190B2 (en) 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
US20040047858A1 (en) 2002-09-11 2004-03-11 Blumberg Richard S. Therapeutic anti-BGP(C-CAM1) antibodies and uses thereof
US20100028330A1 (en) 2002-12-23 2010-02-04 Medimmune Limited Methods of upmodulating adaptive immune response using anti-pd1 antibodies
US7618632B2 (en) 2003-05-23 2009-11-17 Wyeth Method of treating or ameliorating an immune cell associated pathology using GITR ligand antibodies
US20050100543A1 (en) 2003-07-01 2005-05-12 Immunomedics, Inc. Multivalent carriers of bi-specific antibodies
WO2005007190A1 (en) 2003-07-11 2005-01-27 Schering Corporation Agonists or antagonists of the clucocorticoid-induced tumour necrosis factor receptor (gitr) or its ligand for the treatment of immune disorders, infections and cancer
US8399645B2 (en) 2003-11-05 2013-03-19 St. Jude Children's Research Hospital, Inc. Chimeric receptors with 4-1BB stimulatory signaling domain
US20050101624A1 (en) 2003-11-12 2005-05-12 Betts Ronald E. 42-O-alkoxyalkyl rapamycin derivatives and compositions comprising same
WO2005055808A2 (en) 2003-12-02 2005-06-23 Genzyme Corporation Compositions and methods to diagnose and treat lung cancer
WO2005115451A2 (en) 2004-04-30 2005-12-08 Isis Innovation Limited Methods for generating improved immune response
US20060034810A1 (en) 2004-05-27 2006-02-16 The Trustees Of The University Of Pennsylvania Novel artificial antigen presenting cells and uses therefor
WO2006083289A2 (en) 2004-06-04 2006-08-10 Duke University Methods and compositions for enhancement of immunity by in vivo depletion of immunosuppressive cell activity
WO2006020258A2 (en) 2004-07-17 2006-02-23 Imclone Systems Incorporated Novel tetravalent bispecific antibody
US8388967B2 (en) 2005-03-25 2013-03-05 Gitr, Inc. Methods for inducing or enhancing an immune response by administering agonistic GITR-binding antibodies
US7812135B2 (en) 2005-03-25 2010-10-12 Tolerrx, Inc. GITR-binding antibodies
EP1866339A2 (en) 2005-03-25 2007-12-19 TolerRx, Inc Gitr binding molecules and uses therefor
WO2006121168A1 (en) 2005-05-09 2006-11-16 Ono Pharmaceutical Co., Ltd. Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics
US8008449B2 (en) 2005-05-09 2011-08-30 Medarex, Inc. Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics
WO2006122806A2 (en) 2005-05-20 2006-11-23 Novartis Ag 1,3-dihydro-imidazo [4,5-c] quinolin-2-ones as lipid kinase inhibitors
US7943743B2 (en) 2005-07-01 2011-05-17 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (PD-L1)
WO2007005874A2 (en) 2005-07-01 2007-01-11 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (pd-l1)
WO2007024715A2 (en) 2005-08-19 2007-03-01 Abbott Laboratories Dual variable domain immunoglobin and uses thereof
WO2007044729A2 (en) 2005-10-07 2007-04-19 Exelixis, Inc. N- (3-amino-quinoxalin-2-yl) -sulfonamide derivatives and their use as phosphatidylinositol 3-kinase inhibitors
WO2007133822A1 (en) 2006-01-19 2007-11-22 Genzyme Corporation Gitr antibodies for the treatment of cancer
US8354509B2 (en) 2007-06-18 2013-01-15 Msd Oss B.V. Antibodies to human programmed death receptor PD-1
US8591886B2 (en) 2007-07-12 2013-11-26 Gitr, Inc. Combination therapies employing GITR binding molecules
US20100247521A1 (en) 2007-10-26 2010-09-30 Jones Richard B Therapeutic and Diagnostic Methods Using TIM-3
WO2009101611A1 (en) 2008-02-11 2009-08-20 Curetech Ltd. Monoclonal antibodies for tumor treatment
WO2009104019A1 (en) 2008-02-21 2009-08-27 Astrazeneca Ab Combination therapy 238
WO2009114335A2 (en) 2008-03-12 2009-09-17 Merck & Co., Inc. Pd-1 binding proteins
WO2010003118A1 (en) 2008-07-02 2010-01-07 Trubion Pharmaceuticals, Inc. Tgf-b antagonist multi-target binding proteins
WO2010019570A2 (en) 2008-08-11 2010-02-18 Medarex, Inc. Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof
US20120114649A1 (en) 2008-08-25 2012-05-10 Amplimmune, Inc. Delaware Compositions of pd-1 antagonists and methods of use
WO2010027827A2 (en) 2008-08-25 2010-03-11 Amplimmune, Inc. Targeted costimulatory polypeptides and methods of use to treat cancer
