WO2015097536A2 - Anti-vista antibodies and fragments - Google Patents
Anti-vista antibodies and fragments Download PDFInfo
- Publication number
- WO2015097536A2 WO2015097536A2 PCT/IB2014/002868 IB2014002868W WO2015097536A2 WO 2015097536 A2 WO2015097536 A2 WO 2015097536A2 IB 2014002868 W IB2014002868 W IB 2014002868W WO 2015097536 A2 WO2015097536 A2 WO 2015097536A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- vista
- seq
- antibody fragment
- fragment
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3015—Breast
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3023—Lung
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3038—Kidney, bladder
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57505—Immunoassay; Biospecific binding assay; Materials therefor for cancer of the blood, e.g. leukaemia
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5751—Immunoassay; Biospecific binding assay; Materials therefor for cancer of the skin, e.g. melanoma
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5758—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
- G01N33/5759—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds localised on the membrane of tumour or cancer cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/51—Complete heavy chain or Fd fragment, i.e. VH + CH1
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/54—F(ab')2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates to antibodies and antibody fragments comprising an antigen binding region that binds to a V-domain Ig Suppressor of T cell Activation (VISTA).
- VISTA is a checkpoint regulator that negatively suppresses immune responses. See Wang et ah, "VISTA, a novel mouse Ig superfamily ligand that negatively regulates T cell responses," J. Exp. Med., 208(3) 577-92 (2011). It is expressed on normal human neutrophils, monocytes and T cells subsets. In addition, cynomolgus monkey cells express VISTA in a similar pattern to normal human cells. VISTA is also expressed in the peripheral blood cells of cancer patients.
- the binding of the antibody or antibody fragment to VISTA modulates or enhances an immune response.
- the antibody fragment can include, for example, a Fab, F(ab') 2 , or scFv antibody fragment.
- the antibody or antibody fragment can comprise an antibody constant region.
- the antibody or antibody fragment can bind to VISTA that is expressed on a hematopoietic cell, for example, a myeloid cell and/or a lymphocyte, a monocyte or a neutrophil, a T cell, a natural killer ( K) cell, a natural killer T (NKT) cell, a tumor cell, and/or in the tumor microenvironment (TME).
- the tumor microenvironment is the cellular environment of the tumor. It can include surrounding immune cells, fibroblasts, blood vessels, other cells, signaling molecules, and the extracellular matrix.
- the antibody or antibody fragment can comprise one or more heavy chain complementary determining regions (CDRs) and/or one or more light chain CDRs, including one or more CDRs (e.g., all three heavy chain CDRs, all 3 light chain CDRs, or all 6 CDRs) of any of the anti- VISTA antibodies described herein, including the antibodies designated VSTBl 12 (S2), VSTBl 16 (S5), VSTB95 (SI 6), VSTB50 (S41), VSTB53 (S43) and VSTB60 (S47).
- the antibodies or fragments thereof are selected from the group consisting of VSTBl 12, VSTB95, VSTBl 16, VSTB50, VSTB53 and VSTB60.
- the antibody or fragment comprises one or more of the heavy chain CDRs and one or more light chain CDRs of any of the anti-VISTA antibodies described herein. In some embodiments, the antibody or antibody fragment can further comprise at least one heavy chain and at least one light chain of any of the anti-VISTA antibodies described herein. In some embodiments, the antibody or antibody fragment comprises at least one heavy chain comprising the heavy chain variable region sequence, and/or at least one light chain comprising the light chain variable region sequence. In some embodiments, the antibody comprises a human framework region. In some embodiments, the antibody is a whole antibody. In some embodiments, the fragment is an anti-VISTA binding member. In some
- the heavy chain CDRs of the antibody are represented in SEQ ID NOs: l, 2, and 3 and the light chain CDRs are represented in SEQ ID NOs: 4, 5, and 6.
- the heavy chain and light chain variable region amino acid sequences are represented in SEQ ID NOS: 7 and 8, respectively.
- the antibody or fragment comprises an antibody VH domain comprising a VH CDR1 having an amino acid sequence that is substantially similar to SEQ ID NO: l, a VH CDR2 having an amino acid sequence that is substantially similar to SEQ ID NO:2 and a VH CDR3 having an amino acid sequence that is substantially similar to SEQ ID NO:3, and which further comprises an antibody VL domain comprising a VL CDR1 having an amino acid sequence that is substantially similar to SEQ ID NO:4, a VL CDR2 having an amino acid sequence that is substantially similar to SEQ ID NO: 5 and a VL CDR3 having an amino acid sequence that is substantially similar to SEQ ID NO:6.
- the invention also relates to anti- VISTA antibodies that competitively inhibit, or compete for binding to, the anti- VISTA antibodies described herein.
- the anti-VISTA antibodies are part of a conjugate, for example, a conjugate that comprises a cytotoxic molecule r another agent described herein.
- a conjugate for example, a conjugate that comprises a cytotoxic molecule r another agent described herein.
- Such molecules are well-known in the art.
- the antibody or antibody fragment is a
- the antibody is a chimeric, humanized or human antibody.
- the antibody or antibody fragment comprises a human constant region.
- the antibody or antibody fragment is specific for an epitope of VISTA, e.g., within the amino acid sequence SEQ ID NO: 9.
- the antibody or antibody fragment binds to an epitope of VISTA with an affinity of at least lxlO "7 liter/mole, for example, at least 1x10 " liter/mole, for example, at least 1x10 " liter/mole.
- the modulation of the immune response comprises an increase in CD45+ leukocytes, CD4+ T cells, and/or CD8+ T cells.
- the modulation of the immune response comprises enhanced production of (e.g., T-cell) cytokines (e.g., IFNy, IL-10, TNFa, IL-17), enhanced T- cell response, and/or modulated Foxp3 expression.
- the present invention also relates to compositions comprising an antibody or antibody fragment described herein (e.g., an anti-VISTA antibody) and a pharmaceutically acceptable carrier, diluent, or excipient.
- the composition can comprise a VISTA antagonist comprising an antibody or antibody fragment thereof comprising an antigen binding region that binds to VISTA, and a vaccine (such as a viral vector vaccine, bacterial vaccine, DNA vaccine, RNA vaccine, peptide vaccine).
- a vaccine such as a viral vector vaccine, bacterial vaccine, DNA vaccine, RNA vaccine, peptide vaccine.
- the composition is a
- composition and binding of the antibody or antibody fragment to VISTA modulates or enhances an immune response.
- the invention also relates to methods for treating or preventing cancer comprising administering to an individual (e.g., a mammal, e.g., a human or a nonhuman animal) in need thereof an effective amount of at least one antibody, antibody fragment, or composition described herein.
- an individual e.g., a mammal, e.g., a human or a nonhuman animal
- the antibody or antibody fragment binds to VISTA, thereby modulating or enhancing an immunogenic response to cancer.
- the cancer is a leukemia, lymphoma, myelodysplastic syndrome and/or myeloma.
- the cancer can be any kind or type of leukemia, including a lymphocytic leukemia or a myelogenous leukemia, such as, e.g., acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), acute myeloid (myelogenous) leukemia (AML), chronic myelogenous leukemia (CML), hairy cell leukemia, T-cell prolymphocytic leukemia, large granular lymphocytic leukemia, or adult T-cell leukemia.
- the lymphoma is a histocytic lymphoma
- the cancer is a multiple myeloma.
- the cancer is a solid tumor, for example, a melanoma, or bladder cancer.
- the cancer is a lung cancer (e.g., a non-small cell lung carcinoma (NSCLC)).
- NSCLC non-small cell lung carcinoma
- Some methods of treatment further comprise administering a vaccine (such as a viral vector vaccine, bacterial vaccine, cell-based vaccine, DNA vaccine, RNA vaccine, peptide vaccine, or protein vaccine).
- a vaccine such as a viral vector vaccine, bacterial vaccine, cell-based vaccine, DNA vaccine, RNA vaccine, peptide vaccine, or protein vaccine.
- the invention also relates to a method for suppressing tumor growth in an individual in need thereof, said method comprising administering an effective antibody or antibody fragment or composition described herein.
- composition, antibody or fragment or other pharmaceutical agent e.g., a vaccine
- parenteral or nonparenteral means for example, intravenously (IV), subcutaneously (SQ) or orally (PO).
- the composition, antibody or fragment is administered quarterly, weekly, once every two weeks, once every three weeks, or once every four weeks.
- other pharmaceutical or therapeutic agents are co-administered, before, during or after the antibodies, fragments and compositions described herein.
- the co-administered agent can be administered by the same route as the antibody, fragment or composition, or by a different route.
- the invention also includes methods of making the antibodies, fragments and compositions, for example, a method of producing an antibody or fragment described herein, comprising culturing host cells under conditions for production of said antibody.
- the method can further comprise isolating the antibody.
- nucleic acids e.g., isolated nucleic acids which comprises a nucleotide sequence encoding the antibodies and fragments
- expression vectors comprising such nucleic acids, e.g., operably linked to a promoter, and host cells transformed with such an expression vector.
- the invention also relates to kits and to articles of manufacture comprising a composition comprising an anti-VISTA antibody and a container, and further comprising a package insert or label indicating that the composition can be used to treat cancer.
- the invention also provides an isolated antibody or antibody fragment thereof comprising an antigen binding region that binds to a V-domain Ig
- the antibody comprises an antibody VH domain comprising a VH CDR1 having the amino acid sequence of SEQ ID NO:25, a VH CDR2 having the amino acid sequence of SEQ ID NO:26 and a VH CDR3 having the amino acid sequence of SEQ ID NO:27, and which further comprises an antibody VL domain comprising a VL CDR1 having the amino acid sequence of SEQ ID NO:28, a VL CDR2 having the amino acid sequence of SEQ ID NO:29 and a VL CDR3 having the amino acid sequence of SEQ ID NO:30.
- the antibody or antibody fragment comprises one or more humanized or human framework regions.
- the antibody or antibody fragment comprises an antibody VH domain that comprises SEQ ID NO:37 and/or an antibody VL domain comprises SEQ ID NO:44.
- the antibody comprises a heavy chain constant region (e.g., a human heavy chain constant region) and/or a light chain constant region (e.g., a human light chain constant region, such as the light chain constant region present in SEQ ID NO:56).
- the heavy chain constant region is an IgGl heavy chain constant region (e.g., the IgGl heavy chain constant region present in SEQ ID NO:61).
- the IgGl heavy chain constant region has been modified to enhance protease resistance of the antibody.
- an IgGl heavy chain constant region that has been modified to enhance protease resistance is the IgGl heavy chain constant region present in SEQ ID NO:60.
- the antibody or antibody fragment comprises a heavy chain comprising SEQ ID NO.60 and a light chain comprising SEQ ID NO:56; or a heavy chain comprising SEQ ID NO:61 and a light chain comprising SEQ ID NO:56.
- the antibody or antibody fragment is expressed in a cell that is deficient in fucosylation enzymes (e.g., a Chinese hamster ovary (CHO) cell that is deficient in fucosylation enzymes).
- the invention also relates to a composition
- a composition comprising an antibody or antibody fragment thereof comprising an antibody VH domain comprising a VH CDR1 having the amino acid sequence of SEQ ID NO:25, a VH CDR2 having the amino acid sequence of SEQ ID NO:26 and a VH CDR3 having the amino acid sequence of SEQ ID NO:27, and which further comprises an antibody VL domain comprising a VL CDR1 having the amino acid sequence of SEQ ID NO:28, a VL CDR2 having the amino acid sequence of SEQ ID NO:29 and a VL CDR3 having the amino acid sequence of SEQ ID NO:30; and a pharmaceutically acceptable carrier, diluent, or excipient.
- the invention relates to a method for treating cancer in an individual in need thereof, said method comprising administering to the subject an effective amount of the antibody or antibody fragment that binds to a V- domain Ig Suppressor of T cell Activation (VISTA), wherein the antibody comprises an antibody VH domain comprising a VH CDR1 having the amino acid sequence of SEQ ID NO:25, a VH CDR2 having the amino acid sequence of SEQ ID NO:26 and a VH CDR3 having the amino acid sequence of SEQ ID NO:27, and which further comprises an antibody VL domain comprising a VL CDR1 having the amino acid sequence of SEQ ID NO:28, a VL CDR2 having the amino acid sequence of SEQ ID NO:29 and a VL CDR3 having the amino acid sequence of SEQ ID NO:30.
- VISTA V- domain Ig Suppressor of T cell Activation
- the cancer is a lung cancer.
- the lung cancer is a non-small cell lung carcinoma (NSCLC).
- the method further comprises administering a second cancer treatment (e.g., surgery, chemotherapy, radiation therapy, biologic therapy, immunomodulatory therapy, and combinations thereof).
- a second cancer treatment e.g., surgery, chemotherapy, radiation therapy, biologic therapy, immunomodulatory therapy, and combinations thereof.
- the invention also provides an antibody or antibody fragment thereof comprising an antigen binding region that binds to a V-domain Ig Suppressor of T cell Activation (VISTA), wherein the antibody binds to a conformational epitope in VISTA (e.g., human VISTA).
- VISTA V-domain Ig Suppressor of T cell Activation
- the conformational epitope comprises, or is present within, residues 103-111 (NLTLLDSGL (SEQ ID N062)) and 136-146 (VQTGKDAPSNC (SEQ ID NO:63)) of human VISTA (SEQ ID NO:46).
- the conformational epitope comprises, or is present within, residues 24-36 (LLGPVDKGHDVTF (SEQ ID NO:64)), 54-65
- the conformational epitope comprises amino acid residues in the FG loop of human VISTA (SEQ ID NO:46).
- the invention relates to a method of enhancing an immune response in an individual in need thereof, comprising administering to the individual a therapeutically effective amount of an antibody that binds V-domain Ig Suppressor of T cell Activation (VISTA), or an antibody fragment thereof, comprising an antigen binding region that binds to VISTA, thereby enhancing an immune response to the cancer.
- the immune response is an antitumor immune response.
- the invention provides a method of eliciting a biological response in an individual in need thereof, comprising administering to the individual a therapeutically effective amount of an antibody that binds V-domain Ig Suppressor of T cell Activation (VISTA), or an antibody fragment thereof, comprising an antigen binding region that binds to VISTA, thereby enhancing an immune response to the cancer.
- biological responses include activation of monocytes; induction of T-cell proliferation and cytokine secretion; antibody- dependent cell-mediated cytotoxicity (ADCC) of cells expressing VISTA; and antibody-dependent cellular phagocytosis (ADCP) of cells expressing VISTA.
- Figure 1 A- 1 C Graphs showing VISTA expression on TF 1 AML Cells Expression of VISTA protein by flow cytometry is shown in the TF-1 AML cell line.
- Figure 2A-2E Graphs showing staining and gating strategies for identification of Human Myeloid and Lymphoid Subsets.
- Figure 3A-3G Graphs showing expression of VISTA on Human
- Figure 4 Graph showing expression of VISTA on Human Myeloid
- Lymphoid Subsets across multiple healthy normal donors.
- Figure 5A-5B Graph showing staining and gating strategies for identification of expression of VISTA on Human Monocytes and Macrophages.
- Figure 6 A-6C Graphs showing expression of VISTA on Human
- Figure 7A-7E Graphs showing staining and gating strategies for identification of expression of VISTA on Human T and NK Cell Subsets.
- Figure 8A-8G Graphs showing expression of VISTA on Human T and NKCell Subsets from one healthy normal donor.
- Figure 9 Graph showing expression of VISTA on Human T and NK Cell Subsets across multiple healthy normal donors.
- Figure 10A-10D Graphs showing staining and gating strategies for identification of expression of VISTA on Human Dendritic Cell subsets.
- Figure 11 A- 11 C Graphs showing expression of VISTA on Human
- Dendritic Cell subsets and basophils from one healthy normal donor are dendritic Cell subsets and basophils from one healthy normal donor.
- Figure 12 Graph showing expression of VISTA on Human Dendritic
- Figure 13A-13D Analysis of VISTA expression on healthy human peripheral blood cells. Profile of VISTA expression on healthy human peripheral blood cells using multicolor flow cytometry analysis: Whole blood samples from 2 different individuals were analyzed for VISTA expression on ( Figure 13 A) monocytes SSC ,0 'CD1 lb hi CD14 hi CD16- ve CD33 +ve HLA-DR +ve CD19- ve ) ( Figure 13B) neutrophils (SSC hi CD 177 + CD 1 lb hi CD 14 lo CD 16 +ve CD33 +ve HLA-DR- ve CD 19 've ).
- Peripheral blood mononuclear cells were isolated using Ficoll gradient for analysis of (Figure 13C) CD4+ T cells (CD3 +ve CD4 +ve ), and (Figure 13D) CD8+ T cells (CD3 +ve CD8 +ve ).
- Figure 14A-14C Analysis of VISTA expression on peripheral blood cells from a lung cancer patient and a healthy control donor. Profile of VISTA expression on lung cancer patient peripheral blood cells using multicolor flow cytometry analysis: Representative FACS plot ( Figure 14 A) from one individual is shown. Peripheral blood mononuclear cells were isolated by Ficoll and analyzed for VISTA expression on ( Figure 14B) monocytes (CD14+ CD1 lb+ CD33+ HLADR+ CD15-) and (Figure 14C) myeloid derived suppressor cells (CD14- CD1 lb+ CD33- HLADR-CD15+ CD 16+).
- Figure 15A-15C Profile of VISTA expression in peripheral blood cells from a patient with colon cancer, using multicolor flow cytometry analysis:
- FIG. 15 A Representative FACS plot ( Figure 15 A) from one individual is shown.
- Peripheral blood mononuclear cells were isolated by Ficoll and analyzed for VISTA expression on ( Figure 15B) monocytes (CD14+ CD1 lb+ CD33+ HLADR+ CD15-) and
- Figure 15C myeloid derived suppressor cells (CD 14- CD1 lb+ CD33 -HLADR-CD 15+ CD 16+).
- Figure 16A-16D Profile of VISTA expression on Cynomolgus monkey peripheral blood cells using multicolor flow cytometry analysis: Whole blood from 4 different monkeys was analyzed for VISTA expression on ( Figure 16A) monocytes (SSC l0 CDl lb hi CD14 hi HLA-DR hi CD16- ve CD19 "ve and ( Figure 16B) neutrophils CD1 lb hi CD14 l0 HLA-DR- ye CD16- ve CD19 "ve .
- Peripheral blood mononuclear cells from three monkeys were isolated using Ficoll gradient for analysis of (Figure 16C) CD4+ T cells (TCRa/p +ve CD4 +ve ) and ( Figure 16D) CD8+ T cells
- Figure 17 Graph showing absolute expression values of VISTA RNA in Heme cell lines.
- Figure 18 Mouse A20 cells were stably transfected with either GFP or human VISTA. They were incubated with ova peptide and with DOl 1.10 T cells. CD25 expression by the T cells was measured 24 hours after incubation began. The A20-huVISTA cells suppress CD25 expression by the T cells, but this readout is significantly restored by incubation with VSTB95.
- Figure 19A- 19F Graphs showing Human VISTA ELISA results.
- Figure 20A-20F Human VISTA FACS results, showing anti- VISTA antibodies binding to cells expressing human VISTA.
- Figure 21A-21D Dilution study of 6 anti- VISTA antibody candidates in the mixed lymphocyte reaction from 30 ⁇ g/ml to 0.0 ⁇ / ⁇ 1.
- Figure 22 A-22B Dilution studies of 6 anti- VISTA antibody candidates in the SEB assay (individual CPM counts and IFN-g concentrations) from 30 ⁇ g ml to 0.0 ⁇ .
- Figure 23 Sensorgram plot using anti-VISTA antibody VSTB85 coated on a Proteon SPR chip and VISTA protein with the indicated competitors run over the chip (competitors listed in Table 16).
- Figure 24 Experimental design for MB49 murine bladder tumor model
- Figure 25 A-25B MB49 tumor growth in female C57B1/6 mice. Graphs illustrate tumor growth in individual mice treated with anti-mouse VISTA antibody ( Figure 25B) or control IgG ( Figure 25A).
- Figure 26 Amino acid sequence of human VISTA (SEQ ID NO:46).
- Figure 27 Multiple sequence alignment of VISTA orthologues
- Figure 28 Regions of human VISTA bound by VSTB50 and VSTB60 antibodies (top) or VSTB95 and VSTBl 12 antibodies (bottom), as determined by HDX
- FIG. 29 VISTA Epitope bound by VSTBl 12.
- (Top) VISTA is shown in cartoon with strands labeled. Residues having at least one atom within 5 A of VSTBl 12 in the complex are colored blue. Blue and orange spheres highlight a chain break, and the cyan and green spheres mark the N- and C-termini of the VISTA structure, respectively.
- Shapes are colored to indicate the CDR having the greatest number of atoms contacted by the given residue with CDR colors defined in Figure 59.
- Secondary structural elements are as defined in the program MOE with yellow arrows representing ⁇ -strands and red rectangles indicating oc-helices.
- Figure 30 VSTBl 12 Paratope.
- (Top) VISTA antigen is shown in illustration and VSTBl 12 within 5 angstrom (A) of VISTA is shown in surface with colors used to designate CDR identity as specified in the sequence below.
- Figure 31 Comparison of epitope regions identified by crystallography and hydrogen deuterium exchange (HDX). Sequence of VISTA construct used in structure determination. Circles below the sequence are used to indicate residues which make only main chain contacts with VSTB l 12, triangles indicate a side chain contact, and squares indicate the side chain contact results in either a hydrogen bond or salt bridge interaction as calculated by PISA.
- HDX hydrogen deuterium exchange
- Figure 32 Activation of CD14+ monocytes in whole PBMC by
- VSTBl 74 (derived from VSTBl 12). In each part of the experiment, cells were incubated with PBS, IgGl control antibody, or VSTBl 74 at 1, 0.1 or 0.01 ug/ml. Left panel shows CD80 MFI; right panel shows HLA-DR MFI (two donors tested with representative results shown).
- Figure 33 Graph showing ADCC activity of VSTBl 74 directed against K562-VISTA cells.
- Figure 34 Graph showing ADCP activity of VSTBl 74 directed against K562-VISTA cells. Both antibodies depicted have the same Fab, but VSTBl 74 has an IgGl Fc and VSTBl 40 has Fc silent IgG2 .
- Figure 35 Graph showing phagocytosis mediated by VSTB 174,
- VSTB149 or VSTB 140 mAbs against K562-VISTA were tested with 7 half log doses, ranging from 0.0008 ⁇ g/ml to 0.56 ug/ml.
- Figure 36 Graph showing phagocytosis mediated by VSTB 174
- FIG. 37 MB49 tumor efficacy study evaluating VSTB 123 1, 5, 7.5, and 10 mg/kg in female VISTA-KI mice. Tumor volumes were approximately 50 mm 3 when dosing began at day 6 after implant.
- VSTB123 is the VSTB1 12 Fab grafted onto a mouse Fc scaffold and binds to human VISTA in the VISTA-KI mouse.
- Figure 38 Graph shows that CD 14+ cells expressing high/intermediate levels of VISTA are found in 13/13 lung cancer samples, as well as in distant lung tissue and peripheral blood of patients.
- Figure 39 IHC staining for VISTA in Lung Cancer using GG8.
- the present invention relates to antibodies to novel Immunoglobulin family ligand designated V-domain Immunoglobulin Suppressor of T cell Activation (VISTA) (Genbank: J 602184) (Wang et al., 2010, 2011).
- VISTA bears homology to PD-L1 but displays a unique expression pattern that is restricted to the hematopoietic compartment. Specifically, VISTA is constitutively and highly expressed on CD1 lb hlgh myeloid cells, and expressed at lower levels on CD4 + and CD8 + T cells.
- the human homologue shares approximately 85% homology with murine VISTA and has similar expression patterns (Lines et al., Cancer Research 74: 1924, 2014).
- VISTA expressed on antigen presenting cells (APCs) suppresses CD4 + and CD8 + T cell proliferation and cytokine production via a cognate receptor independent of PD- 1.
- APCs antigen presenting cells
- VISTA encephalomyelitis
- a VISTA specific monoclonal antibody enhanced T-cell dependent immune responses and exacerbated disease.
- VISTA over-expression on tumor cells impaired protective anti-tumor immunity in tumor-bearing hosts.
- Studies of human VISTA confirmed its suppressive function on human T cells (Lines et al Cancer Research 74: 1924, 2014,.
- Studies from Flies et al. also identified VISTA (named PD-1H) as a potent immune suppressive molecule (Flies et al., 201 1).
- VISTA is described in further detail in U.S. Published application US 20130177557 Al and U.S. Patent Nos. 7,919,585 and 8,236,304, all of which are incorporated herein by reference in their entirety.
- VISTA is a novel negative checkpoint regulator that suppresses immune responses. As described in Example 12 herein, treatment with a VISTA-specific monoclonal antibody in murine tumor models has been shown to reverse the suppressive character of the tumor immune microenvironment and enhance protective anti-tumor immunity, thus, demonstrating the potential of a VISTA monoclonal antibody as a novel therapeutic for cancer immunotherapy.
- antibody is meant to include polyclonal antibodies, monoclonal antibodies (mAbs), chimeric antibodies, humanized antibodies, human antibodies and anti-idiotypic (anti-Id) antibodies, as well as fragments, regions or derivatives thereof, provided by any known technique, such as, but not limited to, enzymatic cleavage, peptide synthesis or recombinant techniques.
