EP1664306A2 - Sekretion von proteinen aus hefen - Google Patents
Sekretion von proteinen aus hefenInfo
- Publication number
- EP1664306A2 EP1664306A2 EP04765253A EP04765253A EP1664306A2 EP 1664306 A2 EP1664306 A2 EP 1664306A2 EP 04765253 A EP04765253 A EP 04765253A EP 04765253 A EP04765253 A EP 04765253A EP 1664306 A2 EP1664306 A2 EP 1664306A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- sequence
- pheromone
- seq
- nucleic acid
- shuttle
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 185
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 120
- 240000004808 Saccharomyces cerevisiae Species 0.000 title claims description 55
- 230000028327 secretion Effects 0.000 title claims description 32
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 112
- 230000014509 gene expression Effects 0.000 claims abstract description 78
- 150000007523 nucleic acids Chemical group 0.000 claims abstract description 68
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 65
- 108091028043 Nucleic acid sequence Proteins 0.000 claims abstract description 42
- 101710091977 Hydrophobin Proteins 0.000 claims abstract description 31
- 238000000034 method Methods 0.000 claims abstract description 30
- 239000013604 expression vector Substances 0.000 claims abstract description 20
- 210000005253 yeast cell Anatomy 0.000 claims abstract description 17
- 238000004519 manufacturing process Methods 0.000 claims abstract description 15
- 239000010985 leather Substances 0.000 claims abstract description 7
- 239000003016 pheromone Substances 0.000 claims description 59
- 229920001184 polypeptide Polymers 0.000 claims description 52
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 46
- 108020004707 nucleic acids Proteins 0.000 claims description 24
- 102000039446 nucleic acids Human genes 0.000 claims description 24
- 101800002502 P-factor Proteins 0.000 claims description 23
- LUNBMBVWKORSGN-TYEKWLQESA-N P-factor Chemical group CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]1N(C(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC=2C3=CC=CC=C3NC=2)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=2C=CC(O)=CC=2)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC=2C=CC(O)=CC=2)NC(=O)[C@@H](N)[C@@H](C)O)[C@@H](C)O)C(C)C)CCC1 LUNBMBVWKORSGN-TYEKWLQESA-N 0.000 claims description 22
- 108091092195 Intron Proteins 0.000 claims description 21
- 210000004899 c-terminal region Anatomy 0.000 claims description 19
- 108020001507 fusion proteins Proteins 0.000 claims description 18
- 102000037865 fusion proteins Human genes 0.000 claims description 18
- 238000012545 processing Methods 0.000 claims description 16
- 108091026890 Coding region Proteins 0.000 claims description 15
- 230000001105 regulatory effect Effects 0.000 claims description 15
- 108700026244 Open Reading Frames Proteins 0.000 claims description 11
- 150000001413 amino acids Chemical group 0.000 claims description 11
- 244000005700 microbiome Species 0.000 claims description 11
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 claims description 9
- 108091005804 Peptidases Proteins 0.000 claims description 9
- 239000004365 Protease Substances 0.000 claims description 8
- 101100401329 Schizosaccharomyces pombe (strain 972 / ATCC 24843) mfm3 gene Proteins 0.000 claims description 8
- 239000008188 pellet Substances 0.000 claims description 8
- 239000001963 growth medium Substances 0.000 claims description 7
- 239000011521 glass Substances 0.000 claims description 6
- 238000004381 surface treatment Methods 0.000 claims description 6
- 101100401327 Schizosaccharomyces pombe (strain 972 / ATCC 24843) mfm2 gene Proteins 0.000 claims description 5
- 239000004744 fabric Substances 0.000 claims description 5
- 239000000835 fiber Substances 0.000 claims description 5
- -1 lacquered objects Substances 0.000 claims description 5
- 230000008569 process Effects 0.000 claims description 5
- 241000235346 Schizosaccharomyces Species 0.000 claims description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 2
- 101000597263 Homo sapiens Phosphate-regulating neutral endopeptidase PHEX Proteins 0.000 claims description 2
- 102100035153 Phosphate-regulating neutral endopeptidase PHEX Human genes 0.000 claims description 2
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 claims 3
- 239000011248 coating agent Substances 0.000 abstract description 3
- 238000000576 coating method Methods 0.000 abstract description 3
- 235000018102 proteins Nutrition 0.000 description 69
- 210000004027 cell Anatomy 0.000 description 59
- 239000013598 vector Substances 0.000 description 51
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 48
- 239000013615 primer Substances 0.000 description 23
- 238000003752 polymerase chain reaction Methods 0.000 description 22
- 108020004414 DNA Proteins 0.000 description 20
- 239000013612 plasmid Substances 0.000 description 20
- 239000012634 fragment Substances 0.000 description 19
- 241000235347 Schizosaccharomyces pombe Species 0.000 description 18
- 238000001502 gel electrophoresis Methods 0.000 description 14
- 238000006243 chemical reaction Methods 0.000 description 13
- 125000003729 nucleotide group Chemical group 0.000 description 12
- 108091008146 restriction endonucleases Proteins 0.000 description 12
- 238000013518 transcription Methods 0.000 description 12
- 230000035897 transcription Effects 0.000 description 12
- 239000012228 culture supernatant Substances 0.000 description 11
- 241000588724 Escherichia coli Species 0.000 description 10
- 125000003275 alpha amino acid group Chemical group 0.000 description 10
- 239000002609 medium Substances 0.000 description 10
- 239000000047 product Substances 0.000 description 10
- 150000003839 salts Chemical class 0.000 description 10
- 238000012163 sequencing technique Methods 0.000 description 10
- 239000006228 supernatant Substances 0.000 description 10
- 241000351920 Aspergillus nidulans Species 0.000 description 9
- 235000001014 amino acid Nutrition 0.000 description 9
- 238000010367 cloning Methods 0.000 description 9
- 238000001514 detection method Methods 0.000 description 9
- 230000000295 complement effect Effects 0.000 description 8
- 230000013011 mating Effects 0.000 description 8
- 239000002773 nucleotide Substances 0.000 description 8
- 239000002243 precursor Substances 0.000 description 8
- 238000000746 purification Methods 0.000 description 8
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 8
- 238000004520 electroporation Methods 0.000 description 7
- 238000002474 experimental method Methods 0.000 description 7
- 125000005647 linker group Chemical group 0.000 description 7
- 239000000203 mixture Substances 0.000 description 7
- 241000233866 Fungi Species 0.000 description 6
- 239000004809 Teflon Substances 0.000 description 6
- 229920006362 Teflon® Polymers 0.000 description 6
- 238000001262 western blot Methods 0.000 description 6
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 5
- 108091034117 Oligonucleotide Proteins 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 239000011324 bead Substances 0.000 description 5
- 238000004587 chromatography analysis Methods 0.000 description 5
- 238000003776 cleavage reaction Methods 0.000 description 5
- 239000002299 complementary DNA Substances 0.000 description 5
- 230000004927 fusion Effects 0.000 description 5
- 230000002209 hydrophobic effect Effects 0.000 description 5
- 238000010369 molecular cloning Methods 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 230000007017 scission Effects 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 230000009466 transformation Effects 0.000 description 5
- 238000013519 translation Methods 0.000 description 5
- 241000235349 Ascomycota Species 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 4
- YDFHVOKEEMMIBE-RDJQXTLESA-N M-factor Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CSC\C=C(/C)CC\C=C(/C)CCC=C(C)C)C(=O)OC)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 YDFHVOKEEMMIBE-RDJQXTLESA-N 0.000 description 4
- 101710204204 M-factor Proteins 0.000 description 4
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 4
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 4
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 4
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 4
- 230000001276 controlling effect Effects 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 238000002955 isolation Methods 0.000 description 4
- 239000003550 marker Substances 0.000 description 4
- 239000013642 negative control Substances 0.000 description 4
- 229920000136 polysorbate Polymers 0.000 description 4
- 230000002797 proteolythic effect Effects 0.000 description 4
- 239000011541 reaction mixture Substances 0.000 description 4
- 238000001179 sorption measurement Methods 0.000 description 4
- 238000011144 upstream manufacturing Methods 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 235000001674 Agaricus brunnescens Nutrition 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 108010021466 Mutant Proteins Proteins 0.000 description 3
- 102000008300 Mutant Proteins Human genes 0.000 description 3
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- 239000002253 acid Chemical class 0.000 description 3
- 238000007792 addition Methods 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 230000003115 biocidal effect Effects 0.000 description 3
- 125000003178 carboxy group Chemical class [H]OC(*)=O 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 238000010828 elution Methods 0.000 description 3
- 230000013595 glycosylation Effects 0.000 description 3
- 238000009396 hybridization Methods 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- 108091033319 polynucleotide Proteins 0.000 description 3
- 239000002244 precipitate Substances 0.000 description 3
- 239000002987 primer (paints) Substances 0.000 description 3
- 108700028369 Alleles Proteins 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 2
- 102000053602 DNA Human genes 0.000 description 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 2
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 2
- 241000701533 Escherichia virus T4 Species 0.000 description 2
- 230000037057 G1 phase arrest Effects 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- 241000235087 Lachancea kluyveri Species 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 238000000636 Northern blotting Methods 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- 108010006922 S pombe P-factor Proteins 0.000 description 2
- 241001480130 Schizosaccharomycetales Species 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- 101710172711 Structural protein Proteins 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- LSNNMFCWUKXFEE-UHFFFAOYSA-N Sulfurous acid Chemical compound OS(O)=O LSNNMFCWUKXFEE-UHFFFAOYSA-N 0.000 description 2
- ODMZDQKUHYGKKN-UHFFFAOYSA-N TCA C Natural products CC(CCCC(C)C1=CCC2(C)OC3=C(CC12)C(=O)C(O)CC3)C(=O)O ODMZDQKUHYGKKN-UHFFFAOYSA-N 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 244000301083 Ustilago maydis Species 0.000 description 2
- 235000015919 Ustilago maydis Nutrition 0.000 description 2
- IXKSXJFAGXLQOQ-XISFHERQSA-N WHWLQLKPGQPMY Chemical compound C([C@@H](C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)C1=CNC=N1 IXKSXJFAGXLQOQ-XISFHERQSA-N 0.000 description 2
- 125000002252 acyl group Chemical group 0.000 description 2
- 125000003277 amino group Chemical class 0.000 description 2
- 239000000427 antigen Substances 0.000 description 2
- 108091007433 antigens Proteins 0.000 description 2
- 102000036639 antigens Human genes 0.000 description 2
- 230000027455 binding Effects 0.000 description 2
- 238000009739 binding Methods 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 125000002843 carboxylic acid group Chemical group 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 230000001086 cytosolic effect Effects 0.000 description 2
- 239000003599 detergent Substances 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 239000011888 foil Substances 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 230000002538 fungal effect Effects 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- 238000007857 nested PCR Methods 0.000 description 2
- 235000015097 nutrients Nutrition 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 238000005215 recombination Methods 0.000 description 2
- 239000013074 reference sample Substances 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 238000005063 solubilization Methods 0.000 description 2
- 230000007928 solubilization Effects 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- 101150028074 2 gene Proteins 0.000 description 1
- IPWKGIFRRBGCJO-IMJSIDKUSA-N Ala-Ser Chemical compound C[C@H]([NH3+])C(=O)N[C@@H](CO)C([O-])=O IPWKGIFRRBGCJO-IMJSIDKUSA-N 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- JQFZHHSQMKZLRU-IUCAKERBSA-N Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CCCN=C(N)N JQFZHHSQMKZLRU-IUCAKERBSA-N 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- CKAJHWFHHFSCDT-WHFBIAKZSA-N Asp-Glu Chemical compound OC(=O)C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(O)=O CKAJHWFHHFSCDT-WHFBIAKZSA-N 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 102000019260 B-Cell Antigen Receptors Human genes 0.000 description 1
- 108010012919 B-Cell Antigen Receptors Proteins 0.000 description 1
- 241000221198 Basidiomycota Species 0.000 description 1
- 101800001415 Bri23 peptide Proteins 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- 101800000655 C-terminal peptide Proteins 0.000 description 1