US8609089B2 (en) 2008-08-25 2013-12-17 Amplimmune, Inc. Compositions of PD-1 antagonists and methods of use
US8586023B2 (en) 2008-09-12 2013-11-19 Mie University Cell capable of expressing exogenous GITR ligand
WO2010051043A1 (en) 2008-11-03 2010-05-06 Intellikine, Inc. Benzoxazole kinase inhibitors and methods of use
WO2010077634A1 (en) 2008-12-09 2010-07-08 Genentech, Inc. Anti-pd-l1 antibodies and their use to enhance t-cell function
US20120039906A1 (en) 2009-02-09 2012-02-16 INSER (Institut National de la Recherche Medicale) PD-1 Antibodies and PD-L1 Antibodies and Uses Thereof
WO2010114484A1 (en) 2009-04-03 2010-10-07 S*Bio Pte Ltd Pyrimidine substituted purine compounds as kinase (s) inhibitors
WO2010125571A1 (en) 2009-04-30 2010-11-04 Tel Hashomer Medical Research Infrastructure And Services Ltd. Anti ceacam1 antibodies and methods of using same
WO2011028683A1 (en) 2009-09-03 2011-03-10 Schering Corporation Anti-gitr antibodies
WO2011051726A2 (en) 2009-10-30 2011-05-05 Isis Innovation Ltd Treatment of obesity
WO2011056894A2 (en) 2009-11-03 2011-05-12 Jensen Michael C TRUNCATED EPIDERIMAL GROWTH FACTOR RECEPTOR (EGFRt) FOR TRANSDUCED T CELL SELECTION
WO2011066342A2 (en) 2009-11-24 2011-06-03 Amplimmune, Inc. Simultaneous inhibition of pd-l1/pd-l2
WO2011090754A1 (en) 2009-12-29 2011-07-28 Emergent Product Development Seattle, Llc Polypeptide heterodimers and uses thereof
US20110286980A1 (en) 2010-05-21 2011-11-24 Brenner Malcolm K Methods for inducing selective apoptosis
US20130156774A1 (en) 2010-06-18 2013-06-20 The Brigham And Women's Hospital, Inc. Bi-specific antibodies against tim-3 and pd-1 for immunotherapy in chronic immune conditions
WO2012006552A1 (en) 2010-07-09 2012-01-12 Exelixis, Inc. Combinations of kinase inhibitors for the treatment of cancer
WO2012007926A1 (en) 2010-07-16 2012-01-19 Piramal Life Sciences Limited Substituted imidazoquinoline derivatives as kinase inhibitors
US8822663B2 (en) 2010-08-06 2014-09-02 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
US8710200B2 (en) 2011-03-31 2014-04-29 Moderna Therapeutics, Inc. Engineered nucleic acids encoding a modified erythropoietin and their expression
WO2012138475A1 (en) 2011-04-08 2012-10-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Anti-epidermal growth factor receptor variant iii chimeric antigen receptors and use of same for the treatment of cancer
WO2013006490A2 (en) 2011-07-01 2013-01-10 Cellerant Therapeutics, Inc. Antibodies that specifically bind to tim3
WO2013023184A1 (en) 2011-08-11 2013-02-14 Intellikine, Llc Kinase inhibitor polymorphs
WO2013039954A1 (en) 2011-09-14 2013-03-21 Sanofi Anti-gitr antibodies
WO2013054331A1 (en) 2011-10-11 2013-04-18 Tel Hashomer Medical Research Infrastructure And Services Ltd. Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
US20140271618A1 (en) 2011-10-11 2014-09-18 Ramot At Tel-Aviv University Ltd. Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
US20150124036A1 (en) 2011-11-28 2015-05-07 Brother Kogyo Kabushiki Kaisha Ink-Jet Recording Apparatus
WO2013082366A1 (en) 2011-12-01 2013-06-06 The Brigham And Women's Hospital, Inc. Anti-ceacam1 recombinant antibodies for cancer therapy
US8754062B2 (en) 2011-12-16 2014-06-17 Moderna Therapeutics, Inc. DLIN-KC2-DMA lipid nanoparticle delivery of modified polynucleotides
US8680069B2 (en) 2011-12-16 2014-03-25 Moderna Therapeutics, Inc. Modified polynucleotides for the production of G-CSF
US8664194B2 (en) 2011-12-16 2014-03-04 Moderna Therapeutics, Inc. Method for producing a protein of interest in a primate
WO2013126712A1 (en) 2012-02-22 2013-08-29 The Trustees Of The University Of Pennsylvania Compositions and methods for generating a persisting population of t cells useful for the treatment of cancer
WO2014022332A1 (en) 2012-07-31 2014-02-06 The Brigham And Women's Hospital, Inc. Modulation of the immune response
WO2014055442A2 (en) 2012-10-01 2014-04-10 The Trustees Of The University Of Pennsylvania Compositions and methods for targeting stromal cells for the treatment of cancer
