US9771431B2 - Antibodies to carcinoembryonic antigen-related cell adhesion molecule (CEACAM) - Google Patents

Antibodies to carcinoembryonic antigen-related cell adhesion molecule (CEACAM) Download PDF

Info

Publication number
US9771431B2
US9771431B2 US14/350,970 US201214350970A US9771431B2 US 9771431 B2 US9771431 B2 US 9771431B2 US 201214350970 A US201214350970 A US 201214350970A US 9771431 B2 US9771431 B2 US 9771431B2
Authority
US
United States
Prior art keywords
ceacam1
antibody
cells
ceacam
antibodies
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active, expires
Application number
US14/350,970
Other languages
English (en)
Other versions
US20140271618A1 (en
Inventor
Gal Markel
Tehila Ben Moshe
Yair Sapir
Ilana Mandel
Jacob Schachter
Rona Ortenberg
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
FameWave Ltd
Original Assignee
cCAM Biotherapeutics Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by cCAM Biotherapeutics Ltd filed Critical cCAM Biotherapeutics Ltd
Assigned to RAMOT AT TEL-AVIV UNIVERSITY LTD. reassignment RAMOT AT TEL-AVIV UNIVERSITY LTD. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: ORTENBERG, RONA
Assigned to CCAM BIOTHERAPEUTICS LTD. reassignment CCAM BIOTHERAPEUTICS LTD. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: BEN-MOSHE, TEHILA, MANDEL, Ilana, SAPIR, Yair
Assigned to TEL HASHOMER MEDICAL RESEARCH INFRASTRUCTURE AND SERVICES LTD. reassignment TEL HASHOMER MEDICAL RESEARCH INFRASTRUCTURE AND SERVICES LTD. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: MARKEL, GAL, SCHACHTER, JACOB
Publication of US20140271618A1 publication Critical patent/US20140271618A1/en
Assigned to CCAM BIOTHERAPEUTICS LTD. reassignment CCAM BIOTHERAPEUTICS LTD. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: RAMOT AT TEL AVIV UNIVERSITY LTD., Tel Hashomer-Medical Research, Infrastructure And Services Ltd.
Application granted granted Critical
Publication of US9771431B2 publication Critical patent/US9771431B2/en
Assigned to CCAM BIOTHERAPEUTICS LTD. reassignment CCAM BIOTHERAPEUTICS LTD. CHANGE OF ADDRESS Assignors: CCAM BIOTHERAPEUTICS LTD.
Assigned to FAMEWAVE LTD. reassignment FAMEWAVE LTD. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: CCAM BIOTHERAPEUTICS LTD.
Active legal-status Critical Current
Adjusted expiration legal-status Critical