- Anti-VISTA antibodies of the present invention are capable of binding portions of VISTA that modulate, regulate, or enhance an immune response. In some embodiments, the antibodies competitively inhibit one or more of the anti- VISTA antibodies described herein. Methods for determining whether two or more antibodies compete for binding to the same target are known in the art.
- a competitive binding assay can be used to determine whether one antibody blocks the binding of another antibody to the target.
- a competitive binding assay involves the use of purified target antigen (e.g., PD-1) bound either to a solid substrate or cells, an unlabeled test binding molecule, and a labeled reference binding molecule.
- purified target antigen e.g., PD-1
- Competitive inhibition is measured by determining the amount of label bound to the solid surface or cells in the presence of the test binding molecule. Usually the test binding molecule is present in excess. Typically, when a competing binding molecule is present in excess, it will inhibit specific binding of a reference binding molecule to a common antigen by at least 50-55%, 55-60%, 60-65%, 65-70%, 70- 75%o, or more. In some embodiments, competitive inhibition is determined using a competitive inhibition ELISA assay.
- Polyclonal antibodies are heterogeneous populations of antibody molecules derived from the sera of animals immunized with an antigen.
- a monoclonal antibody contains a substantially homogeneous population of antibodies specific to antigens, which population contains substantially similar epitope binding sites.
- Monoclonal antibodies may be obtained by methods known to those skilled in the art. See, for example Kohler and Milstein, Nature, 256:495-497 (1975); U.S. Pat. No. 4,376,1 10; Ausubel et al., eds., Current Protocols in Molecular Biology, Greene Publishing Assoc. and Wiley Interscience, N.Y., (1987, 1992); and Harlow and Lane ANTIBODIES: A Laboratory Manual Cold Spring Harbor Laboratory (1988);
- a hybridoma producing a monoclonal antibody of the present invention may be cultivated in vitro, in situ or in vivo.
- the invention also encompasses digestion fragments, specified portions and variants thereof, including antibody mimetics or comprising portions of antibodies that mimic the structure and/or function of an antibody or specified fragment or portion thereof, including single chain antibodies arid fragments thereof.
- Functional fragments include antigen-binding fragments that bind to a mammalian VISTA protein.
- antibody fragments capable of binding to VISTA or portions thereof including, but not limited to Fab (e.g., by papain digestion), Fab' (e.g., by pepsin digestion and partial reduction) and F(ab') 2 (e.g., by pepsin digestion), facb (e.g., by plasmin digestion), pFc' (e.g., by pepsin or plasmin digestion), Fd (e.g., by pepsin digestion, partial reduction and reaggregation), Fv or scFv (e.g., by molecular biology techniques) fragments, are encompassed by the invention (see, e.g., Colligan, Immunology, supra).
- Antibody fragments of the present invention also include those discussed and described in Aaron L. Nelson, mAbs 2: 1, 77-83 (January/February 2010), the contents of which are incorporated by reference in their entirety.
- Such fragments can be produced, for example, by enzymatic cleavage, synthetic or recombinant techniques, as known in the art and/or as described herein, antibodies can also be produced in a variety of truncated forms using antibody genes in which one or more stop codons have been introduced upstream of the natural stop site.
- a combination gene encoding a F(ab') 2 heavy chain portion can be designed to include DNA sequences encoding the CHI domain and/or hinge region of the heavy chain.
- the various portions of antibodies can be joined together chemically by conventional techniques, or can be prepared as a contiguous protein using genetic engineering techniques.
- the amino acid sequence of an immunoglobulin chain, or portion thereof has about 70-100% identity (e.g., 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91 , 92, 93, 94, 95, 96, 97, 98, 99, 100 or any range or value therein) to the amino acid sequence of the corresponding variable sequence chain described herein.
- identity e.g., 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91 , 92, 93, 94, 95, 96, 97, 98, 99, 100 or any range or value therein
- 70-100% amino acid identity (e.g., 85, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or any range or value therein) is determined using a suitable computer algorithm, as known in the art.
- the antibodies of the present invention can comprise any number of contiguous amino acid residues from an antibody of the present invention, wherein that number is selected from the group of integers consisting of from 10-100% of the number of contiguous residues in an anti-TNF antibody.
- this subsequence of contiguous amino acids is at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 1 10, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250 or more amino acids in length, or any range or value therein.
- the number of such subsequences can be any integer selected from the group consisting of from 1 to 20, such as at least 2, 3, 4, or 5.
- the present invention includes at least one biologically active antibody of the present invention.
- Biologically active antibodies have a specific activity at least 20%, 30%, or 40%, and preferably at least 50%, 60%, or 70%, and most preferably at least 80%, 90%, or 95%- 100% of that of the native (non-synthetic), endogenous or related and known antibody. Methods of assaying and quantifying measures of enzymatic activity and substrate specificity, are well known to those of skill in the art.
- Substantial similarity refers to a compound having at least 85% (e.g., at least 95%) identity and at least 85% (e.g., at least 95%) of activity of the native (non-synthetic), endogenous or related and known antibody.
- human antibody refers to an antibody in which substantially every part of the protein (e.g., CDR, framework, CL, CH domains (e.g., CHI, CH2, CH3), hinge, (VL, VH)) is substantially non- immunogenic in humans, with only minor sequence changes or variations.
- antibodies designated primate monkey, baboon, chimpanzee, and the like
- rodent mouse, rat, and the like
- other mammals designate such species, sub-genus, genus, sub-family, family specific antibodies.
- chimeric antibodies can include any combination of the above.
- a human antibody is distinct from a chimeric or humanized antibody. It is pointed out that a human antibody can be produced by a non-human animal or prokaryotic or eukaryotic cell that is capable of expressing functionally rearranged human immunoglobulin (e.g., heavy chain and/or light chain) genes. Further, when a human antibody is a single chain antibody, it can comprise a linker peptide that is not found in native human antibodies.
- an Fv can comprise a linker peptide, such as two to about eight glycine or other amino acid residues, which connects the variable region of the heavy chain and the variable region of the light chain.
- linker peptides are considered to be of human origin.
- Bispecific, heterospecific, heteroconjugate or similar antibodies can also be used that are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens. In the present case, one of the binding specificities is for at least one VISTA protein, the other one is for any other antigen.
- Methods for making bispecific antibodies are known in the art. The recombinant production of bispecific antibodies can be based on the co-expression of two immunoglobulin heavy chain-light chain pairs, where the two heavy chains have different specificities (Milstein and Cuello, Nature 305:537 (1983)). See also WO 93/08829, U.S. Pat. Nos. 6,210,668, 6,193,967, 6,132,992, 6,106,833,
- the invention relates to a bispecific antibody targeting VISTA and a second target protein (e.g., an immune checkpoint protein).
- exemplary bispecific anitbodies include a bispecific antibody targeting VISTA and PD-L1 and a bispecific antibody targeting VISTA and PD-L2.
- Human antibodies that are specific for human VISTA proteins or fragments thereof can be raised against an appropriate immunogenic antigen, such as VISTA protein or a portion thereof (including synthetic molecules, such as synthetic peptides).
- Immunogenic antigens preparation and monoclonal antibody production can be performed using any suitable technique.
- a hybridoma is produced by fusing a suitable immortal cell line (e.g., a myeloma cell line such as, but not limited to, Sp2/0, Sp2/0-AG14, NSO, NS1, NS2, AE-1, L.5, >243, P3X63Ag8.653, Sp2 SA3, Sp2 MAI, Sp2 SSI, Sp2 SA5, U937, MLA 144, ACT IV, MOLT4, DA-1, JURKAT, WEHI, K-562, COS, RAJI, NIH 3T3, HL-60, MLA 144, NAMAIWA, NEURO 2A, or the like, or heteromylomas, fusion products thereof, or any cell or fusion cell derived therefrom, or any other suitable cell line as known in the art, See, e.g., www.atcc.org, with antibody-producing cells.
- a suitable immortal cell line e.g., a myeloma cell line such as, but
- Antibody-producing cells can include isolated or cloned spleen, peripheral blood, lymph, tonsil, or other immune cells (e.g., B cells), or any other cells expressing heavy or light chain constant or variable or framework or complementarity determining region (CDR) sequences.
- Such antibody-producing cells can be recombinant or endogenous cells, and can also be prokaryotic or eukaryotic (e.g., mammalian, such as, rodent, equine, ovine, goat, sheep, primate),. See, e.g., Ausubel, supra, and Colligan, Immunology, supra, chapter 2, entirely incorporated herein by reference.
- Antibody producing cells can also be obtained from the peripheral blood or, preferably the spleen or lymph nodes, of humans or other suitable animals that have been immunized with the antigen of interest. Any other suitable host cell can also be used for expressing heterologous or endogenous nucleic acid encoding an antibody, specified fragment or variant thereof, of the present invention. Fused cells (hybridomas) or recombinant cells can be isolated using selective culture conditions or other suitable known methods, and cloned by limiting dilution or cell sorting, or other known methods. Cells which produce antibodies with the desired specificity can be selected by a suitable assay (e.g., enzyme-linked immunosorbent assay (ELISA)).
- ELISA enzyme-linked immunosorbent assay
- Suitable methods of producing or isolating antibodies of the requisite specificity can be used, including, but not limited to, methods that select recombinant antibody from a peptide or protein library (e.g., but not limited to, a bacteriophage, ribosome, oligonucleotide, RNA, cDNA, or the like, display library; e.g., as available from Cambridge antibody Technologies, Cambridgeshire, UK; MorphoSys, Martinsreid/Planegg, DE; Biovation, Aberdeen, Scotland, UK;
- a peptide or protein library e.g., but not limited to, a bacteriophage, ribosome, oligonucleotide, RNA, cDNA, or the like, display library; e.g., as available from Cambridge antibody Technologies, Cambridgeshire, UK; MorphoSys, Martinsreid/Planegg, DE; Biovation, Aberdeen, Scotland, UK;
- a humanized or engineered antibody has one or more amino acid residues from a source which is . non-human, e.g., but not limited to mouse, rat, rabbit, non-human primate or other mammal. These human amino acid residues are often referred to as "import" residues, which are typically taken from an "import" variable, constant or other domain of a known human sequence.
- Such imported sequences can be used to reduce immunogenicity or reduce, enhance or modify binding, affinity, avidity, specificity, half-life, or any other suitable characteristic, as known in the art.
- part or all of the non- human or human CDR sequences are maintained while part or all of the non-human sequences of the framework and/or constant regions are replaced with human or other amino acids.
- Antibodies can also optionally be humanized with retention of high affinity for the antigen and other favorable biological properties using three- dimensional immunoglobulin models that are known to those skilled in the art.
- Humanization or engineering of antibodies of the present invention can be performed using any known method, such as but not limited to those described in, for example, Winter (Jones et al., Nature 321 :522 (1986); Riechmann et al, Nature 332:323 (1988); Verhoeyen et al., Science 239:1534 (1988)), Sims et al., J.
- the anti-VISTA antibody can also be optionally generated by
- transgenic animal e.g., mouse, rat, rabbit, hamster, non-human primate, and the like
- a transgenic animal capable of producing a repertoire of human antibodies, as described herein and/or as known in the art.
- Cells that produce a human anti-VISTA antibody can be isolated from such animals and immortalized using suitable methods, such as the methods described herein.
- Transgenic animals that can produce a repertoire of human antibodies that bind to human antigens can be produced by known methods (e.g., but not limited to, U.S. Pat. Nos. 5,770,428, 5,569,825, 5,545,806, 5,625,126, 5,625,825, 5,633,425, 5,661,016 and 5,789,650 issued to Lonberg et al.; Jakobovits et al. WO 98/50433, Jakobovits et al. WO 98/24893, Lonberg et al. WO 98/24884, Lonberg et al. WO 97/13852, Lonberg et al.
- mice comprise at least one transgene comprising DNA from at least one human immunoglobulin locus that is functionally rearranged, or which can undergo functional rearrangement.
- the endogenous immunoglobulin loci in such mice can be disrupted or deleted to eliminate the capacity of the animal to produce antibodies encoded by endogenous genes.
- Screening antibodies for specific binding to similar proteins or fragments can be conveniently achieved using peptide display libraries.
- This method involves the screening of large collections of peptides for individual members having the desired function or structure.
- Antibody screening of peptide display libraries is well known in the art.
- the displayed peptide sequences can be from 3 to 5000 or more amino acids in length, frequently from 5-100 amino acids long, and often from about 8 to 25 amino acids long.
- several recombinant DNA methods have been described.
- One type involves the display of a peptide sequence on the surface of a bacteriophage or cell. Each bacteriophage or cell contains the nucleotide sequence encoding the particular displayed peptide sequence.
- Peptide display libraries, vector, and screening kits are commercially available from such suppliers as Invitrogen (Carlsbad, Calif), and Cambridge antibody
- Antibodies of the present invention can also be prepared using at least one anti-VISTA antibody encoding nucleic acid to provide transgenic animals, such as goats, cows, sheep, and the like, that produce such antibodies in their milk. Such animals can be provided using known methods. See, e.g., but not limited to, U.S. Pat. Nos. 5,827,690; 5,849,992; 4,873,316; 5,849,992; 5,994,616; 5,565,362;
- the anti-VISTA antibodies of the present invention can also be produced using transgenic plants, according to known methods. See also, e.g., Fischer et al., Biotechnol. Appl. Biochem. 30:99-108 (October, 1999), Cramer et al., Curr. Top. Microbol. Immunol. 240:95-118 (1999) and references cited therein; Ma et al., Trends Biotechnol. 13:522-7 (1995); Ma et al., Plant Physiol. 109:341-6 (1995); Whitelam et al., Biochem. Soc. Trans. 22:940-944 (1994); and references cited therein. Each of the above references is entirely incorporated herein by reference.
- the antibodies of the invention can bind human VISTA with a wide range of affinities (Ko).
- at least one human monoclonal antibody of the present invention can optionally bind human VISTA with high affinity.
- a human monoclonal antibody can bind human VISTA with a KD equal to or less than about 10 "7 M, such as but not limited to, 0.1-9.9 (or any range or value therein) x 10 "7 , 10 "8 , 10 "9 , 10 "10 , 10 "11 , 10 "12 , 10 "13 or any range or value therein.
- the antibody or antibody fragment can binds human VISTA with an affinity of at least lxl 0 "7 liter/mole, for example, at least 1 10 " liter/mole, for example, at least 1x10 " liter/mole liter/mole.
- the affinity or avidity of an antibody for an antigen can be determined experimentally using any suitable method.
- any suitable method See, for example, Berzofsky, et al, "Antibody-Antigen Interactions," In Fundamental Immunology, Paul, W. E., Ed., Raven Press: New York, N.Y. (1984); Kuby, Janis Immunology, W.H. Freeman and Company: New York, N.Y. (1992); and methods described herein).
- the measured affinity of a particular antibody-antigen interaction can vary if measured under different conditions (e.g., salt concentration, pH).
- affinity and other antigen-binding parameters e.g., K D , K a , 3 ⁇ 4 are preferably made with standardized solutions of antibody and antigen, and a standardized buffer.
- nucleic acid molecule of the present invention encoding at least one anti-VISTA antibody comprising all of the heavy chain variable CDR regions of SEQ ID NOS: 1 , 2 and 3 and/or all of the light chain variable CDR regions of SEQ ID NOS:4, 5 and 6 can be obtained using methods described herein or as known in the art.
- Nucleic acid molecules of the present invention can be in the form of RNA, such as mRNA, hnRNA, tRNA or any other form, or in the form of DNA, including, but not limited to, cDNA and genomic DNA obtained by cloning or produced synthetically, or any combinations thereof.
- the DNA can be triple- stranded, double-stranded or single-stranded, or any combination thereof. Any portion of at least one strand of the DNA or RNA can be the coding strand, also known as the sense strand, or it can be the non-coding strand, also referred to as the anti-sense strand.
- Isolated nucleic acid molecules of the present invention can include nucleic acid molecules comprising an open reading frame (ORF), for example, but not limited to, at least one specified portion of at least one CDR, as CDR1, CDR2 and/or CDR3 of at least one heavy chain or light chain; nucleic acid molecules comprising the coding sequence for an anti-VISTA antibody or fragment, e.g., a fragment comprising a variable region; and nucleic acid molecules which comprise a nucleotide sequence different from those described above but which, due to the degeneracy of the genetic code, still encode at least one anti-VISTA antibody as described herein and/or as known in the art.
- ORF open reading frame
- nucleic acid variants that code for specific anti- VISTA antibodies of the present invention. See, e.g., Ausubel, et al., supra, and such nucleic acid variants are included in the present invention.
- nucleic acid molecules of the present invention which comprise a nucleic acid encoding an anti- VISTA antibody can include, but are not limited to, those encoding the amino acid sequence of an antibody fragment; the coding sequence for the entire antibody or a portion thereof; the coding sequence for an antibody, fragment or portion, as well as additional sequences, such as the coding sequence of at least one signal leader or fusion peptide, with or without the aforementioned additional coding sequences, such as at least one intron, together with additional, non-coding sequences, including but not limited to, non-coding 5' and 3' sequences, such as the transcribed, no n- translated sequences that play a role in transcription, mRNA processing, including splicing and polyadenylation signals (for example—ribosome binding and stability of mRNA); an additional coding sequence that codes for additional amino acids, such as those that provide additional functionalities.
- the sequence encoding an antibody can be fused to a marker sequence, such as
- Human genes which encode the constant (C) regions of the antibodies, fragments and regions of the present invention can be derived from a human fetal liver library, by known methods.
- Human C regions genes can be derived from any human cell including those which express and produce human immunoglobulins.
- the human CH region can be derived from any of the known classes or isotypes of human H chains, including ⁇ , ⁇ , ⁇ , ⁇ or ⁇ and subtypes thereof, such as Gl, G2, G3 and G4. Since the H chain isotype is responsible for the various effector functions of an antibody, the choice of CH region will be guided by the desired effector functions, such as complement fixation, or activity in antibody-dependent cellular cytotoxicity (ADCC).
- ADCC antibody-dependent cellular cytotoxicity
- compositions disclosed herein are prepared in accordance with standard procedures and are administered at dosages that are selected to treat, e.g., reduce, prevent, or eliminate, or to slow or halt the progression of, the condition being treated (See, e.g., Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton, PA, and Goodman and Gilman's The Pharmaceutical Basis of Therapeutics, McGraw-Hill, New York, N.Y., the contents of which are incorporated herein by reference, for a general description of the methods for administering various agents for human therapy).
- the compositions comprising the disclosed antibodies and agents can be delivered using controlled or sustained-release delivery systems (e.g. , capsules, biodegradable matrices).
- pharmaceutically acceptable carriers can be solid or liquid.
- Solid form preparations include powders, tablets, pills, capsules, cachets, suppositories, and dispersible granules.
- the compounds of the present invention can be in powder form for reconstitution at the time of delivery.
- a solid carrier can be one or more substances which can also act as diluents, flavoring agents, solubilizers, lubricants, suspending agents, binders, preservatives, tablet disintegrating agents, or an encapsulating material.
- the carrier is a finely divided solid which is in a mixture with the finely divided active ingredient.
- the powders and tablets preferably contain from about one to about seventy percent of the active ingredient.
- Suitable carriers are magnesium carbonate, magnesium stearate, talc, sugar, lactose, pectin, dextrin, starch, gelatin, tragacanth, methylcellulose, sodium caboxymethylcellulose, a low-melting wax, cocoa butter, and the like. Tablets, powders, cachets, lozenges, fast-melt strips, capsules and pills can be used as solid dosage forms containing the active ingredient suitable for oral administration.
- Liquid form preparations include solutions, suspensions, retention enemas, and emulsions, for example, water or water propylene glycol solutions.
- liquid preparations can be formulated in solution in aqueous polyethylene glycol solution.
- the pharmaceutical composition can be in unit dosage form.
- the composition is subdivided into unit doses containing appropriate quantities of the active ingredient.
- the unit dosage form can be a packaged preparation, the package containing discrete quantities of unit doses.
- the dosages can be varied depending upon the requirements of the patient, the severity of the condition being treated, the compound and the route of administration being employed.
- the pharmaceutical composition can contain, if desired, other compatible agents, e.g., pharmaceutical, therapeutic or prophylactic agents.
- Therapeutic or prophylactic agents include, but are not limited to, peptides, polypeptides, proteins, fusion proteins, nucleic acid molecules, small molecules, mimetic agents, synthetic drugs, inorganic molecules, and organic molecules.
- agents include, but are not limited to, cytotoxins, angiogenesis inhibitors, immunomodulatory agents, immuno- oncology agents, and agents used to provide relief from pain or to offset the deleterious effects of one or more therapeutic agents (e.g., bisphosphonate use to reduce the hypercalcemic effects of glucocorticoids).
- Angiogenesis inhibitors, agents and therapies that are suitable for use in the compositions and methods described herein include, but are not limited to, angiostatin (plasminogen fragment); antiangiogenic antithrombin III; angiozyme.
- Bisphosphonates include, but are not limited to, alendronate, clodronate, etidronate, ibandronate, pamidronate, risedronate, tiludronate, and zoledronate.
- Immunomodulatory agents and therapies that are suitable for use in the compositions and methods described herein include, but are not limited to, anti-T cell receptor antibodies such as anti-CD3 antibodies (e.g. Nuvion (Protein Design Labs), OKT3 (Johnson & Johnson), or anti-CD20 antibodies Rituxan (IDEC)), anti- CD52 antibodies (e.g. CAMPATH 1H (Ilex)), anti-CD 1 la antibodies (e.g. Xanelim (Genentech)); anti-cytokine or anti-cytokine receptor antibodies and antagonists such as anti-IL-2 receptor antibodies (Zenapax (Protein Design Labs)), anti-IL-6 receptor antibodies (e.g. MRA (Chugai)), and anti-IL-12 antibodies
- anti-CD3 antibodies e.g. Nuvion (Protein Design Labs), OKT3 (Johnson & Johnson), or anti-CD20 antibodies Rituxan (IDEC)
- anti- CD52 antibodies e.g. CAMPATH 1H (Ile
- CNT01275(Janssen) anti-TNFalpha antibodies
- Remicade(Janssen) or TNF receptor antagonist
- Enbrel (Immunex) anti-IL-6 antibodies
- BE8 Diaclone
- siltuximab CNT032 (Centocor)
- antibodies that immunospecifically bind to tumor-associated antigens e.g., trastuzimab (Genentech)
- Immuno-oncology agents that are suitable for use in the compositions and methods described herein include, but are not limited to, ipilimumab (anti- CTLA-4), nivolumab (anti-PD-1), pembrolizumab (anti-PD-1), anti-PD-Ll antibodies, and anti-LAG-3 antibodies.
- composition is preferably made in the form of a dosage unit containing a therapeutically effective amount of the antibody or fragment.
- dosage units are tablets and capsules.
- the tablets and capsules can contain, in addition to the active ingredient, conventional carriers such as binding agents, for example, acacia gum, gelatin,
- polyvinylpyrrolidone, sorbitol, or tragacanth fillers, for example, calcium phosphate, glycine, lactose, maize-starch, sorbitol, or sucrose; lubricants, for example, magnesium stearate, polyethylene glycol, silica, or talc; disintegrants, for example potato starch, flavoring or coloring agents, or acceptable wetting agents.
- Oral liquid preparations generally in the form of aqueous or oily solutions, suspensions, emulsions, syrups or elixirs can contain conventional additives such as suspending agents, emulsifying agents, non-aqueous agents, preservatives, coloring agents and flavoring agents.
- additives for liquid preparations include acacia, almond oil, ethyl alcohol, fractionated coconut oil, gelatin, glucose syrup, glycerin, hydrogenated edible fats, lecithin, methyl cellulose, methyl or propyl parahydroxybenzoate, propylene glycol, sorbitol, or sorbic acid.
- a clinician can determine the suitable dosage and route of administration for a particular antibody, fragment or composition for administration to an individual, considering the agents chosen, pharmaceutical formulation and route of administration, various patient factors and other considerations.
- the dosage does not cause or produces minimal or no adverse side effects.
- a pharmacological agent may be administered on a dosage schedule that is designed to maintain a predetermined or optimal plasma concentration in the subject undergoing treatment.
- the antibodies, fragments and compositions can be added at any appropriate dosage ranges or therapeutically effective amount, for example, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.7 mg/kg, 0.8 mg/kg, 0.9 mg/kg, 1.0 mg/kg, 1.5 mg/kg, 2.0 mg/kg, 2.5 mg/kg, 3.0 mg/kg, 4.0 mg/kg, 5.0 mg/kg, 6.0 mg/kg, 7.0 mg/kg, 8.0 mg/kg, 9.0 mg/kg, 10.0 mg/kg, 11.0 mg/kg, 12.0 mg/kg, 13.0 mg/kg, 14.0 mg/kg, 15.0 mg/kg, 16.0 mg/kg, 17.0 mg/kg, 18.0 mg/kg, 19.0 mg/kg, 20.0 mg/kg, 30 mg/kg, 40 mg/kg, 50 mg/kg 60 mg/kg, 70 mg/kg, 80 mg/kg, 90 mg/kg and 100 mg/kg.