- 102400000107 C-terminal peptide Human genes 0.000 description 1
- 101100268670 Caenorhabditis elegans acc-3 gene Proteins 0.000 description 1
- 101100275473 Caenorhabditis elegans ctc-3 gene Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 108020004638 Circular DNA Proteins 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 241001085790 Coprinopsis Species 0.000 description 1
- YXQDRIRSAHTJKM-IMJSIDKUSA-N Cys-Ser Chemical compound SC[C@H](N)C(=O)N[C@@H](CO)C(O)=O YXQDRIRSAHTJKM-IMJSIDKUSA-N 0.000 description 1
- 108010017826 DNA Polymerase I Proteins 0.000 description 1
- 102000004594 DNA Polymerase I Human genes 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 101100341037 Drosophila melanogaster Inx7 gene Proteins 0.000 description 1
- 101100240657 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) swoF gene Proteins 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 241001524679 Escherichia virus M13 Species 0.000 description 1
- 108091029865 Exogenous DNA Proteins 0.000 description 1
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 1
- 206010071602 Genetic polymorphism Diseases 0.000 description 1
- FYYSIASRLDJUNP-WHFBIAKZSA-N Glu-Asp Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(O)=O FYYSIASRLDJUNP-WHFBIAKZSA-N 0.000 description 1
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- WSDOHRLQDGAOGU-BQBZGAKWSA-N His-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CN=CN1 WSDOHRLQDGAOGU-BQBZGAKWSA-N 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000881168 Homo sapiens SPARC Proteins 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- TYYLDKGBCJGJGW-UHFFFAOYSA-N L-tryptophan-L-tyrosine Natural products C=1NC2=CC=CC=C2C=1CC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 TYYLDKGBCJGJGW-UHFFFAOYSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 101150039179 LE1 gene Proteins 0.000 description 1
- 101100536883 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) thi5 gene Proteins 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 102000008072 Lymphokines Human genes 0.000 description 1
- 108010074338 Lymphokines Proteins 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 108010038049 Mating Factor Proteins 0.000 description 1
- 101710089743 Mating factor alpha Proteins 0.000 description 1
- 101000708578 Milk vetch dwarf virus (isolate N) Para-Rep C3 Proteins 0.000 description 1
- KZNQNBZMBZJQJO-UHFFFAOYSA-N N-glycyl-L-proline Natural products NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 description 1
- 241000500416 Nakaseomyces delphensis Species 0.000 description 1
- 101100240662 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) gtt-1 gene Proteins 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 101150043338 Nmt1 gene Proteins 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- 241000283898 Ovis Species 0.000 description 1
- 102100034574 P protein Human genes 0.000 description 1
- 101710181008 P protein Proteins 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 101710112083 Para-Rep C1 Proteins 0.000 description 1
- 241000700639 Parapoxvirus Species 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 101710177166 Phosphoprotein Proteins 0.000 description 1
- 101000621511 Potato virus M (strain German) RNA silencing suppressor Proteins 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 239000012614 Q-Sepharose Substances 0.000 description 1
- 102100022881 Rab proteins geranylgeranyltransferase component A 1 Human genes 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102100037599 SPARC Human genes 0.000 description 1
- 101100434411 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) ADH1 gene Proteins 0.000 description 1
- 101100512790 Schizosaccharomyces pombe (strain 972 / ATCC 24843) mei3 gene Proteins 0.000 description 1
- 108091081021 Sense strand Proteins 0.000 description 1
- 108010063499 Sigma Factor Proteins 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 241000187180 Streptomyces sp. Species 0.000 description 1
- 108700026226 TATA Box Proteins 0.000 description 1
- JZRWCGZRTZMZEH-UHFFFAOYSA-N Thiamine Natural products CC1=C(CCO)SC=[N+]1CC1=CN=C(C)N=C1N JZRWCGZRTZMZEH-UHFFFAOYSA-N 0.000 description 1
- GXDLGHLJTHMDII-WISUUJSJSA-N Thr-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CO)C(O)=O GXDLGHLJTHMDII-WISUUJSJSA-N 0.000 description 1
- 101710119887 Trans-acting factor B Proteins 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- GSEJCLTVZPLZKY-UHFFFAOYSA-N Triethanolamine Chemical compound OCCN(CCO)CCO GSEJCLTVZPLZKY-UHFFFAOYSA-N 0.000 description 1
- TYYLDKGBCJGJGW-WMZOPIPTSA-N Trp-Tyr Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)N)C(O)=O)C1=CC=C(O)C=C1 TYYLDKGBCJGJGW-WMZOPIPTSA-N 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- BMPPMAOOKQJYIP-WMZOPIPTSA-N Tyr-Trp Chemical compound C([C@H]([NH3+])C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C([O-])=O)C1=CC=C(O)C=C1 BMPPMAOOKQJYIP-WMZOPIPTSA-N 0.000 description 1
- 241000222126 [Candida] glabrata Species 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 101150102866 adc1 gene Proteins 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 230000006229 amino acid addition Effects 0.000 description 1
- 229910021529 ammonia Inorganic materials 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 108010062796 arginyllysine Proteins 0.000 description 1
- 108010038633 aspartylglutamate Proteins 0.000 description 1
- 108010058966 bacteriophage T7 induced DNA polymerase Proteins 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 108010064866 biozym Proteins 0.000 description 1
- 230000011496 cAMP-mediated signaling Effects 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 208000032343 candida glabrata infection Diseases 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000012707 chemical precursor Substances 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- 238000012411 cloning technique Methods 0.000 description 1
- 238000000975 co-precipitation Methods 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000002425 crystallisation Methods 0.000 description 1
- 230000008025 crystallization Effects 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 150000001945 cysteines Chemical class 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 210000001723 extracellular space Anatomy 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 230000009760 functional impairment Effects 0.000 description 1
- 108010063718 gamma-glutamylaspartic acid Proteins 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- KZNQNBZMBZJQJO-YFKPBYRVSA-N glyclproline Chemical compound NCC(=O)N1CCC[C@H]1C(O)=O KZNQNBZMBZJQJO-YFKPBYRVSA-N 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 108010077515 glycylproline Proteins 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 230000005660 hydrophilic surface Effects 0.000 description 1
- 230000005661 hydrophobic surface Effects 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000008774 maternal effect Effects 0.000 description 1
- SKEFKEOTNIPLCQ-LWIQTABASA-N mating hormone Chemical compound C([C@@H](C(=O)NC(CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCS(C)=O)C(=O)NC(CC=1C=CC(O)=CC=1)C(O)=O)NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)C1=CN=CN1 SKEFKEOTNIPLCQ-LWIQTABASA-N 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000021121 meiosis Effects 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 238000007431 microscopic evaluation Methods 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 239000003068 molecular probe Substances 0.000 description 1
- 239000002808 molecular sieve Substances 0.000 description 1
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 1
- UXDAWVUDZLBBAM-UHFFFAOYSA-N n,n-diethylbenzeneacetamide Chemical compound CCN(CC)C(=O)CC1=CC=CC=C1 UXDAWVUDZLBBAM-UHFFFAOYSA-N 0.000 description 1
- 230000012666 negative regulation of transcription by glucose Effects 0.000 description 1
- 239000000712 neurohormone Substances 0.000 description 1
- 102000008434 neuropeptide hormone activity proteins Human genes 0.000 description 1
- 108040002669 neuropeptide hormone activity proteins Proteins 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 235000006408 oxalic acid Nutrition 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- LQRJAEQXMSMEDP-XCHBZYMASA-N peptide a Chemical compound N([C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](C)C(=O)NCCCC[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)C(\NC(=O)[C@@H](CCCCN)NC(=O)CNC(C)=O)=C/C=1C=CC=CC=1)C(N)=O)C(=O)C(\NC(=O)[C@@H](CCCCN)NC(=O)CNC(C)=O)=C\C1=CC=CC=C1 LQRJAEQXMSMEDP-XCHBZYMASA-N 0.000 description 1
- 239000000813 peptide hormone Substances 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 238000013492 plasmid preparation Methods 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 102000054765 polymorphisms of proteins Human genes 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 235000004252 protein component Nutrition 0.000 description 1
- 238000000164 protein isolation Methods 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 238000005185 salting out Methods 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 150000003335 secondary amines Chemical class 0.000 description 1
- 230000001568 sexual effect Effects 0.000 description 1
- 238000004904 shortening Methods 0.000 description 1
- 230000037432 silent mutation Effects 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- URGAHOPLAPQHLN-UHFFFAOYSA-N sodium aluminosilicate Chemical compound [Na+].[Al+3].[O-][Si]([O-])=O.[O-][Si]([O-])=O URGAHOPLAPQHLN-UHFFFAOYSA-N 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000011343 solid material Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 230000028070 sporulation Effects 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- KYMBYSLLVAOCFI-UHFFFAOYSA-N thiamine Chemical compound CC1=C(CCO)SCN1CC1=CN=C(C)N=C1N KYMBYSLLVAOCFI-UHFFFAOYSA-N 0.000 description 1
- 235000019157 thiamine Nutrition 0.000 description 1
- 229960003495 thiamine Drugs 0.000 description 1
- 239000011721 thiamine Substances 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000003151 transfection method Methods 0.000 description 1
- 238000000844 transformation Methods 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 108010044292 tryptophyltyrosine Proteins 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 150000003751 zinc Chemical class 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/80—Vectors or expression systems specially adapted for eukaryotic hosts for fungi
- C12N15/81—Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts
- C12N15/815—Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts for yeasts other than Saccharomyces
Definitions
- the present invention relates to expression constructs comprising the coding nucleic acid sequence for a shuttle peptide construct processable by yeast cells; corresponding expression vectors containing such constructs; processes carried out with the aid thereof for the recombinant production of target proteins; hosts transformed with it; Shuttle peptides and nucleic acid sequences coding therefor; Nucleic acid sequences coding for such shuttle peptides, fused with a foreign protein; Hydrophobin proteins, which were produced using such shuttle peptides, and the use of hydrophobins for coating objects, such as e.g. Leather.
- yeasts as hosts for heterologous protein expression are widely used. The reason for this is that yeast has several advantages as an expression system. Compared to bacteria and other eukaryotic cells, they can grow in higher density and have the ability for protein glycosylation and post-translational modification. In addition, the products produced and secreted by yeasts can be purified in a simple manner because the yeasts have high resistance to cell lysis and small amounts of foreign protein are usually found in the growth medium. In addition, yeasts can grow faster than other eukaryotic cells in high density on inexpensive nutrient media.
- an expression vector for the expression of heterologous proteins in yeast which, flanked by suitable transcription and translation start or termination sequences, comprises the coding sequence for a hybrid precursor polypeptide which comprises the signal peptide as elements and the leader peptide of a protein secreted by yeasts and a heterologous protein flanked by N-terminal and C-terminal propeptide sequences of the heterologous protein.
- Hydrophobins are small, approximately 100 amino acid residues, cysteine-rich proteins with interesting technical properties. You can make hydrophobic surfaces hydrophilic. They make hydrophilic surfaces hydrophobic.
- hydrophobins from edible mushrooms (cf. SEQ ID NO: 21 and 22).
- WO-A-00/58342 relates to the purification of hydrophobin-containing fusion proteins by phase extraction.
- WO-A-01/57066 describes stabilization, solubilization and the associated better use of hydrophobins by sulfite treatment.
- WO-A-01/57076 describes the purification of hydrophobin by adsorption on Teflon beads and the elution by means of a detergent such as Tween at low temperatures.
- WO-A-01/57528 describes the fixation of hydrophobins on surfaces by the use of tween and temperatures up to 85 degrees Celsius.
- WO-A-01/74864 describes atypical hydrophobins (only one disulfide bridge) with the names RdIA and RdlB (cf. SEQ ID NO: 19 and 20) from filamentous bacteria, in particular Streptomyces sp.