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/42Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39566Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against immunoglobulins, e.g. anti-idiotypic antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3007Carcino-embryonic Antigens
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854Immunoglobulins
    • G01N33/686Anti-idiotype
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/57Skin; melanoma
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention relates to therapeutic and diagnostic antibodies, useful in diseases involving Carcinoembryonic Antigen-Related Cell Adhesion Molecule (CEACAM), expression, activation or function.
  • CEACAM Carcinoembryonic Antigen-Related Cell Adhesion Molecule
  • the present invention provides antibodies having specific complementarity determining regions (CDRs) and improved properties over other antibodies which recognize CEACAM1.
  • CEACAM1 Carcinoembryonic antigen-related cell adhesion molecule 1
  • BGP biliary glycoprotein
  • CD66a and C-CAM1 are members of the carcinoembryonic antigen family (CEA) that also belongs to the immunoglobulin superfamily.
  • CEACAM1 interacts with other known CEACAM proteins, including CD66a (CEACAM1), CD66e (CEACAM6) and CD66e (CEACAM5, CEA) proteins. It is expressed on a wide spectrum of cells, ranging from epithelial cells to those of hemopoietic origin (e.g. immune cells).
  • CEACAM1 has been attributed to many different functions. It was shown that the CEACAM1 protein is over expressed in some carcinomas of colon, prostate, as well as other types of cancer. Additional data support the central involvement of CEACAM1 in angiogenesis and metastasis. CEACAM1 also plays a role in the modulation of innate and adaptive immune responses. For example, CEACAM1 was shown to be an inhibitory receptor for activated T cells contained within the human intestinal epithelium (WO99/52552 and Morales et al. J. Immunol. 1999, 163, 1363-1370). Additional reports have indicated that CEACAM1 engagement either by T Cell Receptor cross-linking with Monoclonal antibodies (mAbs) or by Neisseria gonorrhoeae Opa proteins inhibits T cell activation and proliferation.
  • mAbs Monoclonal antibodies
  • Neisseria gonorrhoeae Opa proteins inhibits T cell activation and proliferation.
  • MM pigment-producing cells
  • MM Metastatic melanoma
  • overexpression of CEACAM1 can be correlated with poor prognosis and is detected in the majority of metastatic melanoma cases.
  • CEACAM1 is rarely expressed by normal melanocytes, but frequently found on melanoma cells.
  • CEACAM1 expression on primary cutaneous melanoma lesions strongly predicts the development of metastatic disease with poor prognosis.
  • increased CEACAM1 expression was observed on NK cells derived from some patients with metastatic melanoma compared with healthy donors.
  • CEACAM1 may have an important role in virus infections.
  • Markel at el. J. Clinical Investigation 2002, 110, 943-953 demonstrated that lymphocytes isolated from the deciduae of CMV-infected patients express the CEACAM1 protein in increased levels.
  • the increased CEACAM1 expression on the decidual lymphocytes might diminish the local immune response and serve as another mechanism developed by the virus to avoid recognition and clearance primarily by activated decidual lymphocytes.
  • CEACAM1 immunostaining is significantly increased in high-grade squamous intraepithelial lesions (SIL) in comparison with low-grade SIL and normal cervical tissues.
  • SIL squamous intraepithelial lesions
  • CEACAM1 upregulation may be related to integration of HPV DNA in high-grade SIL and that CEACAM1 may be an important biological marker in SIL and cervical cancer progression.
  • CEACAM1 plays an important role in various viral infections.
  • CEACAM1 over expression may serve as marker of various viral infections.
  • WO2007/063424 and U.S. Patent Application No. 20070110668 disclose methods for regulating the immune system, and in particular methods for the regulation of a specific immune response, including the regulation of lymphocyte activity. These methods comprise both the negative and positive modulation of CEACAM1 protein function.
  • U.S. Patent Application No. 20070071758 teaches methods and compositions for enhancing the efficacy of tumor-infiltrating lymphocyte (TIL) therapy in the treatment of cancer by negatively modulating the activity of the CEACAM1 protein, such as for example, by using an immunoglobulin specific for CEACAM1.
  • TIL tumor-infiltrating lymphocyte
  • U.S. Patent Application No. 20080108140 discloses methods of modulating specific immune responses to create a protective immunity in the treatment of autoimmune diseases and diseases requiring the transplantation of tissue. In particular, it relates to the suppression of immune responses in a targeted fashion, by increasing the functional concentration of the CEACAM1 protein in the target tissue.
  • U.S. Patent Application No. 20040047858 discloses specific antibodies which are capable of modulating T cell activity via CEACAM1 and uses thereof in treating immune response related diseases (e.g. graft versus host disease, autoimmune diseases, cancers etc.).
  • immune response related diseases e.g. graft versus host disease, autoimmune diseases, cancers etc.
  • compositions which bind T cell inhibitory receptor molecules and modulate (i.e. enhance or suppress) T cell activity (e.g. cytotoxicity and proliferation), such as biliary glycoprotein binding agents, and methods of using such compositions such as for treatment of diseases (e.g. an autoimmune disease, immunodeficiency, cancer etc.).
  • diseases e.g. an autoimmune disease, immunodeficiency, cancer etc.
  • WO 2010/125571 discloses a murine monoclonal antibody produced by a specific hybridoma cell.
  • the mAb is highly selective to CEACAM1 and does not cross-react with other members of the CEACAM family.
  • the present invention discloses monoclonal antibodies which recognize a specific set of CEACAM subtypes.
  • the antibodies of the invention show binding to CEACAM1 and at least one additional subtype selected from CEACAM5 and CEACAM3.
  • the antibodies of the invention are characterized by having unique CDR sequence and framework combinations and by binding to newly identified epitopes within the CEACAM1 molecule.
  • the unique specificity of the monoclonal antibodies of the present invention broaden their therapeutic utility for treatment and diagnosis of additional types of malignancies and viral infections.
  • the present invention also provides methods for identifying and isolating such antibodies, methods for their production, and therapeutic and diagnostic uses thereof.
  • the monoclonal antibodies according to the present invention have specific combinations of CDRs and possess unique properties and improved specificity and potency over known anti CEACAM1 antibodies.
  • the present invention provides a monoclonal antibody which recognizes CEACAM1, or an antibody fragment thereof comprising at least an antigen-binding portion thereof, having heavy-chain CDRs comprising sequences set forth in SEQ ID NOs: 1, 2 and 3, and light-chain CDRs comprising sequences set forth in SEQ ID NOs: 4, 5 and 6, and analogs and derivatives thereof.
  • a monoclonal antibody or antibody fragment which recognizes CEACAM1 having a heavy-chain CDR1 comprising a sequence set forth in SEQ ID NO: 1, a heavy-chain CDR2 comprising a sequence set forth in SEQ ID NO: 2 a heavy-chain CDR3 comprising a sequence set forth in SEQ ID NO: 3, a light-chain CDR1 comprising a sequence set forth in SEQ ID NO: 4, a light-chain CDR2 comprising a sequence set forth in SEQ ID NO: 5 and a light-chain CDR3 comprising a sequence set forth in SEQ ID NO:6, and analogs and derivatives thereof.
  • a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion comprising heavy chain CDRs having the sequences set forth in SEQ ID NOs: 7, 8 and 9.
  • a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion comprising heavy chain CDRs having the sequences set forth in SEQ ID NOs: 13, 14 and 15.
  • a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion comprising light chain CDRs having the sequences set forth in SEQ ID NOs: 10, 11 and 12.
  • a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the light chain CDRs having the sequences set forth in SEQ ID NOs: 16, 17 and 18.
  • a monoclonal antibody having CDR sequences set forth in SEQ ID NOs: 13, 14, 15, 16, 17, and 18.
  • a monoclonal antibody having CDR sequences set forth in SEQ ID NOs: 7, 8, 9, 10, 11, and 12.
  • Analogs and derivatives of the monoclonal antibody or fragment thereof, having at least 90% sequence identity with the antigen-binding portion of the reference sequence are also within the scope of the present invention.
  • analogs and derivatives of the monoclonal antibody or fragment thereof having at least 95% sequence identity with the antigen-binding portion of the reference sequence are provided.
  • the antibody comprises a heavy chain variable domain sequence having a sequence set forth in SEQ ID NO: 26: QVQLQQSGAELVRPGTSVKVSCKASGYAFTNNLIEWVKQRPGQGLEWIGVINPGSG DTNYNEKFKGKATLTADKSSNTAYMQLSSLTSDDSAVYFCARGDYYGGFAVDYW GQGTSVTVSS, or an analog or derivative thereof having at least 97% sequence identity with the heavy chain sequence.
  • the antibody comprises a light chain variable domain sequence having a sequence set forth in SEQ ID NO: 28: DIQMTQTTSSLSASLGDRVTISCRTSQDIGNYLNWYQQKPDGTVKLLIYYTSRLHSG VPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKSLPRTFGGGTKLEIK, or an analog or derivative thereof having at least 97% sequence identity with the light chain sequence.
  • the antibody or fragment thereof comprises a heavy chain variable domain having a sequence set forth in SEQ ID NO: 26 and a light chain variable domain having a sequence set forth in SEQ ID NO: 28, or an analog or derivative thereof having at least 97% sequence identity with the antibody or fragment sequence.
  • the present invention encompasses monoclonal antibodies isolated from hybridoma cells or other biological systems, as well as monoclonal antibodies produced recombinantly or synthetically.
  • a monoclonal antibody according to the present invention may contain a constant region from any mammalian species, including but not limited to mouse, rat and human.
  • a monoclonal antibody according to the present invention includes a chimeric antibody, a humanized antibody, a fully human antibody, a xenogeneic antibody, and an antibody fragment comprising at least the antigen-binding portion of an antibody.
  • the antibody fragment is selected from the group consisting of: Fab, Fab′, F(ab′) 2 , Fd, Fd′, Fv, dAb, isolated CDR region, single chain antibody, “diabodies”, and “linear antibodies”.
  • the present invention provides a monoclonal antibody, or an antibody fragment comprising:
  • the monoclonal antibody or fragment thereof binds with an affinity of at least about 5 ⁇ 10 ⁇ 7 M to at least two CEACAM subtypes.
  • the monoclonal antibody or fragment thereof binds with an affinity of at least about 10 ⁇ 8 M to CEACAM1.
  • the monoclonal antibody is a chimeric monoclonal antibody.
  • the chimeric antibody comprises human-derived constant regions.
  • the human constant regions of the chimeric antibody are selected from the group consisting of: human IgG1, human IgG2, and human IgG3
  • a chimeric or humanized monoclonal antibody which recognizes CEACAM1 comprising the six CDRs having sequences set forth in SEQ ID NOs: 13, 14, 15, 16, 17, and 18; or the six CDRs having sequences set forth in SEQ ID NOs: 7, 8, 9, 10, 11, and 12; and analogs and derivatives thereof having at least 95% sequence identity with said CDR sequences, and a constant region subclass selected from human IgG1, human IgG2 and human IgG3, wherein the monoclonal antibody binds with an affinity of at least about 5 ⁇ 10 ⁇ 7 M to at least two CEACAM subtypes.
  • the chimeric or humanized monoclonal antibody or fragment thereof comprises a constant region subclass of human IgG1 subtype.
  • a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion comprising a heavy chain sequence set forth in SEQ ID NO: 30.
  • a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion comprising a light chain sequence set forth in SEQ ID NO: 31.
  • a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion having a heavy chain sequence set forth in SEQ ID NO: 30, and light chain sequence set forth in SEQ ID NO: 31.
  • a monoclonal antibody which recognizes CEACAM1 is provided produced from DNA sequences of the heavy and light chains contained in a plasmid deposited on Sep. 28, 2011 under ATCC Accession Number PTA-12130 in the American Type Culture Collection (ATCC®) located at 10801 University Boulevard, Manassas, Va. 20110.
  • ATCC® American Type Culture Collection
  • Monoclonal antibodies of the present invention exhibit according to some embodiments specific binding to more than one CEACAM subtype. According to some embodiments, the monoclonal antibody binds at least two different CEACAM subtypes. According to some specific embodiments the monoclonal antibody binds to CEACAM1 and at least one of CEACAM3 and CEACAM5. According to a particular embodiment the monoclonal antibody binds to CEACAM1 and CEACAM5. According to another particular embodiment the monoclonal antibody binds to CEACAM1 and CEACAM3. According to yet other embodiments, a monoclonal antibody according to the present invention binds to CEACAM subtypes 1, 3 and 5.
  • a monoclonal antibody according to the present invention does not bind to CEACAM4 and CEACAM6.
  • the present invention provides a monoclonal antibody which recognizes CEACAM1, or a fragment thereof comprising at least the antigen-binding portion, which is capable of binding the same epitope on the CEACAM1 molecule to which a monoclonal antibody to CEACAM1 having a heavy chain sequence set forth in SEQ ID NO: 26 or SEQ ID NO: 30 and a light chain sequence set forth as SEQ ID NO: 28 or SEQ ID NO: 31, binds.
  • the monoclonal antibody is reactive with a epitope within residues 17-29 and 68-79 of human CEACAM1 having the sequences VLLLVHNLPQQLF (SEQ ID NO:32) and YPNASLLIQNVT (SEQ ID NO:33) respectively.
  • the epitope on the CEACAM1 molecule to which the monoclonal antibody binds is an epitope comprising amino acid residues within the sequences VLLLVHNLPQQLF (SEQ ID NO: 32) and YPNASLLIQNVT (SEQ ID NO: 33).
  • the monoclonal antibody according to the invention binds an epitope comprising at least four amino acids of the sequence VLLLVHNLPQQLF (SEQ ID NO: 32).
  • the monoclonal antibody according to the invention binds an epitope within sequences VLLLVHNLPQQLF (SEQ ID NO: 32) and PNASLLI (SEQ ID NO: 34).
  • the monoclonal antibody or fragment thereof binds to the same epitope of which an antibody having the six CDR sequences set forth in SEQ ID NOs: 7, 8, 9, 10, 11 and 12 binds.
  • the monoclonal antibody or fragment thereof binds to the same epitope of which an antibody having the CDR sequences set forth in SEQ ID NOs: 13, 14, 15, 16, 17 and 18 binds.
  • the monoclonal antibody or fragment thereof binds to the same epitope which is bound by an antibody produced from DNA sequences deposited on Sep. 28, 2011 under ATCC Accession Number PTA-12130.
  • the present invention provides, according to yet another aspect, an isolated peptide sequence of 6-20 amino acids comprising at least three amino acids from the sequence VLLLVHNLPQQLF (SEQ ID NO: 32) and at least three amino acids from the sequence YPNASLLIQNVT (SEQ ID NO: 33). Analogs and derivatives of said peptide, having at least 85%, 90%, 95% or 98% homology with the parent sequence are also within the scope of the present invention.
  • the isolated peptide comprises at least six amino acids from the sequence VLLLVHNLPQQLF (SEQ ID NO: 32).
  • the isolated peptide comprises the amino acids of the sequences VLLLVHNLPQQLF (SEQ ID NO: 32) and PNASLLI (SEQ ID NO: 34).
  • nucleic acid molecules encoding an antibody or antibody fragment according to the invention, having affinity and specificity for CEACAM1.
  • an isolated polynucleotide sequence encoding an antibody which recognizes CEACAM1 or an antibody fragment thereof is disclosed.
  • the isolated polynucleotide sequence comprises a DNA sequence set forth in SEQ ID NO: 25 or analog thereof having at least 90% sequence identity with said DNA sequence. According to other embodiments, the isolated polynucleotide sequence comprises a DNA sequence set forth in SEQ ID NO: 27 or analog thereof having at least 90% sequence identity with said DNA sequence.
  • Plasmids comprising at least one polynucleotide sequence encoding a monoclonal antibody or fragment thereof according to the invention are also disclosed, as well as host cells comprising these plasmids.
  • a plasmid comprising polynucleotide sequences set forth in SEQ ID NOs: 25 and 27, deposited on Sep. 28, 2011 under ATCC Accession Number PTA-12130, is disclosed.
  • the present invention is related to a pharmaceutical composition useful for preventing, attenuating or treating a disease or disorder associated with CEACAM1, CEACAM3 or CEACAM5 expression, activation or function.
  • a pharmaceutical composition according to the invention comprises a therapeutically effective amount of a monoclonal antibody which recognizes CEACAM1, CEACAM3 or CEACAM5 or an antibody fragment thereof comprising at least an antigen-binding portion; and a pharmaceutically acceptable carrier.
  • the pharmaceutical composition comprises a monoclonal antibody capable of binding to CEACAM1 with a binding affinity of at least 10 ⁇ 8 kD.
  • the pharmaceutical composition comprises a monoclonal antibody capable of binding with an affinity of at least about 10 ⁇ 8 kD to CEACAM1 and with affinity of at least about 5 ⁇ 10 ⁇ 7 M to at least one of CEACAM3 and CEACAM5.
  • the pharmaceutical composition comprises a monoclonal antibody capable of binding with an affinity of at least about 5 ⁇ 10 ⁇ 7 kD to CEACAM1, CEACAM3 and CEACAM5.
  • the disease or disorder associated with CEACAM1, CEACAM3 and/or CEACAM5 expression, activation or function is a cell proliferative disease or disorder.
  • the cell proliferative disease or disorder is cancer.
  • the cancer associated with over-expression of CEACAM5 is selected from the group consisting of: gastrointestinal, colorectal (CRC) pancreatic non-small cell lung cancer (NSCL), breast, thyroid, stomach, ovarian and uterine.
  • CRC colorectal
  • NSC pancreatic non-small cell lung cancer
  • the cancers associated with over expression of CEACAM1 are melanoma, pancreatic cancer, all types of lung cancers and myeloma.
  • the pharmaceutical composition according to the present invention may be administered as a stand alone treatment or in addition to a treatment with any other therapeutic agent.
  • antibodies according to the present invention are administered to a subject in need thereof as part of a treatment regimen in conjunction with at least one anti-cancer agent.
  • the pharmaceutical composition according to the present invention may be administered together with the other agent or separately.
  • the present invention provides diagnostic compositions useful for detecting at least one CEACAM subtype selected from the group consisting if: CEACAM1, CEACAM3 and CEACAM5, in a subject.
  • a diagnostic composition according to the invention comprises a therapeutically effective amount of a monoclonal antibody having affinity of at least about 5 ⁇ 10 ⁇ 7 M to CEACAM1, CEACAM3 or CEACAM5 or an antibody fragment thereof comprising at least an antigen-binding portion; and an optional carrier or excipient.
  • the present invention is related to a method of preventing, attenuating or treating a disease or disorder associated with expression, activation or function of CEACAM, comprising administering to a subject in need thereof a pharmaceutical composition comprising a therapeutically effective amount of an antibody to CEACAM; and a pharmaceutically acceptable carrier.
  • the disease or disorder is a cell proliferative disease or disorder.
  • the cell proliferative disease or disorder is cancer.
  • the monoclonal antibody, or fragment thereof has an affinity of at least about 10 ⁇ 8 M to CEACAM1 and the cancer is melanoma.
  • the monoclonal antibody, or fragment thereof has an affinity of at least about 5 ⁇ 10 ⁇ 7 M to CEACAM5 and the cancer is selected from the group consisting of: gastrointestinal, colorectal (CRC) pancreatic, non-small cell lung cancer (NSCL), breast, thyroid, stomach, ovarian, myeloma and uterine.
  • CRC colorectal
  • NSC non-small cell lung cancer
  • the disease or disorder associated with over expression of CEACAM1 is a viral infection.
  • the viral infection is caused by a virus selected from the group consisting of: DNA viruses, such as but not limited to cytomegalovirus (CMV), adenovirus, hepatitis virus and human papillomavirus (HPV); and RNA viruses such as but not limited to influenza virus and human immuno-deficiency virus (HIV).
  • DNA viruses such as but not limited to cytomegalovirus (CMV), adenovirus, hepatitis virus and human papillomavirus (HPV); and RNA viruses such as but not limited to influenza virus and human immuno-deficiency virus (HIV).
  • a method of immunomodulation comprising contacting a CEACAM-expressing lymphocyte with the antibody or antibody fragment.
  • a method of inhibiting migration of a CEACAM expressing tumor cell comprising contacting the CEACAM expressing tumor cell with the antibody or antibody fragment, thereby inhibiting migration of a CEACAM expressing tumor cell.
  • the tumor cell comprises a melanoma tumor cell.
  • a method of treating cancer comprising administering to a subject in need thereof a therapeutically effective amount of the antibody or antibody fragment, thereby treating the cancer in the subject.
  • a method of inhibiting CEACAM homotypic or heterotypic protein-protein interaction comprising contacting a CEACAM1-expressing lymphocyte with the antibody or antibody fragment, thereby inhibiting CEACAM1 homotypic or heterotypic protein-protein interaction.
  • the isolated antibody or antibody fragment is attached to a cytotoxic moiety.
  • the cytotoxic moiety comprises a cytotoxin, a chemokine, a chemotherapeutic composition, a pro-apoptotic, an interferon, a radioactive moiety, or combinations thereof.
  • the antibody or antibody fragment is attached to an identifiable moiety.
  • cells of the cancer are characterized by over expression of CEACAM1 as compared to unaffected cells.
  • the method of treating cancer further comprises administering to the subject lymphocytes.
  • the lymphocytes comprise T cells or NK cells. According to some embodiments, the lymphocytes express CEACAM1. According to other embodiments, the CEACAM1-expressing lymphocyte is a Tumor Infiltrating Lymphocyte (TIL). According to other embodiments, the CEACAM1-expressing lymphocyte is a cytotoxic T cell.
  • TIL Tumor Infiltrating Lymphocyte
  • the antibody of the present invention can be used to block CEACAM on either or both immune effector cells (CEACAM expressing lymphocytes e.g., tumor infiltrating cells, T cells or NK cells) and target cells (e.g., CEACAM expressing pathological cells such as cancer cells).
  • immune effector cells CEACAM expressing lymphocytes e.g., tumor infiltrating cells, T cells or NK cells
  • target cells e.g., CEACAM expressing pathological cells such as cancer cells.
  • cancer cells which are candidates for this therapy include, but are not limited to, melanoma, lung, thyroid, breast, colon, prostate, hepatic, bladder, renal, cervical, pancreatic, leukemia, lymphoma, myeloid, ovarian, uterus, sarcoma, biliary, or endometrial cells.
  • a method of rendering a CEACAM expressing tumor cell susceptible to immunomodulation comprising contacting the CEACAM expressing tumor cell (e.g., melanoma, lung, thyroid, breast, colon, prostate, hepatic, bladder, renal, cervical, pancreatic, leukemia, lymphoma, myeloid, ovarian, uterus, sarcoma, biliary or endometrial cell) with the antibody or antibody fragment described above, thereby rendering the CEACAM expressing tumor cell susceptible to immunomodulation.
  • the CEACAM expressing tumor cell e.g., melanoma, lung, thyroid, breast, colon, prostate, hepatic, bladder, renal, cervical, pancreatic, leukemia, lymphoma, myeloid, ovarian, uterus, sarcoma, biliary or endometrial cell
  • the present invention also envisages a method of immunomodulation (e.g., inhibiting CEACAM1 homotypic or heterotypic protein-protein interaction), by contacting a CEACAM1-expressing lymphocyte with the antibody or antibody fragment described herein.
  • a method of immunomodulation e.g., inhibiting CEACAM1 homotypic or heterotypic protein-protein interaction
  • the therapeutic or preventive methods of the present teachings can be effected ex-vivo (e.g., used in T cell based adoptive immunotherapy) or in-vivo.
  • Antibodies of some embodiments of the invention can have anti cancer activity which is independent from its immunomodulatory activity described above.
  • the present invention provides a method for increasing the duration or progression of response or survival of a subject having cancer, comprising administering to the subject effective amounts of a composition comprising an antibody which recognizes CEACAM and an anti-neoplastic composition, wherein said anti-neoplastic composition comprises at least one chemotherapeutic agent, whereby the co-administration of the antibody and the anti-neoplastic composition effectively increases the duration or progression of response or survival.
  • the present invention provides a method for treating a subject having cancer, comprising administering to the subject effective amounts of a composition comprising an antibody to CEACAM and an anti-neoplastic composition whereby co-administration of the antibody to CEACAM and the anti-neoplastic composition effectively increases the response incidence in the group of subjects.
  • antibodies of the present invention can also be used in diagnostic applications.
  • a method for diagnosing a cancer in a subject in need thereof comprising contacting a biological sample derived from the subject (in-vivo, in vitro or ex-vivo) with the antibody or antibody fragment described herein, wherein a complex formation beyond a predetermined threshold is indicative of the cancer in the subject.
  • cells of the cancer are characterized by over expression of CEACAM as compared to unaffected cells.
  • the diagnosed cancer is selected from the group consisting of: melanoma, pancreatic cancer, lung cancer and myeloma.
  • the measured protein is CEACAM5 and the diagnosed cancer is selected from the group consisting of: gastrointestinal, colorectal (CRC) pancreatic non-small cell lung cancer (NSCL), breast, thyroid, stomach, ovarian and uterine.
  • CRC colorectal
  • NSC pancreatic non-small cell lung cancer
  • the method of the invention is affected under conditions sufficient to form an immunocomplex; such conditions (e.g., appropriate concentrations, buffers, temperatures, reaction times) as well as methods to optimize such conditions are known to those skilled in the art, and examples are disclosed herein.
  • immunocomplex refers to a complex which comprises the antibody of the invention and the CEACAM. Determining a presence or level of the immunocomplex of the invention may be direct or by detecting an identifiable (detectable) moiety which may be attached to the antibody.
  • the level of the immunocomplex in the tested cell (e.g., a cell of a subject in need thereof) is compared to a predetermined threshold.
  • a predetermined threshold may be determined based on a known reference level and/or a level in a control cell or serum.
  • the control cell can be obtained from a control, healthy subject (e.g., a subject not suffering from the cancer) or from the same subject prior to disease initiation or following treatment.
  • the control subject is of the same species e.g. human, preferably matched with the same age, weight, sex etc. as the subject in need thereof.
  • a method for detecting or quantifying the presence of CEACAM in is provided.
  • the present invention also provides methods for diagnosing conditions associated with CEACAM expression using antibodies which recognizes CEACAM. Diagnostic methods according to the invention may be performed according to specific embodiments, in-vitro or ex-vivo.
  • the antibodies according to the present invention may be also used to configure screening methods.
  • an ELISA assay can be constructed for measuring secreted or cell associated levels of polypeptide using monoclonal and polyclonal antibodies by standard methods known in the art.