- the antibody or fragment can be administered once, at least once, twice, at least twice, three times, or at least three times per day.
- the antibody or fragment can be administered once, at least once, twice, at least twice, three times, at least three times, four times, at least four times, five times, at least five times, six times per week, or at least six times per week.
- the antibody or fragment can be administered once per month, at least once per month, twice per month, at least twice per month, three times per month or at least three times per month.
- the antibody or antibody fragment can be administered once per year, at least once per year, twice per year, at least twice per year, three times per year, at least three times per year, four times per year, at least four times per year, five times per year, at least five times per year, six times per year or at least six times per year.
- the anti- VISTA antibodies, fragments and compositions can, for example, be administered through parenteral or nonparenteral means, including, but not limited to, intravenously, subcutaneously, orally, rectally, intramuscularly, intraperitoneally, transmucosally, transdermally, intrathecally, nasally, or topically.
- parenteral or nonparenteral means including, but not limited to, intravenously, subcutaneously, orally, rectally, intramuscularly, intraperitoneally, transmucosally, transdermally, intrathecally, nasally, or topically.
- dosage forms can comprise as the active ingredient, either compounds or a corresponding
- the dosage forms can comprise as the active ingredient, either a compound or a corresponding pharmaceutically acceptable salt of a compound.
- the anti-VISTA antibodies of the invention can be administered as part of a combination therapy (e.g., with each other, or with one or more other therapeutic agents).
- the compounds of the invention can be administered before, after or concurrently with one or more other therapeutic agents.
- a compound of the invention and other therapeutic agent can be coadministered simultaneously (e.g., concurrently) as either separate formulations or as a joint formulation.
- the agents can be administered sequentially, as separate compositions, within an appropriate time frame, as determined by the skilled clinician (e.g., a time sufficient to allow an overlap of the pharmaceutical effects of the therapies).
- a compound of the invention and one or more other therapeutic agents can be administered in a single dose or in multiple doses, in an order and on a schedule suitable to achieve a desired therapeutic effect.
- the present invention also provides a method for modulating or treating at least one malignant disease in a cell, tissue, organ, animal or patient.
- the compounds and compositions of the present invention are used to treat or prevent cancer.
- Cancer can include any malignant or benign tumor of any organ or body system.
- Examples include, but are not limited to, the following: breast, digestive/gastrointestinal, endocrine, neuroendocrine, eye, genitourinary, germ cell, gynecologic, head and neck, hematologic/blood, musculoskeletal, neurologic, respiratory/thoracic, bladder, colon, rectal, lung, endometrial, kidney, pancreatic, liver, stomach, testicular, esophageal, prostate, brain, cervical, ovarian and thyroid cancers.
- Other cancers can include leukemias, melanomas, and lymphomas, and any cancer described herein.
- the solid tumor is infiltrated with myeloid and/or T-cells.
- the cancer is a leukemia, lymphoma, myelodysplastic syndrome and/or myeloma.
- the cancer can be any kind or type of leukemia, including a lymphocytic leukemia or a myelogenous leukemia, such as, e.g., acute
- the lymphoblastic leukemia ALL
- chronic lymphocytic leukemia CLL
- acute myeloid myelogenous
- AML acute myeloid leukemia
- CML chronic myelogenous leukemia
- hairy cell leukemia T-cell prolymphocytic leukemia, large granular lymphocytic leukemia, or adult T-cell leukemia.
- the lymphoma is a histocytic lymphoma, follicular lymphoma or Hodgkin lymphoma
- the cancer is a multiple myeloma.
- the cancer is a solid tumor, for example, a melanoma, or bladder cancer.
- the cancer is a lung cancer, such as a non-small cell lung cancer (NSCLC).
- NSCLC non-small cell lung cancer
- the present invention also provides a method for modulating or treating at least one malignant disease in a cell, tissue, organ, animal or patient, including, but not limited to, at least one of: leukemia, acute leukemia, acute lymphoblastic leukemia (ALL), B-cell, T-cell or FAB ALL, acute myeloid leukemia (AML), chronic myelocytic leukemia (CML), chronic lymphocytic leukemia (CLL), hairy cell leukemia, myelodysplastic syndrome (MDS), a lymphoma, Hodgkin's disease, a malignant lymphoma, non-hodgkin's lymphoma, Burkitt's lymphoma, multiple myeloma, Kaposi's sarcoma, colorectal carcinoma, pancreatic carcinoma, nasopharyngeal carcinoma, malignant histiocytosis, paraneoplastic
- the solid tumor is infiltrated with myeloid and/or T-cells.
- the solid tumor is a lung cancer, such as a non-small cell lung cancer (NSCLC).
- NSCLC non-small cell lung cancer
- the compounds and therapies described herein are co-administered with a vaccine (such as a viral vector vaccine, bacterial vaccine, cell-based vaccine, DNA vaccine, RNA vaccine, peptide vaccine, or protein vaccine).
- a vaccine such as a viral vector vaccine, bacterial vaccine, cell-based vaccine, DNA vaccine, RNA vaccine, peptide vaccine, or protein vaccine.
- Such vaccines are well known in the art. See, e.g., Jeffrey Schlom, "Therapeutic Cancer Vaccines: Current Status and Moving Forward," J Natl Cancer Inst; 104:599-613 (2012), the contents of which are incorporated herein in their entirely.
- the compounds and therapies described herein are co-administered with agents for chemotherapy, hormone therapies and biological therapies, and/or bisphosphonates.
- the agent(s) for chemotherapy include one or more of the following: arboplatin (Paraplatin), cisplatin (Platinol, Platinol-AQ), cyclophosphamide (Cytoxan, Neosar), doxorubicin (Adriamycin), etoposide (VePesid), fluorouracil (5-FU), gemcitabine (Gemzar), irinotecan (Camptosar), paclitaxel (Taxol), topotecan (Hycamtin), vincristine (Oncovin, Vincasar PFS), vinblastine (Velban).
- the anti-VISTA compounds and therapies described herein are co-administered with one or more immune checkpoint antibodies, such as, for example, nivolumab, pembrolizumab, tremelimumab, ipilimumab, anti-PD-Ll antibody, anti-PD-L2 antibody, anti-TIM-3 antibody, anti- LAG-3v, anti-OX40 antibody and anti-GITR antibody.
- immune checkpoint antibodies such as, for example, nivolumab, pembrolizumab, tremelimumab, ipilimumab, anti-PD-Ll antibody, anti-PD-L2 antibody, anti-TIM-3 antibody, anti- LAG-3v, anti-OX40 antibody and anti-GITR antibody.
- the anti-VISTA compounds and therapies described herein are co-administered with a small molecule inhibitor of indoleamine 2,3-dioxygenase (IDO).
- IDO indoleamine 2,3-dioxygenase
- the anti-VISTA compounds and composition of the invention may be administered to a subject in need thereof to prevent (including preventing the recurrence of cancer) or treat (e.g., manage or ameliorate a cancer or one or more symptoms thereof) cancer.
- Any agent or therapy e.g., chemotherapies, radiation therapies, targeted therapies, such as imatinib, sorafenib and vemurafenib, hormonal therapies, and/or biological therapies or immunotherapies
- chemotherapies e.g., radiation therapies, targeted therapies, such as imatinib, sorafenib and vemurafenib, hormonal therapies, and/or biological therapies or immunotherapies
- Anti-cancer agents but not limited to: 5-fluoruracil; acivicin; aldesleukin; altretamine; aminoglutethimide; amsacrine; anastrozole; anthramycin; asparaginase; azacitidine; azetepa; azotomycin; batimastat; bicalutamide; bleomycin sulfate; brequinar sodium; bropirimine; busulfan; carboplatin; carmustine; carubicin hydrochloride; carzelesin; cedefingol; chlorambucil; cirolemycin; cisplatin;
- dactinomycin dactinomycin
- daunorubicin hydrochloride decitabine
- dexormaplatin dezaguanine
- dezaguanine mesylate diaziquone
- docetaxel docetaxel
- doxorubicin doxorubicin
- epipropidine epirubicin hydrochloride
- erbulozole esorubicin hydrochloride
- estramustine estramustine phosphate sodium; etanidazole; etoposide; etoposide phosphate; trasrabine; fenretinide; floxuridine; fludarabine phosphate; fluorouracil; flurocitabine; fosquidone; fostriecin sodium; gemcitabine; gemcitabine
- interleukin II including recombinant interleukin II, or rIL2
- interferon alpha-2a interferon alpha-2b
- interferon alpha-m interferon alpha-n3
- interferon beta-I a interferon gamma-I b
- iproplatin irinotecan hydrochloride
- lanreotide acetate iproplatin
- irinotecan hydrochloride lanreotide acetate
- letrozole leuprolide acetate; liarozole hydrochloride; lometrexol sodium; lomustine; losoxantrone hydrochloride; masoprocol; mechlorethamine hydrochloride; megestrol acetate; melengestrol acetate; melphalan; menogaril; mercaptopurine; methotrexate; methotrexate sodium; metoprine; meturedepa; mitomycin; mitosper; mitotane;
- mitoxantrone hydrochloride mycophenolic acid; nocodazole; ormaplatin; paclitaxel; pegaspargase; porfromycin; prednimustine; procarbazine hydrochloride; puromycin; rogletimide; safingol hydrochloride; semustine; pumprazene; sparfosate sodium; sparsomycin; spiromustine; spiroplatin; streptonigrin; streptozocin; sulofenur;
- talisomycin tegafur; teloxantrone hydrochloride; temoporfm; teniposide; teroxirone; testolactone; thiamiprine; thioguanine; thiotepa; tiazofurin; tirapazamine; topotecan; trimetrexate; trimetrexate glucuronate; triptorelin; uracil mustard; uredepa;
- Targeted therapies include, but are not limited to, tyrosine kinase inhibitors (e.g., imatinib, sorafenib, and vemurafenib).
- the invention also encompasses administration of an anti- VISTA compound of the invention in combination with radiation therapy comprising the use of x-rays, gamma rays and other sources of radiation to destroy the cancer cells. Cancer treatments are known in the art and have been described in such literature as the Physician's Desk
- anti-VISTA antibodies described herein are also useful, for example, in the treatment of chronic infectious diseases, such as HIV, HBV, HCV, and HSV, among others.
- Tables 1 A, IB and 2 herein Various properties and sequence information for select anti-VISTA antibodies of the invention are provided in Tables 1 A, IB and 2 herein. [00126] Table 1 A: CDR Sequences of Select Fully Human or Humanized anti- human VISTA antibodies
- VSTBSO B (SEQIDNO:l) NO:2) (SEQIDNO:3) (SEQIDN0:4) N0:5) (SEQIDIM0:6)
- Table IB Heavy and Light Chain Sequences of Select Fully Human or Humanized anti-human VISTA antibodies
- KSLSLSPG (SEQ ID O:53) VSTB112 QVQLVQSGAEV PGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEW DIQMTQSPSSLSASVGDRVTITCRASQSIDT
- EXAMPLE 1 ANALYSIS OF VISTA EXPRESSION ON HUMAN HEMATOPOIETIC CELLS
- Blood was diluted 1 : 1 in sterile PBS. 22 ml diluted cord blood was layered onto 20ml sterile Ficoll-Hypaque (GE Healthcare Cat# 17-144003) in 50 ml conical tubes. Tubes were centrifuged at 1800 rpm for 20 minutes at room temperature. Mononuclear cells at the interface following centrifugation were harvested using a 1 ml pipettor and combined into two 50 ml conical tubes. Sterile PBS was added to each tube to make the volume up to 50 ml and the cells were centrifuged at 300g for 10 minutes at 4°C. Supernatant was discarded.
- Cells were resuspended in 50 ml of sterile PBS and tubes were spun at 300g for 10 minutes at 4°C. Supernatant was discarded. Cells were combined and resuspended in 50 ml sterile PBS prior to counting.
- Staining Protocol A frozen vial containing 5x10 PBMCs was used for compensation controls and as a control for staining.
- FACS Stain Buffer from BD Biosciences (Cat# 554657) supplemented with 0.2% EDTA; Phosphate-Buffered saline (PBS) (Gibco cat#14190); 96-well polypropylene round-bottomed plate (BD #3077); 1.2 ml polypropylene cluster tubes (Corning #4451); biotinylated Anti-VISTA clone GA-1 from ImmunoNext Lot# 080612B (used, at 5 ⁇ g/ml); biotinylated mlgGl, K isotype control (Clone MOPC-21); Biolegend cat#400104, Lot#Bl 16649 (used at 5 g/ml); anti-human antibodies (See staining table below); near-Infrared live/dead dye (Invitrogen, cat# LI 01 19); and streptavidin reagents including STP-APC (BD Biosciences cat#554067,
- lxlO 6 cells Prior to staining, lxlO 6 cells were transferred into 96-well round- bottomed plates and were washed with 150 ⁇ PBS. Plates were then centrifuged at 1300 rpm at 4°C for 3 minutes. [00142] Subsequently, cells were washed again in PBS and centrifuged as described above.
- Live/dead staining was then performed in 50 ⁇ PBS containing 0.25 ⁇ of near- infrared live/dead dye. After 10 minutes at room temperature the wells were washed with 150 ⁇ FACs staining buffer and centrifuged at 1300 rpm at 4°C for 3 minutes. Supernatant was discarded.
- a cocktail containing the following antibodies was then added to each well for surface staining: The cocktails are described in Tables 3-6 below. Each cocktail would be utilized separately from the others depending on the populations of interest.
- Flow cytometry data was reanalyzed using FlowJo Version 9 software to gate specific phenotypic populations. Enumeration of geometric mean was used to compare VISTA expression in different cell subsets. Each population was normalized for background by subtracting isotype control values from the mean values of the anti-VISTA treated samples. Graphs were prepared in Prism and statistics were performed using either student's T-test if only two samples were compared, or one-way ANOVA with Bonferroni post-tests.
- VISTA expression on CD14 + monocytes was significantly different from all other populations (p ⁇ 0.001). No significant differences between other populations were seen. Monocytes expressed the highest levels of VISTA in peripheral blood, with the CD14 + CD16 " subset having significantly higher expression than CD14 lo CD16 + cells. While APCs showed moderate expression of VISTA, lymphoid subsets showed low expression levels.
- CD56 10 cells exhibited significantly higher expression levels of VISTA than CD56 Hl NK cells.
- CD8 + memory cells expressed the highest expression levels, although they are not significantly higher than CD8 + naive or CD4 + T cells.
- EXAMPLE 2 VISTA EXPRESSION ON PERIPHERAL BLOOD CELLS
- PBMCs peripheral blood mononuclear cells
- the antibodies used were CD1 lb, CD33, CD177, CD16, CD15, CD14, CD20, HLADR, CD3, CD4, CD8, CD 127, CD69, and FOXP3 antibodies
- the APC-conjugated mouse anti-human VISTA (clone GG8) was made by ImmuNext (Lebanon, NH).
- VISTA expression was analyzed for VISTA expression using multicolor flow cytometry. As shown in Fig. 15 A and 15B, the highest level of VISTA expression was detected on monocytes followed by neutrophils. Both the CD4+ and CD8+ T cells expressed low level of VISTA as shown in Figure 13C and 13D.
- FIG. 14A-C peripheral blood mononuclear cells (PBMCs) from lung cancer patients were analyzed.
- Figure 14A is a representative flow plot showing analysis of CD14 + monocytes and CD15 + myeloid derived suppressive cells (MDSCs). The results suggest that phenotypically CD15 + cells are neutrophil derived MDSCs. Additionally, these cells are absent in healthy blood samples.
- Figure 14B is a representative histogram of VISTA expression on healthy and cancer patient derived monocytes, suggesting a higher level of VISTA expression on cancer patient cells compared to healthy controls. Similarly higher level of VISTA was found on MDSCs in cancer patients, as shown in Figure 14C.
- Figure 15 A is a representative FACS plot showing the presence of neutrophil derived MDSCs in the blood of colon cancer patients.
- Figure 15B and 15C are representative histograms showing higher level of VISTA expression on cancer patients' monocytes compare to healthy donor blood samples.
- VISTA is expressed in heme malignancies
- an anti- VISTA antibody could potentially target the malignant cells for destruction, as well as block VISTA and promote anti-tumor immune responses.
- the data includes RNAseq analysis of -140 heme malignancy cell lines (some cell lines are repeated in the analysis). The data is shown in Figure 17.
- RNAseq values are listed as FPKM (Fragments Per Kilobase of exon per Million fragments mapped) values.
- RNA level primarily acute myeloid leukemias and chronic myelogenous leukemias. This may be expected since VISTA is highly expressed in normal myeloid cells, and because its function is believed to dampen immune responses, including anti-tumor immune responses.
- EXAMPLE 4 GENERATION OF MONOCLONAL ANTIBODIES AGAINST VISTA
- phage panning experiments were carried out to enrich for phage reactive to Cyno VISTA-His.
- the cynomolgus VISTA protein was used for these experiments as it showed better biotin conjugation than the human VISTA protein.
- phage pools from the individual panning rounds were added to neutravidin plates coated with biotinylated cyno VISTA-His and detected with a HRP-conjugated anti-M13 antibody.
- VH and VL regions from the Fab plates were amplified, submitted for DNA sequencing and were exported as FASTA files.
- the clones were chosen based on sequence diversity as well as having limited post-translational modification risks and as few hydrophobic residues as possible.
- VH and VL from the phage clones were sub-cloned into mammalian IgGl /kappa expression vectors and transfected into HEK293 cells.
- the antibodies were purified on Protein A Sepharose Fast Flow affinity resin.
- concentration of the phage MABs was determined by quantitative ELISA using Nanodrop measurements, The antibody panel was expressed at high levels. SDS-PAGE analysis demonstrated the integrity of each expressed antibody variant.
- In-line maturation of the phage antibodies was done by amplifying the VH domains from the polyclonal antibody mixes from the last round of panning for cloning into phage vectors that have diversity in the VL. This resulted in an enriched VH pool which was sampled with additional diversity in the VL.
- the phage were taken through 1-2 rounds of stringent panning with the expectation to identify very high affinity binders to VISTA ECD His protein.
- a monoclonal Fab ELISA was run to determine the success of the maturation.
- ELISA and expression data was normalized to a reference clone set to 100% from the original de novo panning experiment and affinity matured clones with higher binding signal to cyno VISTA antigen than the reference clone were identified. This process generated several clones that demonstrated up to 200% binding when screened at low antigen concentration (1 nM), the clones with highest affinity were sequenced and produced as MABs.
- mice received one intraperitoneal (IP) injection of 50 ⁇ g Hu VISTA-Ig recombinant protein (Sino) emulsified in Complete Freund's Adjuvant followed two weeks later by one IP injection of 50 ⁇ g Hu VISTA-Ig recombinant protein emulsified in Incomplete Freund's Adjuvant. Two weeks later the mice received one IP injection of 50 ⁇ g cyno VISTA-Fc recombinant protein emulsified in Incomplete Freund's Adjuvant. All mice received a final injection of 25 ⁇ g human and 25 ⁇ g cyno VISTA at the base of tail in PBS, five days prior to splenic harvest for fusion.
- IP intraperitoneal
- mice received one IP injection of 50 g Hu VISTA-His recombinant protein emulsified in Complete Freund's Adjuvant. Two weeks later the mice received one IP injection of 50 g Hu VISTA-His recombinant protein emulsified in Incomplete Freund's Adjuvant. Two weeks later the mice received one IP injection of 50 g Cyno VISTA-His recombinant protem emulsified in Incomplete Freund's Adjuvant. Two weeks later all mice received a final injection of 25 ⁇ g Hu VISTA-His and 25 ⁇ g Cyno VISTA-His in PBS, three days prior to splenic harvest for fusion.
- mice were euthanized by C02 asphyxiation, the spleens were removed and placed into 10 mL of cold phosphate-buffered saline.
- a single cell suspension of splenocytes was prepared by grinding spleens through a fine mesh screen with a small pestle and rinsing with PBS at room temperature. Cells were washed once in PBS and subjected to RBC lysis. Briefly, cells were resuspended in 3mL of RBC lysis buffer (Sigma #R7757) per every spleen and placed on ice for 5 minutes. Cells were again washed once in PBS at room temperature and labeled for magnetic sorting.
- cells were labeled with anti-murine Thyl .2, anti-murine CD1 lb and anti-murine IgM magnetic beads (Miltenyi Biotec # 130-049-101, 130-049-601 and 130-047-301 respectively) then sorted using a MS column with a Midi MACS. The negative cell fractions (positive cell fractions were discarded) were fused to FO cells. Fusion was carried out at a 1 : 1 ratio of murine myeloma cells to viable spleen cells. Briefly, spleen and myeloma cells were mixed together, pelleted and washed once in 50 mL of PBS.
- the pellet was resuspended with 1 mL of polyethylene glycol (PEG) solution (2 g PEG molecular weight 4000, 2 mL DMEM, 0.4 mL DMSO) per 10e8 splenocytes at 37°C for 30 seconds.
- PEG polyethylene glycol
- the cell/fusion mixture was then immersed in a 37°C water bath for approximately 60 seconds with gentle agitation.
- the fusion reaction was stopped by slowly adding 37°C DMEM over 1 minute.
- the fused cells were allowed to rest for 5 minutes at room temperature and then centrifuged at 150 x g for 5 minutes.
- a capture EIA was used to screen hybridoma supernatants for antibodies specific for cyno VISTA. Briefly, plates (Nunc-Maxisorp #446612) were coated at 4 ⁇ g/ml for at least 60 minutes with goat anti-mouse IgG (Fc) antibody (Jackson #1 15-006-071) in coating buffer (Thermo 28382). Plates were blocked with 200 ⁇ /well of 0.4% (w/v) bovine serum albumin (BSA) in PBS at for 30 minutes at RT. Plates were washed once and 50 ⁇ /well of hybridoma supernatant was added and incubated at room temperature for at least 30 minutes.
- BSA bovine serum albumin
- Plates were washed once and 50 ⁇ /well of 0.1 ⁇ g/mL of cyno VISTA-huIg was added and incubated at RT for 30 minutes. Plates were washed once and 1 :40,000 Streptavidin HRP (Jackson 016- 030-084) in 0.4% BSA/PBS was added to plates and incubated for 30 minutes at RT. Plates were washed 3x and subsequently developed using ⁇ /well TMB Turbo substrate (Thermo Scientific 34022) incubating approximately 10 minutes at RT. The reaction was stopped using 25 ⁇ 1 ⁇ 11 4N Sulfuric Acid and absorbance was measured at 450 nm using an automated plate spectrophotometer. Fifteen of the primary hits were selected for subcloning by limiting dilution and were screened in the same primary screen format.
- Hybridoma cells were prepared prior to the reverse transcriptase (RT) reactions with Invitrogen's Superscript III cells Direct cDNA System. Briefly, the culture medium was discarded and the plate placed on ice and resuspended in 200 ⁇ cold PBS. Forty microliters was transferred to a MicroAmp fast 96 well Reaction PCR plate and the plate was placed on a cold metal plate base, sealed with plastic film and spun at 700 rpm for 3 minutes. The PBS was discarded and to each well, 10 ⁇ Resuspension Buffer and 1 ⁇ Lysis Enhancer was added. The plate was sealed and incubated at 75°C for 10 min and stored at -80°C.
- each well contained 5 ⁇ water, 1.6 ⁇ 10X DNase Buffer, 1.2 ⁇ 50 mM EDTA, 2 ⁇ Oligo(dT)20 (50 mM) and 1 ⁇ 10 mM dNTP Mix.
- the plate was incubated at 70°C for 5 min, followed by incubation on ice for 2 min, then the following reagents were added for each well; 6 ⁇ 5X RT Buffer, ⁇ RNaseOUTTM (40 U/ ⁇ ), 1 ⁇ SuperscriptTM III RT (200 U/ ⁇ ) and 1 ⁇ of 0.1 M DTT.
- the plate was sealed and placed on a thermal cycler preheated to 50°C and incubated at 50°C for 50 minutes, followed by inactivation (5 min incubation at 85°C). The reaction was chilled on ice and the single-stranded cDNA was stored at - 80°C until further use.
- Steps (ii - iv) were repeated for a total of 35 cycles followed by a final extension at 68°C for 3 min. for VL the program was (i) 94°C for 1 min (ii) 94°C for 15 sec (iii) 55°C for 30 sec (iv) 65°C for 30 sec, (v) 68°C for 1 min. Steps (ii - v) were repeated for a total of 35 cycles followed by a final extension at 68°C for 3 min. [00195] Forward primers were pre-mixed and such mixture was used in ration 3 : 1 with the reverse primer. PCR products were verified on an agarose gel.
- the reactions were prepared for infusion cloning by the addition of Enhancer (In-Fusion HC Cloning Kit, cat #639650, Clontech). Five microliters of the PCR reaction was transferred to a PCR plate followed by the transfer of 2 ⁇ of enhancer/well. The plate was sealed and incubated in a thermal cycler (15 min at 37°C and 15 min at 80°C).
- the destination vector (vDR243 or vDR301) was prepared by Esp3I digestion; (l ⁇ g vector was digested in 3 ⁇ Tango Buffer, 2 1 Esp3I and water in a 30 ⁇ reaction at 37°C for 2 hours).