- the hydrophobin is used for the surface treatment of various objects such as windows, contact lenses and vehicle bodies. It is also proposed to produce the proteins described there in a recombinant host that releases the proteins into the medium. After detachment The hydrophobin-containing medium should be suitable for surface coating of the host. Experimental evidence for actual expression and secretion is not provided.
- the object of the present invention is to provide agents which make it possible to secrete expressed homologous or, in particular, heterologous proteins expressed in yeast, in particular Schizosaccharomyces pombe, from the yeast cells into the surrounding medium.
- means should be provided which allow the secretion of recombinantly produced hydrophobin from the host cell.
- Sig signal peptide
- SP shuttle peptide
- hydrophobin DewA protein protein according to SEQ ID NO: 14 with coding sequence according to SEQ ID NO: 13; preprotein with signal sequence: SEQ ID NO: 16 with coding nucleic acid sequence according to SEQ ID NO: 15
- This protein is a class I representative of hydrophobins, i.e. of secreted fungal envelope proteins with the ability to self-assemble.
- the DNA sequence coding for the target protein (DewA) (SEQ ID NO: 13) is at the 3'-terminal end for a peptide pheromone from S. pombe (P factor; amino acid sequence according to SEQ ID NO: 6 for mature P-factor) coding DNA sequence (SEQ ID NO: 5 for mature P-factor) fused.
- the resulting fusion protein contains all the signal sequences necessary for the secretion of the pheromone and the target protein fused to it, in particular the cleavable signal peptide (SEQ ID NO: 4).
- the fusion protein is processed proteolytically.
- the pheromone (P factor) (SEQ ID NO: 6) and the target protein (hydrophobin; SEQ ID NO: 14) are secreted separately into the medium.
- the finding according to the invention is surprising in that the regulatory elements of the P-factor preprotein (N-terminal to the mature pheromone) are obviously not sufficient to control the secretion of the target protein by the yeast cells. Only the use of a construct in which an additional, co-secreting protein component (the mature pheromone) is processably connected upstream of the target protein to be secreted enables the desired secretion of the target protein into the culture medium.
- secrete is a protein which is expressed intracellularly by a host cell, in particular of yeasts, and is excreted from the cell, preferably into the surrounding medium, through the cell membrane via the cell's own mechanisms.
- Protein precursor in its originally expressed form, such as a preprotein, with N- and / or C-terminal peptide sequences that are no longer present in the mature processed protein
- proteolytic processes in and / or outside the host cell.
- a "processable linkage" is given when individual protein sections in a protein to be processed are linked via peptide bonds which can be cleaved by a proteolytic enzyme of the host cell.
- the “processing” can take place N-terminally and optionally also C-terminally to the sequence of the mature, processed protein (target protein).
- target protein A “homologous” target protein, although originally expressed in the host used according to the invention, is therefore a host's own protein, but is secreted by the host cells due to the transformation of the host with an expression construct according to the invention.
- a “heterologous” target protein is not originally expressed in the host used according to the invention, is therefore not a host protein, but is secreted by the host cells due to the transformation of the host with the expression construct according to the invention.
- a “shuttle peptide” is part of a “shuttle peptide construct” that can be processed in the host cell used according to the invention. Together with one or more processable regulative C- and / or N-terminal, preferably N-terminal, associated peptide fragments, such as signal sequences, leader sequences, it forms the shuttle peptide construct.
- the shuttle peptide is e.g. to the signal peptide a polypeptide secreted by the host cell.
- the regulatory elements are preferably processed intracellularly.
- the shuttle peptide can also be secreted if it is fused, preferably C-terminally, to a target protein in a processable manner. This C-terminal processing is preferably carried out, i.e. Cleavage of the target protein, proteolytic during secretion, e.g. during passage through the host cell envelope or in extracellular space, e.g. in the surrounding culture medium, by the cell's own proteases.
- An “expression construct” or an “expression cassette” according to the present invention comprises, operatively linked, to the coding nucleic acid sequence of a processable shuttle peptide construct according to the above definition, the start and termination signals necessary for controlling expression in a special host system, such as in particular yeast cells Transcription and, if necessary, translation.
- the expression construct in particular comprises binding sites for transcription factors. 5'- Upstream of the coding sequence is a constitutive or inducible, native or heterologous, natural or synthetic promoter operable in the host cell.
- the expression construct also includes a number of restriction enzyme sites, e.g. B. those for inserting the construct into an expression vector.
- the expression construct can include a gene for a selectable marker.
- An “expression vector” describes a construct that can be obtained by inserting an expression cassette according to the invention into a replicon, such as, for example, into a plasmid, cosmid or a virus.
- a replicon such as, for example, into a plasmid, cosmid or a virus.
- Such a vector is capable of autonomous replication or integration into the host genome and contains the necessary ones Control sequences for controlling transcription and optionally translation of the coding nucleic acid sequences according to the invention for a processable shuttle peptide construct as defined above.
- a first subject of the invention relates to an expression construct comprising the coding nucleic acid sequence for a shuttle peptide construct of the general formula which can be processed by yeast cells
- telomere sequences for a) a signal peptide (Sig) in the 5'-3 'direction, processably linked to b) at least one shuttle peptide (SP) that can be secreted by the yeast cells; and optionally one or more nucleic acid sequences which promote processing and / or secretion, 5 'or 3' terminal to the coding signal peptide sequence.
- Sig signal peptide
- SP shuttle peptide
- the coding sequences for SP and Sig are in the same reading frame and, in addition, a processable sequence between the C-terminus of Sig and the N-terminus of SP is formed during translation.
- This processable sequence can be, for example, an artificially introduced, proteolytically cleavable natural or synthetic adapter sequence. However, this is preferably part of the C-terminus of Sig or N-terminus of SP.
- the adapter sequence can be processed in such a way that the split sequence can be found in whole or in part at the C-terminus of Sig or the N-terminus of SP. The latter is possible as long as this does not significantly impair, in particular not prevent, the ability to secrete SP.
- the invention relates to such expression constructs which code for a processable shuttle peptide construct which is derived from a polypeptide which is processed by yeasts in the broadest sense.
- yeasts selected from Ascomycetes.
- Preferred yeasts are selected from those of the Class of the Archiascomycetes, the order of the Schizosaccharomycetales and particularly preferably selected from yeasts of the genus Schizosaccharomyces, such as S. pombe.
- the processable shuttle peptide construct is derived in particular from a pheromone preprotein from a yeast, the pheromone being produced from the preprotein by N- and C-terminal processing.
- the pheromone N-terminal preferably has a polypeptide which can be split off by processing and which in particular comprises the elements required for processing and / or secretion of the preprotein, such as signal peptide and possibly leader peptide, and the required protease interfaces.
- Mushroom pheromones are known and e.g. described both for basidiomycetes such as Ustilago maydis (Urban, M., Kahmann, R. and Bolker, M. (1996)
- Three subfamilies of pheromone and reeeptor genes generate mutiple B mating speeifities in the mushroom Coprineus cinereus (Genetics 154 ( 3): 1115-1123)) and ascomycetes such as Schizosaccharomyces pombe (Imai, Y.
- Pheromones suitable according to the invention are relatively small peptides (such as 5 to 40 or 8 to 30 amino acids). They usually do not show significant homology in the primary sequence. They are formed as preproteins, processed proteolytically and released into the culture medium.
- pheromones or corresponding pre-proteins examples include the so-called P and M factors or their pre-proteins from S. pombe. (cf.Imai, Y. and Yamamoto, M. (1995) The fission yeast mating pheromone P-factor: its molecular strueture, gene strueture, and ability to induce gene expression and G1 arrest in the mating partner (Genes Dev 8 (3 ): 328-338), Davey, J.
- the P-factor preprotein has, for example, a DNA sequence according to SEQ ID NO: 9 and a protein sequence according to SEQ ID NO: 10.
- the preprotein comprises an N-terminal signal peptide sequence bridged with four successive pheromone peptide sequences which can be separated by processing (cf. FIG. 3).
- the processable shuttle peptide construct is designed such that it contains a signal polypeptide (Sig) which is processably linked to the N-terminal end of a C-terminally processable pheromone polypeptide (Pher).
- Sig signal polypeptide
- Pher C-terminally processable pheromone polypeptide
- the signal polypeptide comprises or is identical to the proteolytically cleavable native signal polypeptide (e.g. SEQ ID NO: 4 encoded by SEQ ID NO: 3) of the pheromone preprotein.
- the C-terminal processed pheromone polypeptide comprises a C-terminal protease interface.
- the expression construct preferably further comprises the coding nucleic acid sequence for a homologous or heterologous target protein (Targ), processably linked to the C-terminus of the shuttle peptide construct (Sig-SP).
- the invention preferably relates to expression constructs of the type described above, comprising the coding nucleic acid sequence for a fusion protein of the general formula which can be processed by yeast cells
- L1 and L2 stand for processable linkers or adapter sequences and n and m stand independently for 0 or 1. However, n is preferably 1 and m is O.
- L1 and L2 can be natural or synthetic linkers. They comprise at least one proteolytically processable peptide sequence. If necessary, with L1 and / or L2, e.g. the processing, secreting, transcription and / or translation-promoting effector functions are associated.
- the coding nucleic acid sequence for the processable shuttle peptide construct being a sequence coding for a signal polypeptide (Sig) according to SEQ ID NO: 3 or a functional equivalent thereof, operatively linked to that for the mature P factor pheromone (Pher) encoding nucleic acid sequence according to SEQ ID NO: 5 or a functional equivalent thereof.
- Sig signal polypeptide
- Pher mature P factor pheromone
- the linker L2 is preferably not present.
- the linker L1 is preferably provided and comprises the coding sequence for a polypeptide according to amino acid residues 21 to 30 in SEQ ID NO: 10.
- L1 bridges the signal polypeptide with the first pheromone building block (positions 31 to 57 in SEQ ID NO : 10) the prehormone.
- the C-terminal end of L1 corresponds to a recognition sequence of the protease required for the proteolytic processing.
- the coding nucleic acid sequence for the processable shuttle peptide construct comprises a sequence according to SEQ ID NO: 1.
- the same procedure can also be used with the help of the M factor - the second pheromone occurring in S. pombe - and applicable to the expression of any homo- and heterologous target proteins (target proteins).
- Genomically there are three genes (mfmf, SEQ ID NO: 42; mfm2 SEQ ID NO: 45; and mfm3 + , SEQ ID NO: 48) which each encode the M factor, the pheromone of the cells with the minus pairing type.
- a preprotein (SEQ ID NO: 43, 46 and 49) is first formed from each gene, which is processed as part of the secretion.
- the M factor (YTPKVPYMC; SEQ ID NO: 51), encoded by SEQ ID NO: 44, 47 and 50) is released into the medium as a mature pheromone (cf. FIG. 9).
- shuttle peptide constructs suitable according to the invention could therefore be derived from the coding sequences according to SEQ ID NO: 42, 45 or 48, which code for M factor signal peptide, functionally linked to an M factor pheromone.
- Non-limiting examples of corresponding coding shuttle peptide sequences include e.g.
- Functional equivalents can contain the sequence segments located 5 'upstream from the coding sequence of the mature M factor (SEQ ID NO: 44, 47 or 50) unchanged or modified (e.g. by deletion of one or more nucleic acid residues), and thus for an in encode its amino acid sequence modified shuttle peptide, which functionally links the mature M factor peptide sequence with a, eg C-terminal shortened signal sequence section includes.
- a target protein (target) expressed according to the invention can be derived from any prokaryotic or eukaryotic organism, in particular humans, animals or yeasts, as long as it can be expressed by the host cell in the manner according to the invention as a component of a fusion protein with the shuttle peptide (SP) and is processable.
- the secreted and processed product can be therapeutically useful or have other advantageous application properties.
- therapeutically useful proteins are immunoglobulins, Peptide hormones, growth factors, lymphokines, protease inhibitors and the like. Hydrophobins are particularly worthy of mention as an example of target proteins with other properties which are of interest in terms of application technology.