  • a method for detecting or quantifying the presence of CEACAM comprising the steps of:
  • the biological sample is a body fluid of a mammalian subject.
  • the mammalian subject is human.
  • the antibodies of the present invention may be also used in screening assays for assessing the CEACAM levels in patients and for prediction of the effectiveness of treatment.
  • the screening assays with the antibodies of the present invention may allow determination of the levels of CEACAM and therefore prediction of treatment outcome and planning of an appropriate treatment regimen.
  • the level of at least one of CEACAM1, CEACAM3 and CEACAM5 is assessed. According to a particular embodiment the level of CEACAM1 is assessed.
  • the antibody or antibody fragment is attached to an identifiable moiety.
  • the identifiable moiety can be a member of a binding pair, which is identifiable via its interaction with an additional member of the binding pair and a label which is directly visualized.
  • the member of the binding pair is an antigen which is identified by a corresponding labeled antibody.
  • the label is a fluorescent protein or an enzyme producing a colorimetric reaction.
  • Another aspect of the present invention relates to the use of an antibody to CEACAM or an antibody fragment thereof, for diagnosis or treatment of a cell proliferative or angiogenesis-related disease or disorder or a viral infection.
  • the cell proliferative disease is melanoma.
  • the cell proliferative disease or disorder is a cancer selected from the group consisting of: gastrointestinal, colorectal (CRC) pancreatic non-small cell lung cancer (NSCL), breast, thyroid, stomach, ovarian, uterine, and myeloma.
  • CRC colorectal
  • NSC pancreatic non-small cell lung cancer
  • breast thyroid
  • stomach ovarian
  • uterine myeloma
  • the present invention provides use of an antibody to CEACAM or an antibody fragment thereof comprising at least an antigen-binding portion, for preparation of a medicament for treatment of a disorder or disease associated with expression or activation of, including but not limited to cancer and viral infection.
  • the invention also relates to use of an antibody to CEACAM or an antibody fragment thereof, for the manufacture of a diagnostic composition for the diagnosis of a cell proliferative or angiogenesis-related disease or disorder or a viral infection.
  • CEACAM1 Essentially all of the uses known or envisioned in the prior art for CEACAM1, CEACAM3 and CEACAM5 antibodies can be accomplished with the antibodies of the present invention which are shown to posses improved affinity toward these proteins and superior inhibitory and in indirect immunomodulatory effects on CEACAM1 bearing cells. These uses include diagnostic, prophylactic and therapeutic techniques.
  • FIG. 1 is an SDS-PAGE image showing light and heavy chains of the chimeric antibody CM10.
  • FIG. 2 shows specific binding curve of CM10 to purified hCEACAM1.
  • FIG. 3 demonstrates specific binding of CM10 to CEACAM1 as detected by Flow Cytometry analysis.
  • FIG. 4 confirms that CM10 blocks CEACAM1-CEACAM1 interaction between cells.
  • Mouse IL-2 secretion of effectors cells (BW/221 cells expressing CEACAM1) incubated in the presence of various CM10 concentrations, was measured by ELISA.
  • FIG. 5 shows CM10 enhancement of the specific killing activity of CEACAM1-positive melanoma cells.
  • FIG. 6 demonstrates that CM10 stimulates the killing activity of tumor-infiltrating lymphocyte (TILs).
  • FIG. 7 demonstrates that CM10 enhances the killing activity of NK cells on CEACAM1 positive melanoma cell lines.
  • FIG. 8 CM10 immunomodulatory effect inhibits tumor growth in-vivo. Arrows indicate time of administration (CM10 circles, TIL triangles, CM10 and TIL open squares).
  • FIG. 9 is a schematic presentation of CM10 immunomodulatory mode of action.
  • FIG. 10 represents CEACAM1 binding intensity level in tumors as determined by anti CEACAM1 antibody.
  • FIG. 11 shows quantification of CM10 molecules bound per cell.
  • FIG. 12 confirms that CM10 has no effect on PBMC Proliferation. Results represent average proliferation rates from three donors for each treatment.
  • FIG. 13 presents FACS analysis of binding between CM10 to CEACAM family proteins.
  • CEACAM1, 5, 6 and 8 were expressed by 721.221 cells, and CEACAM3 and 4 by HEK293T cells.
  • FIG. 14 represents results of complement-dependent cytotoxicity (CDC) assay in melanoma cell lines.
  • FIG. 15 demonstrates that CM10 enhances granzyme B secretion of TIL in the presence of CEACAM1 and HLA-A2 positive melanoma cells.
  • FIG. 16 shows that CM10 blocks CEACAM1-CEACAM5 interactions.
  • FIG. 17 presents CM10 enhancement of HLA restricted T cell killing.
  • FIG. 18 demonstrates the immunomodulatory activity of CM10 inhibits tumor growth in-vivo.
  • FIG. 19 indicates that CM10 enhances the killing activity of NK cells on CEACAM1-positive pancreatic cancer cell lines COLO-357 and BXPC3.
  • FIG. 20 demonstrates that CM10 enhances granzyme B secretion of NK cells in the presence of CEACAM1-positive pancreatic cancer cell lines.
  • the present invention provides antibodies which recognize CEACAM1 comprising specific sets of CDR sequences which possess improved and unique specificity, selectivity, affinity and/or activity.
  • Antibodies according to the present invention bind CEACAM1 with higher affinity than other anti-CEACAM1 antibodies, they blocks the function of CEACAM1, while not all anti CEACAM antibodies do, and more efficiently than polyclonal anti CEACAM antibodies. Furthermore, antibodies according to the present invention are effective against cancer cells, in particular melanoma cells: the antibodies render melanoma cells more susceptible to lymphocytes, inhibit melanoma growth rate in vivo, an effect which is enhanced when the antibody is combined with adoptive T cell transfer in vivo.
  • the in vivo anti-melanoma effect of anti-CEACAM1 antibodies according to the invention is a combined direct anti-tumor effect as well as immunomodulatory effect rendering the cells more susceptible to reactive lymphocytes.
  • An antibody according to the present invention fragments and derivatives can be used as an effective tool for diagnosis, immunomodulation and cancer treatment.
  • the antibody inhibits CEACAM1 homophilic interactions, as determined by co-incubation of immune effector cells and target cells expressing CEACAM1 and assaying IL-2 secretion and by the in vitro killing assays.
  • the antibody of the present invention is shown to enhances CM10 enhances HLA restricted T cell killing and to enhance granzyme B (a serine protease involves in mediation apoptosis of the target cells) secretion from effector NK and T cells in the presence of specific target cells, thus enabling the observed enhanced killing of the target cells by the antibody. It is also inhibits the binding between CEACAM1 to CEACAM5 in a dose-dependent manner therefore can be used to treat malignancies that express high level of CEACAM5 and exploit the CEACAM1-CEACAM5 axis in order to suppress the immune cells.
  • an antibody according to the invention is effective in inhibiting melanoma cells invasion. Furthermore, in vivo administration of an antibody according to the invention, either alone or in combination with reactive lymphocytes was shown effective in inhibiting growth of melanoma tumors. The combination of adoptive human T cell transfer with monoclonal antibody injections exhibited significant synergism and strongly inhibited xenograft growth compared to the isotype control group.
  • isolated antibody or antibody fragment having the same binding specificity and selectivity to an antibody defined herein comprising an antigen recognition domain having specific CDR segments described above.
  • isolated antibody or antibody fragment is capable of binding the same epitope determinant of the CEACAM1 protein as does the antibody described above by its specific CDR segments sequences.
  • Monoclonal antibodies can be designed to selectively target tumor cells and elicit a variety of responses once bound. These agents can destruct tumor cells in different ways such as blocking tumor cell proliferation or activating the immune system.
  • Chimeric monoclonal antibodies according to the present invention were designed to specifically bind and neutralize various functions of the CEACAM1 protein and other CEACAM subtype proteins, and to induce the specific death of tumor cells. Without wishing to be bound to any theory, it is suggested that monoclonal antibodies according to the present invention act also via activation of the immune system against cancerous cells.
  • CEACAM1 is not found on normal melanocytes, but undergoes neo-expression and is widely expressed on the vast majority of metastatic melanoma specimens. It has been previously demonstrated mechanistically that CEACAM1 protects melanoma cells by inhibiting effector functions of NK cells and T cells.
  • CM10 is a chimeric monoclonal antibody which binds with high affinity to human CEACAM1.
  • CM10 efficiently blocked CEACAM1-homophilic interactions in a dose dependent manner and improves CEACAM1 positive melanoma cells killing by T cells and NK cells.
  • CM10 significantly inhibited the in-vivo growth of melanoma xenografts when administered systemically along with melanoma-reactive human T lymphocytes (tumor-infiltrating lymphocytes, TILs). Without wishing to be bound to any theory, this is in line with the suggested mechanism of action; abrogation of immune-protective interactions of the tumor cells with the activated lymphocytes.
  • CEACAM1 is expressed by a wide variety of epithelial cells, including colon, prostate, breast, kidney etc. Extensive examination of CEACAM1 expression profile on normal and malignant tissues by IHC have been performed. The expression analysis showed a strong staining of melanoma cells, as compared to no staining of the vast majority of the tissues tested in a normal human tissue. Nevertheless, some selective staining was observed in restricted sites of several organs. When more quantitative method was used to quantify the number of CM10 mAb molecules bound to malignant and normal primary cells, very low CM10 molecules could be detected in normal cells, which may indicate that CM10 binds mostly to patient's tumor cells. Furthermore it is shown that CM10 has no effect on primary cells proliferation and is completely or almost completely, unable to induce CDC or ADCC indicating the potential safety of the monoclonal antibody in human subjects.
  • CM10 has an immunomodulation activity, possible immune-related side effects, are evaluated. Following PBMC activation, CEACAM1 is upregulated on the activated lymphocytes (Gray-Owen and Blumberg 2006, Nat Rev Immunol 6, 433-46). Ex-vivo human PBMC proliferation assay revealed that CM10 has no effect on na ⁇ ve and activated PBMC proliferative response.
  • CEACAM1 blockade over abrogation of generalized inhibitory mechanisms is the expected selectivity to the vicinity of the tumor and therefore fewer adverse events compare to other general immune toxicity agents.
  • CM10 shows encouraging activity and safety profile and is a promising candidate for cancer immunotherapy and can be used as a strategy to selectively enhance the anti-tumor properties of the endogenous immune response in several malignancies, such as melanoma and non-small cell lung cancer.
  • binding to additional CEACAM subtypes increases the therapeutic profile of the antibody, thus it can be used for diagnosis and treatment of other types of malignancies which do not extensively express CEACAM1 but express CEACAM5, for example.
  • CEACAM5 has been found to be over-expressed in a high percentage of many human tumors, including 90% of gastrointestinal, colorectal (CRC) and pancreatic cancers, 70% of non-small cell lung cancer cells and 50% of breast cancers. It is also over-expressed in thyroid, stomach, ovarian and uterine cancers (Thompson, Grunert et al. 1991, J Clin Lab Anal 5, 344-66). CEACAM5 even serves as a clinical marker for liver metastasis in CRC and post-surgical surveillance of colon cancer (Duffy 2001, Clin Chem 47, 624-30).
  • CM10 is capable to bind CEACA5 is very important and can expand the possible indications that can be treated by CM10 from 4-5 types of malignancies to above 10.
  • the anti-CEACAM5 agents that have entered clinical trials include anti-CEACAM5 antibodies conjugated to toxic substances such as radioactive substances for both diagnostic purposes and for the treatment of various malignancies. It seems that even these toxic conjugated forms don't show safety problems, which can indicate that CEACAM5 is a safe target.
  • Murine IgG2a and IgG2b and human IgG1 and IgG3 share the ability to fix complement and bind to protein antigens (Hussain et al., 1995, Clinical and Diagnostic Laboratory Immunology 726-732).
  • Murine IgG1 and human IgG4 are considered to be similar because of their property of binding to mast cells.
  • Human IgG4 is the only human IgG subclass which does not activate complement and the subclasses IgG1 and 3 are the most effective in activating complements. For mouse it is the subclasses IgG2a and IgG2b which are active with IgG1 and possibly IgG3 being inactive (Clark M R., Chem Immunol. 1997; 65:88-110).
  • chimeric monoclonal antibodies which recognize CEACAM1 are of subtype mouse IgG1.
  • human equivalent of mouse IgG1 is IgG4 it would be expected to create a chimeric antibody comprising the human IgG4 constant framework.
  • chimeric monoclonal antibodies comprise a human IgG1 constant framework.
  • the present invention provides a monoclonal antibody which recognizes CEACAM1, or an antibody fragment comprising at least an antigen-binding portion thereof, comprising at least one heavy-chain CDR comprising a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, and at least one light-chain CDR comprising a sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, and analogs and derivatives thereof.
  • analogs and derivatives of the monoclonal antibody or fragment thereof, having at least 90% sequence identity with the sequence of the reference sequence are disclosed.
  • analogs and derivatives of the monoclonal antibody or fragment thereof having at least 95% sequence identity with the reference sequence are disclosed.
  • analogs and derivatives of the monoclonal antibody or fragment thereof having at least 98% sequence identity with the CDR sequence of the reference antibody are disclosed.
  • the antibody or antibody fragment comprises at least two heavy-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, and at least one light-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, and analogs and derivatives thereof having at least 97% sequence identity with the sequence of the monoclonal antibody or fragment thereof.
  • the antibody or antibody fragment comprises at least one heavy-chain CDR comprising a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, and at least two light-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, and analogs and derivatives thereof having at least 97% sequence identity with the sequence of the monoclonal antibody or fragment thereof.
  • the antibody or antibody fragment comprises at least two heavy-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, and at least two light-chain CDRs comprising a sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, and analogs and derivatives thereof having at least 97% sequence identity with the sequence of the monoclonal antibody or fragment thereof.
  • the antibody or antibody fragment comprises at least one heavy-chain CDR sequence of at least five amino acids derived from a sequence selected from the group consisting of: SEQ ID NO: 19, SEQ ID NO: 20 and SEQ ID NO: 21, and at least one light-chain CDR sequence of at least five amino acids derived from a sequence selected from the group consisting of: SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24, and analogs and derivatives thereof having at least 97% sequence identity with the sequence of the monoclonal antibody or fragment thereof.
  • the antibody binding site of the antibody or fragment thereof consists of three heavy chain CDRs selected from the group consisting of SEQ ID NOs: 7, 8, 9, 13, 14 and 15 and three light chain CDRs selected from the group consisting of SEQ ID NOs: 10, 11, 12, 16, 17, 18, and analogs and derivatives thereof having at least 97% sequence identity with the antibody binding site.
  • the antibody binding site consists of the six CDRs of SEQ ID NOs: 13, 14, 15, 16, 17, and 18.
  • the antibody binding site consists of the six CDRs of SEQ ID NOs: 7, 8, 9, 10, 11, and 12.
  • the CDR sequences according to the invention were identified using two different algorithm methods: IMGT algorithm (Lefranc et al., 1999, Nucleic Acids Research, 27, 209-212); and KABAT algorithm (Wu T T and Kabat E. A., 1970, J. Exp. Med. 132, 211-250). The sequences revealed by both methods are disclosed.
  • the heavy chain CDR1 of the antibody according to the invention or a fragment thereof is selected from NNLIE (SEQ ID NO: 7) and GYAFTNNL (SEQ ID NO: 13).
  • the heavy chain CDR2 of the antibody according to the invention or a fragment thereof is selected from VINPGSGDTNYNEKFKG (SEQ ID NO: 8) and INPGSGDT (SEQ ID NO: 14).
  • the heavy chain CDR3 of the antibody according to the invention or a fragment thereof is selected from GDYYGGFAVDY (SEQ ID NO: 9) and ARGDYYGGFAVDY (SEQ ID NO: 15).
  • the light chain CDR1 of the antibody according to the invention or a fragment thereof is selected from RTSQDIGNYLN (SEQ ID NO: 10) and QDIGNY (SEQ ID NO: 16).
  • the light chain CDR2 of the antibody according to the invention or a fragment thereof is selected from YTSRLHS (SEQ ID NO: 11) and YTS (SEQ ID NO: 17).
  • the light chain CDR3 of the antibody according to the invention or a fragment thereof is selected from QQGKSLP (SEQ ID NO: 12) and QQGKSLPRT (SEQ ID NO: 18).
  • a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the heavy chain CDRs consist of the sequences of SEQ ID NOs: 7, 8 and 9.
  • a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the heavy chain CDRs consist of the sequences of SEQ ID NOs: 13, 14 and 15.
  • a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the light chain CDRs consist of the sequences of SEQ ID NOs: 10, 11 and 12.
  • a monoclonal antibody which recognizes CEACAM1 or a fragment thereof comprising at least an antigen binding portion is provided, wherein the light chain CDRs consist of the sequences of SEQ ID NOs: 16, 17 and 18.
  • the antibody or fragment thereof comprises a heavy chain variable domain sequence consisting of the of SEQ ID NO: 26 and a light chain variable domain sequence consisting of SEQ ID NO: 28, or an analog or derivative thereof having at least 90% sequence identity with the antibody or fragment sequence.
  • the present invention provides a monoclonal antibody, or an antibody fragment comprising a set of six CDRs selected from i. SEQ ID NOs: 13, 14, 15, 16, 17, and 18 and ii. SEQ ID NOs: 7, 8, 9, 10, 11, and 12; and analogs and derivatives thereof having at least 97% sequence identity with said CDR sequences, and a framework sequence selected from mouse IgG2a, mouse IgG2b, mouse IgG3, human IgG1, human IgG2, human IgG3, wherein the monoclonal antibody binds with an affinity of at least about 5 ⁇ 10 ⁇ 7 M to at least two CEACAM subtypes.
  • a chimeric monoclonal antibody which recognizes CEACAM1 comprising at least one CDR sequence selected from the group consisting of: SEQ ID NOs: 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, and 18; and analogs and derivatives thereof having at least 97% sequence identity with said CDR sequences, and a constant region sequence selected from human IgG1, human IgG2 and human IgG3, wherein the monoclonal antibody binds with an affinity of at least about 5 ⁇ 10 ⁇ 7 M to at least two CEACAM subtypes.
  • a chimeric or humanized monoclonal antibody which recognizes CEACAM1 comprising a set of six CDRs selected from i. SEQ ID NOs: 13, 14, 15, 16, 17, and 18 and ii. SEQ ID NOs: 7, 8, 9, 10, 11, and 12; and analogs and derivatives thereof having at least 97% sequence identity with said CDR sequences, and a constant region subclass selected from human IgG1, human IgG2 and human IgG3, wherein the monoclonal antibody binds with an affinity of at least about 5 ⁇ 10 ⁇ 7 M to at least two CEACAM subtypes.
  • a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion comprising a heavy chain sequence according to SEQ ID NO: 30.
  • a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion comprising a light chain sequence according to SEQ ID NO: 31.
  • a chimeric monoclonal antibody or a fragment thereof comprising at least the antigen-binding portion comprising a human IgG1 heavy chain sequence according to SEQ ID NO: 30, and a human IgG1 light chain sequence according to SEQ ID NO: 31.
  • CEACAM1 is used to refer to the protein product of the CEACAM1 gene e.g., NP_001020083.1, NP_001703.2. In humans, 11 different CEACAM1 splice variants have been detected so far. Individual CEACAM1 isoforms differ with respect to the number of extracellular immunoglobulin-like domains (for example, CEACAM1 with four extracellular immunoglobulin-like domains is known as CEACAM1-4), membrane anchorage and/or the length of their cytoplasmic tail (for example, CEACAM1-4 with a long cytoplasmic tail is known as CEACAM1-4L and CEACAM1-4 with a short cytoplasmic tail is known as CEACAM1-4S).
  • the N-terminal domain of CEACAM1 starts immediately after the signal peptide and its structure is regarded as IgV-type.
  • the N-terminal IgV-type domain is comprised of 108 amino acids, from amino acid 35 to 142. This domain was identified as responsible for the homophilic binding activity (Watt et al., 2001, Blood. 98, 1469-79). All variants, including these splice variants are included within the term “CEACAM1”.
  • an “anti-CEACAM1 antibody”, “an antibody which recognizes CEACAM1”, “an antibody against CEACAM1”, or “an antibody to CEACAM1” is an antibody that binds to the CEACAM1 protein with sufficient affinity and specificity.
  • an antibody according to the present teachings is capable of binding CEACAM1 with a minimal affinity of about 10 ⁇ 8 or 10 ⁇ 9 M.
  • Some of the monoclonal antibodies of the present invention are capable of binding CEACAM3, 5 and/or 8 with a minimal affinity of about 5 ⁇ 10 ⁇ 7 M.
  • the anti-CEACAM1 antibody of the invention can be used as a diagnostic or therapeutic agent in targeting and interfering with diseases or conditions wherein the CEACAM1 expression or activity is involved.
  • an “antigen” is a molecule or a portion of a molecule capable of eliciting antibody formation and being bound by an antibody.
  • An antigen may have one or more than one epitope. The specific reaction referred to above is meant to indicate that the antigen will react, in a highly selective manner, with its corresponding antibody and not with the multitude of other antibodies which may be evoked by other antigens.
  • An antigen according to the present invention is a CEACAM1 protein or a fragment thereof.
  • antigenic determinant or “epitope” according to the invention refers to the region of an antigen molecule that specifically reacts with particular antibody.
  • Peptide sequences derived from an epitope can be used, alone or in conjunction with a carrier moiety, applying methods known in the art, to immunize animals and to produce additional polyclonal or monoclonal antibodies. Isolated peptides derived from an epitope may be used in diagnostic methods to detect antibodies and as therapeutic agents when inhibition of said antibodies is required.
  • Antibodies, or immunoglobulins comprise two heavy chains linked together by disulfide bonds and two light chains, each light chain being linked to a respective heavy chain by disulfide bonds in a “Y” shaped configuration.
  • Proteolytic digestion of an antibody yields Fv (Fragment variable) and Fc (fragment crystalline) domains.
  • the antigen binding domains, Fab include regions where the polypeptide sequence varies.
  • F(ab′) 2 represents two Fab′ arms linked together by disulfide bonds.
  • the central axis of the antibody is termed the Fc fragment.
  • Each heavy chain has at one end a variable domain (V H ) followed by a number of constant domains (C H ).
  • Each light chain has a variable domain (V L ) at one end and a constant domain (C L ) at its other end, the light chain variable domain being aligned with the variable domain of the heavy chain and the light chain constant domain being aligned with the first constant domain of the heavy chain (CH1).
  • the variable domains of each pair of light and heavy chains form the antigen-binding site.
  • the domains on the light and heavy chains have the same general structure and each domain comprises four framework regions, whose sequences are relatively conserved, joined by three hypervariable domains known as complementarity determining regions (CDR1-3). These domains contribute specificity and affinity of the antigen-binding site.
  • the isotype of the heavy chain determines immunoglobulin class (IgG, IgA, IgD, IgE or IgM, respectively).
  • the light chain is either of two isotypes (kappa, ⁇ or lambda, ⁇ ) found in all antibody classes.
  • antibody is used in the broadest sense and includes monoclonal antibodies (including full length or intact monoclonal antibodies), polyclonal antibodies, multivalent antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired biological activity.
  • the antibody according to the present invention is a molecule comprising at least the antigen-binding portion of an antibody.
  • Antibody or antibodies according to the invention include intact antibodies, such as polyclonal antibodies or monoclonal antibodies (mAbs), as well as proteolytic fragments thereof such as the Fab or F(ab′) 2 fragments. Further included within the scope of the invention are chimeric antibodies; human and humanized antibodies; recombinant and engineered antibodies, and fragments thereof. Furthermore, the DNA encoding the variable region of the antibody can be inserted into the DNA encoding other antibodies to produce chimeric antibodies. Single chain antibodies also fall within the scope of the present invention.
  • Antibody fragments comprise only a portion of an intact antibody, generally including an antigen binding site of the intact antibody and thus retaining the ability to bind antigen.
  • Examples of antibody fragments encompassed by the present definition include: (i) the Fab fragment, having VL, CL, VH and CH1 domains; (ii) the Fab′ fragment, which is a Fab fragment having one or more cysteine residues at the C-terminus of the CH1 domain; (iii) the Fd fragment having VH and CH1 domains; (iv) the Fd′ fragment having VH and CHI domains and one or more cysteine residues at the C-terminus of the CH1 domain; (v) the Fv fragment having the VL and VH domains of a single arm of an antibody; (vi) the dAb fragment (Ward et al., Nature 1989, 341, 544-546) which consists of a VH domain; (vii) isolated CDR regions; (viii) F(ab′) 2 fragments, a
  • Single chain antibodies can be single chain composite polypeptides having antigen binding capabilities and comprising amino acid sequences homologous or analogous to the variable regions of an immunoglobulin light and heavy chain i.e. linked V H -V L or single chain Fv (scFv).
  • a “neutralizing antibody” as used herein refers to a molecule having an antigen-binding site to a specific receptor or ligand target capable of reducing or inhibiting (blocking) activity or signaling through a receptor, as determined by in vivo or in vitro assays, as per the specification.
  • the term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigen. Furthermore, in contrast to polyclonal antibody preparations that typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
  • the modifier “monoclonal” is not to be construed as requiring production of the antibody by any particular method. mAbs may be obtained by methods known to those skilled in the art.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al., Nature 1975, 256, 495, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567).
  • the “monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al., Nature 1991, 352, 624-628 or Marks et al., J. Mol. Biol., 1991, 222:581-597, for example.
  • the mAbs of the present invention may be of any immunoglobulin class including IgG, IgM, IgE, IgA.
  • a hybridoma producing a mAb may be cultivated in vitro or in vivo.