- V regions were sequenced using sequencing primer SPF0052. The sequences were analyzed, one positive well per hybridoma vH and vL was chosen, re-arrayed in new plates and grown overnight in rich medium with ampicillin. Clones then had miniprep DNA prepared for small scale
- Mouse A20 cells were stably transfected with either GFP or human VISTA. They were incubated with ova peptide and with DO 11.10 T cells. CD25 expression by the T cells was measured 24 hours after incubation began. The A20- huVISTA cells suppress CD25 expression by the T cells, but this readout is significantly restored by incubation with VSTB95 ( Figure 18).
- EXAMPLE 6 HUMAN FRAMEWORK REGIONS ADAPTATION OF ANTI-VISTA ANTIBODIES
- Mouse hybridoma sequences for both heavy and light chain were human framework adapted by CDR-grafting (Jones, et al. Nature, 321 : 522-525 (1986) using an internal software program.
- the program delineates the complementarity determining regions (CDRs) of the V region sequences according to the Kabat definitions (Wu, T. T. & Kabat, E. A. (1970). J Exp Med, 132, 211-50) and compares the framework regions with the human germline genes using Blast.
- the human germline with the highest sequence identity to the mouse frameworks was chosen as the acceptor gene for human framework adaptation (HFA).
- EXAMPLE 7 ANTI- VISTA ANTIBODY CONSTRUCTS
- Plasmid and sequence information for the molecules for cell line development Plasmid constructs were generated for anti- VISTA antibodies having the VSTB1 12 variable regions and an IgGlK constant regions (VSTB174, new number due to an allotypic change in the constant region), an IgG2sigma constant region (VSTB140) or an IgGl protease-resistant constant region (VSTB149).
- Lonza Vectors [00205] The pEE6.4 and pEE12.4 Chinese hamster ovary (CHO) expression vector system (Lonza Biologies, PLC) was established in Biologies Research (BR) and Pharmaceutical Development & Manufacturing Sciences (PDMS) as the primary expression system for generation of therapeutic mAbs in mammalian expression cell lines.
- Each vector contains a human cytomegalovirus (huCMV- MIE) promoter to drive the expression of the heavy chain (HC) or light chain (LC) and contains the ampicillin resistence gene.
- pEE12.4 vector also includes the gene encoding the glutamine synthetase (GS) enzyme.
- pEE6.4 was used to clone the HC gene and pEE12.4 to clone the LC gene as single gene vectors.
- the Lonza double gene plasmid is created from these two Lonza single genes vectors.
- DIVMTQSPLSLPVTPG EPASISCRSSQSIVHSNGNTYLEWYLQKPG QSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSH VPWTFGQGTKLEIK
- EXAMPLE 8 ELISA and FACS SCREENING OF ANTI- VISTA ANTIBODIES
- ELISA procedure summary Plates were coated overnight at 4°C with 1 ⁇ g/ml SB0361 (human) or SB0361 (cyno (cynomolgus)) proteins, which are the extracellular domains of VISTA from the respective species.
- Antibodies were diluted to 1 ⁇ g/ml as a starting concentration with 1 :4 step-wise dilutions for a total of 4 concentrations and incubated at room temperature room temperature (RT) for 2 hours.
- Mouse anti-human IgGl-HRP (horseradish peroxidase) was used for detection and incubated for 1 hour at RT. All washes were performed using PBS- Tween (0.05%).
- FACS procedure summary 2 x 10 5 K562-G8 (human) or K562-C7 (cyno) cells were stained with 5 ⁇ g/ml of each test antibody and incubated for 30 minutes at 4°C. Goat anti-human IgGl-PE (phycoerythrin) antibody was used as a secondary detection antibody at 5 ⁇ g/ml. Cells were run on a BD Fortessa and analyzed using FlowJo software (Tree Star, Inc., Ashlang, OR) for MFI (mean fluorescence intensity) of the live population.
- FlowJo software Tele Star, Inc., Ashlang, OR
- EXAMPLE 9 SCREENING RESULTS OF ANTI-HUMAN VISTA ANTIBODIES USING THE MIXED LYMPHOCYTE REACTION (MLR) AND STAPHYLOCOCCUS ENTEROTOXJN B (SEB) ACTIVATION ASSAYS
- MLR mixed lymphocyte reaction
- SEB staphylococcus enterotoxin B activation
- MLR mixed lymphocyte reaction
- 10% AB Media was prepared by combining 500 ml of RPMI with 50 ml of human AB serum, 5 ml of Penicillin/Streptomycin (10,000 U/ml), 5 ml of L- glutamine (lOOx) and 10 ml of HEPES (1M). Media was stored for no longer than 14 days.
- 1 mCi tritiated thymidine was prepared by diluting 0.2 ml of thymidine stock (1 mCi/ml) in 9.8 ml of RPMI.
- Soluble VISTA antibodies were diluted to 20 ⁇ in 10% AB serum media. 100 ⁇ of the appropriate antibody solutions was added to the appropriate wells of a 96 well U-bottom plate (Falcon product #353077 or equivalent). After the various cellular populations were added, the final concentration was 10 g/ml.
- Donors were at least 18 years of age, generally healthy and selected randomly from the local population/Transferred donor blood from isolation tubes to 50 ml corneals. Under-laid 15 ml of Ficoll 1077 per 25 ml of blood being careful not to mix with the blood. Centrifuged the cells at 1250g for 25 minutes at room temperate with no brake. White blood cells were isolated at the interphase of the Ficoll and the serum and diluted the cells into 40 ml of Hanks Balances Salt Solution (HBSS). Centrifuged the cells at 453g (1500 rpm) for 10 minutes at 4°C. Resuspended the cells in 50 ml of HBSS and counted by transferring 500 ⁇ to a separate tube.
- HBSS Hanks Balances Salt Solution
- MLR Mixed lymphocyte reaction
- IFN- ⁇ interferon gamma
- VSTB1 12 S2
- VSTB 1 16 S5
- VSTB95 S I 6
- VSTB50 S41
- VSTB53 S43
- VSTB60 S47
- Calculations of IC50 were determined through use of the program "EZ-R stats.” Six individual responders were used to determine the IC 50 values. Individual CPM counts and IFN- ⁇ concentrations in the MLR with dose titrations of the lead candidates.
- Antibodies were then ranked based upon efficacy and variance and based upon these results, VSTB1 12, VSTB116, VSTB95, VSTB50, VSTB53 and VSTB60 were chosen to. evaluate in dose-titration experiments. VSTB60 induced a weaker response than the other five antibodies in the dose-titration experiments.
- SEB staphylococcus enterotoxin B activation assay: SEB is a bacterial super-antigen that induces activation of specific ⁇ + T cells. Peripheral blood mononuclear cells are isolated and incubated with the SEB antigen in culture, which induces robust cytokine production. This assay was conducted on the five lead candidates. [00251] Preparation of 10% AB Media, preparation of 1 mCi tritiated thymidine, preparation of soluble VISTA antibodies, and isolation of white blood cells were all performed as previous described above in the MLR.
- SEB 96 well plate setup Determined the appropriate number of ⁇ responder cells needed for the assay based on the number of samples to be analyzed.
- the responder population is seeded at 2.0 x 10 s cells/well of a 96 well U-bottom plate. All conditions must were performed in triplicate.
- Centrifuged cells as previously described and resuspended at a concentration of 4 x 10 6 /ml in 10% AB serum media and added 50 ⁇ to the appropriate wells. Added 50 ⁇ of 10% AB serum media containing the SEB antigen at a concentration of 40 ng/ml.
- SEB was obtained from Sigma Aldrich (cat# S0812). The final concentration in the well was at 10 ng/ml.
- Protocol Data analysis. Calculated the average counts per minute (CPM) or IFN- ⁇ concentration for each of antibodies at all concentrations. Acceptance criteria were performed as previously described. Determination of IC 50 values was performed as described. Individual CPM counts and IFN- ⁇ concentrations in the SEB assay with dose titrations of the lead candidates.
- Table 9 IC 50 values for both CPM and IFN- ⁇ in the SEB.
- EXAMPLE 10 EPITOPE BINNING ASSAY
- Competing mAbs were pre-incubated in excess (250 nM final concentration) with human VISTA (25 nM final concentration) for 4 hours at room temperature and 6 at a time were run over the chip coated with the panels of coated mAbs with an association time of 4 minutes followed by dissociation for 5 minutes. Following each run, the chips were regenerated with 100 n M phosphoric acid.
- the data analysis involved grouping all sensorgrams by ligand and applying an alignment wizard, which automatically performs an X and Y axis alignment, and artifact removal. An Interspot correction was then applied to the data.
- a non-competing mAb was defined as having a binding signal the same or > Al signal (binding to human VISTA only).
- a competing mAb was defined as having binding signal « Al signal ⁇ i.e., binding to human VISTA only).
- Results In the example sensorgram shown in Figure 23, theVSTB85 antibody was coated on the Proteon SPR chip and VISTA protein preincubated with the indicated competitors was run over the chip.
- VSTB50 is an example of a noncompetitive antibody, as a positive response was seen when the VISTA/VSTB50 complex was run.
- GG8 VSTB49 and VSTB51 complexed with VISTA did not bind to the VSTB85 coated on the chip and were therefore classified as competing for the same binding site on VISTA as VSTB85.
- Table 10 Table 10:
- Sample Set #1 coupled to sensor Sample Set #2: coupled to sensor
- EXAMPLE 1 1 PROTEON AFFINITY DETERMINATION
- Antibodies were captured on ProteOn chips using anti-IgG Fc coated surfaces.
- the antibodies were tested for binding of human and cynomolgus (cyno) VISTA extracellular domains (ECDs) at concentrations of VISTA proteins ranging from 0.39 nM to 100 nM.
- ECDs extracellular domains
- the antigens were allowed to bind/associate to the antibody-coated chips for 4 minutes after which time dissociation was monitored for 30 minutes. Chips were regenerated with two treatments of 100 mM phosphoric acid for 18 seconds. All experiments were run at 25 °C and data was fit to 1 : 1
- EXAMPLE 12 EFFECTS OF ANTI- VISTA TREATMENT IN A
- C57B1/6 mice were injected with MB49 tumor cells. Once the tumors were established, anti-VISTA treatment was initiated. Tumor growth was then monitored 3 times/week. Mice were euthanized, in accordance with IACUC regulations, once the tumors reached 15 mm in any dimension.
- a frozen vial of MB49 cells was thawed and grown in RPMI 1640 (+ L-Glut) with 10% serum and penicillin/streptomycin antibiotics. After three days in culture, the cells were harvested using StemPro Accutase and resuspended in RPMI at a concentration of 5x10 6 cells/ml and 50 ⁇ injected per mouse.
- mice Female C57B1/6 mice, aged 6-8 weeks were purchased from the National Cancer Institute. Upon arrival they were allowed to acclimatize for one day prior to having their right flanks shaved and their tails tattooed. They were then injected three-five days later.
- Tumor Injection Intradermal: Mice were injected intradermally (i.d.) on their shaved flank with 50 ⁇ of MB49 cell suspension (-250,000 cells).
- Tumor growth was measured using electronic calipers first across the widest dimension (L) and secondly at a 90° angle to the first measurement (W).
- Tumor volume derived as follows:
- Tumors were considered established once they reached ⁇ 5mm in diameter (-60 mm 3 volume). Once established, treatment was initiated. Tumor growth was measured three times per week over the course of treatment and until the experiment was terminated.
- Anti- VISTA Treatment Chimerized 13F3-mIgG2a monoclonal antibody was injected intraperitoneally at 10 mg/kg. Injection schedules were thrice weekly for four weeks.
- EXAMPLE 13 EPITOPE MAPPING OF ANTI- VISTA ANTIBODIES USING HYDROGEN/DEUTERIUM (H D) EXCHANGE STUDIES
- the deglycosylated VISTA protein was incubated in a deuterated water solution for predetermined times resulting in deuterium incorporation at exchangeable hydrogen atoms.
- the deuterated VISTA protein was in complex with either Fab of VSTB50, VSTB60, VSTB95 or VSTB1 12 in 46 deuterium oxide (D 2 0) at 4 °C for 30 sec, 2 min, 10 min and 60 min.
- the exchange reaction was quenched by low pH and the proteins were digested with pepsin.
- the deuterium levels at the identified peptides were monitored from the mass shift on LC-MS.
- VISTA protein was processed similarly except that it was not in complex with the Fab molecules. Regions bound to the Fab were inferred to be those sites relatively protected from exchange and, thus, containing a higher fraction of deuterium than the reference VISTA protein. About 94% of the protein could be mapped to specific peptides.
- Anti-VISTA VSTB95 and 1 12 appear to target similar epitopes, comprising segments 27 PVDKGHDVTF 36 (SEQ ID NO:75), and 54 RRPIRDLTFQDL 65 (SEQ ID NO:65) ( Figure 28 bottom). There are two other segments showing weak perturbation by VSTB95 and 112, including residues 39-52 and 118-134. However, the levels of the reduction are not as strong as the previous regions (27-36 and 54-65) in the differential map.
- EXAMPLE 14 STRUCTURE DETERMINATION OF THE HUMAN VISTA ECD:VSTB112 FAB COMPLEX BY PROTEIN CRYSTALLOGRAPHY
- the structure reveals the ECD to have two additional disulfide bonds, one tethering the CC loop to the front sheet and a second between the A' and G' strands.
- crystal contacts between VISTA molecules are present, they are minor and there is no evidence for a dimer of VISTA ECDs based on this structure.
- the VSTBl 12 epitope is shown to comprise the portions of the VISTA BC, CC, and FG loops together with residues of the front beta sheet (C'CFG) nearest those loops. The paratope is biased largely toward heavy chain interactions with CDR L3 making minimal contact. [00289] Epitope/paratope defining VISTA: VSTBl 12 interaction
- VSTBl 12 Fab buries a surface area of 1024.3 A2 upon binding VISTA ECD, with burial of the heavy chain surface accounting for 715.3 A2 of this total. Seven hydrogen bonds and 4 salt bridge interactions are formed between VISTA and VSTBl 12 light chain and 10 hydrogens and 2 salt bridge interactions between VISTA and VSTBl 12 heavy chain. VSTBl 12 recognizes residues in the front sheet strands C ⁇ C, F, and G on the ends proximal to the FG loop as well as residues in the BC, FG, and CC loops ( Figures 29 and 30).
- W 103 in the VSTBl 12 CDR H3 packs nicely against the backbone of VISTA residues H122 and H123, and VISTA H121 makes an edge on interaction with the aromatic ring of F55 in CDR H2.
- EXAMPLE 15 ACTIVATION OF T CELLS AND MONOCYTES BY ANTI-VISTA ANTIBODIES
- MLR mixed leukocyte reaction
- SEB Staphylococcus enterotoxin B
- PBMCs from a single donor are incubated with a bacterial superantigen, which directly links MHC Class II protein on the surface of antigen-presenting cells (APC) to the T-cell receptor (TCR) on T cells, causing T cell activation, proliferation, and cytokine secretion.
- APC antigen-presenting cells
- TCR T-cell receptor
- Antibodies VSTB103 and VSTB63 bind to VISTA with high affinity (KD 6.36E-10 and 8.30E- 10 respectively) and to cells expressing VISTA protein, similar to VSTB112 and VSTB1 11.
- VSTB103 is in the same epitope bin as VSTB112, while VSTB63 is in a different epitope bin; neither antibody facilitated monocyte activation.
- Penicillin/Streptomycin (Lonza, 17-602E) 10,000 U/ml, 5 ml of L-glutamine (lOOx) (Gibco, 25030-081) and 10 ml of HEPES (1M) (Fisher BP299-100, Lot#-l). Media was stored for no longer than 14 days at 4°C.
- Antibodies were diluted to 2X desired concentration in 10% AB serum media: VSTB174: lot VSTB174.003
- Donors were at least 18 years of age, generally healthy and selected randomly from the local population.
- Donor blood was transferred from isolation tube to 50 ml corneals.
- 15 mis of Ficoll 1077 (SIGMA, 10771) were under-laid being careful not to mix with the blood. This was per 25 mis of blood.
- the white blood cells were isolated at the interphase of the Ficoll and the serum and the cells were diluted into 40 ml of Hanks Balanced Salt Solution (HBSS).
- HBSS Hanks Balanced Salt Solution
- the cells were resuspended in 50 mis of HBSS and were counted by transferring 500 1 to a separate eppendorf tube.
- Pan Monocyte isolation kit from Miltenyi was used per manufacturer's instructions (cat# 130-096-537) to isolate CD14+ cells by negative selection in several treatment groups.
- the appropriate number of cells needed was determined for the assay based on the number of samples to be analyzed.
- the responder population was seeded at 2.0x10 5 cells/well of a 96-well U-bottom plate.
- the cells were centrifuged as described above and resuspended at a concentration of 2xl0 6 /ml for the whole PBMC population and 0.5xl0 6 /ml for the CD 14 negatively selected population in 10% AB serum media and added 100 1 of test antibody to appropriate wells bringing the total volume in each well to 200 1.
- CD80-PE clone 2D10 1 :250 (Biolegend cat # 305208)
- EXAMPLE 16 ADCC AND ADCP ACTIVITIES OF ANTI- VISTA ANTIBODIES
- VSTB174 has an IgGl Fc, which can confer antibody-dependent cell- mediated cytotoxicity (ADCC) and antibody-dependent cell-mediated phagocytosis (ADCP) activity. Both types of assays were conducted and showed that VSTB 174 could lyse or phagocytose K562-VISTA cells ( Figures 33-34), but not K562 myeloma cell line parental cells (data not shown).
- An additional mechanism of action of VSTB 174 to modulate the inhibitory action of VISTA may be the lysis or engulfment of cells expressing high levels of VISTA, thus removing them from the local microenvironment.
- EXAMPLE 17 ADCP ACTIVITIES OF ADDITIONAL ANTI- VISTA ANTIBODIES
- An in vitro phagocytosis assay was used to study the enhancement of macrophage-mediated phagocytosis of cells ectopically expressing VISTA by anti- human VISTA mAbs (VSTB 173 and VSTB 174). These mAbs were cloned into different Fc backbones (IgGl WT (wild type), IgGl PR (protease resistant), and IgG2a) and were postulated to potentially have different activities with respect to enhancing phagocytosis.
- the IgGl and IgGl PR backbones are capable of binding to Fc receptors and have the potential to cause ADCP, while the IgG2o does not bind to Fc receptors and should not mediate ADCP.
- Anti-VISTA antibodies were tested in ADCP assays with K562 parental and K562-VISTA target cells. As shown in Figures 35-36, VSTB 174, VSTB 149, VSTB 173 and VSTB 145 enhanced hMac phagocytosis of K562-VISTA cells. VISTA antibodies VSTB 140 or VSTB 132, with the IgG2o Fc that did not bind Fc receptors, did not enhance phagocytosis as expected.
- VISTA mAbs VSTB 174 and VSTB 173 with IgGl Fc showed more robust phagocytosis than VSTB 149 and VSTB145 with the IgGlPR Fc (see Tables 13 and 14 for EC 50 values). [00330] Table 13. Anti-human VISTA mAb ECso values.
- VSTB 174 and VSTB 173 showed weak enhancement of phagocytosis of K562 parental cells at the highest concentration ( Figures 35-36), which may be due to low expression of VISTA by the 562 cells.
- the other anti-VISTA antibodies did not enhance phagocytosis of the K562 cells.
- the negative control antibodies were each tested at two different concentrations in the K562- VISTA phagocytosis assay, but did not induce any phagocytosis. This result indicates that the phagocytosis mediated by the anti-VISTA antibodies is specific and due to VISTA antigen expression by the K562-VISTA cells.
- EXAMPLE 18 ADCC ACTIVITIES OF ADDITIONAL ANTI-VISTA ANTIBODIES
- VSTB174.LF IgGl LF (low fucose)
- VSTB 174, VSTB 149, and VSTB174.LF each demonstrated measurable ADCC activity at 10, 1, 0.1 and 0.01 while only the LF antibody
- the LF antibody demonstrated increased ADCC potency as evidenced by the smaller EC 50 value for the LF antibody curve (0.002293 g/mL) as compared to the regular IgGl antibody curve (0.02381 ⁇ g/mL).
- the IgGl PR antibody curve had an EC 50 value similar to the regular IgGl curve (0.01846 ⁇ g/mL).
- Table 15 EC 50 values ⁇ g/mL) of three tested anti-VISTA antibodies as determined by ADCC analysis.
- the human IgGl, human IgGl PR and human IgGl LF antibodies all showed measurable ADCC mediated killing at the 10, 1, 0.1 and 0.01 ⁇ g/mL antibody concentrations, while only the LF antibody showed killing at the 0.001 g/mL antibody concentration. None of the anti-VISTA antibodies showed killing at the 0.0001 ⁇ g/mL antibody concentration.
- the LF antibody showed approximately 10 times more potent ADCC killing than either the regular IgGl antibody or the IgGl PR antibody, as seen in the EC50 values.
- EXAMPLE 19 AFFINITY OF VSTB 174 FOR HUMAN AND
- VSTB 174 The affinity of VSTB 174 for human and cynomolgus monkey VISTA extracellular domain (ECD) was determined by surface plasmon resonance (SPR) methods on a ProteOn instrument. VSTB 174 displayed very similar KD values for each protein, 1.56E-10 M for human VISTA ECD and 8.66E-11 M for cynomolgus VISTA.
- EXAMPLE 20 VISTA ANTIBODIES EXHIBIT EFFICACY IN MURINE TUMOR MODELS
- VISTA knockin mice back- crossed onto a C57B1/6 background were used.
- An anti-human VISTA antibody was generated to enable testing in the VISTA-KI mice, using the VSTB174 variable region grafted onto mouse Fc IgG2a (VSTB123).
- MB49 efficacy studies were conducted in female VISTA-KI mice, testing VSTB123 at several doses ranging from 1- 10 mg/kg. Mice were injected intradermally with 250,000 MB49 tumor cells on day 0. On day 6, dosing began as indicated in Figure 37 (either 10 mg/kg of the isotype control mIgG2a, or the .
- VSTB123 was more effective at higher vs lower doses, as shown in Figure 37. Doses of 10 mg/kg and 7.5 mg/kg were equivalent, while tumors grew more quickly in the mice dosed at 5 or 1 mg/kg.
- EXAMPLE 21 DETECTION OF VISTA EXPRESSION IN HUMAN TUMORS WITH ANTI-VISTA ANTIBODIES
- Figure 1 shows VISTA expression by an AML tumor cell line— this and the RNA seq expression data in Figure 17 support the idea that VISTA is expressed by AML cells and that anti- VISTA drug be efficacious through directly targeting these cells for immune modulation or antibody-mediated killing.
- EXAMPLE 22 DETECTION OF VISTA EXPRESSION IN LUNG TUMORS USING ANTI- VISTA ANTIBODIES
- FFPE tumor sections were treated with standard antigen retrieval methods prior to staining.
- GG8 mouse anti-human VISTA antibody was used at a 1 :500 dilution.
- GG8 binding was detected using a rabbit anti-mouse polyclonal antibody, followed by anti-rabbit polymer HRP. Counterstain with hematoxylin followed, then tumor sections were scored.
- VISTA expression in lung cancer was mostly restricted to the immune infiltrate (example shown in Figure 39) and high levels of VISTA positive cells were present in many lung cancer samples
- EXAMPLE 23 STRUCTURE OF THE EXTRACELLULAR DOMAIN (ECD) OF HUMAN VISTA IN COMPLEX WITH THE FAB FRAGMENT OF VSTB174
- VISTA antigen variants were generated and purified for crystallography. Recombinant his-tagged VSTB 174 Fab was internally expressed and purified.
- Crystals were generated and used to collect higher resolution data for the VISTA ECD:VSTB174 Fab complex using synchrotron radiation and the structural determination was solved using combinations of homology modeling and electron density analyses (Figure 29(Top)).
- the structure of the VISTA ECD-.VSTB174 Fab complex was determined by x-ray crystallography to a resolution of 1.85 A, providing the first structure of the VISTA ECD and delineating the VSTB 174 epitope and paratope.
- the VISTA ECD adopts an IgV fold with a topology similar to CTLA-4 ECD, but possesses a unique G' strand that extends the front sheet of the ⁇ -sandwich.
- A' and G' are further tethered chemically via a disulfide bridge formed between residues C12 in the A' strand and CI 46 in the G' strand.