WO2014055657A1 (en) 2012-10-05 2014-04-10 The Trustees Of The University Of Pennsylvania Use of a trans-signaling approach in chimeric antigen receptors
WO2014055771A1 (en) * 2012-10-05 2014-04-10 The Trustees Of The University Of Pennsylvania Human alpha-folate receptor chimeric antigen receptor
WO2014059251A1 (en) 2012-10-12 2014-04-17 The Brigham And Women's Hospital, Inc. Enhancement of the immune response
WO2014110591A1 (en) 2013-01-14 2014-07-17 Fred Hutchinson Cancer Research Center Compositions and methods for delivery of immune cells to treat un-resectable or non-resected tumor cells and tumor relapse
WO2014127261A1 (en) 2013-02-15 2014-08-21 The Regents Of The University Of California Chimeric antigen receptor and methods of use thereof
US20140322275A1 (en) 2013-02-20 2014-10-30 Jennifer Brogdon TREATMENT OF CANCER USING HUMANIZED ANTI-EGFRvIII CHIMERIC ANTIGEN RECEPTOR
US20140322212A1 (en) 2013-02-20 2014-10-30 Jennifer Brogdon Effective targeting of primary human leukemia using anti-cd123 chimeric antigen receptor engineered t cells
WO2014130909A1 (en) 2013-02-22 2014-08-28 The Board Of Trustees Of The Leland Stanford Junior University Compounds, compositions, methods, and kits relating to telomere extension
WO2014164348A2 (en) 2013-03-10 2014-10-09 Bellicum Pharmaceuticals, Inc. Modified caspase polypeptides and uses thereof
US20140255360A1 (en) 2013-03-10 2014-09-11 Bellicum Pharmaceuticals, Inc. Modified caspase polypeptides and uses thereof
WO2014151960A2 (en) 2013-03-14 2014-09-25 Bellicum Pharmaceuticals, Inc. Methods for controlling t cell proliferation
WO2014145252A2 (en) 2013-03-15 2014-09-18 Milone Michael C Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy
WO2014153270A1 (en) 2013-03-16 2014-09-25 Novartis Ag Treatment of cancer using humanized anti-cd19 chimeric antigen receptor
WO2014190273A1 (en) 2013-05-24 2014-11-27 Board Of Regents, The University Of Texas System Chimeric antigen receptor-targeting monoclonal antibodies
WO2014197638A2 (en) 2013-06-05 2014-12-11 Bellicum Pharmaceuticals, Inc. Methods for inducing partial apoptosis using caspase polypeptides
US20150140036A1 (en) 2013-11-13 2015-05-21 Novartis Institutes For Biomedical Research, Inc. Low, immune enhancing, dose mtor inhibitors and uses thereof
WO2015090230A1 (en) 2013-12-19 2015-06-25 Novartis Ag Human mesothelin chimeric antigen receptors and uses thereof
WO2015090229A1 (en) 2013-12-20 2015-06-25 Novartis Ag Regulatable chimeric antigen receptor
US20150210769A1 (en) 2014-01-24 2015-07-30 Novartis Ag Antibody molecules to pd-1 and uses thereof
US20150218274A1 (en) 2014-01-31 2015-08-06 Novartis Ag Antibody molecules to tim-3 and uses thereof
US20150259420A1 (en) 2014-03-14 2015-09-17 Novartis Ag Antibody molecules to lag-3 and uses thereof
WO2015142675A2 (en) 2014-03-15 2015-09-24 Novartis Ag Treatment of cancer using chimeric antigen receptor
WO2015157252A1 (en) * 2014-04-07 2015-10-15 BROGDON, Jennifer Treatment of cancer using anti-cd19 chimeric antigen receptor
US20160046724A1 (en) 2014-07-21 2016-02-18 The Trustees Of The University Of Pennsylvania Treatment of cancer using humanized anti-bcma chimeric antigen receptor
US20160051651A1 (en) 2014-07-21 2016-02-25 The Trustees Of The University Of Pennsylvania Treatment of cancer using a cll-1 chimeric antigen receptor
US20160096892A1 (en) 2014-07-21 2016-04-07 The Trustees Of The University Of Pennsylvania Treatment of cancer using a cd33 chimeric antigen receptor
WO2016019300A1 (en) 2014-07-31 2016-02-04 Novartis Ag Subset-optimized chimeric antigen receptor-containing t-cells
WO2016028896A1 (en) * 2014-08-19 2016-02-25 Novartis Ag Anti-cd123 chimeric antigen receptor (car) for use in cancer treatment
US20160068601A1 (en) 2014-08-19 2016-03-10 The Trustees Of The University Of Pennsylvania Treatment of cancer using a cd123 chimeric antigen receptor
WO2016057705A1 (en) * 2014-10-08 2016-04-14 Novartis Ag Biomarkers predictive of therapeutic responsiveness to chimeric antigen receptor therapy and uses thereof