  • High titers of mAbs can be obtained in vivo production where cells from the individual hybridomas are injected intraperitoneally into pristine-primed Balb/c mice to produce ascites fluid containing high concentrations of the desired mAbs.
  • mAbs of isotype IgM or IgG may be purified from such ascites fluids, or from culture supernatants, using column chromatography methods well known to those of skill in the art.
  • the monoclonal antibodies herein specifically include “chimeric” antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA 81:6851-6855 (1984)).
  • complementarity determining region (CDR) grafting may be performed to alter certain properties of the antibody molecule including affinity or specificity. A non-limiting example of CDR grafting is disclosed in U.S. Pat. No. 5,225,539.
  • Chimeric antibodies are molecules, the different portions of which are derived from different animal species, such as those having a variable region derived from a murine mAb and a human immunoglobulin constant region.
  • Antibodies which have variable region framework residues substantially from human antibody (termed an acceptor antibody) and complementarity determining regions substantially from a mouse antibody (termed a donor antibody) are also referred to as humanized antibodies.
  • Chimeric antibodies are primarily used to reduce immunogenicity in application and to increase yields in production, for example, where murine mAbs have higher yields from hybridomas but higher immunogenicity in humans, such that human/murine chimeric mAbs are used.
  • “Humanized” forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
  • the humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • a “human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
  • Human antibodies can be produced using various techniques known in the art. In one embodiment, the human antibody is selected from a phage library, where that phage library expresses human antibodies (Vaughan et al. Nature Biotechnology 1996 14, 309-314; Sheets et al. PNAS (USA), 1998, 95, 6157-6162); Hoogenboom and Winter, J. Mol. Biol., 1991, 227, 381; Marks et al., J. Mol.
  • Human antibodies can also be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Pat. Nos.
  • the human antibody may be prepared via immortalization of human B lymphocytes producing an antibody directed against a target antigen (such B lymphocytes may be recovered from an individual or may have been immunized in vitro). See, e.g., Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boerner et al., J. Immunol., 147 (1):86-95 (1991); and U.S. Pat. No. 5,750,373.
  • single chain variable fragment scFv
  • Single chain antibodies can be single chain composite polypeptides having antigen binding capabilities and comprising amino acid sequences homologous or analogous to the variable regions of an immunoglobulin light and heavy chain (linked V H -V L or single chain Fv (scFv)).
  • V H and V L may copy natural monoclonal antibody sequences or one or both of the chains may comprise a CDR-FR construct of the type described in U.S. Pat. No. 5,091,513, the entire contents of which are incorporated herein by reference.
  • a “molecule having the antigen-binding portion of an antibody” as used herein is intended to include not only intact immunoglobulin molecules of any isotype and generated by any animal cell line or microorganism, but also the antigen-binding reactive fraction thereof, including, but not limited to, the Fab fragment, the Fab′ fragment, the F(ab′) 2 fragment, the variable portion of the heavy and/or light chains thereof, Fab mini-antibodies (see WO 93/15210, U.S. patent application Ser. No. 08/256,790, WO 96/13583, U.S. patent application Ser. No. 08/817,788, WO 96/37621, U.S. patent application Ser. No.
  • dimeric bispecific mini-antibodies see Muller et al., 1998) and chimeric or single-chain antibodies incorporating such reactive fraction, as well as any other type of molecule or cell in which such antibody reactive fraction has been physically inserted, such as a chimeric T-cell receptor or a T-cell having such a receptor, or molecules developed to deliver therapeutic moieties by means of a portion of the molecule containing such a reactive fraction.
  • Such molecules may be provided by any known technique, including, but not limited to, enzymatic cleavage, peptide synthesis or recombinant techniques.
  • Antibodies according to the invention can be obtained by administering CEACAM1, or epitope-bearing fragments, analogs, or cells expressing, to an animal, preferably a nonhuman, using routine protocols.
  • any technique known in the art that provides antibodies produced by continuous cell line cultures can be used. Examples include various techniques, such as those in Kohler, G. and Milstein, C., Nature 256: 495-497 (1975); Kozbor et al., Immunology Today 4: 72 (1983); Cole et al., pg. 77-96 in MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc. (1985).
  • antibodies can be generated in vitro using phage display technology.
  • Such a production of recombinant antibodies is much faster compared to conventional antibody production and they can be generated against an enormous number of antigens.
  • many antigens prove to be non-immunogenic or extremely toxic, and therefore cannot be used to generate antibodies in animals.
  • affinity maturation i.e., increasing the affinity and specificity
  • large numbers of different antibodies against a specific antigen can be generated in one selection procedure.
  • To generate recombinant monoclonal antibodies one can use various methods all based on display libraries to generate a large pool of antibodies with different antigen recognition sites.
  • Such a library can be made in several ways: One can generate a synthetic repertoire by cloning synthetic CDR3 regions in a pool of heavy chain germline genes and thus generating a large antibody repertoire, from which recombinant antibody fragments with various specificities can be selected.
  • Non-human antibodies may be humanized by any methods known in the art.
  • the non-human complementarity determining regions are inserted into a human antibody or consensus antibody framework sequence. Further changes can then be introduced into the antibody framework to modulate affinity or immunogenicity.
  • U.S. Pat. No. 5,585,089 of Queen et al. discloses a humanized immunoglobulin and methods of preparing same, wherein the humanized immunoglobulin comprises complementarity determining regions (CDRs) from a donor immunoglobulin and heavy and light chain variable region frameworks from human acceptor immunoglobulin heavy and light chains, wherein said humanized immunoglobulin comprises amino acids from the donor immunoglobulin framework outside the Kabat and Chothia CDRs, wherein the donor amino acids replace corresponding amino acids in the acceptor immunoglobulin heavy or light chain frameworks.
  • CDRs complementarity determining regions
  • U.S. Pat. No. 5,225,539, of Winter also discloses an altered antibody or antigen-binding fragment thereof and methods of preparing same, wherein a variable domain of the antibody or antigen-binding fragment has the framework regions of a first immunoglobulin heavy or light chain variable domain and the complementarity determining regions of a second immunoglobulin heavy or light chain variable domain, wherein said second immunoglobulin heavy or light chain variable domain is different from said first immunoglobulin heavy or light chain variable domain in antigen binding specificity, antigen binding affinity, species, class or subclass.
  • Anti-idiotype antibodies specifically immunoreactive with an antibody of the invention are also comprehended.
  • phage display technology can be utilized to select antibody genes with binding activities towards a polypeptide of the invention either from repertoires of PCR amplified v-genes of lymphocytes from humans screened for possessing anti-CEACAM1 or from libraries (McCafferty, et al., 1990, Nature 348, 552-554; Marks, et al., 1992, Biotechnology 10, 779-783).
  • the affinity of these antibodies can also be improved by, for example, chain shuffling (Clackson et al., 1991, Nature 352:628).
  • the above-described antibodies can be employed to isolate or to identify clones expressing the polypeptides to purify the polypeptides by, for example, affinity chromatography.
  • the invention also provides conservative amino acid variants of the antibody molecules according to the invention.
  • Variants according to the invention also may be made that conserve the overall molecular structure of the encoded proteins. Given the properties of the individual amino acids comprising the disclosed protein products, some rational substitutions will be recognized by the skilled worker. Amino acid substitutions, i.e. “conservative substitutions,” may be made, for instance, on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues involved.
  • a “disorder” is any condition that would benefit from treatment with the antibody. This includes chronic and acute disorders or diseases including those pathological conditions which predispose the mammal to the disorder in question.
  • disorders to be treated herein include benign and malignant tumors; leukemias and lymphoid malignancies; neuronal, glial, astrocytal, hypothalamic and other glandular, macrophagal, epithelial, stromal and blastocoelic disorders; and inflammatory, angiogenic, immunologic disorders or hyperpermeability states.
  • the term “therapeutically effective amount” refers to an amount of a drug effective to treat a disease or disorder in a mammal.
  • the therapeutically effective amount of the drug may reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the disorder.
  • the drug may prevent growth and/or kill existing cancer cells, it may be cytostatic and/or cytotoxic.
  • efficacy in vivo can, for example, be measured by assessing the duration of survival, time to disease progression (TTP), the response rates (RR), duration of response, and/or quality of life.
  • Treatment refers to both therapeutic treatment and prophylactic or preventative measures. Those in need of treatment include those already with the disorder as well as those in which the disorder is to be prevented.
  • cancer and “cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
  • examples of cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular examples of such cancers include melanoma, lung, thyroid, breast, colon, prostate, hepatic, bladder, renal, cervical, pancreatic, leukemia, lymphoma, myeloid, ovarian, uterus, sarcoma, biliary, or endometrial cancer.
  • the antibody of the present invention is attached to a cytotoxic or therapeutic moiety.
  • the cytotoxic or therapeutic moiety can be, for example, a cytotoxic moiety, a toxic moiety, a cytokine moiety, a bi-specific antibody moiety, a cytotoxin, a chemokine, a chemotherapy, a pro-apoptotic, interferon, a radioactive moiety, or combinations thereof, examples of which are provided infra.
  • anti-neoplastic composition refers to a composition useful in treating cancer comprising at least one active therapeutic agent capable of inhibiting or preventing tumor growth or function, and/or causing destruction of tumor cells.
  • Therapeutic agents suitable in an anti-neoplastic composition for treating cancer include, but not limited to, chemotherapeutic agents, radioactive isotopes, toxins, cytokines such as interferons, and antagonistic agents targeting cytokines, cytokine receptors or antigens associated with tumor cells.
  • the therapeutic agent is a chemotherapeutic agent.
  • diagnosis refers to determining presence or absence of a pathology, classifying a pathology or a symptom, determining a severity of the pathology, monitoring pathology progression, forecasting an outcome of a pathology and/or prospects of recovery.
  • the present invention also contemplates pharmaceutical formulations for human medical use, which comprise as the active agent at least one antibody which recognizes CEACAM1, for the manufacture of a therapeutic or diagnostic composition for the treatment, diagnosis or prophylaxis of the conditions variously described herein.
  • the active agent is preferably utilized together with one or more pharmaceutically acceptable carrier(s) and optionally any other therapeutic ingredients.
  • the carrier(s) must be pharmaceutically acceptable in the sense of being compatible with the other ingredients of the formulation and not unduly deleterious to the recipient thereof.
  • the active agent is provided in an amount effective to achieve the desired pharmacological effect, as described above, and in a quantity appropriate to achieve the desired daily dose.
  • the molecules of the present invention comprising the antigen binding portion of an antibody or comprising another polypeptide including a peptidomimetic will be suspended in a sterile saline solution for therapeutic uses.
  • the pharmaceutical compositions may alternatively be formulated to control release of active ingredient (molecule comprising the antigen binding portion of an antibody) or to prolong its presence in a patient's system.
  • suitable drug delivery systems include, e.g., implantable drug release systems, hydrogels, hydroxymethylcellulose, microcapsules, liposomes, microemulsions, microspheres, and the like. Controlled release preparations can be prepared through the use of polymers to complex or adsorb the molecule according to the present invention.
  • biocompatible polymers include matrices of poly(ethylene-co-vinyl acetate) and matrices of a polyanhydride copolymer of a stearic acid dimer and sebaric acid.
  • the rate of release of the molecule according to the present invention, i.e., of an antibody or antibody fragment, from such a matrix depends upon the molecular weight of the molecule, the amount of the molecule within the matrix, and the size of dispersed particles.
  • composition of this invention may be administered by any suitable means, such as orally, topically, intranasally, subcutaneously, intramuscularly, intravenously, intra-arterially, intraarticulary, intralesionally or parenterally. Ordinarily, intravenous (i.v.), intraarticular, topical or parenteral administration will be preferred.
  • the therapeutically effective amount of the molecule according to the present invention will depend, inter alia upon the administration schedule, the unit dose of molecule administered, whether the molecule is administered in combination with other therapeutic agents, the immune status and health of the patient, the therapeutic activity of the molecule administered and the judgment of the treating physician.
  • a “therapeutically effective amount” refers to the amount of a molecule required to alleviate one or more symptoms associated with a disorder being treated over a period of time.
  • the daily dosage can generally be between about 0.01 mg to about 500 mg, preferably about 0.01 mg to about 50 mg, more preferably about 0.1 mg to about 10 mg, per kg body weight.
  • the daily dosage can generally be between about 0.001 mg to about 100 mg, preferably about 0.001 mg to about 10 mg, more preferably about 0.01 mg to about 1 mg, per kg body weight.
  • the daily dosage can be administered, for example in regimens typical of 1-4 individual administration daily.
  • Other preferred methods of administration include intraarticular administration of about 0.01 mg to about 100 mg per kg body weight.
  • Various considerations in arriving at an effective amount are described, e.g., in Goodman and Gilman's: The Pharmacological Bases of Therapeutics, 8th ed., Pergamon Press, 1990; and Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Co., Easton, Pa., 1990.
  • Suitable dosing regimens of combination chemotherapies are known in the art and described in, for example, Saltz et al. Proc ASCO 1999, 18, 233a and Douillard et al., Lancet 2000, 355, 1041-7.
  • the molecules of the present invention as active ingredients are dissolved, dispersed or admixed in an excipient that is pharmaceutically acceptable and compatible with the active ingredient as is well known.
  • excipients are, for example, water, saline, phosphate buffered saline (PBS), dextrose, glycerol, ethanol, or the like and combinations thereof.
  • PBS phosphate buffered saline
  • dextrose glycerol
  • ethanol ethanol
  • suitable carriers are well known to those skilled in the art.
  • the composition can contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents.
  • the pharmaceutical composition according to the present invention may be administered together with an anti-neoplastic composition.
  • the anti-neoplastic composition comprises at least one chemotherapeutic agent.
  • the chemotherapy agent which could be administered together with the antibody according to the present invention, or separately, may comprise any such agent known in the art exhibiting anticancer activity, including but not limited to: mitoxantrone, topoisomerase inhibitors, spindle poison vincas: vinblastine, vincristine, vinorelbine (taxol), paclitaxel, docetaxel; alkylating agents: mechlorethamine, chlorambucil, cyclophosphamide, melphalan, ifosfamide; methotrexate; 6-mercaptopurine; 5-fluorouracil, cytarabine, gemcitabin; podophyllotoxins: etoposide, irinotecan, topotecan, dacarbazin; antibiotics: doxorubicin (a)
  • the chemotherapeutic agent is selected from the group consisting of alkylating agents, antimetabolites, folic acid analogs, pyrimidine analogs, purine analogs and related inhibitors, vinca alkaloids, epipodophyllotoxins, antibiotics, L-asparaginase, topoisomerase inhibitor, interferons, platinum coordination complexes, anthracenedione substituted urea, methyl hydrazine derivatives, adrenocortical suppressant, adrenocorticosteroides, progestins, estrogens, antiestrogen, androgens, antiandrogen, and gonadotropin-releasing hormone analog.
  • the chemotherapeutic agent is selected from the group consisting of 5-fluorouracil (5-FU), leucovorin (LV), irenotecan, oxaliplatin, capecitabine, paclitaxel and doxetaxel.
  • 5-fluorouracil 5-FU
  • leucovorin LV
  • irenotecan oxaliplatin
  • capecitabine paclitaxel
  • doxetaxel Two or more chemotherapeutic agents can be used in a cocktail to be administered in combination with administration of the anti-CEACAM1 antibody.
  • Monoclonal antibodies that effectively block the CEACAM1 homophilic interactions in vitro at nanomolar concentrations were generated by immunizing mice with recombinant human CEACAM1 protein.
  • Hybridomas producing the CEACAM1-blocking antibodies were produced and re-cloned several times to yield a stable clone.
  • the DNA and amino acid sequence of one exemplary monoclonal antibody which recognizes CEACAM1 was determined by Fusion Antibodies Ltd. mRNA was extracted from the hybridoma cell pellets and total RNA was extracted from the pellets using RNA extraction protocol. RT-PCR-cDNA was created from the RNA by reverse-transcription with an oligo(dT) primer. PCR reactions using variable domain primers were used to amplify both the VH and VL regions of the monoclonal antibody DNA.
  • VH and VL products were cloned into the Invitrogen sequencing vector pCR2.1 and transformed into TOP10 for positive transformants. Selected colonies were picked and analyzed through sequencing. The resulted DNA and amino acid sequences determined are:
  • VH Variable heavy chain DNA sequence of the VH domain: (SEQ ID NO: 25) ATGGGATGGACCTTGGTCTTTCTCTTTCTCCTGTCAGTAACTGCAGGTGTTCACTC CCAGGTCCAGCTGCAGCAGTCTGGAGCTGAGCTGGTAAGGCCTGGGACTTCAGT GAAGGTGTCCTGCAAGGCTTCTGGATACGCCTTCACTAATAACTTGATAGAGTGG GTAAAACAGAGGCCTGGACAGGGCCTTGAGTGGATTGGAGTGATTAATCCTGGA AGTGGTGATACTAACTACAATGAGAAGTTCAAGGGCAAGGCAACACTGACTGCA GACAAATCCTCCAACACTGCCTACATGCAGCTCAGCAGCCTGACATCTGATGACT CTGCGGTCTATTTCTGTGCAAGAGGGGATTACTACGGTGGCTTTGCTGTGGACTA CTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAGCCAAAACGACACCCCCATCC GTTTATCCCTTGGCCCCTGGAAGCTTGGG.
  • Amino acid sequence of the VH domain (SEQ ID NO: 26) QVQLQQSGAELVRPGTSVKVSCKASGYAFTNNLIEWVKQRPGQGLEWIGVINPGSG DTNYNEKFKGKATLTADKSSNTAYMQLSSLTSDDSAVYFCARGDYYGGFAVDYWG QGTSVTVSS.
  • VL Variable light chain DNA sequence of the VL domain: (SEQ ID NO: 27) ATGGTGTCCTCAGCTCAGTTCCTTGGTCTCCTGTTGCTCTGTTTTCAAGGAACCAG ATGTGATATCCAGATGACACAGACTACATCCTCCCTGTCTGCCTCTCTGGGAGAC AGAGTCACCATCAGTTGCAGGACAAGTCAGGACATTGGCAATTATTTAAACTGG TATCAGCAGAAACCAGATGGAACTGTTAAACTCCTGATCTACTACACATCAAGAT TACACTCAGGAGTCCCATCAAGGTTCAGTGGCAGTGGGTCTGGAACAGATTATTC TCTCACCATTAGCAACCTGGAGCAAGAAGATATTGCCACTTACTTTTGCCAACAG GGTAAAAGCCTTCCTCGGACGTTCGGTGGAGGCACCAAGTTGGAAATCAAACGG GCTGATGCTGCACCAACTGTATCCATCTTCCCACCATCCAGTGAGCAGTTAACAT CTGGAGGTGCCTCAGTCGTGTGCTTCTTGA
  • Amino acid sequence of the VL domain (SEQ ID NO: 28) DIQMTQTTSSLSASLGDRVTISCRTSQDIGNYLNWYQQKPDGTVKLLIYYTSRLHSGV PSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKSLPRTFGGGTKLEIK. N-terminal amino-acid sequencing and Mass-Spectra analysis were used to confirm the VL and VH identities.
  • N-terminal sequence analysis of the light chain was performed by the Edman degradation method to verify the N-terminus sequence of the light chain of one of the monoclonal antibodies.
  • the obtained N-terminal sequence was: DIQMTQTTSS (SEQ ID NO: 29), which is in accordance with the N-terminal expected sequence based on the DNA sequence.
  • the CDR segments were identified using two different algorithm methods:
  • Table 1 summarizes the determined CDR sequences using the two methods as well as the minimal consensus sequence and combined sequence of sequences identified using both methods.
  • variable heavy and light chains (SEQ ID NOs 25 and 27) were used to construct a chimeric antibody, comprising the human IgG1 isotype constant domains and constant light (CL) human IgKappa domain.
  • the parent monoclonal antibody is mouse IgG1 and its human equivalent is IgG4, a human IgG1 framework was used to construct some of the chimeric antibodies of the present invention.
  • the DNA sequences for the light chain and heavy chain were synthesized and cloned into the expression vector pFUSION-DHFR1 under separate promoters.
  • Suspension CHO cells (Invitrogen, UK) were cultivated at 130 rpm, 8% CO 2 , 37° C. in Pro CHO 5 serum free medium (Lonza, UK) in 250 and 500 ml vented Erlenmeyer flasks (Corning, Netherlands). On the day of transfection, cells were seeded at a density of 2.0 ⁇ 106 cells/ml, 2.5 g/ml of plasmid DNA (Geneart, Germany) was transfected into the cells using Polyethylenimine (Polysciences Inc, PA, US). Transfected cultures were incubated at 130 rpm, 8% CO 2 , 37° C. for 9-10 days. Prior to harvest of the culture supernatants were spinned at 4,000 rpm for 40 minutes.
  • FIG. 1 depicts the SDS-PAGE gel image showing light and heavy chains of the chimeric antibody. MS analysis revealed that the molecular weight of CM10 heavy chain is 48.6 KDa and of light chain is 23.3 KDa.
  • CM10 has the following amino acid sequence of the heavy and light chains:
  • Heavy chain amino acid sequence (without signal peptide): (SEQ ID NO: 30) QVQLQQSGAELVRPGTSVKVSCKAS GYAFTNNL IEWVKQRPGQGLEWIGV INPGSG DT NYNEKFKGKATLTADKSSNTAYMQLSSLTSDDSAVYFC ARGDYYGGFAVDY WG QGTSVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCP PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVE
  • Variable domain is in bold, CDRs according to IMGT are underlined.
  • Light chain amino acid sequence (SEQ ID NO: 31) DIQMTQTTSSLSASLGDRVTISCRTS QDIGNY LNWYQQKPDGTVKLLIY YTS RLHSG VPSRFSGSGSGTDYSLTISNLEQEDIATYFC QQGKSLPRT FGGGTKLEIK RTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Variable domain is in bold, CDRs according to IMGT are underlined.
  • CM10 A plasmid containing the DNA sequences of the heavy and light chains of an exemplary chimeric monoclonal antibody denoted CM10 was deposited on Sep. 28, 2011 under ATCC Accession Number PTA-12130.
  • CM10 The binding specificity of CM10 to human CEACAM1 was tested in ELISA assay using purified human CEACAM1. Indirect ELISA using 23 double dilutions of CM10 were used to generate specific binding curve. The results shown in FIG. 2 represent average O.D. from triplicate ⁇ SE. Similar results were obtain from other ten independent experiments.
  • the chimeric antibody CM10 was evaluated for CEACAM1 binding by competitive ELISA and by BIAcore analysis.
  • the apparent affinity values detected for CM10 were 1.2-1.6 nM.
  • Each antibody was immobilized onto a single channel of a CM5 sensor chip of Biacore3000 instrument by NHS-EDC coupling chemistry.
  • Recombinant CEACAM1 was flowed at 50 ⁇ l/min over the chip in various concentrations (0.19, 0.39, 0.78, 1.56, 3.12, 6.25, 12.5 and 25 nM).
  • the running buffer was PBS-ET (10 mM p-buffer pH7.4, 150 mM NaCl, 3.4 mM EDTA and 0.005% tween 20).
  • the data were analyzed using BIAEvaluation software 3.0 and the KD values of CM10-CEACAM1 affinity, calculated from three independent experiments were (KD): 4.07-5.05 nM (average 4.56 nM).
  • CM10 membrane-bound endogenous CEACAM1
  • FACS analysis was performed.
  • Several human melanoma cell lines were screened for hCEACAM1 expression while 526mel cell line was used as positive control and 003mel as negative control line.
  • 526mel, 003mel, Malme 3M, Skmel 5 and A375 cell lines were stained with CM10.
  • Empty histograms represent mAb staining while darker histograms represent background staining. At least 5000 cells were used to analyze CEACAM1 expression in each histogram.
  • CM10 detects membrane-bound endogenous CEACAM1.
  • Malme3M and Skmel5 cell lines showed high expression of CEACAM1 while no expression could be detected in A375 melanoma cell-line.
  • the chimerization process was carried out successfully.
  • the chimeric antibody bind CEACAM1 in an affinity of 1.4 nM as validated by two different approaches
  • the assay which determines the ability of anti CEACAM1 mAb to blocks CEACAM1 cell-cell interaction uses murine T cells (BW cells) that are stably transfected with a chimeric molecule composed of the extracellular portion of human CEACAM1 fused to mouse z-chain (BW/CEACAM1). Engagement of CEACAM1 by co-incubation of BW/CEACAM1 cells with B cells stably transfected with CEACAM1 (221/CEACAM1), lead to the secretion of mouse IL-2, mediated by the z-chain.
  • BW cells murine T cells
  • BW/CEACAM1 chimeric molecule composed of the extracellular portion of human CEACAM1 fused to mouse z-chain
  • Effectors cells (BW, expressing CEACAM1) were incubated in the presence of CM10 or PBS for 30 minutes on ice. Following the incubation the effectors cells were co-culture over night with target cell expressing CEACAM1 (221+) or negative to CEACAM1 (221 ⁇ ). Mouse IL-2 secretion was measured by commercial ELISA. The results shown in FIG. 4 represent average IL-2 secretion from duplicate wells. As shown in the figure, upon addition of CM10, CEACAM1-mediated cell-cell interactions between T and B cells were abolished in a dose-depended manner as indicated by blockage of IL-2 secretion.
  • TILs Tumor Infiltrating Lymphocytes, derived from melanoma patients
  • TILs can destroy melanoma cells with matched HLA.
  • TILs were purchased from ELLA Institute at Shiba medical center and were growth according to the clinical lab protocols.
  • CFSE-labeled melanoma cells (SKmel5) were pre-incubated with CM10 (10 ⁇ g/ml) for 30 minutes on ice. TIL were added for additional 10 hours incubation at 37° C. Percentage of killing was determined by PI-staining of the CFSE labeled melanoma cells. Effector-to-target ratio was 5:1.
  • CFSE-labeled melanoma cells were pre-incubated with CM10 for 30 minutes on ice. TIL were added for additional 5 hours incubation at 37° C. Percentage of killing was determined by PI-staining of the CFSE labeled melanoma cells. Results represent average of % specific killing from triplicate wells ⁇ SE per treatment. Effector-to-target ratio was 5:1.
  • FIG. 5 show that the killing activity of T cells is enhanced in the presence of the anti CEACAM1 mAb, CM10. Furthermore, in assay conditions where TILs where unable to kill any melanoma cells (short incubation or low TIL ratio), addition of CM10 stimulated the killing activity of TILs while no killing could be detected with IgG1 isotype control ( FIG. 6 ).
  • NK cells Natural killer cells
  • NK cells are a type of cytotoxic lymphocyte that can destroy malignant cells by releasing small proteins called perforin and granzyme that cause the target cell to die by apoptosis.
  • NK cells can by activated throw several different pathways among them cytokines, FC receptor, and MHC class 1 absence at the target cells.
  • cytokines cytokines, FC receptor, and MHC class 1 absence at the target cells.
  • Several activation and inhibition receptors to various ligands on target cells regulate the final cytoxicity activity of NK cells.