- VSTB174 recognizes residues in the front sheet strands C, C, F, and G on the ends proximal to the FG loop as well as residues in the BC, FG, and CC loops.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Genetics & Genomics (AREA)
- Cell Biology (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Physics & Mathematics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Food Science & Technology (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Epidemiology (AREA)
- Oncology (AREA)
- Zoology (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Mycology (AREA)
- Plant Pathology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (43)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020217042306A KR102534681B1 (ko) | 2013-12-24 | 2014-12-22 | 항-vista 항체 및 단편 |
| BR112016014966-1A BR112016014966B1 (pt) | 2013-12-24 | 2014-12-22 | Anticorpos humanizados isolados anti-vista ou seus fragmentos,composição, uso e artigo |
| NZ721866A NZ721866A (en) | 2013-12-24 | 2014-12-22 | Anti-vista antibodies and fragments |
| CN201480076187.1A CN106661107B (zh) | 2013-12-24 | 2014-12-22 | 抗vista抗体及片段 |
| US15/107,784 US10273301B2 (en) | 2013-12-24 | 2014-12-22 | Anti-vista antibodies and fragments |
| CN202411717966.7A CN119775416A (zh) | 2013-12-24 | 2014-12-22 | 抗vista抗体及片段 |
| UAA201607766A UA125490C2 (uk) | 2013-12-24 | 2014-12-22 | Анти-vista антитіло і його антигензв'язувальний фрагмент |
| SG11201605200XA SG11201605200XA (en) | 2013-12-24 | 2014-12-22 | Anti-vista antibodies and fragments |
| DK14833462.6T DK3087098T3 (da) | 2013-12-24 | 2014-12-22 | Anti-Vista-antistoffer og -fragmenter |
| JP2016543001A JP6590810B2 (ja) | 2013-12-24 | 2014-12-22 | 抗vista抗体および断片 |
| MA39210A MA39210A1 (fr) | 2013-12-24 | 2014-12-22 | Anticorps et fragments anti-vista |
| IL290972A IL290972B2 (en) | 2013-12-24 | 2014-12-22 | Antibodies and anti-VISTA fragments |
| AU2014372309A AU2014372309C1 (en) | 2013-12-24 | 2014-12-22 | Anti-VISTA antibodies and fragments |
| EP14833462.6A EP3087098B1 (en) | 2013-12-24 | 2014-12-22 | Anti-vista antibodies and fragments |
| MA44947A MA44947B1 (fr) | 2013-12-24 | 2014-12-22 | Anticorps et fragments anti-vista |
| EA201691323A EA201691323A1 (ru) | 2013-12-24 | 2014-12-22 | Анти-vista антитела и фрагменты |
| EP20159500.6A EP3712174B1 (en) | 2013-12-24 | 2014-12-22 | Anti-vista antibodies and fragments |
| EP22154818.3A EP4043493A1 (en) | 2013-12-24 | 2014-12-22 | Anti-vista antibodies and fragments |
| IL301714A IL301714B1 (en) | 2013-12-24 | 2014-12-22 | Anti-vista antibodies and fragments |
| CA2935378A CA2935378C (en) | 2013-12-24 | 2014-12-22 | Anti-vista antibodies and fragments |
| MYPI2016001169A MY182431A (en) | 2013-12-24 | 2014-12-22 | Anti-vista antibodies and fragments |
| CR20160339A CR20160339A (es) | 2013-12-24 | 2014-12-22 | Anticuerpos y fragmentos anti-vista |
| MX2016008193A MX369173B (es) | 2013-12-24 | 2014-12-22 | Anticuerpos y fragmentos anti-vista. |
| KR1020167020168A KR102344991B1 (ko) | 2013-12-24 | 2014-12-22 | 항-vista 항체 및 단편 |
| PL20159500T PL3712174T3 (pl) | 2013-12-24 | 2014-12-22 | Przeciwciała i fragmenty anty-vista |
| CN202111330125.7A CN114163529B (zh) | 2013-12-24 | 2014-12-22 | 抗vista抗体及片段 |
| JOP/2015/0008A JOP20150008B1 (ar) | 2014-11-26 | 2015-01-19 | أجسام مضادة ل vista وأجزاء منها |
| UY0001035961A UY35961A (es) | 2013-12-24 | 2015-01-21 | Anticuerpos y fragmentos anti-vista |
| TW111121865A TWI836472B (zh) | 2014-11-26 | 2015-03-23 | 抗vista抗體及片段 |
| TW104109174A TWI684601B (zh) | 2014-11-26 | 2015-03-23 | 抗vista抗體及片段 |
| TW113106152A TWI897246B (zh) | 2014-11-26 | 2015-03-23 | 抗vista抗體及片段 |
| TW109100193A TWI770455B (zh) | 2014-11-26 | 2015-03-23 | 抗vista抗體及片段 |
| TW114130365A TW202546004A (zh) | 2014-11-26 | 2015-03-23 | 抗vista抗體及片段 |
| IL246401A IL246401B (en) | 2013-12-24 | 2016-06-22 | Anti-vista antibodies and fragments |
| PH12016501244A PH12016501244A1 (en) | 2013-12-24 | 2016-06-23 | Anti-vista antibodies and fragments |
| US15/481,410 US11014987B2 (en) | 2013-12-24 | 2017-04-06 | Anti-vista antibodies and fragments, uses thereof, and methods of identifying same |
| AU2017228688A AU2017228688B2 (en) | 2013-12-24 | 2017-09-15 | Anti-vista antibodies and fragments |
| US16/395,585 US11242392B2 (en) | 2013-12-24 | 2019-04-26 | Anti-vista antibodies and fragments |
| AU2019213384A AU2019213384C1 (en) | 2013-12-24 | 2019-08-08 | Anti-vista antibodies and fragments |
| JOJO/P/2020/0184A JOP20200184B1 (ar) | 2013-12-24 | 2020-07-29 | أجسام مضادة لـ vista وأجزاء منها |
| US17/325,792 US12441801B2 (en) | 2013-12-24 | 2021-05-20 | Anti-VISTA antibodies and fragments, uses thereof, and methods of identifying same |
| AU2021215226A AU2021215226B2 (en) | 2013-12-24 | 2021-08-12 | Anti-vista antibodies and fragments |
| US17/529,711 US12516122B2 (en) | 2013-12-24 | 2021-11-18 | Anti-VISTA antibodies and fragments |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361920695P | 2013-12-24 | 2013-12-24 | |
| US61/920,695 | 2013-12-24 | ||
| US201462085086P | 2014-11-26 | 2014-11-26 | |
| US62/085,086 | 2014-11-26 |
Related Child Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/107,784 A-371-Of-International US10273301B2 (en) | 2013-12-24 | 2014-12-22 | Anti-vista antibodies and fragments |
| US15/481,410 Continuation-In-Part US11014987B2 (en) | 2013-12-24 | 2017-04-06 | Anti-vista antibodies and fragments, uses thereof, and methods of identifying same |
| US16/395,585 Division US11242392B2 (en) | 2013-12-24 | 2019-04-26 | Anti-vista antibodies and fragments |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| WO2015097536A2 true WO2015097536A2 (en) | 2015-07-02 |
| WO2015097536A3 WO2015097536A3 (en) | 2015-11-12 |
| WO2015097536A8 WO2015097536A8 (en) | 2016-08-04 |
Family
ID=52444326
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2014/002868 Ceased WO2015097536A2 (en) | 2013-12-24 | 2014-12-22 | Anti-vista antibodies and fragments |
Country Status (34)
Cited By (53)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016207717A1 (en) * | 2015-06-24 | 2016-12-29 | Janssen Pharmaceutica Nv | Anti-vista antibodies and fragments |
| WO2017023753A1 (en) | 2015-07-31 | 2017-02-09 | University Of Florida Research Foundation, Inc. | Hematopoietic stem cells in combinatorial therapy with immune checkpoint inhibitors against cancer |
| WO2017124001A3 (en) * | 2016-01-14 | 2017-08-17 | Memorial Sloan-Kettering Cancer Center | T cell receptor-like antibodies specific for foxp3-derived peptides |
| US20170233479A1 (en) * | 2016-02-12 | 2017-08-17 | Janssen Pharmaceutica Nv | Anti-vista antibodies and fragments, uses thereof, and methods of identifying same |
| WO2017149143A1 (en) | 2016-03-04 | 2017-09-08 | Agency For Science, Technology And Research | Anti-lag-3 antibodies |
| WO2017181109A1 (en) * | 2016-04-15 | 2017-10-19 | Michael Molloy | Anti-human vista antibodies and use thereof |
| WO2017181139A3 (en) * | 2016-04-15 | 2017-11-16 | Michael Molloy | Anti-human vista antibodies and use thereof |
| WO2017194265A1 (en) | 2016-05-10 | 2017-11-16 | Agency For Science, Technology And Research | Anti-CTLA-4 Antibodies |
| WO2017220990A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 antibodies |
| WO2018014001A1 (en) | 2016-07-14 | 2018-01-18 | Fred Hutchinson Cancer Research Center | Multiple bi-specific binding domain constructs with different epitope binding to treat cancer |
| WO2018098352A2 (en) | 2016-11-22 | 2018-05-31 | Jun Oishi | Targeting kras induced immune checkpoint expression |
| WO2018170168A1 (en) | 2017-03-15 | 2018-09-20 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| WO2018169993A1 (en) * | 2017-03-14 | 2018-09-20 | Five Prime Therapeutics, Inc. | Antibodies binding to vista at acidic ph |
| US10273301B2 (en) | 2013-12-24 | 2019-04-30 | Janssen Pharmaceutica Nv | Anti-vista antibodies and fragments |
| WO2019087092A1 (en) | 2017-11-06 | 2019-05-09 | Aurigene Discovery Technologies Limited | Conjoint therapies for immunomodulation |
| WO2019087087A1 (en) | 2017-11-03 | 2019-05-09 | Aurigene Discovery Technologies Limited | Dual inhibitors of tim-3 and pd-1 pathways |
| US10370455B2 (en) | 2014-12-05 | 2019-08-06 | Immunext, Inc. | Identification of VSIG8 as the putative VISTA receptor (V-R) and use thereof to produce VISTA/VSIG8 agonists and antagonists |
| WO2019183040A1 (en) | 2018-03-21 | 2019-09-26 | Five Prime Therapeutics, Inc. | ANTIBODIES BINDING TO VISTA AT ACIDIC pH |
| WO2019185879A1 (en) * | 2018-03-29 | 2019-10-03 | Hummingbird Bioscience Holdings Pte. Ltd. | Vista antigen-binding molecules |
| WO2019185163A1 (en) | 2018-03-29 | 2019-10-03 | Hummingbird Bioscience Holdings Pte. Ltd. | Vista antigen-binding molecules |
| WO2020014327A2 (en) | 2018-07-11 | 2020-01-16 | Five Prime Therapeutics, Inc. | Antibodies binding to vista at acidic ph |
| WO2020016459A1 (en) | 2018-07-20 | 2020-01-23 | Pierre Fabre Medicament | Receptor for vista |
| CN110959013A (zh) * | 2017-06-22 | 2020-04-03 | 埃派斯进有限公司 | 抗vista抗体和使用方法 |
| US10633456B1 (en) | 2018-09-07 | 2020-04-28 | Hummingbird Bioscience Holdings Pte. Ltd. | Vista antigen-binding molecules |
| RU2721582C1 (ru) * | 2016-08-05 | 2020-05-20 | И-Байолоджикс Инк. | Антитела против лиганда-1 запрограммированной смерти (PD-L1) и их применение |
| US10745467B2 (en) | 2010-03-26 | 2020-08-18 | The Trustees Of Dartmouth College | VISTA-Ig for treatment of autoimmune, allergic and inflammatory disorders |
| US10781254B2 (en) | 2010-03-26 | 2020-09-22 | The Trustees Of Dartmouth College | VISTA regulatory T cell mediator protein, VISTA binding agents and use thereof |
| EP3768259A2 (en) | 2018-03-14 | 2021-01-27 | Aurigene Discovery Technologies Limited | Method of modulating tigit and pd-1 signalling pathways using 1,2,4-oxadiazole compounds |
| US10933115B2 (en) | 2012-06-22 | 2021-03-02 | The Trustees Of Dartmouth College | VISTA antagonist and methods of use |
| WO2021055698A1 (en) | 2019-09-19 | 2021-03-25 | Bristol-Myers Squibb Company | Antibodies binding to vista at acidic ph |
| US11014987B2 (en) | 2013-12-24 | 2021-05-25 | Janssen Pharmaceutics Nv | Anti-vista antibodies and fragments, uses thereof, and methods of identifying same |
| RU2750723C1 (ru) * | 2017-10-20 | 2021-07-01 | Фармабцин Инк. | Антитела против vista и их применение |
| WO2021155130A1 (en) | 2020-01-29 | 2021-08-05 | Board Of Regents, The University Of Texas System | Use of poziotinib for the treatment of cancers with nrg1 fusions |
| WO2021155113A1 (en) | 2020-01-29 | 2021-08-05 | Board Of Regents, The University Of Texas System | Use of egfr/her2 tyrosine kinase inhibitors and/or her2/her3 antibodies for the treatment of cancers with nrg1 fusions |
| US11123426B2 (en) | 2014-06-11 | 2021-09-21 | The Trustees Of Dartmouth College | Use of vista agonists and antagonists to suppress or enhance humoral immunity |
| JP2021155442A (ja) * | 2016-06-30 | 2021-10-07 | ナント ホールディングス アイピー,エルエルシー | Nant癌ワクチン |
| US11306150B2 (en) | 2017-01-11 | 2022-04-19 | Bristol-Myers Squibb Company | Method of identifying a P-selectin glycoprotein ligand-1 (PSGL-1) antagonist |
| US11396647B2 (en) | 2020-01-07 | 2022-07-26 | Board Of Regents, The University Of Texas System | Human methylthioadenosine/adenosine depleting enzyme variants for cancer therapy |
| WO2022229469A1 (en) | 2021-04-30 | 2022-11-03 | Pierre Fabre Medicament | New stable anti-vista antibody |
| US11529416B2 (en) | 2012-09-07 | 2022-12-20 | Kings College London | Vista modulators for diagnosis and treatment of cancer |
| WO2023041745A1 (en) | 2021-09-16 | 2023-03-23 | Hummingbird Bioscience Pte. Ltd. | Treatment and prevention of cancer using vista antigen-binding molecules |
| WO2023046979A1 (en) | 2021-09-27 | 2023-03-30 | Hummingbird Bioscience Pte. Ltd. | Treatment and prevention of cancer using vista antigen-binding molecules |
| WO2023056361A1 (en) | 2021-09-29 | 2023-04-06 | Board Of Regents, The University Of Texas System | Anti-hsp70 antibodies and therapeutic uses thereof |
| US11649285B2 (en) | 2016-08-03 | 2023-05-16 | Bio-Techne Corporation | Identification of VSIG3/VISTA as a novel immune checkpoint and use thereof for immunotherapy |
| US11787857B2 (en) | 2018-02-02 | 2023-10-17 | Bio-Techne Corporation | Compounds that modulate the interaction of VISTA and VSIG3 and methods of making and using |
| WO2023213814A1 (en) | 2022-05-02 | 2023-11-09 | Pierre Fabre Medicament | New formulation of anti vista antibody |
| US11883432B2 (en) | 2020-12-18 | 2024-01-30 | Century Therapeutics, Inc. | Chimeric antigen receptor system with adaptable receptor specificity |
| WO2024062073A1 (en) | 2022-09-22 | 2024-03-28 | Hummingbird Bioscience Pte. Ltd. | Treatment and prevention of cancer using vista antigen-binding molecules |
| WO2024121380A1 (en) | 2022-12-08 | 2024-06-13 | Pierre Fabre Medicament | Vaccinal composition and adjuvant |
| US12162928B2 (en) | 2012-06-22 | 2024-12-10 | The Trustees Of Dartmouth College | VISTA-Ig constructs and the use of VISTA-Ig for treatment of autoimmune, allergic and inflammatory disorders |
| EP4560319A1 (en) | 2023-11-24 | 2025-05-28 | Pierre Fabre Medicament | Immune and tumour cells expression of vista in a panel of cancer indications |
| WO2025125495A1 (en) | 2023-12-13 | 2025-06-19 | Hummingbird Bioscience Pte. Ltd. | Treatment and prevention of cancer using vista antigen-binding molecules |
| RU2844688C2 (ru) * | 2016-04-15 | 2025-08-05 | Иммьюнекст Инк. | Антитела против человеческого vista и их применение |
Families Citing this family (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2016256911B2 (en) | 2015-05-07 | 2022-03-31 | Agenus Inc. | Anti-OX40 antibodies and methods of use thereof |
| SG10201912984WA (en) | 2015-12-02 | 2020-03-30 | Agenus Inc | Antibodies and methods of use thereof |
| MX389710B (es) | 2016-05-27 | 2025-03-20 | Agenus Inc | Anticuerpos anti proteina inmunoglobulina de linfocitos t y dominio de mucina 3 (tim-3) y métodos para usarlos. |
| ES3008937T3 (en) | 2016-11-04 | 2025-03-25 | Aximmune Inc | Beta-alethine in combination with immune modulators and uses thereof |
| MA46770A (fr) | 2016-11-09 | 2019-09-18 | Agenus Inc | Anticorps anti-ox40, anticorps anti-gitr, et leurs procédés d'utilisation |
| US20200087390A1 (en) | 2016-12-21 | 2020-03-19 | Amgen Inc. | Anti-tnf alpha antibody formulations |
| CN108640972B (zh) * | 2018-05-17 | 2021-07-30 | 中国药科大学 | 与vista具有亲和力的短肽及其用途 |
| BR112021003156A2 (pt) * | 2018-08-23 | 2021-05-11 | Seagen, Inc. | composição, anticorpo que se liga ao tigit humano, formulação farmacêutica, polinucleotídeo isolado, vetor, célula hospedeira, métodos para a produção de um anticorpo que se liga ao tigit humano e de anticorpos afucosilados que se ligam a tigit e para o tratamento de um câncer, e, kit. |
| US10577424B1 (en) * | 2019-08-15 | 2020-03-03 | Beijing Mabworks Biotech Co., Ltd. | Antibodies binding VISTA and uses thereof |
| HUE072262T2 (hu) * | 2020-06-26 | 2025-11-28 | Bioarctic Ab | Alfa-szinuklein protofibrillum-kötõ antitestek |
| US20240190965A1 (en) * | 2022-12-09 | 2024-06-13 | Vanderbilt University | Targeting anti-human pd 1h/vista to treat hematologic disorders |
| CN118515760B (zh) * | 2023-07-28 | 2024-11-12 | 北京亦庄国际蛋白药物技术有限公司 | 抗vista的抗体或其抗原结合片段及其用途 |
| CN119306839B (zh) * | 2024-12-03 | 2025-10-14 | 重庆市畜牧科学院 | 一种抗vista全人源单克隆抗体及其应用 |
Citations (92)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3854480A (en) | 1969-04-01 | 1974-12-17 | Alza Corp | Drug-delivery system |
| EP0003089A1 (fr) | 1978-01-06 | 1979-07-25 | Bernard David | Séchoir pour feuilles imprimées par sérigraphie |
| US4376110A (en) | 1980-08-04 | 1983-03-08 | Hybritech, Incorporated | Immunometric assays using monoclonal antibodies |
| US4452775A (en) | 1982-12-03 | 1984-06-05 | Syntex (U.S.A.) Inc. | Cholesterol matrix delivery system for sustained release of macromolecules |
| WO1986005803A1 (fr) | 1985-03-30 | 1986-10-09 | Marc Ballivet | Procede d'obtention d'adn, arn, peptides, polypeptides ou proteines, par une technique de recombinaison d'adn |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4704692A (en) | 1986-09-02 | 1987-11-03 | Ladner Robert C | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| WO1988006630A1 (en) | 1987-03-02 | 1988-09-07 | Genex Corporation | Method for the preparation of binding molecules |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| WO1989006283A1 (en) | 1988-01-11 | 1989-07-13 | Ingene (International Genetic Engineering, Inc.) | Novel plasmid vector with pectate lyase signal sequence |
| US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
| WO1990003809A1 (en) | 1988-10-12 | 1990-04-19 | Rochal Industries, Inc. | Conformable bandage and coating material |
| WO1990004036A1 (en) | 1988-10-12 | 1990-04-19 | Medical Research Council | Production of antibodies from transgenic animals |
| EP0371998A1 (en) | 1987-07-24 | 1990-06-13 | Int Genetic Eng | Modular assembly of antibody genes, antibodies prepared thereby and use. |
| US4939666A (en) | 1987-09-02 | 1990-07-03 | Genex Corporation | Incremental macromolecule construction methods |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| WO1990014430A1 (en) | 1989-05-16 | 1990-11-29 | Scripps Clinic And Research Foundation | A new method for tapping the immunological repertoire |
| WO1990014424A1 (en) | 1989-05-16 | 1990-11-29 | Scripps Clinic And Research Foundation | Method for isolating receptors having a preselected specificity |
| WO1990014443A1 (en) | 1989-05-16 | 1990-11-29 | Huse William D | Co-expression of heteromeric receptors |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| US5039660A (en) | 1988-03-02 | 1991-08-13 | Endocon, Inc. | Partially fused peptide pellet |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1991018980A1 (en) | 1990-06-01 | 1991-12-12 | Cetus Corporation | Compositions and methods for identifying biologically active molecules |
| WO1991019818A1 (en) | 1990-06-20 | 1991-12-26 | Affymax Technologies N.V. | Peptide library and screening systems |
| WO1992000373A1 (en) | 1990-06-29 | 1992-01-09 | Biosource Genetics Corporation | Melanin production by transformed microorganisms |
| WO1992005258A1 (en) | 1990-09-20 | 1992-04-02 | La Trobe University | Gene encoding barley enzyme |
| WO1992014843A1 (en) | 1991-02-21 | 1992-09-03 | Gilead Sciences, Inc. | Aptamer specific for biomolecules and method of making |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1993008278A1 (en) | 1991-10-16 | 1993-04-29 | Affymax Technologies N.V. | Peptide library and screening method |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
| US5304489A (en) | 1987-02-17 | 1994-04-19 | Genpharm International, Inc. | DNA sequences to target proteins to the mammary gland for efficient secretion |
| GB2272440A (en) | 1990-08-29 | 1994-05-18 | Genpharm Int | Transgenic non-human animals capable of producing heterologous antibodies |
| EP0614989A1 (en) | 1993-02-17 | 1994-09-14 | MorphoSys AG | A method for in vivo selection of ligand-binding proteins |
| WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1995016027A1 (en) | 1993-12-06 | 1995-06-15 | Bioinvent International Ab | Method of selecting specific bacteriophages |
| US5496549A (en) | 1990-04-02 | 1996-03-05 | Takeda Chemical Industries, Ltd. | Bispecific monoclonal antibodies, thrombolytic agent and method of cell lysis |
| WO1996007754A1 (en) | 1994-09-02 | 1996-03-14 | The Scripps Research Institute | Methods for producing antibody libraries using universal or randomized immunoglobulin light chains |
| EP0710719A1 (en) | 1990-01-12 | 1996-05-08 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5576195A (en) | 1985-11-01 | 1996-11-19 | Xoma Corporation | Vectors with pectate lyase signal sequence |
| US5582996A (en) | 1990-12-04 | 1996-12-10 | The Wistar Institute Of Anatomy & Biology | Bifunctional antibodies and method of preparing same |
| US5595898A (en) | 1985-11-01 | 1997-01-21 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
| US5601819A (en) | 1988-08-11 | 1997-02-11 | The General Hospital Corporation | Bispecific antibodies for selective immune regulation and for selective immune cell binding |
| WO1997013852A1 (en) | 1995-10-10 | 1997-04-17 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5625825A (en) | 1993-10-21 | 1997-04-29 | Lsi Logic Corporation | Random number generating apparatus for an interface unit of a carrier sense with multiple access and collision detect (CSMA/CD) ethernet data network |
| US5627052A (en) | 1990-08-02 | 1997-05-06 | B.R. Centre, Ltd. | Methods for the production of proteins with a desired function |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5643768A (en) | 1989-10-05 | 1997-07-01 | Optein, Inc. | Cell-free synthesis and isolation of novel genes and polypeptides |
| US5643759A (en) | 1993-10-30 | 1997-07-01 | Biotest Pharma Gmbh | Method for preparing bispecific monoclonal antibodies |
| US5656730A (en) | 1995-04-07 | 1997-08-12 | Enzon, Inc. | Stabilized monomeric protein compositions |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| EP0814259A1 (de) | 1996-06-19 | 1997-12-29 | Motorenfabrik Hatz GmbH & Co. KG | Kaltstartvorrichtung |
| US5714352A (en) | 1996-03-20 | 1998-02-03 | Xenotech Incorporated | Directed switch-mediated DNA recombination |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US5763733A (en) | 1994-10-13 | 1998-06-09 | Enzon, Inc. | Antigen-binding fusion proteins |
| US5763192A (en) | 1986-11-20 | 1998-06-09 | Ixsys, Incorporated | Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| WO1998024884A1 (en) | 1996-12-02 | 1998-06-11 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5770428A (en) | 1993-02-17 | 1998-06-23 | Wisconsin Alumni Research Foundation | Chimeric retrovial expression vectors and particles containing a simple retroviral long terminal repeat, BLV or HIV coding regions and cis-acting regulatory sequences, and an RNA translational enhancer with internal ribsome entry site |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5807706A (en) | 1995-03-01 | 1998-09-15 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5827690A (en) | 1993-12-20 | 1998-10-27 | Genzyme Transgenics Corporatiion | Transgenic production of antibodies in milk |