Non-Patent Citations (132)

* Cited by examiner, † Cited by third party
Title
16TH ANNU MEET AM SOC GEN CELL THER (ASGCT, 15 May 2013 (2013-05-15)
ACS MED. CHEM. LETT., vol. 1, 2010, pages 39 - 43
AGATA ET AL., INT. IMMUNOL, vol. 8, 1996, pages 765 - 75
AGGEN ET AL., GENE THER, vol. 19, no. 4, 2012, pages 365 - 74
AGGEN ET AL., GENE THER., vol. 19, no. 4, April 2012 (2012-04-01), pages 365 - 74
AL-LAZIKANI ET AL., JMB, vol. 273, 1997, pages 927 - 948
ALVES ET AL., IMMUNOL LETT, vol. 108, 2007, pages 113 - 20
ARONOVICH ET AL., HUM. MOL. GENET., vol. 20.R1, 2011, pages R14 - 20
BATZER ET AL., NUCLEIC ACID RES., vol. 19, 1991, pages 5081
BELL ET AL., NAT. PROTOC., vol. 2.12, 2007, pages 3153 - 65
BERG ET AL., TRANSPLANT PROC., vol. 30, no. 8, 1998, pages 3975 - 3977
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BLANK ET AL., CANCER IMMUNOL. IMMUNOTHER, vol. 54, 2005, pages 307 - 314
BRENTJENS ET AL., BLOOD, vol. 118, no. 18, 2011, pages 4817 - 4828
BRUMMELKAMP TR ET AL., SCIENCE, vol. 296, 2002, pages 550 - 553
CARL JUNE: "Adoptive T cell therapy for cancer in the clinic", JOURNAL OF CLINICAL INVESTIGATION, vol. 117, 2007, pages 1466 - 1476, XP055287551, DOI: doi:10.1172/JCI32446
CARTER ET AL., EUR J IMMUNOL, vol. 32, 2002, pages 634 - 43
CHEN, J.; ZHENG, X. F; BROWN, E. J.; SCHREIBER, S. L: "Identification of an 11-kDa FKBP 12-rapamycin-binding domain within the 289-kDa FKBP 12-rapamycin-associated protein and characterization of a critical serine residue", PROC NATL ACAD SCI USA, vol. 92, 1995, pages 4947 - 51
CHESON ET AL., J CLIN ONCOL, vol. 17, 1999, pages 1244
CHESON ET AL.: "Revised Response Criteria for Malignant Lymphoma", J CLIN ONCOL, vol. 25, 2007, pages 579 - 586
CHITRA HOSING ET AL: "CARs in Chronic Lymphocytic Leukemia - Ready to Drive", CURRENT HEMATOLOGIC MALIGNANCY REPORTS, vol. 8, no. 1, 9 December 2012 (2012-12-09), pages 60 - 70, XP055163475, ISSN: 1558-8211, DOI: 10.1007/s11899-012-0145-y *
CHRESTA, C.M ET AL., CANCER RES, vol. 70, no. 1, 2010, pages 288 - 298
COUGOT ET AL., TRENDS IN BIOCHEM. SCI., vol. 29, 2001, pages 436 - 444
CRUZ ET AL., BLOOD, vol. 122, no. 17, 2013, pages 2965 - 2973
DAO ET AL., SCI TRANSL MED, vol. 5, no. 176, 2013, pages 176RA33
DAVID M. BARRETT ET AL: "Relation of clinical culture method to T-cell memory status and efficacy in xenograft models of adoptive immunotherapy", CYTOTHERAPY, vol. 16, no. 5, 1 May 2014 (2014-05-01), GB, pages 619 - 630, XP055281922, ISSN: 1465-3249, DOI: 10.1016/j.jcyt.2013.10.013 *
DI STASA ET AL., N EGNL. J. MED., vol. 365, no. 18, 3 November 2011 (2011-11-03), pages 1673 - 1683
DI STASI ET AL., N. ENGL. J. MED., vol. 365, 2011, pages 1673 - 83
DING ET AL., CELL, vol. 122.3, 2005, pages 473 - 83
DONALD B KOHN ET AL: "CARs on Track in the Clinic", MOLECULAR THERAPY, vol. 19, no. 3, 1 March 2011 (2011-03-01), pages 432 - 438, XP055122212, ISSN: 1525-0016, DOI: 10.1038/mt.2011.1 *
DONG ET AL., J MOL MED, vol. 81, 2003, pages 281 - 7
ELANGO ET AL., BIOCHIM. BIOPHYS. RES. COMMUN., vol. 330, 2005, pages 958 - 966
ELEANOR J. CHEADLE ET AL: "CAR T cells: driving the road from the laboratory to the clinic", IMMUNOLOGICAL REVIEWS, vol. 257, no. 1, 13 December 2013 (2013-12-13), pages 91 - 106, XP055177342, ISSN: 0105-2896, DOI: 10.1111/imr.12126 *
ESTHER CHA ET AL: "IL-7 + IL-15 are superior to IL-2 for the ex vivo expansion of 4T1 mammary carcinoma-specific T cells with greater efficacy against tumors in vivo", BREAST CANCER RESEARCH AND TREATMENT, KLUWER ACADEMIC PUBLISHERS, BO, vol. 122, no. 2, 14 October 2009 (2009-10-14), pages 359 - 369, XP019814382, ISSN: 1573-7217 *
FLYNN ET AL., CLIN. TRANSLAT. IMMUNOL., vol. 3, 2014, pages E20
FREEMAN ET AL., J EXP MED, vol. 192, 2000, pages 1027 - 34
FREEMAN, J EXP MED, vol. 192, 2000, pages 1027 - 34
GARCIA-MARTINEZ JM ET AL., BIOCHEM J., vol. 421, no. 1, 2009, pages 29 - 42
GARLAND ET AL., J. IMMUNOL METH, vol. 227, no. 1-2, 1999, pages 53 - 63
GATTINONI ET AL., NAT MED, vol. 17, 2011, pages 1290 - 7