  • NK 92MI cells are IL-2 independent NK cell line that were purchased from the ATCC.
  • NK 92MI were incubated with CM10 (0.2 ⁇ g/ml, 1 ⁇ g/ml or 5 ⁇ g/ml) or isotype match control Ab (5 ⁇ g/ml) for 30 minutes at 37° C., target cells expressing CEACAM1 were added for additional 5 hours. Percentage of killing was determined by classical LDH release assay. Results represent average of % cytotoxicity from triplicate wells ⁇ SE per treatment. Effector-to-target ratio was 2.5:1.
  • CM10 strongly enhanced the killing activity of NK cells on two melanoma cell lines expressing CEACAM1 (SKMel 5 and G361), compare to PBS or isotype match IgG. Similar results have been demonstrated in two other CEACAM1+ melanoma cell lines and in various effector-to-target (E:T) ratios.
  • ADCC Antibody-Dependent Cell-Mediated Cytotoxicity
  • CM10 The ability of CM10 to induce ADCC was examined in comparison to a positive control antibody (Polyclonal Ab anti CEACAM1 that showed ADCC activity in preliminary experiment). Isotype matched antibody served as negative control (hIgG1 K). The results indicate that CM10 do not trigger ADCC in the setting tested.
  • Complement proteins are found in the blood, and their action “complements” the work of antibodies.
  • Complement-dependent cytotoxicity (CDC) is a mechanism of killing cells in which antibody bound to the target cell surface fixes complement, results in assembly of the membrane attack complex that create pores in the target cell membrane and finally lead to cell lyses.
  • CM10 In order to access the safety profile of CM10, the ability of CM10 to induce CDC was examined in two melanoma cell lines (SKmel28 and SKmel5) expressing CEACAM1.
  • Commercial pooled human serum was used as complement proteins source.
  • the commercial monoclonal antibody Rituximab incubated with Daudi cells was used as the assay positive control and commercial IgG1K as isotype match control to CM10.
  • Melanoma cell lines—SKMEL5 and SKMEL28 or positive control Daudi cells were incubated with CM10 or Rituxiamab respectively for 1 hour in room temperature followed by the addition of normal human serum at a final concentration of 50% for 2 additional hours in a humidified incubator (37° C., 5% CO 2 ).
  • the percent of lysed cells was determined by Propidium iodine (PI) staining.
  • PI Propidium iodine
  • the purpose of this experiment is to test the direct effect of CM10 on melanoma cells in-vivo, as well as to evaluate the immunomodulatory effect, which is missing in the xenograft setting.
  • SKMel5 melanoma cells were injected SC (subcutaneous) to SCID-NOD mice and tumor volume was monitored by physical measurements. When the tumor volume reached 100 mm ⁇ 3, the mice where divided into 5 randomized groups.
  • the TILs were injected either IT (Intra Tumoral) at two different concentrations or IV (Intra Venus) at one concentration (20 ⁇ 10 ⁇ 6 per mice) while one group received only one injection and the second group received 2 TIL injections.
  • TIL injection was followed by 5 days of hIL-2 administration.
  • the calibration experiment demonstrated that TIL IV injection has higher effect on tumor size than IT administration.
  • repetitive TIL regime provides better tumor growth inhibition over single injection, as could be predicted from T cells half life. Based on this data, TIL will be administrated every 10 days by IV injections, in future xenograft experiments.
  • mice Human CEACAM1 positive SKmel5 melanoma cells were injected SC to SCID-NOD mice. When the tumors reached a volume of approximately 100 mm 3 , the mice were randomized to one of the following treatment groups: a) Weekly IV injections of PBS; b) Weekly IV injections of 0.45 mg CM10; c) Three IV injection of 20 ⁇ 10 6 anti-tumor reactive human T cells (TIL) and weekly IV injections of PBS; d) Three IV injections of 20 ⁇ 10 6 anti-tumor reactive human T cells and weekly IV injections of 0.45 mg CM10. A person blind to the experimental setting measured the tumors volume 2-3 times per week. The results of FIG. 8 represent average tumor volume ⁇ SE from 6-10 mice per group.
  • CEACAM1 is known as a regulator of lymphocyte activation.
  • CM10 is an antibody that blocks the interactions between two CEACAM1 molecules ( FIG. 4 ) and therefore eliminates the inhibitory signals mediated by CEACAM1, results in stronger cytotoxic lymphocytes activation against tumor cells ( FIGS. 6 and 7 ).
  • the in-vivo xenograft result reinforce the immunomostimulatory nature of CM10 and demonstrate significant growth inhibition of tumors in mice treated with CM10 in the presence of TIL.
  • the scheme presented in FIG. 9 demonstrates a non-limitative theory of the mode of action of CM10 that prevents CEACAM1-CEACAM1 interaction enabling activation of killing signals by immune system cells.
  • CEACAM1 In order to evade from the immune system cancer cells alter the expression of many molecules. Several evidences have showed that CEACAM1 expression is increasing during the malignance transformation of melanoma cells. According to the literature CEACAM1 is also expressed on normal cells, therefore it is important to map the possible binding sites of CM10 in the body and to identify if binding of CM10 to normal cells may lead to any undesired outcome.
  • Tissue micro array containing 100 cases of malignant melanoma (primary, metastasis) and of benign nevi were analyzed for anti CEACAM1 binding intensity by standard IHC procedure. Each core of tumor was graded from 0 to +3. As shown in FIG. 10 , binding intensity of anti-CEACAM1 mAb was seen in more than 50% of the melanoma samples and in 65% of metastatic melanoma samples.
  • the multi normal human organ tissue microarray included 33 types of normal organs, each type taken from 3 normal human individuals. The age ranged from 2-67 years, 43 specimens were derived females and 57 specimens from males. The following tissues were negative for anti-CEACAM1 mAb binding: Cerebrum, cerebellum, ovary, pancreas, parathyroid gland, hypophysis, thyroid gland, tonsil, bone marrow, spleen, thymus, lung, cardiac muscle, stomach, skeletal muscle, skin, peripheral nerves, mesothelium and retina.
  • a cell-specific staining was detected in some organs, mainly on the luminal side of epithelial cells forming ducts or glands in hollow visceral organs such as: brush border of small intestine; some apical colonic glands; Breast ductal epithelium; Liver bile canaliuculi; inner surface of renal tubules; few Endometrial glands; luminal part of Salivary gland.
  • some low cellular staining was observed in adrenal gland cortex, apical surface of prostatic glands, Lomme cells of testis and single scattered cells in the pancreas. The only cells of the immune system that found positive were neutrophils within capillaries. No staining of lymphocytes was found in tissues and lymphatic organs.
  • weak to moderate positive staining was found in endothelial cells of small blood vessels at selective sites, including: ovary, adrenal gland, kidney, and rarely in pancreas, prostate, hypophysis and endometrium.
  • the IHC analysis showed a strong anti CEACAM1 staining of melanoma cells, as compared to no staining of the vast majority of the tissues tested in a normal human tissue. Nevertheless, some selective staining was observed in the luminal aspect of epithelial cells of ducts or glands in hollow viscera. This cellular aspect is generally less accessible to an antibody administered via the peripherally blood.
  • the QuantiBRITE kit was used. Using the kit the MFI (mean florescence intensity) was directly translated to the number of molecules bound per cell.
  • MFI mean florescence intensity
  • CM10 was conjugated to a PE molecule (RPE LYNX Rapid Conjugation Kits Serotec) according to the manufacture's protocol and was used (1 ⁇ g/ml) with the QuantiBRITE PE beads kit (BD) to determine the ABC (antibodies bound per cell) by Flow cytometry.
  • RPE LYNX Rapid Conjugation Kits Serotec a PE molecule
  • BD QuantiBRITE PE beads kit
  • HUVEC and primary prostate cells were grown according to the ATCC protocols and were monitored for cell proliferation using XTT standard assay. No effect on cell-proliferation could be detected.
  • CEACAM1 is absence on normal melanocytes but undergoes neo-expression and is widely expressed on the vast majority of metastatic melanoma specimens ( FIG. 10 ), in other normal organ there is restricted expression of CEACAM1 in specific cells within several tissues.
  • CM10 has no effect on cell proliferation, CDC activity, and negligible or low ADCC activity which suggests that the binding of CM10 to non-target cells, would not result in unwanted cell outcome.
  • CM10 is an immunostimulatory antibody that blocks the interaction between two CEACAM1 molecules and by doing so mediates stimulation of lymphocytes against malignant cells. It is important to verify that the antibody will not cause unleashed stimulation of the immune system which can cause severe adverse events.
  • CEACAM1 In normal lymphocytes there is a neglect expression of CEACAM1 on the cell membrane, only following cell activation CEACAM1 is mobilized to the membrane, where it rapidly and strongly up-regulated on activated lymphocytes (Gray-Owen and Blumberg 2006, Nat Rev Immunol 6, 433-46).
  • no cross reactivity to normal lymphatic tissues Spleen, Thymus, Bone Marrow
  • lymphocytes was observed; nevertheless various in-vitro and ex-vivo immuno-toxicity analyses were performed to help in predicting potential side effects.
  • PBMC peripheral blood mononuclear cells
  • Human PBMC from 3 unrelated donors were isolated and incubated with CM10 using 3 different concentrations (2 ⁇ g/ml, 20 ⁇ g/ml or 200 ⁇ g/ml) or with a control mAb IgG1K (200 ⁇ g/ml) for 60 minutes and with eight replicate wells.
  • PHA (1 ⁇ g/ml) was added to 4 of the assay replicate wells and cells were incubated for 96 hours. 3H-Thymidine incorporation used to assay cell proliferation.
  • CM10 has no effect on the proliferation of na ⁇ ve or activated human lymphocytes.
  • cytokine secretion studies define the immunomodulatory effect of CM10 and assist in predicting potential side effects.
  • CEA family is encoded by 18 genes and 11 pseudogenes on chromosome 19q13.2.
  • Several closely related members belong to the CEACAM family (CEACAM1, 3, 4, 5, 6, 7, 8) and are differentially expressed by various human cell types.
  • the CEACAM proteins have been implicated in various adhesion mediated effects that govern the growth and differentiation of normal and cancerous cells (Gray-Owen and Blumberg 2006, Nat Rev Immunol 6, 433-46).
  • the closely related proteins in the family share a high amino acid similarity that varies from 45% up to 90% similarity between certain members.
  • CM10 conjugated to a Biotin molecule and Strep-Avidin APC as secondary agent.
  • 721.221 cells expressing CEACAM1, 5, 6, 8 or HEK 293 T transient expressing CEACAM3, 4 were stained with biotinylated CM10 (1 ⁇ g/ml) and Strep-Avidin APC as secondary agent.
  • Empty histograms represent mAb staining while red histograms represent background staining
  • FAB was calculated by dividing the MFI of the stained cells in the MFI of the background staining. The results demonstrated in FIG. 13 , clearly indicate that CM10 bind strongly to cells expressing CEACAM1. Moderate staining was observed in cells expressing CEACAM3 and 5. Weak or neglect binding was demonstrated in cells expressing CEACAM4, 6, 8.
  • CM10 is a mAb developed to recognize human CEACAM1, a protein that was found to be associated with cancer, in general, and with Melanoma in particular.
  • the over-expression of CEACAM1 has been identified in a few malignancies among them melanoma, NSCLC, Thyroid cancer and gastric cancer. The evidence indicates that over-expression of CEACAM1 can be correlated with poor prognosis in melanoma and NSCLC patients.
  • CEACAM5 has been found to be over-expressed in a high percentage of many human tumors, including 90% of gastrointestinal, colorectal (CRC) and pancreatic cancers, 70% of non-small cell lung cancer cells and 50% of breast cancers.
  • CEACAM5 even serves as a clinical marker for liver metastasis in CRC and post-surgical surveillance of colon cancer (Duffy 2001, Clin Chem 47, 624-30).
  • the evidence that CM10 is capable to bind CEACA5 is very important and can expand the possible indications that can be treated by CM10 from 4-5 types of malignancies to above 10.
  • the anti-CEACAM5 agents that have entered clinical trials include anti-CEACAM5 antibodies conjugated to toxic substances such as radioactive substances for both diagnostic purposes and for the treatment of various malignancies.
  • CEACAM5 is a safe target (Liersch, et al. 2005, J Clin Oncol 23(27), 6763-70; Ychou, et al. 2008, Clin Cancer Res 14(11), 3487-93).
  • none of these agents target the immunological regulation of tumors, which can be targeted by an antibody which can bind both CEACAM1 and CEACAM5, such as CM10.
  • the target molecule was the N-domain of the human CEACAM1 molecule having the sequence:
  • CLIPS Chemically Linked Peptides on Scaffolds
  • a 0.5 mM solution of the T2 CLIPS template 1,3-bis(bromomethyl)benzene is dissolved in ammonium bicarbonate (20 mM, pH 7.9)/acetonitrile (1:1(v/v).
  • ammonium bicarbonate (20 mM, pH 7.9)/acetonitrile (1:1(v/v).
  • This solution is added onto the peptide arrays.
  • the CLIPS template will bind to side-chains of two cysteines as present in the solid-phase bound peptides of the peptide-arrays (455 wells plate with 3 ⁇ l wells).
  • the peptide arrays are gently shaken in the solution for 30 to 60 minutes while completely covered in solution.
  • the peptide arrays are washed extensively with excess of H 2 O and sonicated in disrupt-buffer containing 1 percent SDS/0.1 percent beta-mercaptoethanol in PBS (pH 7.2) at 70° C. for 30 minutes, followed by sonication in H 2 O for another 45 minutes.
  • the T3 CLIPS carrying peptides were made in a similar way but with three cysteines.
  • a total number of 3002 peptides was synthesized that includes: CLIPS matrix set combining two different areas of the entire protein wherein native cysteines are replaced by alanines; Linear peptide sets of length 6, 10, 15, 20, 25 and 33; Linear peptide sets of length 15, where the middle residue is replaced by alanine; CLIPS conformational loop set of length 15 wherein native cysteines are replaced by alanines; and CLIPS conformational loop set of length 15 with the middle residue replace by alanine wherein native cysteines are replaced by alanines.
  • the binding of antibody to each of the synthesized peptides was tested in a PEPSCAN-based ELISA.
  • the peptide arrays were incubated with primary antibody (CM10) solution (overnight at 4° C.). After washing, the peptide arrays were incubated with a 1/1000 dilution of an antibody peroxidase conjugate for one hour at 25° C. After washing, the peroxidase substrate 2,2′-azino-di-3-ethylbenzthiazoline sulfonate (ABTS) and 2 microliters/milliliter of 3 percent H 2 O 2 were added. After one hour, the color development was measured. The color development was quantified with a charge coupled device (CCD)-camera and an image processing system.
  • CCD charge coupled device
  • the values obtained from the CCD camera range from 0 to 3000 mAU, similar to a standard 96-well plate ELISA-reader.
  • the results are quantified and stored into the Peplab database.
  • the binding values are extracted for analysis using graphical representation of data where the values taken by a variable in a two-dimensional map are represented as colors.
  • the core of the epitope of CM10.S91 consists of residues 17 VLLLVHNLPQQLF 29 .
  • a secondary binding region was observed on sequence around 68 YPNASLLIQNVT 79 .
  • the discontinuous epitope for CM10.S91 consists of 17 VLLLVHNLPQQLF 29 (core) together with 68 PNASLLI 75 (support).
  • PD markers are often proximal in a molecular pathway to the drug target and are used to measure the effect of a drug regardless of therapeutic effect.
  • Granzyme B is a serine protease that is released through cytoplasmic granules of cytotoxic T cells (CTLs) and NK cells upon recognition of specific targets. This in turn mediates the apoptosis of the target cells.
  • CTLs cytotoxic T cells
  • CM10 enhances granzyme B secretion from effector NK and T cells in the presence of specific target cells, thus enabling the observed enhanced killing of the target cells by the antibody.
  • TIL were incubated with CM10 (0.2 ⁇ g/ml, 1 ⁇ g/ml, 5 ⁇ g/ml or 10 ⁇ g/ml) or an isotype matched control Ab (IPI-Ipilimumab 10 ⁇ g/ml) for 30 minutes at 37° C.; Target positive melanoma cells expressing CEACAM1 and HLA-A2-SKMEL5, were added for an overnight incubation at effector-to-target ratio of 2.5:1.
  • Granzyme B secretion was measured by ELISA. Results represent the mean ⁇ S.E of granzyme B release values from 6 repeats per treatment. Similar results were seen in another independent experiment.
  • TIL secretes low initial levels of granzyme B that remained low in the presence of CM10 alone. Only when the target cells were added to the TIL, granzyme B elevated dramatically. Yet, CM10 was able to significantly increase granzyme B secretion above the high initial levels. Similar results were seen when NK92MI cells were used as effector cells demonstrating that CM10 can enhance granzyme B secretion form NK cells in a similar manner. The use of Granzyme B as PD marker to CM10 treatment is also examined in complementary set of experiments including in vivo models and patients specimens.
  • Carcinoembryonic antigen (CEA, CEACAM5, and CD66e) has been found to be associated with various types of cancers, particularly colorectal carcinoma, as well as gastrointestinal, pancreatic cancers, non-small cell lung cancer, breast cancers, thyroid, stomach and ovarian cancer.
  • the molecule has been developed to be a target for cancer diagnosis and therapy.
  • CEACAM1 interactions between a MHC-I-deficient melanoma cell line and NK cells significantly inhibited killing of the cancer cells by the NK cells (Markel et al J Immunol. 2002; 168:2803-2810).
  • forced expression of CEACAM5 in HLA class I-defective 721.221 cells also suppressed NK-mediated cytotoxicity (Stern et al J Immunol. 2005; 174:6692-6701), indicating CEACAM5-CEACAM1 heterophilic interactions are also able to trigger inhibitory CEACAM1 signaling in immune cells.
  • CEACAM1 positive cell line (SKMel 5) was incubated with an isotype control or CM10 in various concentrations, unbound CM10 was washed twice, followed by incubation with or without soluble biotinylated CEACAM5. The binding of the biotinylated CEACAM5 to the cells was detected by a secondary strepavidin-APC and FACS analysis. The results represent the mean of duplicate wells ⁇ SE. Similar results were obtained in two other independent experiments.
  • CM10 inhibits the binding between CEACAM1 to CEACAM5 in a dose-dependent manner Therefore CM10 can be used to treat malignancies that express high level of CEACAM5 and exploit the CEACAM1-CEACAM5 axis in order to suppress the immune cells.
  • Cytotoxic T cells destroy virally infected cells and tumor cells, and are also implicated in transplant rejection. These cells recognize their targets by binding to antigens associated with HLA molecules, which are present on the surface of nearly every cell of the body. The killing of infected or malignant cells requires the recruitment of several pathways in order to generate proper response.
  • This set of assays was sought to determine if CM10 enhances the “natural” CTL activity which is HLA restricted or alternatively causes a general stimulation of the immune system.
  • TIL were incubated with CM10 (0.2 ⁇ g/ml, 1 ⁇ g/ml, 5 ⁇ g/ml or 10 ⁇ g/ml) or an isotype matched control antibody for 30 minutes at 37° C.
  • Target melanoma cells SKMEL5, expressing CEACAM1 and HLA-A2 were pre-incubated with or without HLA-A2 blocking monoclonal antibody for 1 hour and were added for an overnight incubation at effector-to-target ratio of 2.5:1. Killing was determined by standard LDH release assay. Results represent the mean ⁇ S.E of LDH release values from 3 repeats per treatment.
  • human tumor xenograft model One of the most widely used models to assess the in vivo action of a novel anti cancer agents is the human tumor xenograft model.
  • human tumor cells are transplanted under the skin into immunocompromised mice that do not reject human cells.
  • the tumor develops over several weeks, and the response to appropriate therapeutic regimes can be studied in vivo.
  • the advantage of a model that involves treatment in early stages of tumor formation is the opportunity to examine the agent's influence in a setting that can be more similar to metastasis spread in patients and to identify the effect of the treatment on initial tumor implantation.
  • CM10 immunomodulatory activity of CM10 in vivo was therefore examined in SCID-NOD mice engrafted with human melanoma cells under prophylactic treatment regime.
  • SCID-NOD mice were randomized according to the five treatment groups indicated in FIG. 18 .
  • 6 ⁇ 10 6 SKmel5 cells (melanoma cell line) were injected SC in Day 0.
  • Mice were treated with antibodies/TIL as indicated in the figure.
  • Arrows indicate time of administration; Thin arrows represent antibodies-0.25 mg/mouse/injection (CM10, IgG control and Ipilimumab control) and wide arrows for TIL (20 ⁇ 10 ⁇ 6 cell per mouse per injection).
  • the tumors' volume was blindly measured 2-3 times per week. The results represent average tumor volumes ⁇ SE from 8-9 mice per group.
  • FIG. 18 shows that the combination of adoptive human T cell transfer with CM10 injections exhibited significant synergism and strongly inhibited xenograft growth compared to the isotype control group (69% TGI).
  • the results demonstrate that CM10 also has an effect as a single agent (45% TGI at day 32) and probably worked directly on the tumor cells or the tumors' surroundings by inhibiting proliferation, angiogenesis or through other biological pathways.
  • the tumors' total weight was determined at the experiment termination day.
  • the results obtained support the volume measurements, and show a dramatic decrease in the tumor burden of the TIL+CM10 treated group and also statistically significant reduction in the tumors' weight in the CM10 treated group.
  • CM10 Enhances the Immunomodulatory Killing Activity of NK Cells on CEACAM1-positive Pancreatic Cancer Cell Lines
  • CM10 can enhance the activity of immune cells against pancreatic cancer cell lines. Killing assays were conducted by co-culture of NK92MI cells that were pre-treated with various concentrations of CM10 with different CEACAM1 positive target pancreatic cancer cell lines. NK 92MI were incubated with CM10 (0.2 ⁇ g/ml, 1 ⁇ g/ml or 10 ⁇ g/ml) or an isotype matched control Ab (10 ⁇ g/ml) for 30 minutes at 37° C.; A.
  • Target cells expressing CEACAM1 were added for additional 5 hours at effector-to-target ratio of 2.5:1 (COLO-357) or overnight at an effector-to-target ratio of 5:1 (BXPC3). Results represent an average of % cytotoxicity ⁇ SE as determined by classical LDH release assay from triplicate wells per treatment.
  • CM10 enhanced this activity by up to 2 folds from the baseline cytotoxicity (PBS or control Ab). Similar results were seen in additional two lines.
  • CM10 Enhances Granzyme B Secretion of NK Cells in the Presence of CEACAM1-positive Pancreatic Cancer Cell Lines
  • CM10 can enhance the secretion of granzyme B from NK cells in the presence of pancreatic cancer cells.
  • NK cells were pre-treated with various concentrations of CM10 and then co-cultured with four different target pancreatic cancer cell lines. The supernatants were analyzed for granzyme B content by a specific ELISA.
  • NK 92MI were incubated with CM10 (0.2 ⁇ g/ml, 1 ⁇ g/ml or 10 ⁇ g/ml) or an isotype matched control antibody (10 ⁇ g/ml) for 30 minutes at 37° C.
  • Target pancreatic cells expressing CEACAM1 were added for additional 5 hours at effector-to-target ratio of 2.5:1 A. (COLO-357 and ASPC-1) and B. (SU8686) or E:T of 10:1 C. (BXPC3).
  • Granzyme B secretion was measured by ELISA. Results represent the mean ⁇ S.E of granzyme B release values from 2-6 repeats per treatment.
  • FIG. 20 clearly demonstrates that CM10 increases granzyme B secretion from NK cells in the presence of pancreatic cancer cells.
  • a humanized antibody typically has a human framework grafted with non human CDRs.
  • a humanized antibody has one or more amino acid sequence introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as “import” residues, which are typically taken from an “import” variable domain.
  • Humanization can be essentially performed following the method of Winter and co-workers (Jones et al., Nature, 321:522-525, 1986; Riechmann et al., Nature, 332:323-327, 1988; Verhoeyen et al., Science, 239:1534-1536, 1988), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody.
  • humanized antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
  • humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
  • variable domains both light and heavy
  • the choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is very important to reduce antigenicity.
  • the sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences.
  • the human sequence which is closest to that of the rodent is then accepted as the human framework (FR) for the humanized antibody (Sims et al., J. Immunol., 151:2296, 1993; Chothia et al., J. Mol. Biol., 196:901, 1987).
  • Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains.
  • the same framework may be used for several different humanized antibodies (Carter et al., Proc. Natl. Acad. Sci. USA, 89:4285, 1992; Presta et al., J. Immunol., 151:2623, 1993).
  • humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences.
  • Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art.
  • Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen.
  • FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved.
  • the CDR residues are directly and most substantially involved in influencing antigen binding.
  • transgenic animals e.g., mice
  • transgenic animals e.g., mice
  • JH antibody heavy-chain joining region
  • transfer of the human germ-line immunoglobulin gene array in such germ-line mutant mice will result in the production of human antibodies upon antigen challenge (e.g., Jakobovits et al., Proc. Natl. Acad. Sci.
  • Human antibodies can also be derived from phage-display libraries (Hoogenboom et al., J. Mol. Biol., 227:381, 1991; Marks et al., J. Mol. Biol., 222:581-597, 1991; Vaughan et al. Nature Biotech 14:309, 1996).
  • antibody fragments Traditionally, these fragments were derived via proteolytic digestion of intact antibodies (e.g., Morimoto et al., Journal of Biochemical and Biophysical Methods 24:107-117, 1992 and Brennan et al., Science, 229:81, 1985). However, these fragments can now be produced directly by recombinant host cells. For example, the antibody fragments can be isolated from the antibody phage libraries discussed above. Alternatively, Fab′-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab′) 2 fragments (Carter et al., Bio/Technology 10:163-167, 1992).
  • F(ab′) 2 fragments can be isolated directly from recombinant host cell culture.
  • Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
  • the antibody of choice is a single chain Fv fragment (scFv).
  • the following experiments are used to determine the potential of CM10 against viral infection.
  • the experiments include different target cells, various virus and several in vivo and in vitro models.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Microbiology (AREA)
  • Oncology (AREA)
  • Biotechnology (AREA)
  • Pathology (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Mycology (AREA)
  • Endocrinology (AREA)
  • Diabetes (AREA)
  • Virology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Communicable Diseases (AREA)
US14/350,970 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (CEACAM) Active 2033-02-06 US9771431B2 (en)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
PCT/IL2011/000808 WO2013054320A1 (en) 2011-10-11 2011-10-11 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
ILPCT/IL2011/000808 2011-10-11
WOPCT/IL2011/000808 2011-10-11
PCT/IL2012/050402 WO2013054331A1 (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/IL2012/050402 A-371-Of-International WO2013054331A1 (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/683,087 Division US20170355781A1 (en) 2011-10-11 2017-08-22 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
US15/683,087 Continuation US20170355781A1 (en) 2011-10-11 2017-08-22 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)