| US5833985A (en) | 1994-03-07 | 1998-11-10 | Medarex, Inc. | Bispecific molecules for use in inducing antibody dependent effector cell-mediated cytotoxicity |
| WO1998050433A2 (en) | 1997-05-05 | 1998-11-12 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| US5856456A (en) | 1992-11-20 | 1999-01-05 | Enzon, Inc. | Linker for linked fusion polypeptides |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5932448A (en) | 1991-11-29 | 1999-08-03 | Protein Design Labs., Inc. | Bispecific antibody heterodimers |
| US5959084A (en) | 1990-10-29 | 1999-09-28 | Chiron Corporation | Bispecific antibodies, methods of production and uses thereof |
| US5959083A (en) | 1991-06-03 | 1999-09-28 | Behringwerke Aktiengellschaft | Tetravalent bispecific receptors, the preparation and use thereof |
| US5989530A (en) | 1992-03-10 | 1999-11-23 | Goldwell Ag | Bleaching composition for human hair and process for its production |
| US5990092A (en) | 1996-09-06 | 1999-11-23 | St. Elizabeth's Medical Center | GATA-6 transcription factor: compositions and methods |
| US6010902A (en) | 1988-04-04 | 2000-01-04 | Bristol-Meyers Squibb Company | Antibody heteroconjugates and bispecific antibodies for use in regulation of lymphocyte activity |
| US6037453A (en) | 1995-03-15 | 2000-03-14 | Genentech, Inc. | Immunoglobulin variants |
| US6060285A (en) | 1989-03-23 | 2000-05-09 | Roche Diagnostics Gmbh | Process for the production of hetero-bispecific antibodies |
| US6132992A (en) | 1993-02-01 | 2000-10-17 | Bristol-Myers Squibb Co. | Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell |
| US6193967B1 (en) | 1992-10-02 | 2001-02-27 | Peter M. Morganelli | Bispecific reagents for redirected targeting of human lipoproteins |
| US6210668B1 (en) | 1996-09-03 | 2001-04-03 | Gsf Forschungszentrum Fur Umwelt Und Gesundheit Gmbh | Destruction of contaminating tumor cells in stem cell transplants using bispecific antibodies |
| US7820169B2 (en) | 2000-08-07 | 2010-10-26 | Centocor, Inc. | Anti-TNF antibodies, compositions, methods and uses |
| US7919585B2 (en) | 2004-06-24 | 2011-04-05 | Mayo Foundation For Medical Education And Research | B7-H5, a costimulatory polypeptide |
| US8236304B2 (en) | 2005-04-25 | 2012-08-07 | Trustees Of Dartmouth College | Use of PD-L3 proteins and PD-L3 specific antibodies or antibody fragments to regulate CD4+ and CD8+ T cell immunity |
| US20130177557A1 (en) | 2010-03-26 | 2013-07-11 | Randolph J. Noelle | Vista regulatory t cell mediator protein, vista binding agents and use thereof |
| US9102989B2 (en) | 2002-05-23 | 2015-08-11 | Cognis Ip Management Gmbh | Non-revertible β-oxidation blocked Candida tropicalis |
| US9107149B2 (en) | 2010-04-07 | 2015-08-11 | Lenovo (Singapore) Pte Ltd | Wireless portable computer capable of autonomously adjusting load of wireless base station |
| US9401234B2 (en) | 2013-03-22 | 2016-07-26 | Polytronics Technology Corp. | Over-current protection device |
| US9619256B1 (en) | 2012-06-27 | 2017-04-11 | EMC IP Holding Company LLC | Multi site and multi tenancy |
Family Cites Families (209)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NO812612L (no) | 1980-08-06 | 1982-02-08 | Ferring Pharma Ltd | Enzym-inhibitorer. |
| US4366241A (en) | 1980-08-07 | 1982-12-28 | Syva Company | Concentrating zone method in heterogeneous immunoassays |
| US4517288A (en) | 1981-01-23 | 1985-05-14 | American Hospital Supply Corp. | Solid phase system for ligand assay |
| US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
| US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
| US4873191A (en) | 1981-06-12 | 1989-10-10 | Ohio University | Genetic transformation of zygotes |
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4870009A (en) | 1982-11-22 | 1989-09-26 | The Salk Institute For Biological Studies | Method of obtaining gene product through the generation of transgenic animals |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
| EP0154316B1 (en) | 1984-03-06 | 1989-09-13 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
| US5288641A (en) | 1984-06-04 | 1994-02-22 | Arch Development Corporation | Herpes Simplex virus as a vector |
| US4736866B1 (en) | 1984-06-22 | 1988-04-12 | Transgenic non-human mammals | |
| JPS6147500A (ja) | 1984-08-15 | 1986-03-07 | Res Dev Corp Of Japan | キメラモノクロ−ナル抗体及びその製造法 |
| EP0173494A3 (en) | 1984-08-27 | 1987-11-25 | The Board Of Trustees Of The Leland Stanford Junior University | Chimeric receptors by dna splicing and expression |
| GB8422238D0 (en) | 1984-09-03 | 1984-10-10 | Neuberger M S | Chimeric proteins |
| US4699880A (en) | 1984-09-25 | 1987-10-13 | Immunomedics, Inc. | Method of producing monoclonal anti-idiotype antibody |
| JPS61134325A (ja) | 1984-12-04 | 1986-06-21 | Teijin Ltd | ハイブリツド抗体遺伝子の発現方法 |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
| MX9203291A (es) | 1985-06-26 | 1992-08-01 | Liposome Co Inc | Metodo para acoplamiento de liposomas. |
| US5139941A (en) | 1985-10-31 | 1992-08-18 | University Of Florida Research Foundation, Inc. | AAV transduction vectors |
| EP0247091B1 (en) | 1985-11-01 | 1993-09-29 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
| CA1291031C (en) | 1985-12-23 | 1991-10-22 | Nikolaas C.J. De Jaeger | Method for the detection of specific binding agents and their correspondingbindable substances |
| WO1987005330A1 (en) | 1986-03-07 | 1987-09-11 | Michel Louis Eugene Bergh | Method for enhancing glycoprotein stability |
| US6548640B1 (en) | 1986-03-27 | 2003-04-15 | Btg International Limited | Altered antibodies |
| ATE141646T1 (de) | 1986-04-09 | 1996-09-15 | Genzyme Corp | Genetisch transformierte tiere, die ein gewünschtes protein in milch absondern |
| US4954617A (en) | 1986-07-07 | 1990-09-04 | Trustees Of Dartmouth College | Monoclonal antibodies to FC receptors for immunoglobulin G on human mononuclear phagocytes |
| US4902505A (en) | 1986-07-30 | 1990-02-20 | Alkermes | Chimeric peptides for neuropeptide delivery through the blood-brain barrier |
| US4881175A (en) | 1986-09-02 | 1989-11-14 | Genex Corporation | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| US4987071A (en) | 1986-12-03 | 1991-01-22 | University Patents, Inc. | RNA ribozyme polymerases, dephosphorylases, restriction endoribonucleases and methods |
| US5116742A (en) | 1986-12-03 | 1992-05-26 | University Patents, Inc. | RNA ribozyme restriction endoribonucleases and methods |
| EP0307434B2 (en) | 1987-03-18 | 1998-07-29 | Scotgen Biopharmaceuticals, Inc. | Altered antibodies |
| US5013653A (en) | 1987-03-20 | 1991-05-07 | Creative Biomolecules, Inc. | Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage |
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| AU612370B2 (en) | 1987-05-21 | 1991-07-11 | Micromet Ag | Targeted multifunctional proteins |
| US4904582A (en) | 1987-06-11 | 1990-02-27 | Synthetic Genetics | Novel amphiphilic nucleic acid conjugates |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| US5080891A (en) | 1987-08-03 | 1992-01-14 | Ddi Pharmaceuticals, Inc. | Conjugates of superoxide dismutase coupled to high molecular weight polyalkylene glycols |
| US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
| US5476996A (en) | 1988-06-14 | 1995-12-19 | Lidak Pharmaceuticals | Human immune system in non-human animal |
| WO1990006952A1 (fr) | 1988-12-22 | 1990-06-28 | Kirin-Amgen, Inc. | Facteur de stimulation de colonies de granulocytes modifies chimiquement |
| US5116964A (en) | 1989-02-23 | 1992-05-26 | Genentech, Inc. | Hybrid immunoglobulins |
| US5328470A (en) | 1989-03-31 | 1994-07-12 | The Regents Of The University Of Michigan | Treatment of diseases by site-specific instillation of cells or site-specific transformation of cells and kits therefor |
| US5108921A (en) | 1989-04-03 | 1992-04-28 | Purdue Research Foundation | Method for enhanced transmembrane transport of exogenous molecules |
| US5763266A (en) | 1989-06-15 | 1998-06-09 | The Regents Of The University Of Michigan | Methods, compositions and devices for maintaining and growing human stem and/or hematopoietics cells |
| DE3923279A1 (de) | 1989-07-14 | 1990-01-18 | Will W Prof Dr Minuth | Minusheets ist ein neues produkt, um zellen in beliebigen behaeltnissen in hochdifferenzierter form auf einer moeglichst natuerlichen unterlage zu kultivieren |
| ATE174058T1 (de) | 1989-11-06 | 1998-12-15 | Cell Genesys Inc | Herstellung von proteinen mittels homologer rekombination |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| US5272071A (en) | 1989-12-22 | 1993-12-21 | Applied Research Systems Ars Holding N.V. | Method for the modification of the expression characteristics of an endogenous gene of a given cell line |
| US6153737A (en) | 1990-01-11 | 2000-11-28 | Isis Pharmaceuticals, Inc. | Derivatized oligonucleotides having improved uptake and other properties |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6673986B1 (en) | 1990-01-12 | 2004-01-06 | Abgenix, Inc. | Generation of xenogeneic antibodies |
| US5283173A (en) | 1990-01-24 | 1994-02-01 | The Research Foundation Of State University Of New York | System to detect protein-protein interactions |
| US6641809B1 (en) | 1990-03-26 | 2003-11-04 | Bristol-Myers Squibb Company | Method of regulating cellular processes mediated by B7 and CD28 |
| GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US6255458B1 (en) | 1990-08-29 | 2001-07-03 | Genpharm International | High affinity human antibodies and human antibodies against digoxin |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5747469A (en) | 1991-03-06 | 1998-05-05 | Board Of Regents, The University Of Texas System | Methods and compositions comprising DNA damaging agents and p53 |
| WO1992016622A1 (en) | 1991-03-12 | 1992-10-01 | Biogen, Inc. | Cd2-binding domain of lymphocyte function associated antigen 3 |
| WO1994004679A1 (en) | 1991-06-14 | 1994-03-03 | Genentech, Inc. | Method for making humanized antibodies |
| ATE255131T1 (de) | 1991-06-14 | 2003-12-15 | Genentech Inc | Humanisierter heregulin antikörper |
| US5844095A (en) | 1991-06-27 | 1998-12-01 | Bristol-Myers Squibb Company | CTLA4 Ig fusion proteins |
| US5851795A (en) | 1991-06-27 | 1998-12-22 | Bristol-Myers Squibb Company | Soluble CTLA4 molecules and uses thereof |
| IL99120A0 (en) | 1991-08-07 | 1992-07-15 | Yeda Res & Dev | Multimers of the soluble forms of tnf receptors,their preparation and pharmaceutical compositions containing them |
| US6335434B1 (en) | 1998-06-16 | 2002-01-01 | Isis Pharmaceuticals, Inc., | Nucleosidic and non-nucleosidic folate conjugates |
| AU3328493A (en) | 1991-12-17 | 1993-07-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5776427A (en) | 1992-03-05 | 1998-07-07 | Board Of Regents, The University Of Texas System | Methods for targeting the vasculature of solid tumors |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| CA2118508A1 (en) | 1992-04-24 | 1993-11-11 | Elizabeth S. Ward | Recombinant production of immunoglobulin-like domains in prokaryotic cells |
| US6172208B1 (en) | 1992-07-06 | 2001-01-09 | Genzyme Corporation | Oligonucleotides modified with conjugate groups |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| CA2148252C (en) | 1992-10-30 | 2007-06-12 | Roger Brent | Interaction trap system for isolating novel proteins |
| GB9223377D0 (en) | 1992-11-04 | 1992-12-23 | Medarex Inc | Humanized antibodies to fc receptors for immunoglobulin on human mononuclear phagocytes |
| GB9225453D0 (en) | 1992-12-04 | 1993-01-27 | Medical Res Council | Binding proteins |
| GB9302660D0 (en) | 1993-02-10 | 1993-03-24 | Sihra Kirpal S | A building system |
| AU6445894A (en) | 1993-03-19 | 1994-10-11 | Duke University | Method of treatment of tumors with an antibody binding to tenascin |
| WO1994029436A1 (en) | 1993-06-04 | 1994-12-22 | The United States Of America Represented By The Secretary Of The Navy | Methods for selectively stimulating proliferation of t cells |
| JPH08511420A (ja) | 1993-06-16 | 1996-12-03 | セルテック・セラピューテイクス・リミテッド | 抗 体 |
| CA2170869C (en) | 1993-09-03 | 1999-09-14 | Phillip Dan Cook | Amine-derivatized nucleosides and oligonucleosides |
| AU3272695A (en) | 1994-08-12 | 1996-03-07 | Immunomedics Inc. | Immunoconjugates and humanized antibodies specific for b-cell lymphoma and leukemia cells |
| US5549551A (en) | 1994-12-22 | 1996-08-27 | Advanced Cardiovascular Systems, Inc. | Adjustable length balloon catheter |
| US5801155A (en) | 1995-04-03 | 1998-09-01 | Epoch Pharmaceuticals, Inc. | Covalently linked oligonucleotide minor grove binder conjugates |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6096532A (en) | 1995-06-07 | 2000-08-01 | Aastrom Biosciences, Inc. | Processor apparatus for use in a system for maintaining and growing biological cells |
| US6410690B1 (en) | 1995-06-07 | 2002-06-25 | Medarex, Inc. | Therapeutic compounds comprised of anti-Fc receptor antibodies |
| US5985653A (en) | 1995-06-07 | 1999-11-16 | Aastrom Biosciences, Inc. | Incubator apparatus for use in a system for maintaining and growing biological cells |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| GB9517779D0 (en) | 1995-08-31 | 1995-11-01 | Roslin Inst Edinburgh | Biological manipulation |
| GB9517780D0 (en) | 1995-08-31 | 1995-11-01 | Roslin Inst Edinburgh | Biological manipulation |
| US5723125A (en) | 1995-12-28 | 1998-03-03 | Tanox Biosystems, Inc. | Hybrid with interferon-alpha and an immunoglobulin Fc linked through a non-immunogenic peptide |
| US6750334B1 (en) | 1996-02-02 | 2004-06-15 | Repligen Corporation | CTLA4-immunoglobulin fusion proteins having modified effector functions and uses therefor |
| US6444806B1 (en) | 1996-04-30 | 2002-09-03 | Hisamitsu Pharmaceutical Co., Inc. | Conjugates and methods of forming conjugates of oligonucleotides and carbohydrates |
| US5922845A (en) | 1996-07-11 | 1999-07-13 | Medarex, Inc. | Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies |
| US6653104B2 (en) | 1996-10-17 | 2003-11-25 | Immunomedics, Inc. | Immunotoxins, comprising an internalizing antibody, directed against malignant and normal cells |
| US6593372B2 (en) | 1996-11-13 | 2003-07-15 | Cold Spring Harbor Laboratory | Therapeutic uses for nitric oxide inhibitors |
| ATE336240T1 (de) | 1996-11-13 | 2006-09-15 | Cold Spring Harbor Lab | Therapeutische verwendung von stickstoffmonoxydinhibitoren |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| US20060084082A1 (en) | 1997-03-07 | 2006-04-20 | Human Genome Sciences, Inc. | 186 human secreted proteins |
| DE19742706B4 (de) | 1997-09-26 | 2013-07-25 | Pieris Proteolab Ag | Lipocalinmuteine |
| WO1999026657A1 (en) | 1997-11-25 | 1999-06-03 | Musc Foundation For Research Development | Inhibitors of nitric oxide synthase |
| US6982323B1 (en) | 1997-12-23 | 2006-01-03 | Alexion Pharmaceuticals, Inc. | Chimeric proteins for diagnosis and treatment of diabetes |
| US6006758A (en) | 1998-02-03 | 1999-12-28 | University Of Maryland | Method and device for the detection and removal of head lice |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| AU3657899A (en) | 1998-04-20 | 1999-11-08 | James E. Bailey | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US6300319B1 (en) | 1998-06-16 | 2001-10-09 | Isis Pharmaceuticals, Inc. | Targeted oligonucleotide conjugates |
| CN1178952C (zh) | 1998-07-28 | 2004-12-08 | 加利福尼亚大学董事会 | 编码与感觉转导有关的g-蛋白偶联受体的核酸 |
| US7026448B2 (en) | 1998-09-01 | 2006-04-11 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
| US6924355B2 (en) | 1998-09-01 | 2005-08-02 | Genentech, Inc. | PRO1343 polypeptides |
| US6335437B1 (en) | 1998-09-07 | 2002-01-01 | Isis Pharmaceuticals, Inc. | Methods for the preparation of conjugated oligomers |
| IL127127A0 (en) | 1998-11-18 | 1999-09-22 | Peptor Ltd | Small functional units of antibody heavy chain variable regions |
| CA2352286C (en) | 1998-11-24 | 2011-07-12 | Bristol-Myers Squibb Company | Intracellular targeted delivery of compounds by 70 kd heat shock protein |
| US6818418B1 (en) | 1998-12-10 | 2004-11-16 | Compound Therapeutics, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| US7115396B2 (en) | 1998-12-10 | 2006-10-03 | Compound Therapeutics, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| KR100940380B1 (ko) | 1999-01-15 | 2010-02-02 | 제넨테크, 인크. | 효과기 기능이 변화된 폴리펩티드 변이체 |
| PT1176195E (pt) | 1999-04-09 | 2013-07-18 | Kyowa Hakko Kirin Co Ltd | Processo para controlar a actividade de uma molécula funcional sob o ponto de vista imunológico |
| US6696686B1 (en) | 1999-06-06 | 2004-02-24 | Elgems Ltd. | SPECT for breast cancer detection |
| EP1194539A2 (en) | 1999-06-25 | 2002-04-10 | Universität Zürich | Hetero-associating coiled-coil peptides and screening method therefor |
| AU6058500A (en) | 1999-06-30 | 2001-01-31 | Center For Blood Research, The | Fusion protein and uses thereof |
| ATE407697T1 (de) | 1999-07-13 | 2008-09-15 | Bolder Biotechnology Inc | Erythropoietin immunglobulin fusionsproteine |
| PT1210428E (pt) | 1999-08-23 | 2015-07-21 | Genetics Inst Llc | Pd-1, um recetor para b7-4 e suas utilizações |
| CN102766210B (zh) | 1999-08-24 | 2015-07-08 | E.R.施贵宝&圣斯有限责任公司 | 人ctla-4抗体及其应用 |
| US6395437B1 (en) | 1999-10-29 | 2002-05-28 | Advanced Micro Devices, Inc. | Junction profiling using a scanning voltage micrograph |
| ATE295832T1 (de) | 2000-03-24 | 2005-06-15 | Pharmacia Corp | Amidino-verbindung sowie salze davon verwendbar als hemmstoffe der stickstoffmonoxid-synthase |
| AU2001247616B2 (en) | 2000-04-11 | 2007-06-14 | Genentech, Inc. | Multivalent antibodies and uses therefor |
| US6545170B2 (en) | 2000-04-13 | 2003-04-08 | Pharmacia Corporation | 2-amino-5, 6 heptenoic acid derivatives useful as nitric oxide synthase inhibitors |
| US6559279B1 (en) | 2000-09-08 | 2003-05-06 | Isis Pharmaceuticals, Inc. | Process for preparing peptide derivatized oligomeric compounds |
| JP5291279B2 (ja) | 2000-09-08 | 2013-09-18 | ウニヴェルジテート・チューリッヒ | 反復モジュールを含む反復タンパク質の集合体 |
| EP1373501A2 (en) | 2000-10-06 | 2004-01-02 | Novartis AG | Targeting molecules for adenoviral vectors |
| IL155977A0 (en) | 2000-11-30 | 2003-12-23 | Medarex Inc | Transgenic transchromosomal rodents for making human antibodies |
| US6551786B2 (en) | 2001-01-04 | 2003-04-22 | Myriad Genetics, Inc. | Screen assay for selecting protein-protein interaction modulators |
| US20050063948A1 (en) | 2001-03-08 | 2005-03-24 | Dickerson Erin B. | Methods for targeting interleukin-12 to malignant endothelium |
| EP1383894A2 (en) | 2001-03-28 | 2004-01-28 | Incyte Genomics, Inc. | Molecules for disease detection and treatment |
| ITTV20010035A1 (it) | 2001-03-30 | 2002-09-30 | Bettio Group Srl | Zanzariera con dispositivo di aggancio e sgancio rapido della barra maniglia |
| WO2002092780A2 (en) | 2001-05-17 | 2002-11-21 | Diversa Corporation | Novel antigen binding molecules for therapeutic, diagnostic, prophylactic, enzymatic, industrial, and agricultural applications, and methods for generating and screening thereof |
| EA010594B1 (ru) | 2001-05-24 | 2008-10-30 | Займодженетикс, Инк. | Слитые белки taci-иммуноглобулина |
| US20030031671A1 (en) | 2001-08-01 | 2003-02-13 | Sydney Welt | Methods of treating colon cancer utilizing tumor-specific antibodies |
| CA2457636C (en) | 2001-08-10 | 2012-01-03 | Aberdeen University | Antigen binding domains |
| US6797493B2 (en) | 2001-10-01 | 2004-09-28 | Lee-Hwei K. Sun | Fc fusion proteins of human granulocyte colony-stimulating factor with increased biological activities |
| KR100988949B1 (ko) | 2001-10-25 | 2010-10-20 | 제넨테크, 인크. | 당단백질 조성물 |
| AU2003217912A1 (en) | 2002-03-01 | 2003-09-16 | Xencor | Antibody optimization |
| US20040132101A1 (en) | 2002-09-27 | 2004-07-08 | Xencor | Optimized Fc variants and methods for their generation |
| DK1482973T3 (da) | 2002-03-15 | 2009-12-07 | Schering Corp | Fremgangsmåde til modulering af CD200-receptorer |
| US20040110704A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells of which genome is modified |
| PT1537878E (pt) | 2002-07-03 | 2010-11-18 | Ono Pharmaceutical Co | Composições de imunopotenciação |
| GB2392158B (en) | 2002-08-21 | 2005-02-16 | Proimmune Ltd | Chimeric MHC protein and oligomer thereof |
| BRPI0315666B8 (pt) | 2002-10-23 | 2021-05-25 | Ludwig Inst For Cancer Res Ltd | dna de a34 e a33 do tipo 3, proteínas, seus anticorpos e métodos de tratamento usando os mesmos |
| EP1563074B1 (en) | 2002-11-12 | 2018-01-10 | VAXum, LLC. | Adenoviral vector vaccine |
| WO2004056875A1 (en) | 2002-12-23 | 2004-07-08 | Wyeth | Antibodies against pd-1 and uses therefor |
| US20090010920A1 (en) | 2003-03-03 | 2009-01-08 | Xencor, Inc. | Fc Variants Having Decreased Affinity for FcyRIIb |
| EP1641818B1 (en) | 2003-07-04 | 2008-12-03 | Affibody AB | Polypeptides having binding affinity for her2 |
| WO2005019255A1 (en) | 2003-08-25 | 2005-03-03 | Pieris Proteolab Ag | Muteins of tear lipocalin |
| US20060134105A1 (en) | 2004-10-21 | 2006-06-22 | Xencor, Inc. | IgG immunoglobulin variants with optimized effector function |
| WO2005056764A2 (en) | 2003-12-05 | 2005-06-23 | Compound Therapeutics, Inc. | Inhibitors of type 2 vascular endothelial growth factor receptors |
| US20050256576A1 (en) | 2004-05-13 | 2005-11-17 | Moskowitz Nathan C | Artificial expansile total lumbar and thoracic discs for posterior placement without supplemental instrumentation and its adaptation for anterior placement of artificial cervical, thoracic and lumbar discs |
| PL1751184T3 (pl) | 2004-05-13 | 2010-02-26 | Lilly Co Eli | Białka fuzyjne FGF-21 |