- the target protein is a hydrophobin, in particular a hydrophobin of class I.
- hydrophobins are relatively small (100 + 25 amino acids) moderately hydrophobic proteins with a conserved motif of 8 cysteines (X -CX 2-38 5- 9-CCX 11-39 -CX 8- 23 -CX 5-9 -CCX. 6 18 -CX 2- ⁇ 3 ). Hydrophobins can assemble at hydrophilic-hydrophobic interfaces to protein films. Such aggregates of class I hydrophobins are insoluble in SDS, while aggregates of class II hydrophobins are soluble in SDS (Wessels, JGH (1997) Hydrophobins: Proteins that change the nature of the fungal surface. Adv Microb Physiol 38: 1-45) ,
- Hydrophobins which can be used according to the invention are derived in particular from fungi, e.g. from Ascomycetes, such as those of the genus Aspergillus, in particular A. nidulans.
- Useful hydrophobins are also known from the prior art mentioned above and are not restricted to those from fungi.
- Non-limiting examples of useful hydrophobins are selected from SEQ ID NO: 14 (DewA), SEQ ID NO: 19 (RdIA) SEQ ID NO: 20 (RdlB) SEQ ID NO: 21 (HYP1) SEQ ID NO: 22 (HYP4) and SEQ ID NO: 56 (RodA).
- the RodA protein together with the DewA protein is part of the outer spore shell of A. nidulans.
- the invention also relates to expression vectors comprising, in operative linkage with at least one regulatory nucleic acid sequence, an expression construct as defined above.
- the invention also relates to recombinant microorganisms which contain, if appropriate stably integrated into the host genome, at least one expression vector or an expression construct as defined above.
- a “recombinant microorganism in the sense of the present invention comprises at least one expression vector according to the invention or an expression construct according to the invention and is derived from yeasts in the broadest sense.
- the yeasts are derived from Ascomycetes.
- Preferred yeasts are selected from the class of the Archiascomycetes, the order of the Schizosaccharomycetales, and particularly preferably selected from yeasts of the genus Schizosaccharomyces, such as S. pombe.
- Another object of the invention relates to shuttle peptide constructs that can be processed by yeast cells, derived from a pheromone preprotein from a yeast, the pheromone being derivable and secrete from the preprotein by N- and C-terminal processing.
- Preferred shuttle peptide constructs containing a signal polypeptide N-terminai are processably linked to the C-terminally processed pheromone polypeptide.
- the signal polypeptide is preferably the proteolytically cleavable native signal polypeptide of the pheromone preprotein and the C-terminally processed pheromone polypeptide comprises the C-terminal protease interface.
- Preferred shuttle peptide constructs are derived from pheromone preproteins, from yeasts, in particular preproteins of the factors P and M from S. pombe.
- Particularly preferred shuttle peptides comprise an amino acid sequence according to SEQ ID NO: 2 or a functional equivalent thereof.
- Another object of the invention relates to a method for the recombinant production of a target protein, wherein a recombinant microorganism according to the above definition is cultivated, which expresses the nucleic acid sequence encoding the target protein and the target protein secreted into the culture medium, such as e.g. a hydrophobin as defined above, isolated.
- the invention further relates to nucleic acids coding for a shuttle peptide construct as defined above; as well as nucleic acids coding for a fusion protein which can be processed by yeast lines and comprises a target protein and as defined above.
- the invention also relates to hydrophobins obtainable by a process according to the invention.
- the invention relates to the use of such a hydrophobin for surface treatment, in particular the surface of objects selected from glass, fibers, fabrics, leather, lacquered objects, such as e.g. Motor vehicle bodies, foils, facades treated.
- the invention also relates to the use of hydrophobins for the surface treatment of fibers, fabrics and leather.
- polypeptide also included according to the invention are “functional equivalents” of the specifically disclosed or used polypeptide / proteins. This applies both to the intermediately formed fusion proteins and to their components, ie target proteins (target), shuttle peptides (SP) such as pheromones (Pher) also for signal peptides (Sig) and linkers.
- target target proteins
- SP shuttle peptides
- Sig signal peptides
- linkers linkers.
- polypeptide is used as a generic term for polypeptide / protein.
- “Functional equivalents” or analogs of the specifically disclosed polypeptides are, within the scope of the present invention, different polypeptides thereof which continue to have the desired biological activity.
- Analog shuttle peptides should continue to be suitable for controlling the secretion and processing of the target protein.
- the functional equivalents should also correspond accordingly of components of the shuttle peptide, such as signal polypeptide, pheromone, linker, furthermore have the properties required for effective secretion and processing of the fusion protein with release of the target protein.
- “Functional equivalents” of polypeptides according to the invention can in particular contain residues of natural linker or adapter sequences which are formed by proteolytic cleavage at the C- and / or N-terminal.
- “functional equivalents” are understood to mean, in particular, mutant proteins which have at least one of the sequence positions of the above-mentioned concrete sequences different from the specifically mentioned amino acid, but nevertheless have one of the above-mentioned biological activities.
- “Functional equivalents” thus include the mutant proteins obtainable by one or more amino acid additions, substitutions (cf. examples in the following table), deletions and / or inversions, the changes mentioned being able to occur in any sequence position as long as they exist a mutant protein with the property profile according to the invention.
- Suitable residues for amino acid substitutions include:
- Functional equivalence is particularly given when the activity pattern between mutant and unchanged polypeptide matches qualitatively.
- modified shuttle peptides express or secrete the same target protein with higher or lower efficiency in the same host; or that modified target proteins have an increased or decreased pharmacological effect or modified application properties.
- “Functional equivalents” in the above sense also include precursors of the polypeptides described and functional derivatives and salts of the polypeptides.
- salts means both salts of carboxyl groups and acid addition salts of amino groups of the protein molecules according to the invention.
- Salts of carboxyl groups can be prepared in a manner known per se and include inorganic salts, such as, for example, sodium, calcium, ammonium, iron and zinc salts, and salts with organic bases, such as, for example, amines, such as triethanolamine, arginine , Lysine, piperidine and the like.
- Acid addition salts such as, for example, salts with mineral acids, such as hydrochloric acid or sulfuric acid, and salts with organic acids, such as acetic acid and oxalic acid, are also a subject of the invention.
- “Functional derivatives” of polypeptides according to the invention can also be prepared on functional amino acid side groups or on their N- or C-terminal end using known techniques.
- Such derivatives include, for example, aliphatic esters of carboxylic acid groups, amides of carboxylic acid groups, obtainable by reaction with ammonia or with a primary or secondary amine, N-acyl derivatives of free amino groups, produced by reaction with acyl groups, or O-acyl derivatives of free hydroxyl groups, produced by reaction with acyl groups.
- “Functional equivalents” naturally also include polypeptides which are accessible from organisms other than those specifically mentioned, and naturally occurring variants. For example, regions of homologous sequence regions can be determined by sequence comparison and, based on the specific requirements of the invention, equivalent enzymes can be determined.
- “Functional equivalents” also include fragments, preferably individual domains or sequence motifs, of the polypeptides according to the invention which, for example, have the desired biological function.
- “Functional equivalents” are also fusion proteins which contain one of the abovementioned polypeptide sequences or functional equivalents derived therefrom and at least one further, functionally different, heterologous sequence in functional N- or C-terminal linkage (ie without mutual substantial functional impairment of the fusion protein parts).
- heterologous sequences are signal peptides, enzymes, immunoglobulins, surface antigens, receptors or receptor ligands.
- “Functional equivalents” encompassed according to the invention are homologs to the specifically named polypeptides. These have at least 60%, preferably at least 75%, in particular at least 85%, such as 90%, 95% or 99%, homology to one of the concretely disclosed Sequences calculated according to the algorithm of Pearson and Lipman, Proc. Natl. Acad, Sei. (USA) 85 (8), 1988, 2444-2448.
- a percentage homology of a homologous polypeptide according to the invention means in particular percentage identity of the amino acid residues based on the total length of one of the amino acid sequences specifically described herein.
- equivalents according to the invention include polypeptides in deglycosylated or glycosylated form and also modified forms obtainable by changing the glycosylation pattern.
- Homologs of the proteins or polypeptides according to the invention can be generated in a manner known per se by mutagenesis, e.g. by point mutation or shortening of the protein.
- Nucleic acid sequences according to the invention in particular those which code for one of the above polypeptides and their functional equivalents, comprise single and double-stranded DNA and RNA sequences, such as e.g. also cDNA and mRNA.
- nucleic acid sequences mentioned here are either of natural origin or can be prepared in a manner known per se by chemical synthesis from nucleotide components, such as, for example, by fragment condensation of individual overlapping, complementary nucleic acid components.
- oligonucleotides can be carried out, for example, in a known manner using the phosphoamidite method (Voet, Voet, 2nd edition, Wiley Press New York, pages 896-897).
- the attachment of synthetic oligonucleotides and the filling of gaps with the aid of the Klenow fragment of DNA polymerase and ligation reactions as well as general cloning methods are described in Sambrook et al. (1989) Molecular Cloning: A laboratory manual, Cold Spring Harbor Laboratory Press.
- the invention also relates to nucleic acid sequences coding for one of the above polypeptides and their functional equivalents, which e.g. are accessible using artificial nucleotide analogs.
- the invention relates both to isolated nucleic acid molecules which code for polypeptides according to the invention or biologically active sections thereof, and to nucleic acid fragments which e.g. are suitable for use as hybridization probes or primers for identifying or amplifying coding nucleic acids according to the invention.
- nucleic acid molecules according to the invention can also contain untranslated sequences from the 3 'and / or 5' end of the coding gene region.
- nucleic acid molecule is separated from other nucleic acid molecules that are present in the natural source of the nucleic acid and, moreover, can be substantially free of other cellular material or culture medium when produced by recombinant techniques, or free of chemical precursors or other chemicals be when it's chemically synthesized.
- a nucleic acid molecule according to the invention can be isolated using standard molecular biological techniques and the sequence information provided according to the invention.
- cDNA can be isolated from a suitable cDNA library by using one of the specifically disclosed complete sequences or a section thereof as a hybridization probe and standard hybridization techniques (as described, for example, in Sambrook, J., Fritsch, EF and Maniatis, T. Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989).
- nucleic acid molecule comprising one of the disclosed sequences or a portion thereof can be isolated by polymerase chain reaction using the oligonucleotide primers which have been created on the basis of this sequence.
- the nucleic acid amplified in this way can be cloned into a suitable vector and characterized by DNA sequence analysis.
- the invention further comprises the nucleic acid molecules complementary to the specifically described nucleotide sequences or a section thereof.
- nucleotide sequences mentioned enable the generation of probes and primers which can be used for the identification and / or cloning of homologous sequences in other cell types and organisms.
- probes or primers usually comprise a nucleotide sequence region which, under stringent conditions, can be attached to at least about 12, preferably at least about 25, e.g. about 40, 50 or 75 successive nucleotides of a sense strand of a nucleic acid sequence according to the invention or a corresponding antisense strand are hybridized.
- nucleic acid sequences according to the invention are derived from the specifically disclosed sequences and differ from them by addition, substitution, insertion or deletion of one or more nucleotides, but continue to code for polypeptides with the desired property profile.
- nucleic acid sequences which comprise so-called silent mutations or which are modified in accordance with the codon usage of a specific source or host organism, in comparison with a specifically named sequence, as well as naturally occurring variants, such as e.g. Splice variants or allele variants, thereof.
- Sequences obtainable by conservative nucleotide substitutions i.e. the amino acid in question is replaced by an amino acid of the same charge, size, polarity and / or solubility are also a subject of the subject.
- the invention also relates to the molecules derived from the specifically disclosed nucleic acids by sequence polymorphisms. These genetic polymorphisms can exist between individuals within a population due to natural variation. These natural variations usually cause a 1 to 5% variance in the nucleotide sequence of a gene.
- the invention also encompasses nucleic acid sequences which hybridize with the abovementioned coding sequences or are complementary thereto.