Publications (2)

Publication Number Publication Date
US20140271618A1 US20140271618A1 (en) 2014-09-18
US9771431B2 true US9771431B2 (en) 2017-09-26

Family

ID=48081453

Family Applications (3)

Application Number Title Priority Date Filing Date
US14/350,970 Active 2033-02-06 US9771431B2 (en) 2011-10-11 2012-10-10 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (CEACAM)
US15/683,087 Abandoned US20170355781A1 (en) 2011-10-11 2017-08-22 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
US17/037,136 Active 2034-02-28 US11891453B2 (en) 2011-10-11 2020-09-29 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (CEACAM)

Family Applications After (2)

Application Number Title Priority Date Filing Date
US15/683,087 Abandoned US20170355781A1 (en) 2011-10-11 2017-08-22 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
US17/037,136 Active 2034-02-28 US11891453B2 (en) 2011-10-11 2020-09-29 Antibodies to carcinoembryonic antigen-related cell adhesion molecule (CEACAM)

Country Status (15)

Country Link
US (3) US9771431B2 (enExample)
EP (2) EP2744829B1 (enExample)
JP (1) JP6170926B2 (enExample)
KR (1) KR102189409B1 (enExample)
CN (1) CN103987729B (enExample)
AU (1) AU2012322272C1 (enExample)
BR (1) BR112014008893B1 (enExample)
CA (1) CA2851762C (enExample)
ES (2) ES2661488T3 (enExample)
IL (1) IL231931B (enExample)
IN (1) IN2014MN00873A (enExample)
LT (1) LT2744829T (enExample)
PL (2) PL3360899T3 (enExample)
RU (1) RU2650869C2 (enExample)
WO (2) WO2013054320A1 (enExample)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022147509A1 (en) * 2021-01-04 2022-07-07 City Of Hope Prevention and treatment of steroid-resistant or gut graft-versus-host disease (gvhd)
US11427647B2 (en) * 2014-04-27 2022-08-30 Famewave Ltd. Polynucleotides encoding humanized antibodies against CEACAM1
EP3906261A4 (en) * 2018-12-07 2022-12-21 The Brigham And Women's Hospital, Inc. HUMANIZED AND AFFINITY MATURED ANTI-CEACAM1 ANTIBODIES
WO2024035662A2 (en) 2022-08-10 2024-02-15 Merck Sharp & Dohme Llc Proteins binding nkg2d, cd16, and ceacam5

Families Citing this family (117)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8735157B2 (en) * 2005-06-09 2014-05-27 Gal Markel CEACAM1 mediated protective immunity
PL2990421T3 (pl) * 2009-04-30 2018-08-31 Tel Hashomer Medical Research Infrastructure And Services Ltd. Przeciwciała anty-ceacam1 oraz sposoby ich stosowania
US9402916B2 (en) 2011-03-17 2016-08-02 The University Of Birmingham Re-directed immunotherapy
MX375221B (es) 2013-11-25 2025-03-06 Famewave Ltd Composiciones que comprenden anticuerpos anti-molécula de adhesión celular relacionada con antígeno carcinoembrionario 1 y anti-muerte celular programada para la terapia contra el cáncer.
WO2015075710A1 (en) * 2013-11-25 2015-05-28 Ccam Biotherapeutics Ltd. Compositions comprising anti-ceacam1 antibodies, lymphocyte activating agents and activated lymphocytes for cancer therapy
CA2931684C (en) 2013-12-19 2024-02-20 Novartis Ag Human mesothelin chimeric antigen receptors and uses thereof
US20170044268A1 (en) * 2013-12-23 2017-02-16 OncoMed Pharmaceuticals Immunotherapy with Binding Agents
WO2015101996A1 (en) * 2014-01-02 2015-07-09 Tel Hashomer Medical Research Infrastructure And Services Ltd. Antibodies to ceacam1 and kinase inhibitors for treating braf-mutated cells
ES2716685T3 (es) 2014-01-24 2019-06-14 Dana Farber Cancer Inst Inc Moléculas de anticuerpo para PD-1 y usos de las mismas
DK3099717T3 (da) 2014-01-31 2019-07-01 Novartis Ag Antistofmolekyler med tim-3 og anvendelser deraf
TWI777174B (zh) 2014-03-14 2022-09-11 瑞士商諾華公司 針對lag-3之抗體分子及其用途
JP2017513818A (ja) 2014-03-15 2017-06-01 ノバルティス アーゲー キメラ抗原受容体を使用する癌の処置
SI3888674T1 (sl) 2014-04-07 2024-08-30 Novartis Ag Zdravljenje raka z uporabo antigenskega himernega receptorja proti-CD19
AP2016009504A0 (en) * 2014-04-27 2016-10-31 Ccam Biotherapeutics Ltd Humanized antibodies against ceacam1
US9753036B2 (en) * 2014-04-29 2017-09-05 Edp Biotech Corporation Methods and compositions for screening and detecting biomarkers
SG10201913765YA (en) 2014-07-21 2020-03-30 Novartis Ag Treatment of cancer using a cd33 chimeric antigen receptor
WO2016014553A1 (en) 2014-07-21 2016-01-28 Novartis Ag Sortase synthesized chimeric antigen receptors
EP3193915A1 (en) 2014-07-21 2017-07-26 Novartis AG Combinations of low, immune enhancing. doses of mtor inhibitors and cars
EP4205749A1 (en) 2014-07-31 2023-07-05 Novartis AG Subset-optimized chimeric antigen receptor-containing cells
AU2015301460B2 (en) 2014-08-14 2021-04-08 Novartis Ag Treatment of cancer using GFR alpha-4 chimeric antigen receptor
RU2020117196A (ru) 2014-08-19 2020-10-15 Новартис Аг Химерный антигенный рецептор (car) против cd123 для использования в лечении злокачественных опухолей
EP3191126B1 (en) 2014-09-13 2020-05-13 Novartis AG Combination therapies of alk inhibitors
JP6839074B2 (ja) 2014-09-17 2021-03-03 ノバルティス アーゲー 養子免疫療法のためのキメラ受容体での細胞毒性細胞のターゲティング
EP3662903A3 (en) 2014-10-03 2020-10-14 Novartis AG Combination therapies
CA2963935A1 (en) 2014-10-08 2016-04-14 Novartis Ag Biomarkers predictive of therapeutic responsiveness to chimeric antigen receptor therapy and uses thereof
UY36351A (es) 2014-10-14 2016-06-01 Novartis Ag Moléculas de anticuerpo que se unen a pd-l1 y usos de las mismas
US20180334490A1 (en) 2014-12-03 2018-11-22 Qilong H. Wu Methods for b cell preconditioning in car therapy
EP3233918A1 (en) 2014-12-19 2017-10-25 Novartis AG Combination therapies
WO2016120331A1 (de) 2015-01-28 2016-08-04 Karl Sebastian Lang Agonistische anti-cd66cd66 antikörper für die antiviralen therapie
US11161907B2 (en) 2015-02-02 2021-11-02 Novartis Ag Car-expressing cells against multiple tumor antigens and uses thereof
EP3253419A1 (en) 2015-02-02 2017-12-13 The University of Birmingham Targeting moiety peptide epitope complexes having a plurality of t-cell epitopes
EP3280795B1 (en) 2015-04-07 2021-03-24 Novartis AG Combination of chimeric antigen receptor therapy and amino pyrimidine derivatives
WO2016168595A1 (en) 2015-04-17 2016-10-20 Barrett David Maxwell Methods for improving the efficacy and expansion of chimeric antigen receptor-expressing cells
EP3286211A1 (en) 2015-04-23 2018-02-28 Novartis AG Treatment of cancer using chimeric antigen receptor and protein kinase a blocker
AU2016297014B2 (en) 2015-07-21 2021-06-17 Novartis Ag Methods for improving the efficacy and expansion of immune cells
CN108025051B (zh) 2015-07-29 2021-12-24 诺华股份有限公司 包含抗pd-1抗体分子的联合疗法
EP3316902A1 (en) 2015-07-29 2018-05-09 Novartis AG Combination therapies comprising antibody molecules to tim-3
LT3317301T (lt) 2015-07-29 2021-07-26 Novartis Ag Kombinuotos terapijos, apimančios antikūno molekules prieš lag-3
US11747346B2 (en) 2015-09-03 2023-09-05 Novartis Ag Biomarkers predictive of cytokine release syndrome
SMT202200118T1 (it) 2015-11-03 2022-05-12 Janssen Biotech Inc Anticorpi che legano specificamente pd-1 e loro usi
ES2986067T3 (es) 2015-12-17 2024-11-08 Novartis Ag Moléculas de anticuerpos frente a PD-1 y usos de las mismas
UY37030A (es) 2015-12-18 2017-07-31 Novartis Ag Anticuerpos dirigidos a cd32b y métodos de uso de los mismos
US11433136B2 (en) 2015-12-18 2022-09-06 The General Hospital Corporation Polyacetal polymers, conjugates, particles and uses thereof
US11413340B2 (en) 2015-12-22 2022-08-16 Novartis Ag Mesothelin chimeric antigen receptor (CAR) and antibody against PD-L1 inhibitor for combined use in anticancer therapy
WO2017149515A1 (en) 2016-03-04 2017-09-08 Novartis Ag Cells expressing multiple chimeric antigen receptor (car) molecules and uses therefore
CN107345968A (zh) * 2016-05-05 2017-11-14 中国医学科学院基础医学研究所 Cecam1蛋白作为血清标记物在诊断肝脏疾病中的用途
CN107345969A (zh) * 2016-05-05 2017-11-14 中国医学科学院基础医学研究所 包含afp、gp73和ceacam1的血清标记物在诊断肝脏疾病中的用途
CN116769050A (zh) 2016-07-20 2023-09-19 犹他大学研究基金会 Cd229 car t细胞及其使用方法
WO2018019380A1 (de) * 2016-07-28 2018-02-01 Universität Duisburg-Essen Immunstimulatorische anti-ceacam1-antikörper
MY200337A (en) 2016-10-07 2023-12-20 Novartis Ag Nucleic acid molecules encoding chimeric antigen receptors comprising a cd20 binding domain
WO2018102786A1 (en) 2016-12-03 2018-06-07 Juno Therapeutics, Inc. Methods for modulation of car-t cells
WO2018106738A1 (en) 2016-12-05 2018-06-14 Massachusetts Institute Of Technology Brush-arm star polymers, conjugates and particles, and uses thereof
KR102019913B1 (ko) * 2017-03-24 2019-09-09 재단법인 목암생명과학연구소 항-ceacam1 항체 및 이의 용도
CN110475788A (zh) 2017-03-24 2019-11-19 财团法人牧岩生命科学研究所 抗ceacam1抗体及其应用
KR102325944B1 (ko) * 2017-11-30 2021-11-12 재단법인 목암생명과학연구소 항-ceacam1 항체 및 이의 용도
US20200179511A1 (en) 2017-04-28 2020-06-11 Novartis Ag Bcma-targeting agent, and combination therapy with a gamma secretase inhibitor
WO2018201056A1 (en) 2017-04-28 2018-11-01 Novartis Ag Cells expressing a bcma-targeting chimeric antigen receptor, and combination therapy with a gamma secretase inhibitor
KR20200054160A (ko) 2017-06-02 2020-05-19 주노 쎄러퓨티크스 인코퍼레이티드 입양 세포 요법을 사용한 치료를 위한 물품 제조 및 방법
WO2018229715A1 (en) 2017-06-16 2018-12-20 Novartis Ag Compositions comprising anti-cd32b antibodies and methods of use thereof
WO2019006427A1 (en) 2017-06-29 2019-01-03 Juno Therapeutics, Inc. WALL MODEL FOR ASSESSING TOXICITIES ASSOCIATED WITH IMMUNOTHERAPIES
WO2019081983A1 (en) 2017-10-25 2019-05-02 Novartis Ag CD32B TARGETING ANTIBODIES AND METHODS OF USE
KR20200074997A (ko) 2017-11-01 2020-06-25 주노 쎄러퓨티크스 인코퍼레이티드 B-세포 성숙 항원에 특이적인 항체 및 키메릭 항원 수용체
WO2019089858A2 (en) 2017-11-01 2019-05-09 Juno Therapeutics, Inc. Methods of assessing or monitoring a response to a cell therapy
KR102845789B1 (ko) 2017-11-01 2025-08-14 주노 쎄러퓨티크스 인코퍼레이티드 B 세포 성숙 항원에 특이적인 키메라 항원 수용체 및 암호화 폴리뉴클레오타이드
WO2019118937A1 (en) 2017-12-15 2019-06-20 Juno Therapeutics, Inc. Anti-cct5 binding molecules and methods of use thereof
US12398209B2 (en) 2018-01-22 2025-08-26 Janssen Biotech, Inc. Methods of treating cancers with antagonistic anti-PD-1 antibodies
KR20200128014A (ko) 2018-01-31 2020-11-11 셀진 코포레이션 입양 세포 요법 및 체크포인트 억제제를 이용한 병용 요법
WO2019210153A1 (en) 2018-04-27 2019-10-31 Novartis Ag Car t cell therapies with enhanced efficacy
EP3788369A1 (en) 2018-05-01 2021-03-10 Novartis Ag Biomarkers for evaluating car-t cells to predict clinical outcome
EP3798227A4 (en) * 2018-05-09 2022-03-02 Good T Cells, Inc. Epitope of regulatory t cell surface antigen and antibody specifically binding thereto
JP7438988B2 (ja) 2018-06-13 2024-02-27 ノバルティス アーゲー Bcmaキメラ抗原受容体及びその使用
CN110684107B (zh) * 2018-07-06 2021-03-23 中国人民解放军第四军医大学 抗MG7-Ag的单克隆抗体(MGd1)及其用途
CN110684108B (zh) * 2018-07-06 2021-06-04 中国人民解放军第四军医大学 抗MG7-Ag的单克隆抗体(CEA37)及其用途
WO2020069405A1 (en) 2018-09-28 2020-04-02 Novartis Ag Cd22 chimeric antigen receptor (car) therapies
US20210347851A1 (en) 2018-09-28 2021-11-11 Novartis Ag Cd19 chimeric antigen receptor (car) and cd22 car combination therapies
MX2021005024A (es) 2018-11-01 2021-07-21 Juno Therapeutics Inc Metodos de tratamiento que utilizan receptores de antigenos quimericos especificos para antigeno de maduracion de celulas b.
CA3116413A1 (en) 2018-11-01 2020-05-07 Juno Therapeutics, Inc. Chimeric antigen receptors specific for g protein-coupled receptor class c group 5 member d (gprc5d)
SG11202105084VA (en) 2018-11-16 2021-06-29 Juno Therapeutics Inc Methods of dosing engineered t cells for the treatment of b cell malignancies
FI3886875T3 (fi) 2018-11-30 2024-07-23 Juno Therapeutics Inc Adoptiivista soluterapiaa käyttäviä hoitomenetelmiä
EP3898694A4 (en) * 2018-12-20 2023-02-15 Albert Einstein College of Medicine ANTAGONIST ANTIBODIES TO HUMAN IMMUNOBAL SCORE CEACAM1 (CD66A) AND FORMULATIONS, KITS AND METHODS OF USE THEREOF
KR102166982B1 (ko) * 2019-01-24 2020-10-16 가톨릭대학교 산학협력단 간암에서 CEACAM1 및 EpCAM의 상관관계 및 이를 이용한 간암 치료효과에 대한 정보를 제공하는 방법
CN113365660A (zh) 2019-01-29 2021-09-07 朱诺治疗学股份有限公司 对受体酪氨酸激酶样孤儿受体1(ror1)具特异性的抗体及嵌合抗原受体
TW202100560A (zh) * 2019-06-04 2021-01-01 大陸商上海吉倍生物技術有限公司 一種抗ceacam5 的單殖株抗體及其製備方法和用途
WO2021024020A1 (en) 2019-08-06 2021-02-11 Astellas Pharma Inc. Combination therapy involving antibodies against claudin 18.2 and immune checkpoint inhibitors for treatment of cancer
CA3158635A1 (en) * 2019-11-07 2021-05-14 Green Cross Corporation Steric epitope of ceacam1, and anti-ceacam1 antibody, or fragment thereof, that specifically binds to same
IL292924A (en) 2019-11-26 2022-07-01 Novartis Ag Chimeric antigen receptors cd19 and cd22 and their uses
BR112022020333A2 (pt) 2020-04-10 2022-11-22 Juno Therapeutics Inc Métodos e usos relacionados à terapia celular projetada com um receptor de antígeno quimérico que alveja o antígeno de maturação de células b
EP3909601A1 (en) * 2020-05-11 2021-11-17 LeukoCom GmbH A novel antibody binding specifically to human ceacam1/3/5 and use thereof
EP4652997A3 (en) 2020-05-19 2026-03-04 Pharmacosmos Holding A/s Cyclin-dependent kinase inhibiting compounds for the treatment of medical disorders
CN111675750B (zh) * 2020-06-11 2022-08-30 中国药科大学 针对癌胚抗原相关黏附分子ceacam的肿瘤靶向肽及其应用
US20250262293A1 (en) 2020-07-07 2025-08-21 BioNTech SE Therapeutic rna for hpv-positive cancer
CN112028997B (zh) * 2020-08-04 2021-08-13 中山大学附属第五医院 抗ceacam5纳米抗体
EP4100028A4 (en) 2020-08-20 2023-07-26 A2 Biotherapeutics, Inc. Compositions and methods for treating mesothelin positive cancers
WO2022040470A1 (en) * 2020-08-20 2022-02-24 A2 Biotherapeutics, Inc. Compositions and methods for treating ceacam positive cancers
EP4097486A4 (en) 2020-08-20 2023-09-06 A2 Biotherapeutics, Inc. COMPOSITIONS AND METHODS OF TREATMENT OF POSITIVE CANCERS AT CEACAM
EP4201961A4 (en) * 2020-08-21 2024-07-03 Shanghai Genbase Biotechnology Co., Ltd. ANTIBODIES SPECIFICALLY BOUND TO GLYCOSYLATED CEACAM5
WO2022041745A1 (zh) * 2020-08-28 2022-03-03 安源医药科技(上海)有限公司 针对SARS-CoV-2冠状病毒S蛋白的抗体及其用途
JP7787164B2 (ja) 2020-09-23 2025-12-16 アキリオン ファーマシューティカルズ, インコーポレーテッド 補体媒介性障害の治療のための医薬化合物
CN116621980B (zh) * 2020-10-21 2025-10-28 北京纽安博生物技术有限公司 抗ceacam6单域抗体及其融合蛋白和应用
WO2022135667A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
TW202245808A (zh) 2020-12-21 2022-12-01 德商拜恩迪克公司 用於治療癌症之治療性rna
WO2022135666A1 (en) 2020-12-21 2022-06-30 BioNTech SE Treatment schedule for cytokine proteins
WO2022254337A1 (en) 2021-06-01 2022-12-08 Novartis Ag Cd19 and cd22 chimeric antigen receptors and uses thereof
MX2024000674A (es) 2021-07-13 2024-02-07 BioNTech SE Agentes de union multiespecificos contra cd40 y cd137 en terapia de combinacion.
TW202333802A (zh) 2021-10-11 2023-09-01 德商拜恩迪克公司 用於肺癌之治療性rna(二)
US20250381272A1 (en) 2022-06-22 2025-12-18 Juno Therapeutics, Inc. Treatment methods for second line therapy of cd19-targeted car t cells
KR20250047766A (ko) 2022-08-05 2025-04-04 주노 쎄러퓨티크스 인코퍼레이티드 Gprc5d 및 bcma에 특이적인 키메라 항원 수용체
WO2024034580A1 (ja) * 2022-08-08 2024-02-15 株式会社先端生命科学研究所 Ceacam1を検出する方法
KR20250139898A (ko) * 2022-11-10 2025-09-23 페임웨이브 리미티드 호중구 세포외 트랩 (net) 매개 활성 억제를 위한 항암배아항원 관련 세포 부착 분자 1 (ceacam1) 항체
CN120712102A (zh) 2022-12-13 2025-09-26 朱诺治疗学股份有限公司 对baff-r和cd19具特异性的嵌合抗原受体及其方法和用途
IL321098A (en) 2022-12-14 2025-07-01 Astellas Pharma Europe Bv Combination therapy including bispecific binding agents that bind to CLDN18.2- and CD3- and immune checkpoint inhibitors
WO2024165403A1 (en) 2023-02-06 2024-08-15 Philogen S.P.A. Anti-cea antibodies
CN121335923A (zh) * 2023-04-13 2026-01-13 苏州逻晟生物医药有限公司 Ceacam1靶向抗体及其用途
WO2025120866A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2
WO2026033885A1 (en) 2024-08-08 2026-02-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2
TW202541837A (zh) 2023-12-08 2025-11-01 日商安斯泰來製藥公司 含有結合至cldn18.2和cd3之雙特異性結合劑和穩定或增加cldn18.2表現之藥劑之組合療法
WO2025120867A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and anti-vegfr2 antibodies