GATTINONI ET AL., NAT. MED, vol. 17, 2011, pages 1290 - 7
GATTINONI ET AL., NAT. MED., vol. 17, 2011, pages 1290 - 7
GHOSH ET AL., GLYCOBIOLOGY, vol. 5, 1991, pages 505 - 10
GRABUNDZIJA ET AL., MOL. THER., vol. 18, 2010, pages 1200 - 1209
GRABUNDZIJA ET AL., NUCLEIC ACIDS RES., vol. 41.3, 2013, pages 1829 - 47
HAANEN ET AL., J. EXP. MED., vol. 190, no. 9, 1999, pages 1319 - 1328
HAMERS-CASTERMAN, C. ET AL., NATURE, vol. 363, 1993, pages 446 - 448
HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1989, COLD SPRING HARBOR
HARLOW ET AL.: "Using Antibodies: A Laboratory Manual", 1999, COLD SPRING HARBOR LABORATORY PRESS
HOLLINGER ET AL., PROC NATL ACAD. SCI. U.S.A., vol. 90, 1993, pages 6444 - 6448
HOLLINGER; HUDSON, NATURE BIOTECHNOLOGY, vol. 23, 2005, pages 1126 - 1136
HOUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
HUANG ET AL., MOL. THER., vol. 16, 2008, pages 580 - 589
HUANG ET AL., NATURE, 2014
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
IZUMOTO ET AL., J N, vol. 108, 2008, pages 963 - 971
JACQUELINE K FLYNN ET AL: "Stem memory T cells (TSCM)-their role in cancer and HIV immunotherapies", CLINICAL & TRANSLATIONAL IMMUNOLOGY, vol. 3, no. 7, 18 July 2014 (2014-07-18), pages e20, XP055282129, DOI: 10.1038/cti.2014.16 *
JENA ET AL.: "Chimeric Antigen Receptor (CAR)-Specific Monoclonal Antibody to Detect CD19-Specific T cells in Clinical Trials", PLOS, vol. 8, March 2013 (2013-03-01), pages 3 E57838
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
JONNALAGADDA ET AL., GENE THER, vol. 20, no. 8, 2013, pages 853 - 860
JOSHI ET AL., J. IMMUNOL., vol. 180.3, 2008, pages 1309 - 15
JUNE ET AL., NATURE REVIEWS IMMUNOLOGY, vol. 9.10, 2009, pages 704 - 716
KABAT ET AL.: "Sequences of Proteins of Immunological Interest 5th Ed.", 1991, NATIONAL INSTITUTES OF HEALTH
KALOS MICHAEL ET AL: "T Cells with Chimeric Antigen Receptors Have Potent Antitumor Effects and Can Establish Memory in Patients with Advanced Leukemia", 20110810, vol. 3, no. 95, 10 August 2011 (2011-08-10), pages 95ra73.1, XP002667262 *
KEBRIAEI ET AL., BLOOD, vol. 122.21, 2013, pages 166
KOCHENDERFER ET AL., BLOOD, vol. 116, no. 20, 2010, pages 4099 - 102
KOCHENDERFER ET AL., BLOOD, vol. 122, no. 25, 2013, pages 4129 - 39
KONISHI ET AL., CLIN CANCER RES, vol. 10, 2004, pages 5094
LANZAVECCHIA ET AL., EUR. J. IMMUNOL, vol. 17, 1987, pages 105
LATCHMAN ET AL., NAT IMMUNOL, vol. 2, 2001, pages 261 - 8
LENARDO ET AL., ANNU REV IMMUNOL, vol. 17, 1999, pages 221 - 53
LIAO ET AL., IMMUNITY, vol. 38, 2013, pages 13 - 25
MALEK ET AL., IMMUNITY, vol. 33, 2010, pages 153 - 65
MARKEL ET AL., CANCER IMMUNOL IMMUNOTHER., vol. 59, no. 2, February 2010 (2010-02-01), pages 215 - 30
MARKEL ET AL., IMMUNOLOGY., vol. 126, no. 2, February 2009 (2009-02-01), pages 186 - 200
MARKEL ET AL., J IMMUNOL., vol. 168, no. 6, 15 March 2002 (2002-03-15), pages 2803 - 10
MARKEL ET AL., J IMMUNOL., vol. 177, no. 9, 1 November 2006 (2006-11-01), pages 6062 - 71
MARKLEY ET AL., BLOOD, vol. 115, 2010, pages 3508 - 19
MEYERSON ET AL.: "hEST2, the Putative Human Telomerase Catalytic Subunit Gene, Is Up-Regulated in Tumor Cells and during Immortalization", CELL, vol. 90, no. 4, 22 August 1997 (1997-08-22), pages 785 - 795, XP002056804, DOI: doi:10.1016/S0092-8674(00)80538-3
MILONE ET AL., MOL. THER., vol. 17, no. 8, 2009, pages 1453 - 1464
MILONE ET AL., MOLECULAR THERAPY, vol. 17, no. 8, 2009, pages 1453 - 1464
MIYAGISHI M ET AL., NAT. BIOTECHNOL., vol. 19, 2002, pages 497 - 500
MONNEY ET AL., NATURE, vol. 415, 2002, pages 536 - 541
MORICHE ET AL., BLOOD, vol. 111.9, 2008, pages 4477 - 89
N. SINGH ET AL: "Early memory phenotypes drive T cell proliferation in patients with pediatric malignancies", SCIENCE TRANSLATIONAL MEDICINE, vol. 8, no. 320, 6 January 2016 (2016-01-06), Washington, DC, pages 320ra3 - 320ra3, XP055281945, ISSN: 1946-6234, DOI: 10.1126/scitranslmed.aad5222 *
NACHEVA; BERZAL-HERRANZ, EUR. J. BIOCHEM., vol. 270, 2003, pages 1485 - 65