- These polynucleotides can be found when screening genomic or cDNA banks and, if appropriate, can be amplified therefrom using suitable primers by means of PCR and then isolated, for example, using suitable probes.
- the property of being able to “hybridize” to polynucleotides means the ability of a poly- or oligonucleotide to bind to an almost complementary sequence under stringent conditions, while under these conditions non-specific bindings between non-complementary partners are avoided.
- sequences should be closed 70-100%, preferably 90-100%, are complementary
- the property of complementary sequences to be able to bind specifically to one another is demonstrated, for example, in the Northern or Southern blot technique or in primer binding in PCR or RT-PCR Usually oligonucleotides with a length of 30 base pairs or more are used for this purpose.
- Stringent conditions mean, for example in Northern blot technology, the use of a washing solution, for example 50-70 ° C., preferably 60-65 ° C. 0.1x SSC buffer with 0.1% SDS (20x SSC: 3M NaCI, 0.3M Na citrate, pH 7.0) for the non-specific hybrid elution cDNA probes or oligonucleotides.
- the invention also relates to expression constructs containing, under the genetic control of regulatory nucleic acid sequences, a nucleic acid sequence coding for a polypeptide to be expressed according to the invention; and vectors comprising at least one of these expression constructs.
- Such constructs according to the invention preferably comprise a promoter 5'-upstream of the respective coding sequence and a terminator sequence 3'-downstream and, if appropriate, further customary regulatory elements, in each case operatively linked to the coding sequence.
- An “operative linkage” is understood to mean the sequential arrangement of promoter, coding sequence, terminator and, if appropriate, further regulatory elements in such a way that each of the regulatory elements can fulfill its function as intended when expressing the coding sequence.
- sequences which can be linked operatively are targeting sequences and enhancers, polyadenylation signals and the like.
- Other regulatory elements include selectable markers, amplification signals, origins of replication and the like. Suitable regulatory sequences are described, for example, in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990).
- the coding nucleic acid sequences can be contained in one or more copies in the gene construct.
- yeast promoters ADC1, MFalpha, AC, P-60, CYC1, GAPDH, nmt1, nmt41 and nmt81.
- Suitable promoters for the yeast S. pombe are e.g. to name: nmtl, nmt41, nmt81, adhl, fbpl, SV40 or CaMV. Further information at (http://pinqu.salk.edU/ ⁇ forsburq/vectors.html#exp).
- the promoters differ in their transcription rate. The selection depends on the desired level of expression. The same applies to other yeasts.
- Suitable yeast promoters are described, for example, in published US patent application 2003/0077831, which is hereby expressly incorporated by reference.
- inducible promoters such as e.g. light-inducible and in particular temperature-inducible promoters.
- the regulatory sequences mentioned are intended to enable the targeted expression of the nucleic acid sequences. Depending on the host organism, this can mean, for example, that the gene is only expressed or overexpressed after induction, or that it is expressed and / or overexpressed immediately.
- the regulatory sequences or factors can preferably have a positive influence on the expression and thereby increase or decrease it.
- the regulatory elements can advantageously be strengthened at the transcription level by using strong transcription signals such as promoters and / or "enhancers".
- an increase in translation is also possible, for example, by improving the stability of the mRNA.
- An expression cassette is produced by fusing a suitable promoter with a suitable coding nucleotide sequence and a terminator or polyadenylation signal. Common recombination and cloning techniques are used, such as those described in T. Maniatis, EF Fritsch and J.
- the recombinant nucleic acid construct or gene construct is advantageously inserted into a host-specific vector which enables optimal expression of the genes in the host.
- Vectors are well known to those skilled in the art and can be found, for example, in "Cloning Vectors" (Pouweis P.H. et al., Ed., Elsevier, Amsterdam-New York-Oxford, 1985).
- vectors are also understood to mean all other vectors known to the person skilled in the art, such as phages, viruses such as SV40, CMV, baculovirus and adenovirus, transposons, IS elements, phasmids, cosmids, and linear or circular DNA. These vectors can be replicated autonomously in the host organism or replicated chromosomally.
- Constructs suitable for the yeast S. pombe can be mentioned as examples of expression vectors suitable according to the invention (see, for example: (http://pinqu.salk.edU/ ⁇ forsburq/vectors.html#exp).
- REP1, REP3, REP4 (Maundrell, K. (1990). Nmtl of fission yeast: a highly transcribed gene completely repressed by thiarnine. J. Biol. Chem. 265: 10857-10864) REP41, REP42, REP81, REP82 (Basi, G., Schmid, E. and Maundrell, K. (1993) TATA box mutations in the Schizosaccharomyces pombe nmtl promoter affect transcription efficiency but not the transcription start point or thiamine repressibility. Gene 123: 131-136)
- Yeast expression vectors for expression in yeast S. cerevisiae such as pYEpSed (Baldari et al., (1987) Embo J. 6: 229-234), pMFa (Kurjan and Herskowitz (1982) Cell 30: 933-943), pJRY88 (Schultz et al. (1987) Gene 54: 113-123) and pYES2 (Invitrogen Corporation, San Diego, CA).
- Vectors and methods of constructing vectors suitable for use in other fungi such as filamentous fungi include those described in detail in: van den Hondel, C.A.M.J.J. & Punt, P.J. (1991) "Gene transfer Systems and vector development for filamentous fungi, in: Applied Molecular Genetics of Fungi, J.F. Peberdy et al., Eds., Pp. 1-28, Cambridge University Press: Cambridge.
- recombinant microorganisms can be produced which, for example, have been transformed with at least one vector according to the invention and can be used to produce the polypeptides according to the invention.
- the recombinant constructs according to the invention described above are advantageously introduced and expressed in a suitable host system.
- Common cloning and transfection methods known to the person skilled in the art such as, for example, co-precipitation, protoplast fusion, electroporation, retroviral transfection and the like, are preferably used to bring the nucleic acids mentioned into expression in the respective expression system. Suitable systems are described, for example, in Current Protocols in Molecular Biology, F. Ausubel et al., Ed., Wiley Interscience, New York 1997, or Sambrook et al. Molecular Cloning: A Laboratory Manual. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989.
- all organisms which enable expression of the nucleic acids according to the invention, their allele variants, their functional equivalents or derivatives are suitable as host organisms.
- Preferred host organisms are yeasts.
- Auxotrophic markers are often used in yeasts to select transformants.
- the strain to be transformed lacks a protein which is necessary for the production of certain metabolic products.
- the corresponding active protein is introduced into the cell by the vector used. Commonly used markers are
- Genes e.g. uracil, leucine, histidine or tryptophan biosynthesis.
- Successfully transformed organisms can be selected using marker genes, which are also contained in the vector or in the expression cassette.
- marker genes are genes for antibiotic resistance and for enzymes which catalyze a coloring reaction which stains the transformed cell. These can then be selected using automatic cell sorting.
- Microorganisms which have been successfully transformed with a vector and carry an appropriate antibiotic resistance gene e.g. G418 or hygromycin
- an appropriate antibiotic resistance gene e.g. G418 or hygromycin
- Marker proteins that are presented on the cell surface can be used for selection by means of affinity chromatography.
- the combination of the host organisms and the vectors which match the organisms, such as plasmids, viruses or phages, such as, for example, plasmids with the RNA polymerase / promoter system, the phages 8 or: or other temperate phages or transposons and / or further advantageous regulatory ones Sequences form an expression system.
- the invention further relates to methods for the recombinant production of a target protein as defined above.
- the recombinant microorganism can be cultivated and fermented by known methods.
- suitable cultivation conditions for example for S. pombe in Alfa et al. (Alfa, C, Fantes, P., Hyams, J., McLeod, M. and Warbrick, E. (1993) Experiments with fission yeast. Cold Spring Harbor Laboratory Press, New York) and Gutz et al. (Gutz, H., Heslot, H., Leupold, U. and Loprieno, U. (1974) Schizosaccharomyces pombe. In: Handbook of Genetics 1, pp 395-446, Plenum Press, New York) or for S. cerevisiae in Kaiser et al. (Kaiser, C, Michaelis, S. and Mitchell, A. (1994) Methods in Yeast Genetics. Cold Spring Harbor Laboratory Press, New York).
- the cells are separated from this and the target protein is obtained from the supernatant by known protein isolation methods.
- Purification of the target protein can be achieved with known chromatographic methods, such as molecular sieve chromatography (gel filtration), ion exchange chromatography, such as Q-Sepharose chromatography, and hydrophobic chromatography, as well as with other conventional methods such as ultrafiltration, crystallization, salting out, dialysis and native gel electrophoresis. Suitable methods are described, for example, in Cooper, T.G., Biochemical Working Methods, Verlag Walter de Gruyter, Berlin, New York or in Scopes, R., Protein Purification, Springer Verlag, New York, Heidelberg, Berlin.
- vector systems can also be used which code for modified polypeptides or fusion proteins which serve for easier purification.
- suitable modifications are, for example, so-called “tags” which act as anchors, such as, for example, the modification known as a hexa-histidine anchor or epitopes which can be recognized as antigens of antibodies (described, for example, in Harlow, E. and Lane, D ., 1988, Antibodies: A Laboratory Manual, Cold Spring Harbor (NY) Press).
- anchors can be used to attach the proteins to a solid support, such as, for example, a polymer matrix, which can be filled, for example, in a chromatography column, or can be used on a microtiter plate or on another support.
- a solid support such as, for example, a polymer matrix, which can be filled, for example, in a chromatography column, or can be used on a microtiter plate or on another support.
- these anchors can also be used to recognize the proteins.
- customary markers such as fluorescent dyes, enzyme markers which form a detectable reaction product after reaction with a substrate, or radioactive markers, alone or in combination with the anchors, can be used to derivatize the proteins.
- WO-A-01/57066 which describes the stabilization, solubilization and the associated better use of hydrophobins by sulfite treatment
- WO-A-01/57076 which describes the purification of Hydrophobin by adsorption on Teflon beads and elution with detergent such as Tween describes at low temperatures
- WO-A-01/57528 which describes the fixation of hydrophobins on surfaces by the use of Tween and temperatures up to 85 degrees Celsius
- solid materials such as glass, fibers, fabrics, leather, lacquered objects, foils, facades, can be coated with hydrophobin.
- Figure 1 different constructs according to the invention for the secretion of the hydrophobins from S. pombe.
- FIG. 2A shows the genomic sequence of the DewA gene (SEQ ID NO: 39); the sequences of the two introns are underlined; B) the amino acid sequence and in brackets the corresponding DNA sequence of the DewA protein from Aspergillus nidulans; the signal sequence is printed in bold, the partial sequence following the signal sequence corresponds to the sequence of mature DewA; C) the amino acid sequence and in brackets the corresponding DNA sequence of the HA tag.
- 3A the amino acid sequence and, in parentheses, the corresponding DNA sequence of the P-factor preprotein; the signal sequence is printed in bold; the underlined partial sequences following the signal sequence correspond to the sequences of the four maternal pheromone peptides; the pheromone closest to the signal peptide is called the P factor; B) amino acid sequence and in brackets the corresponding DNA sequence of the cleavable signal peptide and the subsequent 6 amino acids (underlined) of the P-factor preprotein; C) amino acid sequence and in brackets the corresponding DNA sequence for the "P-Shuttle" according to the invention; the signal sequence is printed in bold; the underlined sub-sequence following the signal sequence corresponds to the sequence of the material P factor;
- FIG. 4 shows a fusion protein according to the invention consisting of the “P-shuttle” sequence (signal sequence bold; mature P protein underlined), the mature DewA (double underlined) and the C-terminally fused HA tag (SEQ ID NO: 18; coded) from SEQ ID NO: 17);
- FIG. 5 shows the immunological detection of hydrophobins in S. pombe *
- Detection fused with an HA tag cloned into the expression vector pJR1-3XL and transformed into S. pombe. "Membrane fraction” and “cytosolic proteins” were separated by SDS-PAGE. The detection in the Westem analysis was carried out with HA antibodies. The size standard in kDa is given on the left.