| EP3061461A1 (en) | 2004-10-29 | 2016-08-31 | ratiopharm GmbH | Remodeling and glycopegylation of fibroblast growth factor (fgf) |
| EP1812031B1 (en) | 2004-11-01 | 2015-06-24 | The Regents of the University of California | Compositions and methods for modification of biomolecules |
| US7700099B2 (en) | 2005-02-14 | 2010-04-20 | Merck & Co., Inc. | Non-immunostimulatory antibody and compositions containing the same |
| US8231872B2 (en) | 2005-04-25 | 2012-07-31 | The Trustees Of Dartmouth College | Regulatory T cell mediator proteins and uses thereof |
| KR101510065B1 (ko) | 2005-06-08 | 2015-04-07 | 다나-파버 캔서 인스티튜트 인크. | 예정 세포사 1(pd-1) 경로를 억제함으로써 지속 감염 및 암을 치료하기 위한 방법 및 조성물 |
| WO2007030198A2 (en) | 2005-07-11 | 2007-03-15 | Human Biosystems | Improved methods and solutions for storing donor organs |
| US7531164B2 (en) | 2005-10-21 | 2009-05-12 | Duke University | Preventing bacterial or viral infectivity and composition containing infection preventing additive |
| US7655778B2 (en) | 2006-02-28 | 2010-02-02 | Curonix Co., Ltd. | SISP-1, a novel p53 target gene and use thereof |
| DK2059533T3 (da) | 2006-08-30 | 2013-02-25 | Genentech Inc | Multispecifikke antistoffer |
| EP1958957A1 (en) | 2007-02-16 | 2008-08-20 | NascaCell Technologies AG | Polypeptide comprising a knottin protein moiety |
| EP3663318A1 (en) | 2008-01-07 | 2020-06-10 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| US20110158995A1 (en) | 2008-07-28 | 2011-06-30 | Renault S.A.S | Multi-Specific Binding Proteins Targeting B Cell Disorders |
| JP2012500652A (ja) | 2008-08-25 | 2012-01-12 | アンプリミューン、インコーポレーテッド | 標的化共刺激ポリペプチドおよび癌を処置するための使用方法 |
| US8486408B2 (en) | 2008-10-03 | 2013-07-16 | Emory University | Methods for the treatment of graft-versus-host disease |
| WO2010146059A2 (en) | 2009-06-16 | 2010-12-23 | F. Hoffmann-La Roche Ag | Biomarkers for igf-1r inhibitor therapy |
| EP2949670B1 (en) | 2009-12-10 | 2019-02-27 | F. Hoffmann-La Roche AG | Antibodies binding preferentially human csf1r extracellular domain 4 and their use |
| WO2011090492A1 (en) | 2010-01-19 | 2011-07-28 | Immunomedics, Inc. | Novel class of monospecific and bispecific humanized antibodies that target the insulin-like growth factor type i receptor (igf-1r) |
| US20180237525A9 (en) | 2010-03-26 | 2018-08-23 | Randolph J. Noelle | VISTA Agonist and Methods of Use |
| US10745467B2 (en) | 2010-03-26 | 2020-08-18 | The Trustees Of Dartmouth College | VISTA-Ig for treatment of autoimmune, allergic and inflammatory disorders |
| US20150231215A1 (en) | 2012-06-22 | 2015-08-20 | Randolph J. Noelle | VISTA Antagonist and Methods of Use |
| US20110250215A1 (en) | 2010-04-02 | 2011-10-13 | Athena Discovery, Inc. | Structurally-related relaxin-fusion proteins with extended in vivo half-lives |
| AU2012294342B2 (en) | 2011-08-10 | 2017-07-27 | Lankenau Institute For Medical Research | Methods and compositions for the treatment of autoimmune and inflammatory diseases |
| CA2875980A1 (en) | 2012-06-06 | 2013-12-12 | Oncomed Pharmaceuticals, Inc. | Binding agents that modulate the hippo pathway and uses thereof |
| US9890215B2 (en) | 2012-06-22 | 2018-02-13 | King's College London | Vista modulators for diagnosis and treatment of cancer |
| CN104619722B (zh) | 2012-06-22 | 2022-10-04 | 达特茅斯大学理事会 | 新型vista-ig构建体和vista-ig用于治疗自身免疫性、过敏性和炎性疾病的用途 |
| CA2884704C (en) | 2012-09-07 | 2023-04-04 | Randolph J. Noelle | Vista modulators for diagnosis and treatment of cancer |
| MX376808B (es) | 2013-05-24 | 2025-03-07 | Medimmune Llc | Anticuerpos anti-b7-h5 y sus usos. |
| SG10201708143QA (en) | 2013-06-06 | 2017-11-29 | Pf Medicament | Anti-c10orf54 antibodies and uses thereof |
| EP4043493A1 (en) | 2013-12-24 | 2022-08-17 | Janssen Pharmaceutica NV | Anti-vista antibodies and fragments |
| US11014987B2 (en) | 2013-12-24 | 2021-05-25 | Janssen Pharmaceutics Nv | Anti-vista antibodies and fragments, uses thereof, and methods of identifying same |
| AU2015206189B2 (en) | 2014-01-14 | 2019-06-20 | Kings College London | VISTA antagonist and methods of use |
| JP6783224B2 (ja) | 2014-04-04 | 2020-11-11 | デル マー ファーマシューティカルズ | 肺の非小細胞癌腫及び卵巣癌を処置するためのジアンヒドロガラクチトール及びその類縁体又は誘導体の使用 |
| EP3154585B1 (en) | 2014-06-11 | 2022-02-23 | Kathy A. Green | Use of vista agonists and antagonists to suppress or enhance humoral immunity |
| JP2018505911A (ja) | 2014-12-05 | 2018-03-01 | イミュネクスト,インコーポレーテッド | 推定上のvista受容体としてのvsig8の同定と、vista/vsig8調節剤を産生するためのその使用 |
| EP3722314A1 (en) * | 2015-06-24 | 2020-10-14 | Janssen Pharmaceutica NV | Anti-vista antibodies and fragments |
| TW202216201A (zh) | 2016-02-12 | 2022-05-01 | 比利時商楊森製藥公司 | 抗vista抗體及片段、其用途及鑑定其之方法 |
| WO2017181109A1 (en) | 2016-04-15 | 2017-10-19 | Michael Molloy | Anti-human vista antibodies and use thereof |
| JP7184751B2 (ja) * | 2016-04-15 | 2022-12-06 | イミュネクスト インコーポレイテッド | 抗ヒトvista抗体およびその使用 |
| CA3032146A1 (en) | 2016-08-03 | 2018-02-08 | Bio-Techne Corporation | Identification of vsig3/vista as a novel immune checkpoint and use thereof for immunotherapy |
-
2014
- 2014-12-22 EP EP22154818.3A patent/EP4043493A1/en active Pending
- 2014-12-22 EP EP14833462.6A patent/EP3087098B1/en not_active Revoked
- 2014-12-22 PT PT201595006T patent/PT3712174T/pt unknown
- 2014-12-22 KR KR1020217042306A patent/KR102534681B1/ko active Active
- 2014-12-22 SM SM20220233T patent/SMT202200233T1/it unknown
- 2014-12-22 SI SI201431954T patent/SI3712174T1/sl unknown
- 2014-12-22 PE PE2016000952A patent/PE20170254A1/es unknown
- 2014-12-22 EA EA201691323A patent/EA201691323A1/ru unknown
- 2014-12-22 AU AU2014372309A patent/AU2014372309C1/en active Active
- 2014-12-22 US US15/107,784 patent/US10273301B2/en active Active
- 2014-12-22 CN CN202111330125.7A patent/CN114163529B/zh active Active
- 2014-12-22 UA UAA201607766A patent/UA125490C2/uk unknown
- 2014-12-22 MX MX2016008193A patent/MX369173B/es active IP Right Grant
- 2014-12-22 RS RS20220562A patent/RS63295B1/sr unknown
- 2014-12-22 EP EP20159500.6A patent/EP3712174B1/en active Active
- 2014-12-22 CN CN202411717966.7A patent/CN119775416A/zh active Pending
- 2014-12-22 JP JP2016543001A patent/JP6590810B2/ja active Active
- 2014-12-22 SG SG10201912797XA patent/SG10201912797XA/en unknown
- 2014-12-22 LT LTEP20159500.6T patent/LT3712174T/lt unknown
- 2014-12-22 CA CA2935378A patent/CA2935378C/en active Active
- 2014-12-22 WO PCT/IB2014/002868 patent/WO2015097536A2/en not_active Ceased
- 2014-12-22 IL IL290972A patent/IL290972B2/en unknown
- 2014-12-22 HR HRP20220748TT patent/HRP20220748T1/hr unknown
- 2014-12-22 PL PL20159500T patent/PL3712174T3/pl unknown
- 2014-12-22 ES ES20159500T patent/ES2920677T3/es active Active
- 2014-12-22 NZ NZ721866A patent/NZ721866A/en unknown
- 2014-12-22 MY MYPI2016001169A patent/MY182431A/en unknown
- 2014-12-22 IL IL301714A patent/IL301714B1/en unknown
- 2014-12-22 DK DK20159500.6T patent/DK3712174T3/da active
- 2014-12-22 KR KR1020167020168A patent/KR102344991B1/ko active Active
- 2014-12-22 SG SG11201605200XA patent/SG11201605200XA/en unknown
- 2014-12-22 BR BR112016014966-1A patent/BR112016014966B1/pt active IP Right Grant
- 2014-12-22 CA CA3190821A patent/CA3190821A1/en active Pending
- 2014-12-22 DK DK14833462.6T patent/DK3087098T3/da active
- 2014-12-22 SG SG10201912793RA patent/SG10201912793RA/en unknown
- 2014-12-22 SG SG10201805933TA patent/SG10201805933TA/en unknown
- 2014-12-22 CN CN201480076187.1A patent/CN106661107B/zh active Active
-
2015
- 2015-01-21 UY UY0001035961A patent/UY35961A/es not_active Application Discontinuation
-
2016
- 2016-06-20 MX MX2019012714A patent/MX2019012714A/es unknown
- 2016-06-21 DO DO2016000153A patent/DOP2016000153A/es unknown
- 2016-06-22 IL IL246401A patent/IL246401B/en unknown
- 2016-06-23 PH PH12016501244A patent/PH12016501244A1/en unknown
- 2016-06-23 SA SA521430032A patent/SA521430032B1/ar unknown
- 2016-06-23 NI NI201600090A patent/NI201600090A/es unknown
- 2016-06-23 SA SA516371402A patent/SA516371402B1/ar unknown
- 2016-06-24 CL CL2016001646A patent/CL2016001646A1/es unknown
- 2016-07-25 EC ECIEPI201662894A patent/ECSP16062894A/es unknown
-
2017
- 2017-09-15 AU AU2017228688A patent/AU2017228688B2/en active Active
-
2019
- 2019-04-26 US US16/395,585 patent/US11242392B2/en active Active
- 2019-08-08 AU AU2019213384A patent/AU2019213384C1/en active Active
- 2019-08-23 CL CL2019002428A patent/CL2019002428A1/es unknown
- 2019-09-17 JP JP2019167936A patent/JP6924234B2/ja active Active
-
2021
- 2021-02-10 CL CL2021000353A patent/CL2021000353A1/es unknown
- 2021-07-30 JP JP2021124965A patent/JP7256238B2/ja active Active
- 2021-08-12 AU AU2021215226A patent/AU2021215226B2/en active Active
- 2021-11-18 US US17/529,711 patent/US12516122B2/en active Active
-
2022
- 2022-06-15 CY CY20221100416T patent/CY1125398T1/el unknown
-
2023
- 2023-03-30 JP JP2023055878A patent/JP7559126B2/ja active Active
Patent Citations (127)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3854480A (en) | 1969-04-01 | 1974-12-17 | Alza Corp | Drug-delivery system |
| EP0003089A1 (fr) | 1978-01-06 | 1979-07-25 | Bernard David | Séchoir pour feuilles imprimées par sérigraphie |
| US4376110A (en) | 1980-08-04 | 1983-03-08 | Hybritech, Incorporated | Immunometric assays using monoclonal antibodies |
| US4452775A (en) | 1982-12-03 | 1984-06-05 | Syntex (U.S.A.) Inc. | Cholesterol matrix delivery system for sustained release of macromolecules |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0229046A1 (fr) | 1985-03-30 | 1987-07-22 | Marc Ballivet | Procede d'obtention d'adn, arn, peptides, polypeptides ou proteines, par une technique de recombinaison d'adn. |
| EP0590689A2 (fr) | 1985-03-30 | 1994-04-06 | BALLIVET, Marc | Procédé d'obtention d'ADN, ARN, peptides, polypeptides ou protéines, par une technique de recombinaison d'ADN |
| WO1986005803A1 (fr) | 1985-03-30 | 1986-10-09 | Marc Ballivet | Procede d'obtention d'adn, arn, peptides, polypeptides ou proteines, par une technique de recombinaison d'adn |
| US5976862A (en) | 1985-03-30 | 1999-11-02 | Ixsys Corporation | Process for obtaining DNA, RNA, peptides, polypeptides, or proteins, by recombinant DNA technique |
| US5723323A (en) | 1985-03-30 | 1998-03-03 | Kauffman; Stuart Alan | Method of identifying a stochastically-generated peptide, polypeptide, or protein having ligand binding property and compositions thereof |
| US5814476A (en) | 1985-03-30 | 1998-09-29 | Stuart Kauffman | Process for the production of stochastically-generated transcription or translation products |
| US5817483A (en) | 1985-03-30 | 1998-10-06 | Stuart Kauffman | Process for the production of stochastically-generated peptides,polypeptides or proteins having a predetermined property |
| US5824514A (en) | 1985-03-30 | 1998-10-20 | Stuart A. Kauffman | Process for the production of expression vectors comprising at least one stochastic sequence of polynucleotides |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US5595898A (en) | 1985-11-01 | 1997-01-21 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
| US5693493A (en) | 1985-11-01 | 1997-12-02 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
| US5576195A (en) | 1985-11-01 | 1996-11-19 | Xoma Corporation | Vectors with pectate lyase signal sequence |
| US6204023B1 (en) | 1985-11-01 | 2001-03-20 | Xoma Ltd. | Modular assembly of antibody genes, antibodies prepared thereby and use |
| US5618920A (en) | 1985-11-01 | 1997-04-08 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
| US5698417A (en) | 1985-11-01 | 1997-12-16 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
| US5698435A (en) | 1985-11-01 | 1997-12-16 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5518889A (en) | 1986-09-02 | 1996-05-21 | Enzon Labs Inc. | Immunoassay methods using single polypeptide chain binding molecules |
| US5534621A (en) | 1986-09-02 | 1996-07-09 | Enzon Labs, Inc. | Immunoaffinity purification methods using single polypeptide chain binding molecules |
| US5455030A (en) | 1986-09-02 | 1995-10-03 | Enzon Labs, Inc. | Immunotheraphy using single chain polypeptide binding molecules |
| US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
| US4704692A (en) | 1986-09-02 | 1987-11-03 | Ladner Robert C | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| US5763192A (en) | 1986-11-20 | 1998-06-09 | Ixsys, Incorporated | Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique |
| US5304489A (en) | 1987-02-17 | 1994-04-19 | Genpharm International, Inc. | DNA sequences to target proteins to the mammary gland for efficient secretion |
| US5565362A (en) | 1987-02-17 | 1996-10-15 | Pharming B.V. | DNA sequences to target proteins to the mammary gland for efficient secretion |
| US5994616A (en) | 1987-02-17 | 1999-11-30 | Pharming B.V. | Targeted synthesis of protein in mammary gland of a non-human transgenic mammal |
| WO1988006630A1 (en) | 1987-03-02 | 1988-09-07 | Genex Corporation | Method for the preparation of binding molecules |
| US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
| EP0550400A2 (en) | 1987-07-24 | 1993-07-07 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
| EP0371998A1 (en) | 1987-07-24 | 1990-06-13 | Int Genetic Eng | Modular assembly of antibody genes, antibodies prepared thereby and use. |
| US4939666A (en) | 1987-09-02 | 1990-07-03 | Genex Corporation | Incremental macromolecule construction methods |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| WO1989006283A1 (en) | 1988-01-11 | 1989-07-13 | Ingene (International Genetic Engineering, Inc.) | Novel plasmid vector with pectate lyase signal sequence |
| US5039660A (en) | 1988-03-02 | 1991-08-13 | Endocon, Inc. | Partially fused peptide pellet |
| US6010902A (en) | 1988-04-04 | 2000-01-04 | Bristol-Meyers Squibb Company | Antibody heteroconjugates and bispecific antibodies for use in regulation of lymphocyte activity |
| US5601819A (en) | 1988-08-11 | 1997-02-11 | The General Hospital Corporation | Bispecific antibodies for selective immune regulation and for selective immune cell binding |
| US5837500A (en) | 1988-09-02 | 1998-11-17 | Dyax, Corp. | Directed evolution of novel binding proteins |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| WO1990004036A1 (en) | 1988-10-12 | 1990-04-19 | Medical Research Council | Production of antibodies from transgenic animals |
| WO1990003809A1 (en) | 1988-10-12 | 1990-04-19 | Rochal Industries, Inc. | Conformable bandage and coating material |
| EP0438474B1 (en) | 1988-10-12 | 1996-05-15 | Medical Research Council | Production of antibodies from transgenic animals |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US6060285A (en) | 1989-03-23 | 2000-05-09 | Roche Diagnostics Gmbh | Process for the production of hetero-bispecific antibodies |
| WO1990014424A1 (en) | 1989-05-16 | 1990-11-29 | Scripps Clinic And Research Foundation | Method for isolating receptors having a preselected specificity |
| WO1990014430A1 (en) | 1989-05-16 | 1990-11-29 | Scripps Clinic And Research Foundation | A new method for tapping the immunological repertoire |
| WO1990014443A1 (en) | 1989-05-16 | 1990-11-29 | Huse William D | Co-expression of heteromeric receptors |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| US5643768A (en) | 1989-10-05 | 1997-07-01 | Optein, Inc. | Cell-free synthesis and isolation of novel genes and polypeptides |
| US5658754A (en) | 1989-10-05 | 1997-08-19 | Optein, Inc. | Cell-free synthesis and isolation of novel genes and polypeptides |
| EP0710719A1 (en) | 1990-01-12 | 1996-05-08 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| EP0463151B1 (en) | 1990-01-12 | 1996-06-12 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| US5496549A (en) | 1990-04-02 | 1996-03-05 | Takeda Chemical Industries, Ltd. | Bispecific monoclonal antibodies, thrombolytic agent and method of cell lysis |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1991018980A1 (en) | 1990-06-01 | 1991-12-12 | Cetus Corporation | Compositions and methods for identifying biologically active molecules |
| WO1991019818A1 (en) | 1990-06-20 | 1991-12-26 | Affymax Technologies N.V. | Peptide library and screening systems |
| WO1992000373A1 (en) | 1990-06-29 | 1992-01-09 | Biosource Genetics Corporation | Melanin production by transformed microorganisms |
| US5627052A (en) | 1990-08-02 | 1997-05-06 | B.R. Centre, Ltd. | Methods for the production of proteins with a desired function |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| GB2272440A (en) | 1990-08-29 | 1994-05-18 | Genpharm Int | Transgenic non-human animals capable of producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1992005258A1 (en) | 1990-09-20 | 1992-04-02 | La Trobe University | Gene encoding barley enzyme |
| US6106833A (en) | 1990-10-29 | 2000-08-22 | Chiron Corporation | Bispecific antibodies, methods of production and use thereof |
| US5959084A (en) | 1990-10-29 | 1999-09-28 | Chiron Corporation | Bispecific antibodies, methods of production and uses thereof |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US5582996A (en) | 1990-12-04 | 1996-12-10 | The Wistar Institute Of Anatomy & Biology | Bifunctional antibodies and method of preparing same |
| WO1992014843A1 (en) | 1991-02-21 | 1992-09-03 | Gilead Sciences, Inc. | Aptamer specific for biomolecules and method of making |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| US5959083A (en) | 1991-06-03 | 1999-09-28 | Behringwerke Aktiengellschaft | Tetravalent bispecific receptors, the preparation and use thereof |
| WO1993008278A1 (en) | 1991-10-16 | 1993-04-29 | Affymax Technologies N.V. | Peptide library and screening method |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| US5932448A (en) | 1991-11-29 | 1999-08-03 | Protein Design Labs., Inc. | Bispecific antibody heterodimers |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5989530A (en) | 1992-03-10 | 1999-11-23 | Goldwell Ag | Bleaching composition for human hair and process for its production |
| US6193967B1 (en) | 1992-10-02 | 2001-02-27 | Peter M. Morganelli | Bispecific reagents for redirected targeting of human lipoproteins |
| US5856456A (en) | 1992-11-20 | 1999-01-05 | Enzon, Inc. | Linker for linked fusion polypeptides |
| US6132992A (en) | 1993-02-01 | 2000-10-17 | Bristol-Myers Squibb Co. | Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell |
| EP0614989A1 (en) | 1993-02-17 | 1994-09-14 | MorphoSys AG | A method for in vivo selection of ligand-binding proteins |
| US5770428A (en) | 1993-02-17 | 1998-06-23 | Wisconsin Alumni Research Foundation | Chimeric retrovial expression vectors and particles containing a simple retroviral long terminal repeat, BLV or HIV coding regions and cis-acting regulatory sequences, and an RNA translational enhancer with internal ribsome entry site |
| WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5625825A (en) | 1993-10-21 | 1997-04-29 | Lsi Logic Corporation | Random number generating apparatus for an interface unit of a carrier sense with multiple access and collision detect (CSMA/CD) ethernet data network |
| US5643759A (en) | 1993-10-30 | 1997-07-01 | Biotest Pharma Gmbh | Method for preparing bispecific monoclonal antibodies |
| WO1995016027A1 (en) | 1993-12-06 | 1995-06-15 | Bioinvent International Ab | Method of selecting specific bacteriophages |
| US5827690A (en) | 1993-12-20 | 1998-10-27 | Genzyme Transgenics Corporatiion | Transgenic production of antibodies in milk |
| US5849992A (en) | 1993-12-20 | 1998-12-15 | Genzyme Transgenics Corporation | Transgenic production of antibodies in milk |
| US5833985A (en) | 1994-03-07 | 1998-11-10 | Medarex, Inc. | Bispecific molecules for use in inducing antibody dependent effector cell-mediated cytotoxicity |
| WO1996007754A1 (en) | 1994-09-02 | 1996-03-14 | The Scripps Research Institute | Methods for producing antibody libraries using universal or randomized immunoglobulin light chains |
| US5767260A (en) | 1994-10-13 | 1998-06-16 | Enzon Inc. | Antigen-binding fusion proteins |
| US5763733A (en) | 1994-10-13 | 1998-06-09 | Enzon, Inc. | Antigen-binding fusion proteins |
| US5821333A (en) | 1995-03-01 | 1998-10-13 | Genetech, Inc. | Method for making heteromultimeric polypeptides |
| US5807706A (en) | 1995-03-01 | 1998-09-15 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US6037453A (en) | 1995-03-15 | 2000-03-14 | Genentech, Inc. | Immunoglobulin variants |
| US5656730A (en) | 1995-04-07 | 1997-08-12 | Enzon, Inc. | Stabilized monomeric protein compositions |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1997013852A1 (en) | 1995-10-10 | 1997-04-17 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5714352A (en) | 1996-03-20 | 1998-02-03 | Xenotech Incorporated | Directed switch-mediated DNA recombination |
| EP0814259A1 (de) | 1996-06-19 | 1997-12-29 | Motorenfabrik Hatz GmbH & Co. KG | Kaltstartvorrichtung |
| US6210668B1 (en) | 1996-09-03 | 2001-04-03 | Gsf Forschungszentrum Fur Umwelt Und Gesundheit Gmbh | Destruction of contaminating tumor cells in stem cell transplants using bispecific antibodies |
| US5990092A (en) | 1996-09-06 | 1999-11-23 | St. Elizabeth's Medical Center | GATA-6 transcription factor: compositions and methods |
| WO1998024884A1 (en) | 1996-12-02 | 1998-06-11 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| WO1998050433A2 (en) | 1997-05-05 | 1998-11-12 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| US7820169B2 (en) | 2000-08-07 | 2010-10-26 | Centocor, Inc. | Anti-TNF antibodies, compositions, methods and uses |
| US9102989B2 (en) | 2002-05-23 | 2015-08-11 | Cognis Ip Management Gmbh | Non-revertible β-oxidation blocked Candida tropicalis |
| US7919585B2 (en) | 2004-06-24 | 2011-04-05 | Mayo Foundation For Medical Education And Research | B7-H5, a costimulatory polypeptide |
| US8236304B2 (en) | 2005-04-25 | 2012-08-07 | Trustees Of Dartmouth College | Use of PD-L3 proteins and PD-L3 specific antibodies or antibody fragments to regulate CD4+ and CD8+ T cell immunity |