NGIOW ET AL., CANCER RES, vol. 71, 2011, pages 3540 - 3551
NICHOLSON ET AL., MOL. IMMUN, vol. 34, no. 16-17, 1997, pages 1157 - 1165
NISHIKAWA ET AL., HUM GENE THER., vol. 12, no. 8, 2001, pages 861 - 70
OHTSUKA ET AL., J. BIOL. CHEM., vol. 260, 1985, pages 2605 - 2608
ORTENBERG ET AL., MOL CANCER THER., vol. LL, no. 6, June 2012 (2012-06-01), pages 1300 - 10
PHILIP ET AL., BLOOD, vol. 124, no. 8, 2014, pages 1277 - 1287
PHILIPP KOEHLER ET AL: "Engineered T Cells for the Adoptive Therapy of B-Cell Chronic Lymphocytic Leukaemia", ADVANCES IN HEMATOLOGY, vol. 180, no. 9, 1 January 2012 (2012-01-01), pages 6365 - 13, XP055094721, ISSN: 1687-9104, DOI: 10.1073/pnas.0710198105 *
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596
PUI ET AL., BLOOD, vol. 92.2, 1998, pages 411 - 5
REICHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329
RESTIFO., BLOOD, vol. 124.4, 2014, pages 476 - 77
ROBERTSON ET AL., CLIN CANCER RES, vol. 12, 2006, pages 4265 - 73
ROSENBERG ET AL., NEW ENG. J. OF MED, vol. 319, 1988, pages 1676
ROSSOLINI ET AL., MOL. CELL. PROBES, vol. 8, 1994, pages 91 - 98
ROTH ET AL.: "Significantly shorter telomeres in T-cells of patients with ZAP-70+/CD38 chronic lymphocytic leukaemia", BRITISH JOURNAL OF HAEMATOLOGY, vol. 143, 28 August 2008 (2008-08-28), pages 383 - 386
SAMBROOK ET AL.: "MOLECULAR CLONING: A LABORATORY MANUAL", vol. 1 -4, 2012, COLD SPRING HARBOR PRESS
SAMBROOK ET AL.: "MOLECULAR CLONING: A LABORATORY MANUAL", vol. 1 -4, COLD SPRING HARBOR PRESS, article "2012"
SASTRY ET AL., J VIROL., vol. 85, no. 5, 2011, pages 1935 - 1942
SCHENBORN; MIERENDORF, NUC ACIDS RES., vol. 13, 1985, pages 6223 - 36
SERGEEVA ET AL., BLOOD, vol. 117, no. 16, 2011, pages 4262 - 4272
SINGH ET AL., CANCER RES., vol. 15, 2008, pages 2961 - 2971
SINGH ET AL., CANCER RES., vol. 68.8, 2008, pages 2961 - 2971
SMITH ET AL., J. CLIN. ONCOL, vol. 14.1, 1996, pages 18 - 24
SMITH ET AL.: "Ex vivo expansion of human T cells for adoptive immunotherapy using the novel Xeno-free CTS Immune Cell Serum Replacement", CLINICAL & TRANSLATIONAL IMMUNOLOGY, vol. 4, 2015, pages E31
SONG ET AL., BLOOD, vol. 119, no. 3, 2012, pages 696 - 706
SONG ET AL., CANCER GENE THER., vol. 15, no. 10, 2008, pages 667 - 75
SRIVASTAVA ET AL., CURR MED CHEM, vol. 17, 2010, pages 3353 - 7
STEPHAN ET AL., NATURE BIOTECHNOLOGY, vol. 33, 2015, pages 97 - 101
STEPINSKI ET AL., RNA, vol. 7, 2001, pages 1468 - 95
STERN ET AL., J IMMUNOL., vol. 174, no. 11, 1 June 2005 (2005-06-01), pages 6692 - 701
STRELTSOV, PROTEIN SCI., vol. 14, 2005, pages 2901 - 2909
TASSEV ET AL., CANCER GENE THER, vol. 19, no. 2, 2012, pages 84 - 100
TISCORNIA G.: "Gene Transfer: Delivery and Expression of DNA and RNA", 2007, COLD SPRING HARBOR LABORATORY PRESS, article "Development of Lentiviral Vectors Expressing siRNA"
TOBIAS MAETZIG ET AL.: "Gammaretroviral Vectors: Biology, Technology and Application", VIRUSES, vol. 3, no. 6, June 2011 (2011-06-01), pages 677 - 713
UI-TEI ET AL., FEBS LETTERS, vol. 479, 2000, pages 79 - 82
VENKATESAN, A.M., J. MED.CHEM., vol. 53, 2010, pages 2636 - 2645
VERMA ET AL., J IMMUNOL, vol. 184, no. 4, 2010, pages 2156 - 2165
WILLEMSEN ET AL., GENE THER, vol. 8, no. 21, 2001, pages 1601 - 1608
WILLEMSEN RA ET AL., GENE THERAPY, vol. 7, 2000, pages 1369 - 1377
WILLIAMS, MOLECULAR THERAPY, vol. 16.9, 2008, pages 1515 - 16
XU ET AL., LEUK LYMPHOMA, vol. 54, no. 2, 2012, pages 255 - 260
XU ET AL., LYMPHOMA, vol. 54, 2013, pages 255 - 60
YANG ET AL., CANCER IMMUNOL IMMUNOTHER, vol. 62, 2013, pages 727 - 36
YU K ET AL.: "Biochemical, Cellular, and In vivo Activity of Novel ATP-Competitive and Selective Inhibitors of the Mammalian Target of Rapamycin", CANCER RES., vol. 69, no. 15, 2009, pages 6232 - 6240, XP008132305, DOI: doi:10.1158/0008-5472.CAN-09-0299
ZHANG T ET AL., CANCER GENE THER, vol. 11, 2004, pages 487 - 496
ZHENG ET AL., PLOS ONE, vol. 5, no. 9, 2 September 2010 (2010-09-02), pages E12529