- Figure 6 shows the immunological detection of the expression of hydrophobins in S. pombe.
- the PDewAHA protein was expressed in S ⁇ pombe.
- the cells were harvested, the culture supernatant was aliquoted and part of the TCA was precipitated.
- the protein was detected by SDS-PAGE and Western blot with the help of HA antibodies.
- the bands marked with * correspond to the precursor protein (approx. 18 kD, upper band) and the mature form (approx. 17 kD lower band).
- S. pombe cells were transformed with plasmids which express P + 6DewA by a strong promoter (pJR1-3XL) or weaker promoter (pJR1-81XL).
- the cells carry a version of the prp7 gene chromosomally with a c-myc tag. This serves as a control to rule out that the culture supernatant has been contaminated by lysed cells.
- Cells were harvested (pellet), the culture supernatant TCA- precipitated (supernatant).
- the proteins were detected by SDS-PAGE and Western blot with the help of antibodies against HA (A) or against c-myc (B).
- Figure 8 shows the detection of secretion using the "P-Shuttle” method.
- S. pombe cells were transformed with plasmids which express PfakDewA through a weaker promoter (pJR1-81XL). The cells were harvested (pellet), the culture supernatant TCA-precipitated (US). The protein was detected according to SDS-PAGE and Westem blot with the help of antibodies against HA.
- FIG. 9 the three genes which each encode the M factor (SEQ ID NO: 51 for mature factor) from S. pombe: A) sequences for the mfm1 + ' gene; B) sequences for the tr7t / 772 + " gene; and C) sequences for the mfm3 * ' gene.
- Figure 10 shows the RodA gene.
- the genomic sequence (SEQ ID NO: 52) of the RodA gene contains two introns (underlined), which are not present in the corresponding coding ORF (SEQ ID NO: 53).
- the preprotein (SEQ ID NO: 54) contains a cleavable signal sequence (printed in bold) which is missing in the mature protein (SEQ ID NO: 56; encoded by SEQ ID NO: 55).
- the cloning steps carried out in the context of the present invention e.g. Restriction cleavage, agarose gel electrophoresis, purification of DNA fragments, transfer of nucleic acids to nitrocellulose and nylon membranes, linking of DNA fragments, transformation of E. coli cells, cultivation of
- DNA was purified from reaction mixtures or after gel electrophoresis using the NucleoSpin Extract Kit (Machery-Nagel, Düren) and plasmid DNA from E. coli was isolated using the NucleoSpin Plasmid Quick Pure Kit (Machery-Nagel, Düren) the manufacturer's instructions.
- Transformations in E. coli were carried out by electroporation using the Gene Pulser II device (BIO-RAD, Kunststoff) using 2 mm electroporation cuvettes (Biozym Diagnostik, Hess. Oldendorf) according to the manufacturer. Transformants were selected on LB medium (150 mg / l) containing ampicillin (Lennox, 1955, Virology, 1: 190).
- PCR amplifications were carried out using the Combizyme DNA polymerase (Invitek, Berlin, Germany) according to the manufacturer's instructions. 100 ⁇ l of reaction volume per 1 pmol of the corresponding primers were used.
- S. pombe The cultivation of S. pombe was carried out as in Alfa et al. (Alfa, C, Fantes, P., Hyams, J., McLeod, M. and Warbrick, E. (1993) Experiments with fission yeast. Cold Spring Harbor Laboratory Press, New York) and Gutz et al. (Gutz, H., Heslot, H., Leupold, U. and Loprieno, U. (1974) Schizosaccharomyces pombe. In: Handbook of Genetics 1, pp 395-446, Plenum Press, New York).
- cells were harvested by centrifugation at 3,500xg for 5 min.
- the cell pellets were resuspended in 1 ml of 1xPBS and 1 volume of glass beads was added. The mixture was vortexed for 5 min, the supernatant removed over the glass beads.
- strains DH5 ⁇ (Invitrogen), XL10-Gold (Stratagene) or BL21 (BioLabs) were used to work with E. coli.
- S. pombe strains used are from the gap yeast strain collection of the working group of Prof. Dr. G. Rodel taken from the Institute of Genetics at the Technical University of Dresden.
- Example 1 Production of the expression construct DewA and DewAHA and cloning into the vector pJR1-3XL
- the reaction mixture was separated by gel electrophoresis and the corresponding DNA band eluted as described above.
- the fragment which is flanked on both sides by a Sa / ⁇ HI site, which was inserted through the primer, was cut with the restriction endonuclease ßamHI (Invitrogen) according to the manufacturer's instructions and purified from the reaction mixture (see above).
- the vector pUC18 (Yanisch-Pron, C, Vieira, J. and Messing, J. (1985) Improved M13 phage cloning vectors and host strains: Nucleotide sequences of M13mp18 and pUC19 vectors. Gene 33: 103) was also cut with ßamHI, separated by gel electrophoresis and then eluted from the gel (see above).
- Vector and fragment were ligated (see above) and the ligation mixture was transformed into E. coli.
- Recombinant plasmids were identified after plasmid preparation and subsequent restriction digestion. After cloning, the correct DNA sequence of the cloned PCR products was - as with all constructs produced below - verified by sequencing. Sequencing reactions were carried out according to Sanger et al. (Sanger, F., Nicklen, S. and Coulson, A.R. (1977) DNA sequencing with chain terminating inhibitors. Proc NatI Acad Sei USA 74: 5463-5467).
- the sequencing reactions were carried out using the "Thermo-Sequenase fluorescent labeled primer cycle sequencing kit with 7-deaza-dGTP" (Amesham Pharamacia Biotech, Freiburg) and S'-side IRD800 labeled primers (MWG Biotech AG, Ebersberg). The products were separated and the sequence evaluated using the automatic LI-COR 4000/4200 (MWG Biotech AG, Ebersberg) sequencing system.
- a construct that contains the intron-containing genomic DewA gene cloned into the ßamHI site of the vector pUC18 was called pDewAgen.
- the intronless ORF was amplified with the subfragments as a template and the distal primers ScDewBamfor and SpDewBamrev.
- the approximately 410 bp long PCR product was separated by gel electrophoresis, purified and cut with the restriction endonuclease ßamHI. Appropriate interfaces had been inserted through the distal primers.
- the cut fragment was purified and cloned into the vector pUC18, also cut with ßamHI. Vector and fragment were ligated (see above) and the ligation mixture was transformed into E. coli.
- DEPA Since no specific antibodies against DewA are available, DEPA was fused with the HA epitope by OEP to detect heterologous expression.
- the primer pairs SpDewXhofor / DewAHArev and DewAHAfor / DewAHANcorev were used in the primary PCRs.
- DNA of the construct pDewAgen was used as a template for the production of DewHA (+ introns) and DNA of the construct pDewA-ORF for the production of DewHA (-ntrons).
- the vector yEP351 HA (Kettner, K., Friederichs, S., Schlapp, T. and Rodel G (2001) Expression of a VEGF-like) carrying the DNA sequence of the HA tag was used as a template for the PCR with DewAHAfor / DewAHANcorev protein from Parapoxvirus ovis in the yeasts Saccharomyces cerevisiae and Schizosaccharomyces pombe. Protein Expr Purif Aug; 22 (3): 479-83). In the final PCRs using the primer pair
- the DNA coding for the HA epitope was fused to the respective DewA DNA.
- the fragments amplified in this way are flanked on the 5 'side by an Xho ⁇ restriction site and on the 3' side by a ⁇ / col restriction site which were introduced with the aid of the distal primers.
- the fragments were separated by gel electrophoresis, purified and cut with the restriction endonucleases Xho ⁇ and Ncol and purified from the reaction mixture.
- the vector pJR1-3XL (Moreno, MB, Duran, A.
- the vectors DewA-HA (+ introns) and DewA-HA (introns) obtained according to a) and b) were in the S. pombe host strain K0103 (t? S ade6-M210 leu1-32 his7-366) as by Schiestl and Gietz (Schiestl, RH and Gietz, RD (1989) High efficency transformation of intact yeast cells using Single stranded nucleic acids as a carrier. Curr Genet 16: 339-346), which are described by the fe ⁇ / 7-32 mutation Conditional leucine auxotrophy of the S. pombe strain is complemented by the LE1 / 2 gene from S. cerevisiae present on the expression vectors. Transformants can thus be selected on minimal medium without leucine. The expression of the fusion proteins in corresponding yeast transformants was determined by means of Western blotting. Analyzes examined.
- anti-HA article 1 583816, anti-HA (12CA5) -mouse monoclonal antibody
- anti-c-myc article 1 667 149, anti-c-myc antibody
- FIG. 5A shows samples of a culture with the insert-free vector (pJR1-3XL, negative control), with an HA-tagged control protein (positive control) and with a vector which contains the HA-tagged DewA gene with introns (DewA -HA (+ introns)).
- samples are culture with the vector (pJR1-3XL, negative control), with a vector which contains the HA-tagged DewA gene without introns (DewA-HA (introns)) or the HA-tagged RodA gene with introns (Rod-AHA ( + lntrons)) contains, applied.
- RodAHA (+ introns) was produced in analogy to the information in Examples 1a) and 1b).
- RodA is another hydrophobin from A. nidulans.
- Example 2 Production of expression vectors for the secretion of the expressed DewA vector containing the construct PDewAHA
- the authentic secretion signal of the A. nidulans protein which is not effective in the split yeast, was first replaced by the cleavable signal peptide of the P factor from S. pombe.
- the P factor is secreted by the cells into the medium as a peptide pheromone. It is synthesized in the cell as a precursor protein (preprotein) consisting of a cleavable N-terminal signal sequence and four P-factor copies, each separated by short spacer sequences, and matures during secretion, including the cleavage of the signal sequence and the proteolytic release of the four P-factor peptides.
- preprotein precursor protein
- the P-factor signal sequence was amplified by means of PCR and genomic DNA from S. pombe as a template using the primer pair SigPXhofor / PDewArev and the corresponding PCR product was purified.
- the PDewAHA fragment was cut with the restriction endonucleases Xho ⁇ and ⁇ / col, separated by gel electrophoresis and ligated into the vector pJR1-3XL (see above) cut with the same restriction endonucleases.
- Vector and fragment were ligated (see above) and the ligation mixture was transformed into E. coli by electroporation.
- Recombinant plasmids were identified after plasmid minipreparation and the correct sequence of the cloned ORF was verified by sequencing.
- the construct obtained was called PDewAHA.
- the PDewAHA protein was expressed in S. pombe.
- the cells were harvested, the culture supernatant was aliquoted and part of the TCA was precipitated.
- the TCA precipitate was taken up in Laemmli buffer (Laemmli, UK (1970) Cleavage of structural proteins during the assembly of the head of bacteriophage T4 (Nature 227: 680-685)). Cell pellet, supernatant and TCA-precipitated supernatant were examined.
- the protein was detected by SDS-PAGE and Westem blot with the help of HA antibodies. The result is shown in FIG. 6.
- the bands marked with * correspond the precursor protein (approx. 18 kD, upper band) and the mature form (approx. 17 kD lower band).
- Example 3 Production of expression vectors for the secretion of the expressed DewA vector containing the construct P + 6DewAHA
- the sequence of the signal peptide in the fusion protein was determined using OEP using the primer pairs SigPXhofor / P + 6DewArev and P + 6DewAfor / DewAHANcorev with DNA of the construct PDewAHA as template in the primary PCR reactions
- the P + 6DewA fragment was cut with the restriction endonucleases Xho ⁇ and ⁇ / col, separated by gel electrophoresis and in those with the same restriction Sendonucleases cut vector pJR1-3XL (see above) and the ligation mixture transformed by electroporation in E. coli. Recombinant plasmids were identified after plasmid minipreparation and the correct sequence of the cloned ORF was verified by sequencing.
- the P + 6DewA fragment was also cloned into the vector pJR-81XL.
- the transcription of the fusion gene is under the control of the weak nmt ⁇ promoter. With this construct, a negative influence of the very high transcription in pJR1-3XL constants on the secretion should be tested.