Citations (73)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3791932A (en) 1971-02-10 1974-02-12 Akzona Inc Process for the demonstration and determination of reaction components having specific binding affinity for each other
US3839153A (en) 1970-12-28 1974-10-01 Akzona Inc Process for the detection and determination of specific binding proteins and their corresponding bindable substances
US3850578A (en) 1973-03-12 1974-11-26 H Mcconnell Process for assaying for biologically active molecules
US3850752A (en) 1970-11-10 1974-11-26 Akzona Inc Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically
US3853987A (en) 1971-09-01 1974-12-10 W Dreyer Immunological reagent and radioimmuno assay
US3867517A (en) 1971-12-21 1975-02-18 Abbott Lab Direct radioimmunoassay for antigens and their antibodies
US3879262A (en) 1972-05-11 1975-04-22 Akzona Inc Detection and determination of haptens
US3901654A (en) 1971-06-21 1975-08-26 Biological Developments Receptor assays of biologically active compounds employing biologically specific receptors
US3935074A (en) 1973-12-17 1976-01-27 Syva Company Antibody steric hindrance immunoassay with two antibodies
US3984533A (en) 1975-11-13 1976-10-05 General Electric Company Electrophoretic method of detecting antigen-antibody reaction
US3996345A (en) 1974-08-12 1976-12-07 Syva Company Fluorescence quenching with immunological pairs in immunoassays
US4034074A (en) 1974-09-19 1977-07-05 The Board Of Trustees Of Leland Stanford Junior University Universal reagent 2-site immunoradiometric assay using labelled anti (IgG)
US4036945A (en) 1976-05-03 1977-07-19 The Massachusetts General Hospital Composition and method for determining the size and location of myocardial infarcts
US4098876A (en) 1976-10-26 1978-07-04 Corning Glass Works Reverse sandwich immunoassay
US4331647A (en) 1980-03-03 1982-05-25 Goldenberg Milton David Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers
US4348376A (en) 1980-03-03 1982-09-07 Goldenberg Milton David Tumor localization and therapy with labeled anti-CEA antibody
WO1986001533A1 (en) 1984-09-03 1986-03-13 Celltech Limited Production of chimeric antibodies
US4666828A (en) 1984-08-15 1987-05-19 The General Hospital Corporation Test for Huntington's disease
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4801531A (en) 1985-04-17 1989-01-31 Biotechnology Research Partners, Ltd. Apo AI/CIII genomic polymorphisms predictive of atherosclerosis
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4879219A (en) 1980-09-19 1989-11-07 General Hospital Corporation Immunoassay utilizing monoclonal high affinity IgM antibodies
WO1990007861A1 (en) 1988-12-28 1990-07-26 Protein Design Labs, Inc. CHIMERIC IMMUNOGLOBULINS SPECIFIC FOR p55 TAC PROTEIN OF THE IL-2 RECEPTOR
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
US5011771A (en) 1984-04-12 1991-04-30 The General Hospital Corporation Multiepitopic immunometric assay
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5096815A (en) 1989-01-06 1992-03-17 Protein Engineering Corporation Generation and selection of novel dna-binding proteins and polypeptides
WO1992022653A1 (en) 1991-06-14 1992-12-23 Genentech, Inc. Method for making humanized antibodies
US5192659A (en) 1989-08-25 1993-03-09 Genetype Ag Intron sequence analysis method for detection of adjacent and remote locus alleles as haplotypes
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
WO1993015210A1 (en) 1992-01-23 1993-08-05 Merck Patent Gmbh Monomeric and dimeric antibody-fragment fusion proteins
US5272057A (en) 1988-10-14 1993-12-21 Georgetown University Method of detecting a predisposition to cancer by the use of restriction fragment length polymorphism of the gene for human poly (ADP-ribose) polymerase
US5281521A (en) 1992-07-20 1994-01-25 The Trustees Of The University Of Pennsylvania Modified avidin-biotin technique
WO1996013583A2 (en) 1994-10-20 1996-05-09 Morphosys Gesellschaft Für Proteinoptimierung Mbh Targeted hetero-association of recombinant proteins to multi-functional complexes
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1996037621A2 (en) 1995-05-23 1996-11-28 Morphosys Gesellschaft Für Proteinoptimierung Mbh Multimeric proteins
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
WO1999052552A1 (en) 1998-04-15 1999-10-21 Brigham & Women's Hospital, Inc. T cell inhibitory receptor compositions and uses thereof
US6013772A (en) 1986-08-13 2000-01-11 Bayer Corporation Antibody preparations specifically binding to unique determinants of CEA antigens or fragments thereof and use of the antibody preparations in immunoassays
WO2001013937A1 (en) 1999-08-26 2001-03-01 Skubitz Keith M Peptides capable of modulating the function of cd66 (ceacam) family members
WO2002012535A1 (en) 2000-08-07 2002-02-14 Karolinska Innovations Ab Use of anti-ceacam antibodies for stimulating b cells in the production of monoclonal antibodies or in immunotherapy
WO2002068601A2 (en) 2001-02-28 2002-09-06 Skubitz Keith M Small peptides capable of modulating the function of cd66 (ceacam) family members
US20030022292A1 (en) 2001-06-07 2003-01-30 Gray-Owen Scott D. Ligation of CEACAM1
US20030190600A1 (en) 2002-04-05 2003-10-09 Dana-Faber Cancer Institute Carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1) structure and uses thereof in drug identification and screening
WO2003087319A2 (en) 2002-04-05 2003-10-23 The Regents Of The University Of Colorado Carcinoembryonic antigen cell adhesion molecule 1 (ceacam1) structure and uses thereof in drug identification and screening
WO2003093315A2 (es) 2002-04-29 2003-11-13 Centro De Ingeniería Genética Y Biotecnología Fragmentos de anticuerpos específicos para el antígeno carcinoembrionario humano (cea)
US20040047858A1 (en) 2002-09-11 2004-03-11 Blumberg Richard S. Therapeutic anti-BGP(C-CAM1) antibodies and uses thereof
WO2004032857A2 (en) 2002-10-08 2004-04-22 Immunomedics, Inc. Antibody therapy
US20050107324A1 (en) 2003-07-12 2005-05-19 Bennett C. F. Modulation of CEACAM1 expression
US20060039913A1 (en) * 2004-06-30 2006-02-23 Anuk Das Anti-MCP-1 antibodies, compositions, methods and uses
US20060058257A1 (en) 2001-08-03 2006-03-16 Christoph Wagener Influencing angiogenesis using CD66a
EP1133311B1 (de) 1998-11-16 2006-10-11 Christoph Wagener BEEINFLUSSUNG DER ANGIOGENESE DURCH CD66a
US20070071758A1 (en) 2005-06-09 2007-03-29 Gal Markel CEACAM1 Based Cancer Therapy and Diagnosis
EP1276770B1 (de) 2000-04-05 2007-10-17 Scintec Diagnostics Gmbh Proteine mit hoher immunreaktivität sowie ein verfahren zu ihrer herstellung
WO2008029271A2 (en) 2006-02-27 2008-03-13 Gal Markel Ceacam based antibacterial agents
US20090136528A1 (en) 2007-07-27 2009-05-28 Immatics Biotechnologies Gmhh Novel immunogenic epitope for immunotherapy
US7579392B2 (en) 1994-10-21 2009-08-25 The Dow Chemical Company Low-viscosity epoxy resin, phenolic chain extender, catalyst and boron inhibitor
US20090226444A1 (en) 2005-12-21 2009-09-10 Micromet Ag Pharmaceutical antibody compositions with resistance to soluble cea
WO2009141679A2 (en) 2007-11-05 2009-11-26 Gal Markel Ceacam1 based point-of-care cancer diagnostic
WO2010125571A1 (en) 2009-04-30 2010-11-04 Tel Hashomer Medical Research Infrastructure And Services Ltd. Anti ceacam1 antibodies and methods of using same
WO2011010309A1 (en) 2009-07-21 2011-01-27 Tel Hashomer Medical Research Infrastructure And Services Ltd. A method of diagnosing cancer
US20110104148A1 (en) 2009-08-31 2011-05-05 Roche Glycart Ag Antibodies to Carcinoembryonic Antigen (CEA), Methods of Making Same, and Uses Thereof
EP1558284B1 (en) 2002-10-08 2013-09-11 Immunomedics, Inc. Combination therapy with naked class iii anti-cea monoclonal antibodies and therapeutic agents
WO2014059251A1 (en) 2012-10-12 2014-04-17 The Brigham And Women's Hospital, Inc. Enhancement of the immune response

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5719867A (en) 1995-06-30 1998-02-17 Scientific-Atlanta, Inc. Plural telephony channel baseband signal demodulator for a broadband communications system
JP2007515949A (ja) 2003-11-13 2007-06-21 ジェネンテック・インコーポレーテッド スクリーニングアッセイ及び腫瘍治療の方法
WO2007071426A1 (en) 2005-12-21 2007-06-28 Micromet Ag Pharmaceutical compositions with resistance to soluble cea
JP5115561B2 (ja) 2008-01-17 2013-01-09 日本電気株式会社 無線通信端末、方法、プログラム、記録媒体、および無線通信システム
US8580714B2 (en) 2009-10-14 2013-11-12 Janssen Biotech, Inc. Methods of affinity maturing antibodies
US8256790B2 (en) 2010-05-26 2012-09-04 William Olen Fortner Adjustable receiver hitch system
PL2800196T3 (pl) 2011-12-27 2019-05-31 Lg Chemical Ltd Litowa bateria akumulatorowa i sposób jej wytwarzania

Patent Citations (89)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3850752A (en) 1970-11-10 1974-11-26 Akzona Inc Process for the demonstration and determination of low molecular compounds and of proteins capable of binding these compounds specifically
US3839153A (en) 1970-12-28 1974-10-01 Akzona Inc Process for the detection and determination of specific binding proteins and their corresponding bindable substances
US3791932A (en) 1971-02-10 1974-02-12 Akzona Inc Process for the demonstration and determination of reaction components having specific binding affinity for each other
US3901654A (en) 1971-06-21 1975-08-26 Biological Developments Receptor assays of biologically active compounds employing biologically specific receptors
US3853987A (en) 1971-09-01 1974-12-10 W Dreyer Immunological reagent and radioimmuno assay
US3867517A (en) 1971-12-21 1975-02-18 Abbott Lab Direct radioimmunoassay for antigens and their antibodies
US3879262A (en) 1972-05-11 1975-04-22 Akzona Inc Detection and determination of haptens
US3850578A (en) 1973-03-12 1974-11-26 H Mcconnell Process for assaying for biologically active molecules
US3935074A (en) 1973-12-17 1976-01-27 Syva Company Antibody steric hindrance immunoassay with two antibodies
US3996345A (en) 1974-08-12 1976-12-07 Syva Company Fluorescence quenching with immunological pairs in immunoassays
US4034074A (en) 1974-09-19 1977-07-05 The Board Of Trustees Of Leland Stanford Junior University Universal reagent 2-site immunoradiometric assay using labelled anti (IgG)
US3984533A (en) 1975-11-13 1976-10-05 General Electric Company Electrophoretic method of detecting antigen-antibody reaction
US4036945A (en) 1976-05-03 1977-07-19 The Massachusetts General Hospital Composition and method for determining the size and location of myocardial infarcts
US4098876A (en) 1976-10-26 1978-07-04 Corning Glass Works Reverse sandwich immunoassay
US4331647A (en) 1980-03-03 1982-05-25 Goldenberg Milton David Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers
US4348376A (en) 1980-03-03 1982-09-07 Goldenberg Milton David Tumor localization and therapy with labeled anti-CEA antibody
US4879219A (en) 1980-09-19 1989-11-07 General Hospital Corporation Immunoassay utilizing monoclonal high affinity IgM antibodies
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5011771A (en) 1984-04-12 1991-04-30 The General Hospital Corporation Multiepitopic immunometric assay
US4666828A (en) 1984-08-15 1987-05-19 The General Hospital Corporation Test for Huntington's disease
WO1986001533A1 (en) 1984-09-03 1986-03-13 Celltech Limited Production of chimeric antibodies
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683202B1 (enExample) 1985-03-28 1990-11-27 Cetus Corp
US4801531A (en) 1985-04-17 1989-01-31 Biotechnology Research Partners, Ltd. Apo AI/CIII genomic polymorphisms predictive of atherosclerosis
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US6013772A (en) 1986-08-13 2000-01-11 Bayer Corporation Antibody preparations specifically binding to unique determinants of CEA antigens or fragments thereof and use of the antibody preparations in immunoassays
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5272057A (en) 1988-10-14 1993-12-21 Georgetown University Method of detecting a predisposition to cancer by the use of restriction fragment length polymorphism of the gene for human poly (ADP-ribose) polymerase
US5693761A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Polynucleotides encoding improved humanized immunoglobulins
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
WO1990007861A1 (en) 1988-12-28 1990-07-26 Protein Design Labs, Inc. CHIMERIC IMMUNOGLOBULINS SPECIFIC FOR p55 TAC PROTEIN OF THE IL-2 RECEPTOR
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5096815A (en) 1989-01-06 1992-03-17 Protein Engineering Corporation Generation and selection of novel dna-binding proteins and polypeptides
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
US5192659A (en) 1989-08-25 1993-03-09 Genetype Ag Intron sequence analysis method for detection of adjacent and remote locus alleles as haplotypes
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
WO1992022653A1 (en) 1991-06-14 1992-12-23 Genentech, Inc. Method for making humanized antibodies
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
WO1993015210A1 (en) 1992-01-23 1993-08-05 Merck Patent Gmbh Monomeric and dimeric antibody-fragment fusion proteins
US5910573A (en) 1992-01-23 1999-06-08 Merck Patent Gesellschaft Mit Beschrankter Haftung Monomeric and dimeric antibody-fragment fusion proteins
US5281521A (en) 1992-07-20 1994-01-25 The Trustees Of The University Of Pennsylvania Modified avidin-biotin technique
WO1996013583A2 (en) 1994-10-20 1996-05-09 Morphosys Gesellschaft Für Proteinoptimierung Mbh Targeted hetero-association of recombinant proteins to multi-functional complexes
US7579392B2 (en) 1994-10-21 2009-08-25 The Dow Chemical Company Low-viscosity epoxy resin, phenolic chain extender, catalyst and boron inhibitor
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
WO1996037621A2 (en) 1995-05-23 1996-11-28 Morphosys Gesellschaft Für Proteinoptimierung Mbh Multimeric proteins
WO1999052552A1 (en) 1998-04-15 1999-10-21 Brigham & Women's Hospital, Inc. T cell inhibitory receptor compositions and uses thereof
US20080102071A1 (en) 1998-04-15 2008-05-01 Blumberg Richard S T cell inhibitory receptor compositions and uses thereof
US20020028203A1 (en) 1998-04-15 2002-03-07 Blumberg Richard S. T cell inhibitory receptor compositions and uses thereof
US20050169922A1 (en) 1998-04-15 2005-08-04 Blumberg Richard S. T cell inhibitory receptor compositions and uses thereof
EP1133311B1 (de) 1998-11-16 2006-10-11 Christoph Wagener BEEINFLUSSUNG DER ANGIOGENESE DURCH CD66a
WO2001013937A1 (en) 1999-08-26 2001-03-01 Skubitz Keith M Peptides capable of modulating the function of cd66 (ceacam) family members
US7820410B2 (en) 2000-04-05 2010-10-26 Scintec Diagnostics Gmbh Proteins with high immunoreactivity and method for their production
EP1276770B1 (de) 2000-04-05 2007-10-17 Scintec Diagnostics Gmbh Proteine mit hoher immunreaktivität sowie ein verfahren zu ihrer herstellung
WO2002012535A1 (en) 2000-08-07 2002-02-14 Karolinska Innovations Ab Use of anti-ceacam antibodies for stimulating b cells in the production of monoclonal antibodies or in immunotherapy
US20040214184A1 (en) 2001-02-28 2004-10-28 Skubitz Keith M Small peptides capable of modulating the function of cd66 (ceacam) family members
WO2002068601A2 (en) 2001-02-28 2002-09-06 Skubitz Keith M Small peptides capable of modulating the function of cd66 (ceacam) family members
US20030022292A1 (en) 2001-06-07 2003-01-30 Gray-Owen Scott D. Ligation of CEACAM1
US20060058257A1 (en) 2001-08-03 2006-03-16 Christoph Wagener Influencing angiogenesis using CD66a
WO2003087319A2 (en) 2002-04-05 2003-10-23 The Regents Of The University Of Colorado Carcinoembryonic antigen cell adhesion molecule 1 (ceacam1) structure and uses thereof in drug identification and screening
US20030190600A1 (en) 2002-04-05 2003-10-09 Dana-Faber Cancer Institute Carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1) structure and uses thereof in drug identification and screening
WO2003093315A2 (es) 2002-04-29 2003-11-13 Centro De Ingeniería Genética Y Biotecnología Fragmentos de anticuerpos específicos para el antígeno carcinoembrionario humano (cea)
US20040047858A1 (en) 2002-09-11 2004-03-11 Blumberg Richard S. Therapeutic anti-BGP(C-CAM1) antibodies and uses thereof
WO2004032857A2 (en) 2002-10-08 2004-04-22 Immunomedics, Inc. Antibody therapy
US8062636B2 (en) 2002-10-08 2011-11-22 Immunomedics, Inc. Antibody therapy
EP1558284B1 (en) 2002-10-08 2013-09-11 Immunomedics, Inc. Combination therapy with naked class iii anti-cea monoclonal antibodies and therapeutic agents
US20050107324A1 (en) 2003-07-12 2005-05-19 Bennett C. F. Modulation of CEACAM1 expression
US20060039913A1 (en) * 2004-06-30 2006-02-23 Anuk Das Anti-MCP-1 antibodies, compositions, methods and uses
US20070110668A1 (en) 2005-06-09 2007-05-17 Gal Markel Modulation of Immunity and Ceacam1 Activity
US20070071758A1 (en) 2005-06-09 2007-03-29 Gal Markel CEACAM1 Based Cancer Therapy and Diagnosis
US20080108140A1 (en) 2005-06-09 2008-05-08 Gal Markel CEACAM1 Mediated Protective Immunity
WO2007063424A2 (en) 2005-06-09 2007-06-07 Gal Markel The modulation of immunity and ceacam1 activity
US20090226444A1 (en) 2005-12-21 2009-09-10 Micromet Ag Pharmaceutical antibody compositions with resistance to soluble cea
WO2008029271A2 (en) 2006-02-27 2008-03-13 Gal Markel Ceacam based antibacterial agents
US20090136528A1 (en) 2007-07-27 2009-05-28 Immatics Biotechnologies Gmhh Novel immunogenic epitope for immunotherapy
WO2009141679A2 (en) 2007-11-05 2009-11-26 Gal Markel Ceacam1 based point-of-care cancer diagnostic
WO2010125571A1 (en) 2009-04-30 2010-11-04 Tel Hashomer Medical Research Infrastructure And Services Ltd. Anti ceacam1 antibodies and methods of using same
US8598322B2 (en) 2009-04-30 2013-12-03 Tel Hashomer Medical Research Infrastucture and Services Ltd. Anti CEACAM1 antibodies and methods of using same
US20140120554A1 (en) * 2009-04-30 2014-05-01 Ramot At Tel Aviv University Ltd. Anti ceacam1 antibodies and methods of using same
WO2011010309A1 (en) 2009-07-21 2011-01-27 Tel Hashomer Medical Research Infrastructure And Services Ltd. A method of diagnosing cancer
US20110104148A1 (en) 2009-08-31 2011-05-05 Roche Glycart Ag Antibodies to Carcinoembryonic Antigen (CEA), Methods of Making Same, and Uses Thereof
WO2014059251A1 (en) 2012-10-12 2014-04-17 The Brigham And Women's Hospital, Inc. Enhancement of the immune response

Non-Patent Citations (104)