| US20130177557A1 (en) | 2010-03-26 | 2013-07-11 | Randolph J. Noelle | Vista regulatory t cell mediator protein, vista binding agents and use thereof |
| US9107149B2 (en) | 2010-04-07 | 2015-08-11 | Lenovo (Singapore) Pte Ltd | Wireless portable computer capable of autonomously adjusting load of wireless base station |
| US9619256B1 (en) | 2012-06-27 | 2017-04-11 | EMC IP Holding Company LLC | Multi site and multi tenancy |
| US9401234B2 (en) | 2013-03-22 | 2016-07-26 | Polytronics Technology Corp. | Over-current protection device |
Non-Patent Citations (52)
| Title |
|---|
| "Current Protocols in Immunology", 1992, GREENE PUBLISHING ASSOC. AND WILEY INTERSCIENCE |
| "Current Protocols in Molecular Biology", 1987, GREENE PUBLISHING ASSOC. AND WILEY INTERSCIENCE |
| "Physician's Desk Reference", 2003 |
| "Remington's Pharmaceutical Sciences", MACK PUBLISHING COMPANY |
| AARON L. NELSON, MABS, vol. 2, no. 1, January 2010 (2010-01-01), pages 77 - 83 |
| BABCOOK ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 7843 - 7848 |
| BERZOFSKY ET AL.: "Fundamental Immunology", 1984, RAVEN PRESS, article "Antibody-Antigen Interactions" |
| CARTER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 89, 1992, pages 4285 |
| CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 |
| CRAMER ET AL., CURR. TOP. MICROBOL. IMMUNOL., vol. 240, 1999, pages 95 - 118 |
| EREN ET AL., IMMUNOL, vol. 93, 1998, pages 154 - 161 |
| FISCHER ET AL., BIOTECHNOL. APPL. BIOCHEM., vol. 30, October 1999 (1999-10-01), pages 99 - 108 |
| FISHWALD ET AL., NAT BIOTECHNOL, vol. 14, no. 7, 1996, pages 845 - 851 |
| GOODMAN; GILMAN'S: "The Pharmaceutical Basis of Therapeutics", MCGRAW-HILL |
| GRAY ET AL., J. IMM. METH., vol. 182, 1995, pages 155 - 163 |
| GREEN ET AL., NATURE GENETICS, vol. 7, 1994, pages 13 - 21 |
| HAMURO ET AL., J. BIOMOL. TECHNIQUES, vol. 14, 2003, pages 171 - 182 |
| HANES ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, May 1997 (1997-05-01), pages 4937 - 4942 |
| HANES ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, November 1998 (1998-11-01), pages 14130 - 14135 |
| HARLOW; LANE: "ANTIBODIES: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY |
| HORN ET AL., BIOCHEMISTRY, vol. 45, 2006, pages 8488 - 8498 |
| JEFFREY SCHLOM: "Therapeutic Cancer Vaccines: Current Status and Moving Forward", JNATL CANCER INST, vol. 104, 2012, pages 599 - 613, XP002735513, DOI: doi:10.1093/jnci/djs033 |
| JONAK ET AL.: "Progress Biotech", vol. 5, 1988, ELSEVIER SCIENCE PUBLISHERS B.V., article "In Vitro Immunization in Hybridoma Technology" |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| KENNY ET AL., BIO/TECHNOL., vol. 13, 1995, pages 787 - 790 |
| KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497 |
| KUBY; JANIS: "Immunology", 1992, W.H. FREEMAN AND COMPANY |
| LINES ET AL., CANCER RESEARCH, vol. 74, 2014, pages 1924 |
| LONBERG ET AL., INT REV IMMUNOL, vol. 13, no. 1, 1995, pages 65 - 93 |
| LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859 |
| MA ET AL., PLANT PHYSIOL., vol. 109, 1995, pages 341 - 6 |
| MA ET AL., TRENDS BIOTECHNOL., vol. 13, 1995, pages 522 - 7 |
| MENDEZ ET AL., NATURE GENETICS, vol. 15, 1997, pages 146 - 156 |
| MILSTEIN; CUELLO, NATURE, vol. 305, 1983, pages 537 |
| NGUYEN ET AL., MICROBIOL. IMMUNOL., vol. 41, 1997, pages 901 - 907 |
| POWELL ET AL., BIOTECHNOL., vol. 8, 1990, pages 333 - 337 |
| PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 |
| SANDHU ET AL., CRIT. REV. BIOTECHNOL., vol. 16, 1996, pages 95 - 118 |
| SIMS ET AL., J. IMMUNOL, vol. 151, 1993, pages 2296 |
| STEENBAKKERS ET AL., MOLEC. BIOL. REPORTS, vol. 19, 1994, pages 125 - 134 |
| SURESH ET AL., METHODS IN ENZYMOLOGY, vol. 121, 1986, pages 210 |
| TAYLOR ET AL., INT. IMMUNOL., vol. 6, no. 4, 1994, pages 579 - 591 |
| TAYLOR ET AL., NUCLEIC ACIDS RESEARCH, vol. 20, no. 23, 1992, pages 6287 - 6295 |
| TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655 |
| TUAILLON ET AL., PROC NATL ACAD SCI USA, vol. 90, no. 8, 1993, pages 3720 - 3724 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 |
| WANG ET AL.: "VISTA, a novel mouse Ig superfamily ligand that negatively regulates T cell responses", J EXP. MED., vol. 208, no. 3, 2011, pages 577 - 92, XP055387118, DOI: doi:10.1084/jem.20100619 |
| WEN ET AL., J. IMMUNOL, vol. 17, 1987, pages 887 - 892 |
| WHITELAM ET AL., BIOCHEM. SOC. TRANS., vol. 22, 1994, pages 940 - 944 |
| WU, T. T.; KABAT, E. A., JEXP MED, vol. 132, 1970, pages 211 - 50 |
Cited By (113)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10781254B2 (en) | 2010-03-26 | 2020-09-22 | The Trustees Of Dartmouth College | VISTA regulatory T cell mediator protein, VISTA binding agents and use thereof |
| US12071473B2 (en) | 2010-03-26 | 2024-08-27 | The Trustees Of Darmouth College | VISTA-Ig for treatment of autoimmune, allergic and inflammatory disorders |
| US10745467B2 (en) | 2010-03-26 | 2020-08-18 | The Trustees Of Dartmouth College | VISTA-Ig for treatment of autoimmune, allergic and inflammatory disorders |
| US12162928B2 (en) | 2012-06-22 | 2024-12-10 | The Trustees Of Dartmouth College | VISTA-Ig constructs and the use of VISTA-Ig for treatment of autoimmune, allergic and inflammatory disorders |
| US11752189B2 (en) | 2012-06-22 | 2023-09-12 | The Trustees Of Dartmouth College | Vista antagonist and methods of use |
| US10933115B2 (en) | 2012-06-22 | 2021-03-02 | The Trustees Of Dartmouth College | VISTA antagonist and methods of use |
| US12064463B2 (en) | 2012-06-22 | 2024-08-20 | King's College London | Vista antagonist and methods of use |
| US11529416B2 (en) | 2012-09-07 | 2022-12-20 | Kings College London | Vista modulators for diagnosis and treatment of cancer |
| US11014987B2 (en) | 2013-12-24 | 2021-05-25 | Janssen Pharmaceutics Nv | Anti-vista antibodies and fragments, uses thereof, and methods of identifying same |
| US10273301B2 (en) | 2013-12-24 | 2019-04-30 | Janssen Pharmaceutica Nv | Anti-vista antibodies and fragments |
| US11242392B2 (en) | 2013-12-24 | 2022-02-08 | Janssen Pharmaceutica Nv | Anti-vista antibodies and fragments |
| EP3087098B1 (en) | 2013-12-24 | 2020-04-08 | Janssen Pharmaceutica NV | Anti-vista antibodies and fragments |
| US12441801B2 (en) | 2013-12-24 | 2025-10-14 | Janssen Pharmaceutica Nv | Anti-VISTA antibodies and fragments, uses thereof, and methods of identifying same |
| US12516122B2 (en) | 2013-12-24 | 2026-01-06 | Janssen Pharmaceutica Nv | Anti-VISTA antibodies and fragments |
| US11123426B2 (en) | 2014-06-11 | 2021-09-21 | The Trustees Of Dartmouth College | Use of vista agonists and antagonists to suppress or enhance humoral immunity |
| US10370455B2 (en) | 2014-12-05 | 2019-08-06 | Immunext, Inc. | Identification of VSIG8 as the putative VISTA receptor (V-R) and use thereof to produce VISTA/VSIG8 agonists and antagonists |
| WO2016207717A1 (en) * | 2015-06-24 | 2016-12-29 | Janssen Pharmaceutica Nv | Anti-vista antibodies and fragments |
| EP3722314A1 (en) * | 2015-06-24 | 2020-10-14 | Janssen Pharmaceutica NV | Anti-vista antibodies and fragments |
| US12188938B2 (en) | 2015-06-24 | 2025-01-07 | Janssen Pharmaceutica Nv | Anti-VISTA antibodies and fragments |
| US11904016B2 (en) | 2015-07-31 | 2024-02-20 | University Of Florida Research Foundation, Incorporated | Hematopoietic stem cells in combinatorial therapy with immune checkpoint inhibitors against cancer |
| US10660954B2 (en) | 2015-07-31 | 2020-05-26 | University Of Florida Research Foundation, Incorporated | Hematopoietic stem cells in combinatorial therapy with immune checkpoint inhibitors against cancer |
| WO2017023753A1 (en) | 2015-07-31 | 2017-02-09 | University Of Florida Research Foundation, Inc. | Hematopoietic stem cells in combinatorial therapy with immune checkpoint inhibitors against cancer |
| US12605445B2 (en) | 2015-07-31 | 2026-04-21 | University Of Florida Research Foundation, Incorporated | Hematopoietic stem cells in combinatorial therapy with immune checkpoint inhibitors against cancer |
| US11505599B2 (en) | 2016-01-14 | 2022-11-22 | Memorial Sloan-Kettering Cancer Center | T cell receptor-like antibodies specific for Foxp3-derived peptides |
| WO2017124001A3 (en) * | 2016-01-14 | 2017-08-17 | Memorial Sloan-Kettering Cancer Center | T cell receptor-like antibodies specific for foxp3-derived peptides |
| CN109069626A (zh) * | 2016-02-12 | 2018-12-21 | 詹森药业有限公司 | 抗-vista(b7h5)抗体 |
| WO2017137830A1 (en) * | 2016-02-12 | 2017-08-17 | Janssen Pharmaceutica Nv | Anti-vista (b7h5) antibodies |
| US20170233479A1 (en) * | 2016-02-12 | 2017-08-17 | Janssen Pharmaceutica Nv | Anti-vista antibodies and fragments, uses thereof, and methods of identifying same |
| US10899836B2 (en) | 2016-02-12 | 2021-01-26 | Janssen Pharmaceutica Nv | Method of identifying anti-VISTA antibodies |
| JP2019509993A (ja) * | 2016-02-12 | 2019-04-11 | ヤンセン ファーマシューティカ エヌブイ | 抗vista(b7h5)抗体 |
| TWI756204B (zh) * | 2016-02-12 | 2022-03-01 | 比利時商楊森製藥公司 | 抗vista抗體及片段、其用途及鑑定其之方法 |
| JP2023113752A (ja) * | 2016-02-12 | 2023-08-16 | ヤンセン ファーマシューティカ エヌブイ | 抗vista(b7h5)抗体 |
| US11987630B2 (en) | 2016-02-12 | 2024-05-21 | Janssen Pharmaceutica Nv | Anti-vista antibodies and fragments, uses thereof, and methods of identifying same |
| WO2017149143A1 (en) | 2016-03-04 | 2017-09-08 | Agency For Science, Technology And Research | Anti-lag-3 antibodies |
| EP3442579A4 (en) * | 2016-04-15 | 2019-12-18 | Immunext Inc. | ANTI-HUMAN-VISTA ANTIBODIES AND USE THEREOF |
| US12139532B2 (en) | 2016-04-15 | 2024-11-12 | Immunext, Inc. | Anti-human vista antibodies and use thereof |
| JP7184751B2 (ja) | 2016-04-15 | 2022-12-06 | イミュネクスト インコーポレイテッド | 抗ヒトvista抗体およびその使用 |
| US11525000B2 (en) | 2016-04-15 | 2022-12-13 | Immunext, Inc. | Anti-human VISTA antibodies and use thereof |
| CN109414480B (zh) * | 2016-04-15 | 2023-08-22 | 伊穆奈克斯特股份有限公司 | 抗人vista抗体及其用途 |
| EP3448412A4 (en) * | 2016-04-15 | 2020-03-25 | Immunext Inc. | ANTI-HUMAN-VISTA ANTIBODIES AND USE THEREOF |
| US11603403B2 (en) | 2016-04-15 | 2023-03-14 | Immunext, Inc. | Anti-human vista antibodies and use thereof |
| US11649283B2 (en) | 2016-04-15 | 2023-05-16 | Immunext, Inc. | Anti-human vista antibodies and use thereof |
| RU2844688C2 (ru) * | 2016-04-15 | 2025-08-05 | Иммьюнекст Инк. | Антитела против человеческого vista и их применение |
| WO2017181109A1 (en) * | 2016-04-15 | 2017-10-19 | Michael Molloy | Anti-human vista antibodies and use thereof |
| CN109414480A (zh) * | 2016-04-15 | 2019-03-01 | 伊穆奈克斯特股份有限公司 | 抗人vista抗体及其用途 |
| JP2019525943A (ja) * | 2016-04-15 | 2019-09-12 | イミュネクスト インコーポレイテッド | 抗ヒトvista抗体およびその使用 |
| TWI829621B (zh) * | 2016-04-15 | 2024-01-21 | 麥可 莫利 | 抗人類vista 抗體及其用途 |
| WO2017181139A3 (en) * | 2016-04-15 | 2017-11-16 | Michael Molloy | Anti-human vista antibodies and use thereof |
| RU2746994C2 (ru) * | 2016-04-15 | 2021-04-23 | Иммьюнекст Инк. | Антитела против человеческого vista и их применение |
| US11603402B2 (en) | 2016-04-15 | 2023-03-14 | Immunext, Inc. | Anti-human vista antibodies and use thereof |
| WO2017194265A1 (en) | 2016-05-10 | 2017-11-16 | Agency For Science, Technology And Research | Anti-CTLA-4 Antibodies |
| WO2017220989A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 and il-2 cytokines |
| WO2017220990A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Anti-pd-l1 antibodies |
| WO2017220988A1 (en) | 2016-06-20 | 2017-12-28 | Kymab Limited | Multispecific antibodies for immuno-oncology |
| JP2021155442A (ja) * | 2016-06-30 | 2021-10-07 | ナント ホールディングス アイピー,エルエルシー | Nant癌ワクチン |
| WO2018014001A1 (en) | 2016-07-14 | 2018-01-18 | Fred Hutchinson Cancer Research Center | Multiple bi-specific binding domain constructs with different epitope binding to treat cancer |
| US11649285B2 (en) | 2016-08-03 | 2023-05-16 | Bio-Techne Corporation | Identification of VSIG3/VISTA as a novel immune checkpoint and use thereof for immunotherapy |
| US10919966B2 (en) | 2016-08-05 | 2021-02-16 | Y-Biologics Inc. | Antibody to programmed death-ligand 1 (PD-L1) and use thereof |
| RU2721582C1 (ru) * | 2016-08-05 | 2020-05-20 | И-Байолоджикс Инк. | Антитела против лиганда-1 запрограммированной смерти (PD-L1) и их применение |
| WO2018098352A2 (en) | 2016-11-22 | 2018-05-31 | Jun Oishi | Targeting kras induced immune checkpoint expression |
| US11306150B2 (en) | 2017-01-11 | 2022-04-19 | Bristol-Myers Squibb Company | Method of identifying a P-selectin glycoprotein ligand-1 (PSGL-1) antagonist |
| WO2018169993A1 (en) * | 2017-03-14 | 2018-09-20 | Five Prime Therapeutics, Inc. | Antibodies binding to vista at acidic ph |
| US11603406B2 (en) | 2017-03-14 | 2023-03-14 | Five Prime Therapeutics, Inc. | Antibodies binding to VISTA at acidic pH |
| AU2018236218B2 (en) * | 2017-03-14 | 2025-03-06 | Bristol-Myers Squibb Company | Antibodies binding to vista at acidic pH |
| US12195535B2 (en) | 2017-03-14 | 2025-01-14 | Five Prime Therapeutics, Inc. | Antibodies binding to VISTA at acidic pH |
| EP4431109A2 (en) | 2017-03-15 | 2024-09-18 | Cue Biopharma, Inc. | Combination of multimeric fusion polypeptides and immune checkpoint inhibitor for treating hpv-associated cancer |
| WO2018170168A1 (en) | 2017-03-15 | 2018-09-20 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| EP3642231A4 (en) * | 2017-06-22 | 2021-06-23 | Apexigen, Inc. | ANTI-VISTA ANTIBODIES AND METHODS OF USE |
| CN110959013A (zh) * | 2017-06-22 | 2020-04-03 | 埃派斯进有限公司 | 抗vista抗体和使用方法 |
| US11407833B2 (en) | 2017-10-20 | 2022-08-09 | Pharmabcine Inc. | Anti-VISTA antibody and use thereof |
| RU2750723C1 (ru) * | 2017-10-20 | 2021-07-01 | Фармабцин Инк. | Антитела против vista и их применение |
| EP3699193A4 (en) * | 2017-10-20 | 2022-01-26 | Pharmabcine Inc. | ANTI-VISTA ANTIBODIES AND USE THEREOF |
| WO2019087087A1 (en) | 2017-11-03 | 2019-05-09 | Aurigene Discovery Technologies Limited | Dual inhibitors of tim-3 and pd-1 pathways |
| WO2019087092A1 (en) | 2017-11-06 | 2019-05-09 | Aurigene Discovery Technologies Limited | Conjoint therapies for immunomodulation |
| US11787857B2 (en) | 2018-02-02 | 2023-10-17 | Bio-Techne Corporation | Compounds that modulate the interaction of VISTA and VSIG3 and methods of making and using |
| EP3768259A2 (en) | 2018-03-14 | 2021-01-27 | Aurigene Discovery Technologies Limited | Method of modulating tigit and pd-1 signalling pathways using 1,2,4-oxadiazole compounds |
| WO2019183040A1 (en) | 2018-03-21 | 2019-09-26 | Five Prime Therapeutics, Inc. | ANTIBODIES BINDING TO VISTA AT ACIDIC pH |
| US12173069B2 (en) | 2018-03-21 | 2024-12-24 | Five Prime Therapeutics, Inc. | Antibodies binding to vista at acidic pH |
| CN111971304A (zh) * | 2018-03-21 | 2020-11-20 | 戊瑞治疗有限公司 | 在酸性pH结合至VISTA的抗体 |
| KR20200135421A (ko) * | 2018-03-21 | 2020-12-02 | 파이브 프라임 테라퓨틱스, 인크. | 산성 pH에서 VISTA에 결합하는 항체 |
| EP3868786A1 (en) | 2018-03-29 | 2021-08-25 | Hummingbird Bioscience Holdings Limited | Vista antigen-binding molecules |
| AU2019240906B2 (en) * | 2018-03-29 | 2025-05-08 | Hummingbird Bioscience Pte. Ltd. | VISTA antigen-binding molecules |
| WO2019185879A1 (en) * | 2018-03-29 | 2019-10-03 | Hummingbird Bioscience Holdings Pte. Ltd. | Vista antigen-binding molecules |
| US20210380697A1 (en) * | 2018-03-29 | 2021-12-09 | Hummingbird Bioscience Holdings Pte. Ltd. | Vista antigen-binding molecules |
| WO2019185163A1 (en) | 2018-03-29 | 2019-10-03 | Hummingbird Bioscience Holdings Pte. Ltd. | Vista antigen-binding molecules |
| JP7545438B2 (ja) | 2018-03-29 | 2024-09-04 | ハミングバード・バイオサイエンス・プライベート・リミテッド | Vista抗原結合性分子 |
| TWI828673B (zh) * | 2018-03-29 | 2024-01-11 | 新加坡商蜂鳥生物科技私人有限公司 | Vista抗原結合分子 |
| CN112513080A (zh) * | 2018-03-29 | 2021-03-16 | 蜂鸟生物科技控股私人有限公司 | Vista抗原结合分子 |
| JP7118332B2 (ja) | 2018-03-29 | 2022-08-16 | ハミングバード・バイオサイエンス・プライベート・リミテッド | Vista抗原結合性分子 |
| JP2021511818A (ja) * | 2018-03-29 | 2021-05-13 | ハミングバード・バイオサイエンス・ホールディングス・プライベート・リミテッド | Vista抗原結合性分子 |
| JP2024164156A (ja) * | 2018-03-29 | 2024-11-26 | ハミングバード・バイオサイエンス・プライベート・リミテッド | Vista抗原結合性分子 |
| JP2022128604A (ja) * | 2018-03-29 | 2022-09-02 | ハミングバード・バイオサイエンス・プライベート・リミテッド | Vista抗原結合性分子 |
| WO2020014327A3 (en) * | 2018-07-11 | 2020-02-27 | Five Prime Therapeutics, Inc. | Antibodies binding to vista at acidic ph |
| US12091462B2 (en) | 2018-07-11 | 2024-09-17 | Five Prime Therapeutics, Inc. | Antibodies binding to vista at acidic pH |
| WO2020014327A2 (en) | 2018-07-11 | 2020-01-16 | Five Prime Therapeutics, Inc. | Antibodies binding to vista at acidic ph |
| WO2020016459A1 (en) | 2018-07-20 | 2020-01-23 | Pierre Fabre Medicament | Receptor for vista |
| US10633456B1 (en) | 2018-09-07 | 2020-04-28 | Hummingbird Bioscience Holdings Pte. Ltd. | Vista antigen-binding molecules |
| US11873346B2 (en) | 2018-09-07 | 2024-01-16 | Hummingbird Bioscience Pte. Ltd. | VISTA antigen-binding molecules |
| WO2021055698A1 (en) | 2019-09-19 | 2021-03-25 | Bristol-Myers Squibb Company | Antibodies binding to vista at acidic ph |
| US11396647B2 (en) | 2020-01-07 | 2022-07-26 | Board Of Regents, The University Of Texas System | Human methylthioadenosine/adenosine depleting enzyme variants for cancer therapy |
| US11591579B2 (en) | 2020-01-07 | 2023-02-28 | Board Of Regents, The University Of Texas System | Human methylthioadenosine/adenosine depleting enzyme variants for cancer therapy |
| WO2021155130A1 (en) | 2020-01-29 | 2021-08-05 | Board Of Regents, The University Of Texas System | Use of poziotinib for the treatment of cancers with nrg1 fusions |
| WO2021155113A1 (en) | 2020-01-29 | 2021-08-05 | Board Of Regents, The University Of Texas System | Use of egfr/her2 tyrosine kinase inhibitors and/or her2/her3 antibodies for the treatment of cancers with nrg1 fusions |
| US11883432B2 (en) | 2020-12-18 | 2024-01-30 | Century Therapeutics, Inc. | Chimeric antigen receptor system with adaptable receptor specificity |
| WO2022229469A1 (en) | 2021-04-30 | 2022-11-03 | Pierre Fabre Medicament | New stable anti-vista antibody |
| WO2023041745A1 (en) | 2021-09-16 | 2023-03-23 | Hummingbird Bioscience Pte. Ltd. | Treatment and prevention of cancer using vista antigen-binding molecules |
| WO2023046979A1 (en) | 2021-09-27 | 2023-03-30 | Hummingbird Bioscience Pte. Ltd. | Treatment and prevention of cancer using vista antigen-binding molecules |
| WO2023056361A1 (en) | 2021-09-29 | 2023-04-06 | Board Of Regents, The University Of Texas System | Anti-hsp70 antibodies and therapeutic uses thereof |
| WO2023213814A1 (en) | 2022-05-02 | 2023-11-09 | Pierre Fabre Medicament | New formulation of anti vista antibody |
| WO2024062073A1 (en) | 2022-09-22 | 2024-03-28 | Hummingbird Bioscience Pte. Ltd. | Treatment and prevention of cancer using vista antigen-binding molecules |
| WO2024121380A1 (en) | 2022-12-08 | 2024-06-13 | Pierre Fabre Medicament | Vaccinal composition and adjuvant |
| EP4560319A1 (en) | 2023-11-24 | 2025-05-28 | Pierre Fabre Medicament | Immune and tumour cells expression of vista in a panel of cancer indications |
| WO2025125495A1 (en) | 2023-12-13 | 2025-06-19 | Hummingbird Bioscience Pte. Ltd. | Treatment and prevention of cancer using vista antigen-binding molecules |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2021215226B2 (en) | Anti-vista antibodies and fragments | |
| TWI770455B (zh) | 抗vista抗體及片段 | |
| HK40079362A (en) | Anti-vista antibodies and fragments | |
| HK40036877A (en) | Anti-vista antibodies and fragments | |
| HK40036877B (en) | Anti-vista antibodies and fragments | |
| HK1227891A1 (en) | Anti-vista antibodies and fragments | |
| HK1227891B (en) | Anti-vista antibodies and fragments | |
| NZ735662B2 (en) | Anti-vista antibodies and fragments | |
| EA050681B1 (ru) | Анти-vista антитела и фрагменты | |
| EA043336B1 (ru) | Анти-vista антитела и фрагменты антител, содержащие их композиции и их применение для стимуляции иммунитета и лечения рака |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14833462 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2016/008193 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2016543001 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 246401 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2935378 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 000952-2016 Country of ref document: PE Ref document number: 15107784 Country of ref document: US Ref document number: 12016501244 Country of ref document: PH |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112016014966 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 39210 Country of ref document: MA |
|
| ENP | Entry into the national phase |
Ref document number: 2014372309 Country of ref document: AU Date of ref document: 20141222 Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2014833462 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014833462 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 20167020168 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201691323 Country of ref document: EA Ref document number: NC2016/0000097 Country of ref document: CO Ref document number: CR2016-000339 Country of ref document: CR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: A201607766 Country of ref document: UA |
|
| WWP | Wipo information: published in national office |
Ref document number: CR2016-000339 Country of ref document: CR |
|
| ENP | Entry into the national phase |
Ref document number: 112016014966 Country of ref document: BR Kind code of ref document: A2 Effective date: 20160624 |
|
| WWG | Wipo information: grant in national office |
Ref document number: CR2016-000339 Country of ref document: CR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 516371402 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2023/009387 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 516371402 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 516371402 Country of ref document: SA |
|
| WWG | Wipo information: grant in national office |
Ref document number: 521430032 Country of ref document: SA |