- Example 2a The experiment was carried out in analogy to Example 2a.
- the amplified sequences are cloned in pJR1-3XI analogously to Example 2a.
- S. pombe cells were transformed with the two plasmids, which express P + 6DewA by a strong promoter (pJR1-3XL) or weaker promoter (pJR1-81XL).
- the cells carry a version of the prpl gene chromosomally with a c-myc tag. This serves as a control to rule out that the culture supernatant has been contaminated by lysed cells.
- Cells were harvested (pellet), the culture supernatant TCA-precipitated (supernatant). The precipitate was taken up in Laemmli buffer and also analyzed.
- the proteins were detected by SDS-PAGE and Western blot with the aid of antibodies against HA (FIG. 7A) or against c-myc (Röche Diagnostics) (FIG. 7B).
- Example 4 Production of expression vectors for the secretion of the expressed DewA vector containing the construct PfakDewAHA
- PCR fragments obtained were separated by gel electrophoresis, purified and used as a template for the final PCR using the primer pair SigPXhofor / DewAHANcorev.
- the PfakDewA fragment thus obtained was cut with the restriction endonucleases Xho ⁇ and ⁇ / col, separated by gel electrophoresis and ligated into the vector pJR1-81XL cut with the same restriction endonucleases (see above).
- the ligation mixture was transformed into E. coli by electroporation. Recombinant plasmids were identified after plasmid minipreparation and the correct sequence of the cloned ORF was verified by sequencing.
- PfakDewA / pJR1-81XL Such a construct was called PfakDewA / pJR1-81XL.
- the P-factor preprotein including the first amino terminal pheromone and the fused sequence encoding the hydrophobin are under the control of the nmt81 promoter.
- Example 2a The experiment was carried out in analogy to Example 2a, but using the expression vector pJR1-81XL.
- the amplified sequences were cloned into pJR1 -81XL analogously to Example 2a.
- the amplified and cut with the restriction endonucleases Xho ⁇ and ⁇ / col DNA was cloned into the Xho ⁇ and ⁇ / col sites of the expression vector pJR1-81XL.
- Example 5 Microscopic detection of the adsorption of expressed hydrophobin on Teflon
- a fluorescence-labeled HA antibody (Molecular Probes, Cat. No. A-21287) is used for the microscopic detection of the adsorption of expressed hydrophobin on Teflon.
- Transformed host cells produced according to one of Examples 1 to 4, are cultivated. Cells and any supernatant are harvested separately. Cells which have been transformed and cultured with a corresponding vector without hydrophobic genes or corresponding culture supernatants serve as reference sample.
- Teflon plates are incubated at room temperature for 18 h in cell disruption or supernatant, rinsed with water (3 x 10 min).
- the treated teflon is then incubated in PBS with fluorescence-labeled antibody.
- PBS 3 x 15 min
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Biomedical Technology (AREA)
- Organic Chemistry (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Zoology (AREA)
- Mycology (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
- Treatment And Processing Of Natural Fur Or Leather (AREA)
- Surface Treatment Of Glass (AREA)
- Treatments For Attaching Organic Compounds To Fibrous Goods (AREA)
Abstract
Die vorliegende Erfindung betrifft Expressionskonstrukte, umfassend die kodierende Nukleinsäuresequenz für ein von Hefezellen prozessierbares Shuttlepeptidkonstrukt; entsprechende Expressionsvektoren, enthaltend derartige Konstrukte; mit deren Hilfe durchgeführte Verfahren zur rekombinanten Herstellung von Zielproteinen; damit transformierte Wirte; Shuttlepeptide und dafür kodierende Nukleinsäuresequenzen; Nukleinsäuresequenzen kodierend für solche Shuttlepeptide, fusioniert mit einem Fremdprotein; Hydrophobin-Proteine, welche unter Verwendung von derartigen Shuttlepeptiden hergestellt wurden, sowie die Verwendung Hydrophobinen zur Beschichtung von Gegenständen, wie z.B. Leder.
Description
Sekretion von Proteinen aus Hefen
Beschreibung
Die vorliegende Erfindung betrifft Expressionskonstrukte, umfassend die kodierende Nukleinsäuresequenz für ein von Hefezellen prozessierbares Shuttlepeptidkonstrukt; entsprechende Expressionsvektoren, enthaltend derartige Konstrukte; mit deren Hilfe durchgeführte Verfahren zur rekombinanten Herstellung von Zielproteinen; damit transformierte Wirte; Shuttlepeptide und dafür kodierende Nukleinsauresequenzen; Nuklein- säuresequenzen kodierend für solche Shuttlepeptide, fusioniert mit einem Fremdprotein; Hydrophobin-Proteine, welche unter Verwendung von derartigen Shuttlepeptiden hergestellt wurden, sowie die Verwendung Hydrophobinen zur Beschichtung von Gegenständen, wie z.B. Leder.
Stand der Technik
a) Expression in Hefen
Hefen als Wirt für die heterologe Proteinexpression sind weit verbreitet. Grund dafür ist, dass Hefen als Expressionssystem mehrere Vorteile besitzen. Im Vergleich zu Bakterien und anderen eukaryotischen Zellen können sie nämlich in höherer Dichte wachsen und sie besitzen die Fähigkeit zur Proteinglykosilierung und post-translationalen Modifikation. Außerdem können die von Hefen produzierten und sezemierten Produkte deshalb in einfacher Weise gereinigt werden, weil die Hefen hohe Resistenz gegen Zelllyse besitzen, und im Wachstumsmedium gewöhnlich geringe Mengen an Fremdprotein zu finden sind. Darüber hinaus können Hefen schneller als andere eukaryoti- sche Zellen in hoher Dichte auf kostengünstigen Nährmedien wachsen.
Im Stand der Technik gibt es zahlreiche verschiedene Ansätze zur Expression und Sekretion heterologer Proteine in Hefen. So wird beispielsweise in der US 5,642,487 ein Verfahren zur rekombinanten Produktion von Proteinen in Hefen beschrieben, wobei man Hefe mit einer Expressionskassette transformiert, welche für ein Strukturelement kodiert, das eine Leadersequenz aus einem tierischen Peptidneurohormon, eine Adaptor-Sequenz, produzierend eine σ-Helixstruktur, ein Prozessierungssignal sowie ein Strukturgen kodiert.
Weiterhin ist aus dem Stand der Technik bekannt, aus dem Gen des σ-Faktors, einem von Hefen produzierten Pheromon, regulative Elemente für die Steuerung der Expression heterologer Proteine in Hefen einzusetzen. So wurden beispielsweise -Faktor Signal-Leader-Peptidsequenzen zur Expression heterologer Proteine verwendet (vgl. z. B. US 5,010,182).
Aus der veröffentlichten US-Patentanmeldung US 2003/0077831 ist außerdem ein Expressionsvektor zur Expression heterologer Proteine in Hefen bekannt, welcher flankiert von geeig neten Transkriptions- und Translations-Start- bzw. Terminationssequenzen die kodierende Sequenz für ein Hybndprecursorpolypeptid umfasst, welches als Elemente das Signalpeptid und das Leaderpeptid eines von Hefen sezernierten Proteins sowie ein heterologes Protein, flankiert von N-terminalen und C-terminalen Propeptid-Sequenzen des heterologen Proteins umfasst.
b) Hydrophobine
Hydrophobine sind kleine, circa 100 Aminosäurereste umfassende, cysteinreiche Proteine mit interessanten technischen Eigenschaften. Sie können hydrophobe Oberflächen hydrophil machen. Hydrophile Oberflächen werden durch sie hydrophobiert.
Es gibt aber eine Reihe von Schutzrechten auf Hydrophobine und deren Anwendung: So beschreibt z.B. die WO-A-96/41882 Hydrophobine aus eßbaren Pilzen (vgl. SEQ ID NO:21 und 22). Die WO-A-00/58342 betrifft die Reinigung von Hydrophobin-haltigen Fusionsproteinen durch Phasenextraktion. Die WO-A-01/57066 beschreibt Stabilisie- rung, Solubilisierung und die damit verbundene bessere Anwendung von Hydrophobinen durch Sulfitbehandlung. Die WO-A-01/57076 beschreibt die Reinigung von Hydrophobin durch Adsorption an Teflon-Kügelchen und die Elution mittels Detergens, wie Tween, bei niedrigen Temperaturen. Die WO-A-01/57528 beschreibt die Fixierung von Hydrophobinen auf Oberflächen durch die Anwendung von Tween und Temperatu- ren bis 85 Grad Celsius.
Die WO-A-01/74864 beschreibt untypische Hydrophobine (nur eine Disulfidbrücke) mit der Bezeichnung RdIA und RdlB (vgl. SEQ ID NO: 19 und 20) aus filamentösen Bakterien, insbesondere Streptomyces sp. Das Hydrophobin wird zur Oberflächenbehand- lung verschiedener Gegenstände, wie Fenster, Kontaktlinsen, Fahrzeugkarosserien verwendet. Weiterhin wird vorgeschlagen, die dort beschriebenen Proteine in einen rekombinanten Wirt zu produzieren, der die Proteine ins Medium abgibt. Nach Abtren-
nung des Wirts soll das Hydrophobin-haltige Medium zur Oberflächenbeschichtung geeignet sein. Experimentelle Belege für die tatsächliche Expression und Sekretion werden nicht geliefert.
Kurze Beschreibung der Erfindung
Aufgabe der vorliegenden Erfindung ist es, Mittel bereitzustellen, die es ermöglichen, in der Hefe, insbesondere Schizosaccharomyces pombe, exprimierte homologe oder insbesondere heterologe Proteine, aus den Hefezellen in das umgebende Medium zu sezemieren. Insbesondere sollten Mittel bereitgestellt werden, welche die Sekretion von rekombinant hergestelltem Hydrophobin aus der Wirtszelle ermöglichen.
Gelöst wird obige Aufgabe durch Bereitstellung eines Expressionskonstrukts, umfassend die kodierende Nukleinsäuresequenz für ein von Hefezellen prozessierbares Shuttlepeptidkonstrukt der allgemeinen Formel
(Sig-SP),
enthaltend in 5'-3'-Richtung die kodierenden Nukleinsauresequenzen für a) ein Signalpeptid (Sig), prozessierbar verknüpft mit b) wenigstens einem von den Hefezellen sezernierbaren Shuttlepeptid (SP).
Modellhaft wird die Lösung obiger Aufgabe am Beispiel des Hydrophobins DewA (Ma- tures Protein gemäß SEQ ID NO: 14 mit kodierender Sequenz gemäß SEQ ID NO:13; Präprotein mit Signalsequenz: SEQ ID NO:16 mit kodierender Nukleinsäuresequenz gemäß SEQ ID NO:15) aus Aspergillus nidulans als heterologem Zielprotein (Targ) veranschaulicht. Dieses Protein ist ein Vertreter der Klasse I von Hydrophobinen, d.h. von sezemierten pilzlichen Hüllproteinen mit der Befähigung zur Selbstassemblierung.
Insbesondere wird die für das Zielprotein (DewA) kodierende DNA-Sequenz (SEQ ID NO: 13) an das 3'-terminale Ende der für ein Peptid-Pheromon aus S. pombe (P-Faktor; Aminosäuresequenz gemäß SEQ ID NO:6 für reifen P-Faktor) kodierende DNA Sequenz (SEQ ID NO:5 für reifen P-Faktor) fusioniert. Das entstehende Fusionsprotein enthält alle für die Sekretion des Pheromons und des daran fusionierten Zielproteins notwendigen Signalsequenzen, insbesondere das abspaltbare Signalpeptid (SEQ ID NO:4). Im Rahmen der Sekretion wird das Fusionsprotein proteolytisch prozessiert. Als
Folge wird das Pheromon (P-Faktor) (SEQ ID NO:6) und das Zielprotein (Hydrophobin; SEQ ID NO: 14) separat ins Medium sezerniert.