Cited By (48)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10273300B2 (en) 2014-12-29 2019-04-30 The Trustees Of The University Of Pennsylvania Methods of making chimeric antigen receptor-expressing cells
US11896614B2 (en) 2015-04-17 2024-02-13 Novartis Ag Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
US10829735B2 (en) 2015-07-21 2020-11-10 The Trustees Of The University Of Pennsylvania Methods for improving the efficacy and expansion of immune cells
US12240884B2 (en) 2015-07-21 2025-03-04 Novartis Ag Methods for improving the efficacy and expansion of immune cells
US12037583B2 (en) 2015-12-04 2024-07-16 Novartis Ag Compositions and methods for immunooncology
US11859208B2 (en) 2016-04-08 2024-01-02 Emory University Methods of treating cancer using cell based therapies
JP2019536786A (ja) * 2016-11-30 2019-12-19 イントレキソン コーポレーション ステロイドの投与および免疫療法
US12269859B2 (en) 2016-12-02 2025-04-08 Angeles Therapeutics, Inc. Synthetic immune receptors and methods of use thereof
JP2020511115A (ja) * 2016-12-21 2020-04-16 オートラス リミテッド Carおよび転写因子を発現する細胞、ならびにその使用
JP7149273B2 (ja) 2016-12-21 2022-10-06 オートラス リミテッド Carおよび転写因子を発現する細胞、ならびにその使用
JP2024133287A (ja) * 2016-12-21 2024-10-01 オートラス リミテッド Carおよび転写因子を発現する細胞、ならびにその使用
WO2018132695A1 (en) * 2017-01-13 2018-07-19 Celdara Medical, Llc Chimeric antigen receptors targeting tim-1
US11541076B2 (en) 2017-01-13 2023-01-03 Celdara Medical, Llc Chimeric antigen receptors targeting TIM-1
US11851659B2 (en) 2017-03-22 2023-12-26 Novartis Ag Compositions and methods for immunooncology
WO2019060425A1 (en) 2017-09-19 2019-03-28 Massachusetts Institute Of Technology COMPOSITIONS FOR CHIMERIC ANTIGENIC RECEPTOR T CELL THERAPY AND USES THEREOF
CN109971718A (zh) * 2017-12-28 2019-07-05 上海细胞治疗研究院 获得高阳性率car-t细胞的方法
CN109971718B (zh) * 2017-12-28 2023-09-01 上海细胞治疗研究院 获得高阳性率car-t细胞的方法
EP3737695A1 (en) * 2018-01-10 2020-11-18 The Board of Trustees of the Leland Stanford Junior University Compositions and methods of expansion of t cell populations
JP2021518121A (ja) * 2018-03-21 2021-08-02 イマティクス ユーエス,アイエヌシー. 養子注入されたt細胞の持続性を増強する方法
JP7344898B2 (ja) 2018-03-21 2023-09-14 イマティクス ユーエス,アイエヌシー. 養子注入されたt細胞の持続性を増強する方法
US11905529B2 (en) 2018-03-21 2024-02-20 Immatics Us Inc. Method of enhancing persistence of adoptively infused T cells
WO2019241315A1 (en) 2018-06-12 2019-12-19 Obsidian Therapeutics, Inc. Pde5 derived regulatory constructs and methods of use in immunotherapy
IL296050B1 (en) * 2018-08-01 2024-08-01 Immunitybio Inc A quadricistronic system containing a receptor or cytokine and a chimeric antigen receptor for genetic modification of immunotherapies
EP3829605A4 (en) * 2018-08-01 2022-10-19 ImmunityBio, Inc. QUADRICISTRONIC SYSTEM COMPRISING A homing or CYTOKINE RECEPTOR, AND CHIMERIC ANTIGEN RECEPTOR FOR GENETIC MODIFICATION OF IMMUNOTHERAPIES
WO2020047449A3 (en) * 2018-08-31 2020-04-09 Novartis Ag Methods of making chimeric antigen receptor-expressing cells
WO2020068261A1 (en) 2018-09-28 2020-04-02 Massachusetts Institute Of Technology Collagen-localized immunomodulatory molecules and methods thereof
EP3773918A4 (en) * 2019-03-05 2022-01-05 Nkarta, Inc. ANTI-CD19 CHEMERIC ANTIGEN RECEPTORS AND THEIR USE IN IMMUNOTHERAPY
WO2020185632A1 (en) 2019-03-08 2020-09-17 Obsidian Therapeutics, Inc. Human carbonic anhydrase 2 compositions and methods for tunable regulation
WO2020185628A1 (en) 2019-03-08 2020-09-17 Obsidian Therapeutics, Inc. Cd40l compositions and methods for tunable regulation
WO2020252404A1 (en) 2019-06-12 2020-12-17 Obsidian Therapeutics, Inc. Ca2 compositions and methods for tunable regulation
WO2020252405A1 (en) 2019-06-12 2020-12-17 Obsidian Therapeutics, Inc. Ca2 compositions and methods for tunable regulation
WO2020263399A1 (en) 2019-06-26 2020-12-30 Massachusetts Institute Of Technology Immunomodulatory fusion protein-metal hydroxide complexes and methods thereof
WO2021040736A1 (en) 2019-08-30 2021-03-04 Obsidian Therapeutics, Inc. Tandem cd19 car-based compositions and methods for immunotherapy
US12444491B2 (en) 2019-08-30 2025-10-14 Juno Therapeutics, Inc. Machine learning methods for classifying cells
WO2021050789A1 (en) 2019-09-10 2021-03-18 Obsidian Therapeutics, Inc. Ca2-il15 fusion proteins for tunable regulation
WO2021061648A1 (en) 2019-09-23 2021-04-01 Massachusetts Institute Of Technology Methods and compositions for stimulation of endogenous t cell responses
WO2021092097A1 (en) * 2019-11-05 2021-05-14 Juno Therapeutics, Inc. Methods of determining attributes of therapeutic t cell compositions
WO2021108613A1 (en) 2019-11-26 2021-06-03 Novartis Ag Cd19 and cd22 chimeric antigen receptors and uses thereof
WO2021142376A1 (en) 2020-01-08 2021-07-15 Obsidian Therapeutics, Inc. Compositions and methods for tunable regulation of transcription
WO2021150919A1 (en) 2020-01-23 2021-07-29 The Children's Medical Center Corporation Stroma-free t cell differentiation from human pluripotent stem cells
US12365874B2 (en) 2020-01-28 2025-07-22 Immunitybio, Inc. Chimeric antigen receptor-modified NK-92 cells targeting EGFR super-family receptors
WO2021183675A2 (en) 2020-03-10 2021-09-16 Massachusetts Institute Of Technology Methods for generating engineered memory-like nk cells and compositions thereof
WO2021183207A1 (en) 2020-03-10 2021-09-16 Massachusetts Institute Of Technology COMPOSITIONS AND METHODS FOR IMMUNOTHERAPY OF NPM1c-POSITIVE CANCER
WO2021221782A1 (en) 2020-05-01 2021-11-04 Massachusetts Institute Of Technology Chimeric antigen receptor-targeting ligands and uses thereof
WO2021221783A1 (en) 2020-05-01 2021-11-04 Massachusetts Institute Of Technology Methods for identifying chimeric antigen receptor-targeting ligands and uses thereof
US11883432B2 (en) 2020-12-18 2024-01-30 Century Therapeutics, Inc. Chimeric antigen receptor system with adaptable receptor specificity
WO2022254337A1 (en) 2021-06-01 2022-12-08 Novartis Ag Cd19 and cd22 chimeric antigen receptors and uses thereof
WO2023081715A1 (en) 2021-11-03 2023-05-11 Viracta Therapeutics, Inc. Combination of car t-cell therapy with btk inhibitors and methods of use thereof