* Cited by examiner, † Cited by third party
Title
Albarran-Somoza et al., (2006) CEACAM1 in cervical cancer and precursor lesions: association with human papillomavirus infection. J Histochem Cytochem 54(12): 1393-9.
Azuz-Lieberman et al., (2005) The involvement of NK cells in ankylosing spondylitis. Int Immunol 17(7): 837-45.
Balmaña et al., (2009) BRCA in breast cancer: ESMO clinical recommendations. Ann Oncol 20 (Suppl 4): 19-20.
Bartolazzi et al., (2008) Galectin-3-expression analysis in the surgical selection of follicular thyroid nodules with indeterminate fine-needle aspiration cytology: a prospective multicentre study. The lancet oncology, 9(6), 543-549.
Besser et al., (2009) Minimally cultured or selected autologous tumor-infiltrating lymphocytes after a lympho-depleting chemotherapy regimen in metastatic melanoma patients. J Immunother 32(4): 415-423.
Besser et al., (2010) Clinical responses in a phase II study using adoptive transfer of short-term cultured tumor infiltration lymphocytes in metastatic melanoma patients. Clin Cancer Res 16(9): 2646-2655.
Bird et al., (1988) Single-chain antigen-binding proteins. Science 242(4877): 423-6.
Boerner et al., (1991) Production of antigen-specific human monoclonal antibodies from in vitro-primed human splenocytes. J Immunol 147(1): 86-95.
Brand et al., (2006) Prospect for anti-HER2 receptor therapy in breast cancer. Anticancer Res 26(1B): 463-470.
Brennan et al., (1985) Preparation of bispecific antibodies by chemical recombination of monoclonal immunoglobulin G1 fragments. Science 229(4708): 81-3.
Brüggemann et al., (1993) Designer mice: the production of human antibody repertoires in transgenic animals. Year Immunol 7: 33-40.
Carter et al., (1992) High level Escherichia coli expression and production of a bivalent humanized antibody fragment. Biotechnology (N Y) 10(2):163-7.
Carter et al., (1992) Humanization of an anti-p185HER2 antibody for human cancer therapy. Proc Natl Acad Sci U S A 89(10): 4285-9.
Chothia and Lesk (1987) Canonical structures for the hypervariable regions of immunoglobulins. J Mol Biol 196(4): 901-17.
Cianfriglia et al., "CEACAM1 is a Privileged Cell Surface Antigen to Design Novel ScFv Mediated-Immunotherapies of Melanoma, Lung Cancer and Other Types of Tumors", The Open Pharmacology Journal, 2012, 6, 1-11.
Clackson et al., (1991) Making antibody fragments using phage display libraries. Nature 352(6336): 624-8.
Clark (1997) IgG effector mechanisms. Chem Immunol 65: 88-110.
Cruse JM and Lewis RE (2003) "Illustrated Dictionary of Immunology", 2nd Ed., CRC Press, p. 42.
Culic et al., (1992) Molecular cloning and expression of a new rat liver cell-CAM105 isoform. Biochem J 285: 47-53.
Douillard et al., (2000) Irinotecan combined with fluorouracil compared with fluorouracil alone as first-line treatment for metastatic colorectal cancer: a multicentre randomised trial. Lancet 355(9209): 1041-7.
Duchosal et al., (1992) Immunization of hu-PBL-SCID mice and the rescue of human monoclonal Fab fragments through combinatorial libraries. Nature 355(6357): 258-62.
Duffy (2001) Carcinoembryonic antigen as a marker for colorectal cancer: is it clinically useful? Clin Chem 47(4): 624-30.
Fishwild et al., (1996) High-avidity human IgG kappa monoclonal antibodies from a novel strain of minilocus transgenic mice. Nat Biotechnol 14(7): 845-51.
Gong et al., (2011) Diagnostic value of serum CEACAM1 in patients with pancreatic cancer. J South Med Univ 31: 164-166. English abstract.
Gray-Owen and Blumberg (2006) CEACAM1: contact-dependent control of immunity. Nat Rev Immunol 6(6): 433-46.
Hansen et al., (1993) Characterization of second-generation monoclonal antibodies against carcinoembryonic antigen. Cancer 71(11): 3478-3485.
Holliger et al., (1993) "Diabodies": small bivalent and bispecific antibody fragments. Proc Natl Acad Sci U S A 90(14): 6444-8.
Hoogenboom and Winter (1992) By-passing immunisation. Human antibodies from synthetic repertoires of germline VH gene segments rearranged in vitro. J Mol Biol 227(2): 381-8.
Hussain et al., (1995) Selective increases in antibody isotypes and immunoglobulin G subclass responses to secreted antigens in tuberculosis patients and healthy household contacts of the patients. Clin Diagn Lab Immunol 2(6): 726-32.
Huston et al., (1988) Protein engineering of antibody binding sites: recovery of specific activity in an anti-digoxin single-chain Fv analogue produced in Escherichia coli. Proc Natl Acad Sci U S A 85(16): 5879-83.
Inbar et al., (1972) Localization of antibody-combining sites within the variable portions of heavy and light chains. Proc Natl Acad Sci USA 69(9): 2659-6262.
Jakobovits et al., (1993) Analysis of homozygous mutant chimeric mice: deletion of the immunoglobulin heavy-chain joining region blocks B-cell development and antibody production. Proc Natl Acad Sci U S A 90(6): 2551-5.
Jakobovits et al., (1993) Germ-line transmission and expression of a human-derived yeast artificial chromosome. Nature 362(6417): 255-8.
Jin et al., (2008) The research progress of carcino-embryonic antigen related cellular adhesion molecule 1. China Oncology 18(4) 310-314 Translated abstract.
Jones et al., (1986) Replacing the complementarity-determining regions in a human antibody with those from a mouse. Nature 321(6069): 522-5.
Kammerer et al., (2004) The tumour suppressor gene CEACAM1 is completely but reversibly downregulated in renal cell carcinoma. J Pathol 204(3): 258-267.
Kataja et al., (2009) Primary breast cancer: ESMO clinical recommendations for diagnosis, treatment and follow-up. Ann Oncol 20(Suppl 4): iv10-4.
Khatib et al., (2011) Carcinoembryonic antigen cell adhesion molecule-1 (CEACAM1) in posterior uveal melanoma: correlation with clinical and histological survival markers. Invest Ophthalmol Vis Sci 52(13): 9368-9372.
Kim et al., (2005) Antibody engineering for the development of therapeutic antibodies. Mol Cells 20(1): 17-29.
Köhler (1980) Immunoglobulin chain loss in hybridoma lines. Proc Natl Acad Sci U S A 77(4): 2197-2199.
Köhler and Milstein (1975) Continuous cultures of fused cells secreting antibody of predefined specificity. Nature 256 (5517): 495-7.
Kozbor and Roder (1983) The production of monoclonal antibodies from human lymphocytes. Immunology Today 4(3): 72-79.
Kromenaker and Srienc (1994) Stability of producer hybridoma cell lines after cell sorting: A case study. Biotechnology 10(3): 299-307.
Laack et al., (2002) Expression of CEACAM1 in adenocarcinoma of the lung: a factor of independent prognostic significance. J Clin Oncol 20(21): 4279-84.
Larrick and Fry (1991) PCR amplification of antibody genes. Methods 2(2): 106-110.
Lefranc et al., (1999) IMGT, the international ImMunoGeneTics database. Nucleic Acids Res 27(1): 209-12.
Liersch et al., (2005) Phase II trial of carcinoembryonic antigen radioimmunotherapy with 131I-labetuzumab after salvage resection of colorectal metastases in the liver: five-year safety and efficacy results. J Clin Oncol 23(27): 6763-70.
Lonberg and Huszar (1995) Human antibodies from transgenic mice. Int Rev Immunol 13(1): 65-93.
Lonberg et al., (1994) Antigen-specific human antibodies from mice comprising four distinct genetic modifications. Nature 368(6474): 856-9.
Makire et al., "Generation, Immunologic Characterization and Antitumor Effects of Human Monoclonal Antibodies for Carcinoembryonic Antigen", Int. J. Cancer, 108, 564-570 (2004).
Mariuzza et al. (Annu. Rev. Biophys. Biophys. Chem. 1987; 16: 139-159). *
Markel et al., (2002) CD66a interactions between human melanoma and NK cells: a novel class I MHC-independent inhibitory mechanism of cytotoxicity. J Immunol 168(6): 2803-10.
Markel et al., (2002) Pivotal role of CEACAM1 protein in the inhibition of activated decidual lymphocyte functions. J Clin Invest 110(7): 943-53.
Markel et al., (2004) Biological function of the soluble CEACAM1 protein and implications in TAP2-deficient patients. Eur J Immunol 34(8): 2138-2148.
Markel et al., (2004) The critical role of residues 43R and 44Q of carcinoembryonic antigen cell adhesion molecules-1 in the protection from killing by human NK cells. J Immunol 173(6): 3732-9.
Markel et al., (2004) The mechanisms controlling NK cell autoreactivity in TAP2-deficient patients. Blood 103(5): 1770-1778.
Markel et al., (2006) Inhibition of human tumor-infiltrating lymphocyte effector functions by the homophilic carcinoembryonic cell adhesion molecule 1 interactions. J Immunol 177(9): 6062-71.
Markel et al., (2009) Dynamic expression of protective CEACAM1 on melanoma cells during specific immune attack. Immunology 126(2): 186-200.
Markel et al., (2010) Systemic dysregulation of CEACAM1 in melanoma patients. Cancer Immunol Immunother 59(2): 215-230.
Marks et al., (1991) By-passing immunization. Human antibodies from V-gene libraries displayed on phage. J Mol Biol 222(3): 581-97.
Marks et al., (1992) By-passing immunization: building high affinity human antibodies by chain shuffling. Biotechnology (N Y) 10(7): 779-83.
McCafferty et al., (1990) Phage antibodies: filamentous phage displaying antibody variable domains. Nature 348 (6301): 552-4.
McCarthy et al. (J. Immunol. Methods, 251(1-2): 137-149, 2001). *
Morales et al., (1999) Regulation of human intestinal intraepithelial lymphocyte cytolytic function by biliary glycoprotein (CD66a). J Immunol 163(3): 1363-70.
Morimoto and Inouye (1992) Single-step purification of F(ab′)2 fragments of mouse monoclonal antibodies (immunoglobulins G1) by hydrophobic interaction high performance liquid chromatography using TSKgel Phenyl-5PW. J Biochem Biophys Methods 24(1-2): 107-17.
Morrison (1994) Immunology. Success in specification. Nature 368(6474): 812-3.
Morrison et al., (1984) Chimeric human antibody molecules: mouse antigen-binding domains with human constant region domains. Proc Natl Acad Sci U S A 81(21): 6851-5.
Müller et al., (1998) A dimeric bispecific miniantibody combines two specificities with avidity. FEBS Lett 432(1-2): 45-9.
Nelson et al., (2009) Screening for breast cancer: an update for the U.S. Preventive Services Task Force. Ann Intern Med 151(10): 727-737.
Neuberger (1996) Generating high-avidity human Mabs in mice. Nat Biotechnol 14(7): 826.
Oikawa et al., (1992) Homotypic and heterotypic Ca++-independent cell adhesion activities of biliary glycoprotein, a member of carcinoembryonic antigen family, expressed on Cho cell surface. Biochemical and Biophysical Research Communications 186(2): 881-887.
Ozturk and Palsson (1990) Loss of antibody productivity during long-term cultivation of a hybridoma cell line in low serum and serum-free media. Hybridoma 9(2): 167-175.
Pack et al., (1993) Improved bivalent miniantibodies, with identical avidity as whole antibodies, produced by high cell density fermentation of Escherichia coli. BioTechnology (N Y) 11(11): 1271-1277.
Pavoni et al., (2006) Selection, affinity maturation, and characterization of a human scFv antibody against CEA protein. BMC Cancer 6: 41.
Porter (1959) The hydrolysis of rabbit y-globulin and antibodies with crystalline papain. Biochem J 73: 119-126.
Presta (1992) Antibody engineering. Current Opinion in Structural Biology 2(4): 593-596.
Presta et al., (1993) Humanization of an antibody directed against IgE. J Immunol 151(5): 2623-32.
Presta et al., (1997) Humanization of an anti-vascular endothelial growth factor monoclonal antibody for the therapy of solid tumors and other disorders. Cancer Res 57(20): 4593-9.
Primus et al., (1983) Immunological heterogeneity of carcinoembryonic antigen: antigenic determinants on carcinoembryonic antigen distinguished by monoclonal antibodies. Cancer Research 43: 686-692.
Riechmann et al., (1988) Reshaping human antibodies for therapy. Nature 332(6162): 323-7.
Roder, John C. et al., (1985) Recent advances in the ebv-hybridoma technique. In: Monoclonal antibodies and cancer therapy. Journal of Cellular Biochemistry Supplement: UCLA Symposia on Molecular & Cellular Biology 29(9A): 33-74 abstract #0106.
Roitt I.M., Brostoff J. & Male D. (1998) Immunology. 5th edition, 1998 Mosby International Ltd., London. p. 80.
Roitt I.M., Brostoff J. & Male D. (1998) Immunology. 5th edition, 1998 Mosby International Ltd., London. pp. 129-131.
Rudikoff et al., (1982) Single amino acid substitution altering antigen-binding specificity. Proc Natl Acad Sci U S A 79 (6): 1979-1983.
Saltz et al., (1999) Weekly irinotecan (CPT-11), leucovorin (LV), and fluorouracil (FU) is superior to daily x5 LV/FU in patients (pts) with previously untreated metastatic colorectal cancer. Proc Am Soc Clin Oncol 18: 233a.
Schildbach et al., (1993) Modulation of antibody affinity by a non-contact residue, Protein Science, 2, 206-214.
Sheets et al., (1998) Efficient construction of a large nonimmune phage antibody library: the production of high-affinity human single-chain antibodies to protein antigens. Proc Natl Acad Sci U S A 95(11): 6157-62.
Sienel et al., (2003) Elevated expression of carcinoembryonic antigen-related cell adhesion molecule 1 promotes progression of non-small cell lung cancer. Clin Cancer Res 9(6): 2260-6.
Simeone et al. (Pancreas, 34(4): 436-443, 2007). *
Sims et al., (1993) A humanized CD18 antibody can block function without cell destruction. J Immunol 151(4): 2296-308.
Slootstra et al., (1996) Structural aspects of antibody-antigen interaction revealed through small random peptide libraries. Mol Divers 1(2): 87-96.
Stern et al., (2005) Carcinoembryonic antigen (CEA) inhibits NK killing via interaction with CEA-related cell adhesion molecule 1. J Immunol 174(11): 6692-701.
Thies et al., (2002) CEACAM1 expression in cutaneous malignant melanoma predicts the development of metastatic disease. J Clin Oncol 20(10): 2530-2536.
Thompson et al., (1991) Carcinoembryonic antigen gene family: molecular biology and clinical perspectives. J Clin Lab Anal 5(5): 344-66.
Timmerman et al., (2007) Functional reconstruction and synthetic mimicry of a conformational epitope using CLIPS technology. J Mol Recognit 20(5): 283-99.
Vaughan et al., (1996) Human antibodies with sub-nanomolar affinities isolated from a large non-immunized phage display library. Nat Biotechnol 14(3): 309-14.
Verhoeyen et al., (1988) Reshaping human antibodies: grafting an antilysozyme activity. Science 239(4847): 1534-6.
Ward et al., (1989) Binding activities of a repertoire of single immunoglobulin variable domains secreted from Escherichia coli. Nature 341(6242): 544-6.
Watt et al., (2001) Homophilic adhesion of human CEACAM1 involves N-terminal domain interactions: structural analysis of the binding site. Blood 98(5): 1469-79.
Whitlow and Filpula (1991) Single-chain Fv proteins and their fusion proteins. Methods 2(2): 97-105.
Wu and Kabat (1970) An analysis of the sequences of the variable regions of Bence Jones proteins and myeloma light chains and their implications for antibody complementarity. J Exp Med 132(2): 211-50.
Ychou et al., (2008) Adjuvant radioimmunotherapy trial with iodine-131-labeled anti-carcinoembryonic antigen monoclonal antibody F6 F(ab′)2 after resection of liver metastases from colorectal cancer. Clin Cancer Res 14(11): 3487-93.
Zapata et al., (1995) Engineering linear F(ab′)2 fragments for efficient production in Escherichia coli and enhanced antiproliferative activity. Protein Eng 8(10): 1057-62.
Zheng et al., (2011) A novel anti-CEACAM5 monoclonal antibody, CC4, suppresses colorectal tumor growth and enhances NK cells-mediated tumor immunity. PLoS One 6(6): e21146.

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11427647B2 (en) * 2014-04-27 2022-08-30 Famewave Ltd. Polynucleotides encoding humanized antibodies against CEACAM1
EP3906261A4 (en) * 2018-12-07 2022-12-21 The Brigham And Women's Hospital, Inc. HUMANIZED AND AFFINITY MATURED ANTI-CEACAM1 ANTIBODIES
US12173066B2 (en) 2018-12-07 2024-12-24 The Brigham And Women's Hospital, Inc. Humanized and affinity-matured anti-CEACAM1 antibodies
WO2022147509A1 (en) * 2021-01-04 2022-07-07 City Of Hope Prevention and treatment of steroid-resistant or gut graft-versus-host disease (gvhd)
WO2024035662A2 (en) 2022-08-10 2024-02-15 Merck Sharp & Dohme Llc Proteins binding nkg2d, cd16, and ceacam5

Also Published As

Publication number Publication date
IL231931B (en) 2019-06-30
IL231931A0 (en) 2014-05-28
EP3360899B1 (en) 2023-01-25
BR112014008893B1 (pt) 2022-04-26
US20140271618A1 (en) 2014-09-18
CN103987729B (zh) 2017-05-31
ES2942314T3 (es) 2023-05-31
EP2744829A4 (en) 2015-06-03
US20170355781A1 (en) 2017-12-14
CN103987729A (zh) 2014-08-13
WO2013054320A1 (en) 2013-04-18
AU2012322272A1 (en) 2014-04-10
KR20140069206A (ko) 2014-06-09
BR112014008893A2 (pt) 2017-11-28
EP2744829B1 (en) 2017-12-13
US20210070884A1 (en) 2021-03-11
RU2650869C2 (ru) 2018-04-17
HK1199646A1 (en) 2015-07-10
JP2015502138A (ja) 2015-01-22
AU2012322272B2 (en) 2017-08-17
CA2851762A1 (en) 2013-04-18
KR102189409B1 (ko) 2020-12-14
EP3360899A1 (en) 2018-08-15
RU2014118773A (ru) 2015-11-20
EP2744829A1 (en) 2014-06-25
LT2744829T (lt) 2018-03-26
JP6170926B2 (ja) 2017-07-26
ES2661488T3 (es) 2018-04-02
PL2744829T3 (pl) 2018-06-29
PL3360899T3 (pl) 2023-07-10
WO2013054331A1 (en) 2013-04-18
US11891453B2 (en) 2024-02-06
IN2014MN00873A (enExample) 2015-07-03
AU2012322272C1 (en) 2017-11-02
CA2851762C (en) 2021-11-30
WO2013054331A8 (en) 2014-04-10

Similar Documents

Publication Publication Date Title
US11891453B2 (en) Antibodies to carcinoembryonic antigen-related cell adhesion molecule (CEACAM)
US12121579B2 (en) Antibodies specific to human t-cell immunoglobulin and ITIM domain (TIGIT)
RU2745707C2 (ru) Ингибиторы fgfr2 отдельно или в комбинации с иммуностимулирующими агентами в лечении рака
EA037613B1 (ru) Гуманизированные антитела против ceacam1
BR112020012364A2 (pt) anticorpos de ligação a ctla-4 e usos dos mesmos
CN113396160A (zh) 治疗对免疫检查点疗法具有抗性的癌症的方法和药物组合物
KR20210117277A (ko) 인간 넥틴-2에 특이적인 항체
KR20230159823A (ko) Cd112r에 대한 항체 및 이의 용도
CN114616243A (zh) Car-t细胞组合物及其使用方法
RU2820275C2 (ru) Антитела, специфичные в отношении нектина-2 человека
HK1199646B (en) Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
CA2997130C (en) Antibodies specific to human t-cell immunoglobulin and itim domain (tigit)
HK40060175B (zh) 特异性针对人类连接蛋白-2的抗体

Legal Events

Date Code Title Description
AS Assignment

Owner name: CCAM BIOTHERAPEUTICS LTD., ISRAEL

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BEN-MOSHE, TEHILA;SAPIR, YAIR;MANDEL, ILANA;REEL/FRAME:033326/0070

Effective date: 20140410

Owner name: RAMOT AT TEL-AVIV UNIVERSITY LTD., ISRAEL

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:ORTENBERG, RONA;REEL/FRAME:033326/0078

Effective date: 20140423

Owner name: TEL HASHOMER MEDICAL RESEARCH INFRASTRUCTURE AND S

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:MARKEL, GAL;SCHACHTER, JACOB;REEL/FRAME:033326/0054

Effective date: 20140320

AS Assignment

Owner name: CCAM BIOTHERAPEUTICS LTD., ISRAEL

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:TEL HASHOMER-MEDICAL RESEARCH, INFRASTRUCTURE AND SERVICES LTD.;RAMOT AT TEL AVIV UNIVERSITY LTD.;REEL/FRAME:039351/0911

Effective date: 20150701

STCF Information on status: patent grant

Free format text: PATENTED CASE

AS Assignment

Owner name: CCAM BIOTHERAPEUTICS LTD., ISRAEL

Free format text: CHANGE OF ADDRESS;ASSIGNOR:CCAM BIOTHERAPEUTICS LTD.;REEL/FRAME:046365/0234

Effective date: 20160501

FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

FEPP Fee payment procedure

Free format text: SURCHARGE FOR LATE PAYMENT, SMALL ENTITY (ORIGINAL EVENT CODE: M2554); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

MAFP Maintenance fee payment

Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YR, SMALL ENTITY (ORIGINAL EVENT CODE: M2551); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

Year of fee payment: 4

AS Assignment

Owner name: FAMEWAVE LTD., ISRAEL

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:CCAM BIOTHERAPEUTICS LTD.;REEL/FRAME:056129/0984

Effective date: 20190409

MAFP Maintenance fee payment

Free format text: PAYMENT OF MAINTENANCE FEE, 8TH YR, SMALL ENTITY (ORIGINAL EVENT CODE: M2552); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

Year of fee payment: 8