Also Published As

Publication number Publication date
WO2016168595A8 (en) 2018-02-01
AU2022231783A1 (en) 2022-11-10
JP2022002525A (ja) 2022-01-11
AU2016249005A8 (en) 2019-07-25
AU2016249005A1 (en) 2017-11-02
JP2018516592A (ja) 2018-06-28
ES2948133T3 (es) 2023-08-31
US20180133296A1 (en) 2018-05-17
SG11201708516YA (en) 2017-11-29
EP4234685A2 (en) 2023-08-30
EP4234685A3 (en) 2023-09-06
CA2982996A1 (en) 2016-10-20
US20240398913A1 (en) 2024-12-05
US11896614B2 (en) 2024-02-13
AU2025204038A1 (en) 2025-06-19
CN108473957B (zh) 2024-07-16
JP7597688B2 (ja) 2024-12-10
JP7114457B2 (ja) 2022-08-08
CN118726268A (zh) 2024-10-01
JP2025061644A (ja) 2025-04-11
EP3283619A1 (en) 2018-02-21
CN108473957A (zh) 2018-08-31
AU2016249005B2 (en) 2022-06-16
EP3283619B1 (en) 2023-04-05

Similar Documents

Publication Publication Date Title
US20240398913A1 (en) Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
JP7524249B2 (ja) 抗癌治療における組み合わせ使用のためのメソテリンキメラ抗原受容体(car)およびpd-l1阻害剤に対する抗体
US20230052970A1 (en) Phosphoglycerate kinase 1 (pgk) promoters and methods of use for expressing chimeric antigen receptor
EP3174546B1 (en) Subset-optimized chimeric antigen receptor-containing t-cells
US11542488B2 (en) Sortase synthesized chimeric antigen receptors
AU2015292811B2 (en) Treatment of cancer using a CLL-1 chimeric antigen receptor
WO2019099639A1 (en) Bcma-targeting chimeric antigen receptor, cd19-targeting chimeric antigen receptor, and combination therapies
CA2992551A1 (en) Methods for improving the efficacy and expansion of immune cells
WO2016014576A1 (en) Treatment of cancer using a cd33 chimeric antigen receptor
WO2016172537A1 (en) Compositions to disrupt protein kinase a anchoring and uses thereof
HK40094582A (en) Subset-optimized chimeric antigen receptor-containing cells

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16720247

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2982996

Country of ref document: CA

Ref document number: 2018505581

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 11201708516Y

Country of ref document: SG

WWE Wipo information: entry into national phase

Ref document number: 15567156

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2016249005

Country of ref document: AU

Date of ref document: 20160415

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201680035218.8

Country of ref document: CN