Der erfindungsgemäße Befund ist insofern überraschend, weil offensichtlich die eigent- liehen regulativen Elemente des P-Faktor-Präproteins (N-terminal zum reifen Pheromon) nicht ausreichen, um die Sezernierung des Zielproteins durch die Hefezellen steuern. Erst die Verwendung eines Konstruktes, in welchem dem zu sezerniernden Zielprotein eine zusätzliche, co-sezernierende Proteinkomponente (das reife Pheromon) prozessierbar vorgeschaltet ist, ermöglicht die gewünschte Sezernierung des Zielproteins in das Kulturmedium.
Detaillierte Beschreibung der Erfindung:
a) Allgemeine Angaben
Die Proteinsequenzen sind in der Beschreibung und den Figuren gewöhnlich im "EinBuchstaben-Code" angegeben.
„Sezemierbar" im Sinne der vorliegenden Erfindung ist ein Protein, welches von einer Wirtszelle, insbesondere von Hefen, intrazellulär exprimiert und über zelleigene Mechanismen durch die Zellmembran aus der Zelle, vorzugsweise in das umgebende Medium, ausgeschieden wird.
„Prozessierbar" im Sinne der vorliegenden Erfindung ist eine Protein-Vorstufe (d.h. ein Protein in seiner ursprünglich exprimierten Form, wie z.B. ein Präprotein, mit N-und /oder C-terminalen Peptidsequenzen, die im reifen prozessierten Protein nicht mehr vorliegen) wenn es durch proteolytische Vorgänge in und/oder außerhalb der Wirtszelle in die reife Form überführbar ist.
Eine „prozessierbare Verknüpfung" ist dann gegeben, wenn einzelne Proteinabschnitte in einem zu prozessierenden Protein über Peptidbindungen verbunden sind, die von einem proteolytischen Enzym der Wirtszelle spaltbar sind.
Die „Prozessierung" kann N-terminal und gegebenenfalls auch C-terminal zur Sequenz des reifen, prozessierten Proteins (Zielproteins) erfolgen.
Ein „homologes" Zielprotein, wird zwar ursprünglich in dem erfindungsgemäß verwendeten Wirt exprimiert, ist also ein wirtseigenes Protein, wird aber aufgrund der Transformation des Wirts mit einem erfindungsgemäßen Expressionskonstrukt durch die Wirtszellen sezerniert.
Ein „heterologes" Zielprotein, wird ursprünglich in dem erfindungsgemäß verwendeten Wirt nicht exprimiert, ist also kein wirtseigenes Protein, wird aber aufgrund der Transformation des Wirts mit erfindungsgemäßen Expressionskonstrukt durch die Wirtszellen sezerniert.
Ein „Shuttlepeptid" ist Bestandteil eines in der erfindungsgemäß verwendeten Wirtszelle prozessierbares „Shuttlepeptidkonstrukts". Zusammen mit einem oder mehreren prozessierbaren regulativen C- und/oder N- terminal, vorzugsweise N-terminal, damit verknüpften Peptidfragmenten, wie Signalsequenzen, Leadersequenzen, bildet es das Shuttlepeptidkonstrukt. Das Shuttlepeptid ist im Gegensatz z.B. zum Signalpeptid ein von der Wirtszelle sezerniertes Polypeptid. Die Prozessierung der regulativen Elemente erfolgt vorzugsweise intrazellulär. Die Sezernierbarkeit des Shuttlepeptids bleibt auch dann erhalten, wenn es, vorzugsweise C-terminal, mit einem Zielprotein prozessierbar fusioniert wird. Vorzugsweise erfolgt diese C-terminale Prozessierung, d.h. Ab- Spaltung des Zielproteins, proteolytisch im Rahmen der Sekretion, z.B. während des Durchgangs durch die Zellhülle der Wirtszelle, oder im extrazellulären Raum, z.B. im umgebenden Kulturmedium, durch zelleigene, Proteasen.
Ein „Expressionskonstrukt" oder eine „Expressionskassette" gemäß vorliegender Erfin- diung umfasst, operativ verknüpft, mit der kodierenden Nukleinsäuresequenz eines prozessierbaren Shuttlepeptidkonstrukts gemäß obiger Definition, die zur Steuerung der Expression in einem speziellen Wirtssystem, wie insbesondere Hefezellen, erforderlichen Start- und Terminationssignale für Transkription und gegebenenfalls Translation. Das Expressionskonstrukt umfasst insbesondere Bindungsstellen für Transkripi- onsfaktoren. 5'- Stromaufwärts von der kodierenden Sequenz ist ein konstitutiver oder induzierbarer, nativer oder heterologer, natürlicher oder synthetischer in der Wirtszelle operabler Promotor enthalten. Das Expressionskonstrukt umfasst außerdem eine Anzahl von Restriktionsenzymschnittstellen, wie z. B. solche zur Insertion des Konstruk- tes in einen Expressionsvektor. Zusätzlich kann das Expressionskonstrukt ein Gen für einen selektierbaren Marker umfassen.
Ein „Expressionsvektor" beschreibt ein Konstrukt, erhältlich durch Einführung einer erfindungsgemäßen Expressionskassette in ein Replikon, wie z. B. in ein Plasmid, Cosmid oder einen Virus. Ein derartiger Vektor ist zur autonomen Replikation oder zur Integration in das Wirtsgenom befähigt und enthält die erforderlichen Kontrollsequenzen zur Steuerung von Transkription und gegebenenfalls Translation der erfindungsgemäßen kodierenden Nukleinsauresequenzen für ein prozessierbares Shuttlepeptidkonstrukt gemäß obiger Definition.
b) Bevorzugte Ausführungsformen
Ein erster Gegenstand der Erfindung betrifft ein Expressionskonstrukt umfassend die kodierende Nukleinsäuresequenz für ein von Hefezellen prozessierbares Shuttlepeptidkonstrukt der allgemeinen Formel
(Sig-SP),
enthaltend in 5'-3'-Richtung die kodierenden Nukleinsauresequenzen für a) ein Signalpeptid (Sig), prozessierbar verknüpft mit b) wenigstens einem von den Hefezellen sezemierbaren Shuttlepeptid (SP); sowie gegebenenfalls eine oder mehrere die Prozessierung und/oder Sezernierung fördernde Nukleinsauresequenzen, 5'- oder 3'-terminal zur kodierenden Signalpeptid- sequenz.
Die kodierenden Sequenzen für SP und Sig befinden sich dabei im gleichen Leseraster und außerdem wird bei der Translation eine prozessierbare Sequenz zwischen C- Terminus von Sig und N-Terminus von SP ausgebildet. Diese prozessierbare Sequenz kann beispielsweise ein künstlich eingeführte, proteolytisch spaltbare natürliche oder synthetische Adaptor-Sequenz sein. Bevorzugt ist diese aber Bestandteil des C- Terminus von Sig oder N-Terminus von SP. Die Adaptor-Sequenz kann dabei so prozessiert werden, dass die gespaltene Sequenz ganz oder teilweise am C-Terminus von Sig oder N-Terminus von SP zu finden ist. Letzteres ist möglich, solange dadurch die Sezernierbarkeit von SP nicht wesentlich negativ beeinflusst, insbesondere nicht unterbunden, wird.
Insbesondere sind Gegenstand der Erfindung solche Expressionskonstrukte, kodierend für ein prozessierbares Shuttlepeptidkonstrukt, das von einem Polypeptid abgeleitet ist, das von Hefen im weitesten Sinn prozessiert wird. Insbesondere sind dies Hefen ausgewählt unter Ascomyceten. Bevorzugte Hefen sind ausgewählt unter solchen der
Klasse der Archiascomycetes, der Ordnung der Schizosaccharomycetales und besonders bevorzugt ausgewählt unter Hefen des Genus Schizosaccharomyces, wie S. pombe. Obwohl es Daten gibt, die zeigen, dass auch Minus-Zellen den P-Faktor sezernieren, ist es bevorzugt, den zum Mating-Faktor (Pheromon) passenden Stamm (also beim Plus-Faktor (P-Faktor) Plus-Zellen und beim Minus-Faktor (M-Faktor) Minus-Zellen) zu benutzen.
Das prozessierbare Shuttlepeptidkonstrukt ist insbesondere von einem Pheromon- Präprotein aus einer Hefe abgeleitet, wobei das Pheromon durch N- und C-terminale Prozessierung aus dem Präprotein entsteht. Vorzugsweise weist das Pheromon N- terminal ein durch Prozessierung abspaltbares Polypeptid auf, das insbesondere die zur Prozessierung und/oder Sezernierung des Präproteins erforderlichen Elemente, wie Signalpeptid und gegebenenfalls Leaderpeptid sowie die erforderlichen Protea- seschnittstellen umfasst.
Pheromone aus Pilzen sind bekannt und z.B. beschrieben sowohl für Basidiomyceten wie Ustilago maydis (Urban, M., Kahmann, R. and Bolker, M. (1996) The biallelic a mating type locus of Ustilago maydis: remnants of an additional pheromone gene indicate evolution from a multiallelic ancestor (Mol Gen Genet 250(4):414-420)) oder Coprinopsis einem (Halsall, J.R., Milner, M.J. and Casselton, LA (2000) Three subfamilies of pheromone and reeeptor genes generate mutiple B mating speeifities in the mushroom Coprineus cinereus (Genetics 154(3): 1115-1123)) als auch Ascomyceten wie Schizosaccharomyces pombe (Imai, Y. and Yamamoto, M. (1995) The fission yeast mating pheromone P-factor: its molecular strueture, gene strueture, and ability to induce gene expression and G1 arrest in the mating partner (Genes Dev 8(3):328-338), Davey, J. (1992) Mating pheromones of the fission yeast Schizosaccharomyces pombe: purification and structural characterization of M-factor and isolation and analysis of two genes encoding the pheromone (EMBO J 11(3):951- 960)), Saccharomyces cerevisiae (Michaelis, S. and Herskowitz, I. (1988) The a-factor pheromone of Saccharomyces cerevisiae is essential for mating (Mol Cell Biol
8(3):1309-1318), Kurjan, J. and Herskowitz, I. (1982) Strueture of a yeast pheromone gene (MF-alpha): a putative alpha-factor precursor contains four tandem copies of mature alpha-factor (Cell 30(3): 933-943)), Kluyveromyces delphensis (Wong, S., Fares, M.A., Zimmermann, W., Butler, G. and Wolfe, K.H. (2003) Evidence from comparative genomics for a complete sexual cycle in the 'asexual' pathogenic yeast Candida glabrata (Genome Biol 4(2)R10)) and Saccharomyces kluyveri (Egel-Mitani,
M. and Hansen, M.T. (1987) Nucleotide sequence of the gene encoding the Saccharomyces kluyveri alpha mating pheromone (Nucleic Acids Res 15(15)6303)).
Erfindungsgemäß geeignete Pheromone sind relativ kleine Peptide (wie z.B. 5 bis 40 oder 8 bis 30 Aminsäuren). Sie zeigen gewöhnlich keine signifikante Homologie in der Primärsequenz. Sie werden als Präproteine gebildet, proteolytisch prozessiert und in das Kulturmedium abgegeben.
Beispiele für besonders geeignete Pheromone bzw. entsprechende Präproteine sind die sogenannten P- und M-Faktoren bzw. deren Präproteine aus S. pombe. (vgl. Imai, Y. and Yamamoto, M. (1995) The fission yeast mating pheromone P-factor: its molecular strueture, gene strueture, and ability to induce gene expression and G1 arrest in the mating partner (Genes Dev 8(3):328-338), Davey, J. (1992) Mating pheromones of the fission yeast Schizosaccharomyces pombe: purification and structural characterization of M-factor and isolation and analysis of two genes encoding the pheromone (EMBO J 11 (3):951-960), Kjaerulff, S., Davey, J. and Nielsen, O. (1994) Analysis of the structural genes encoding M-factor in the fission yeast Schizosaccharomyces pombe: identification of a third gene, mfm3 (Mol Cell Biol 14(6)3895-3905)).
Das P-Faktor-Präprotein weist beispielsweise eine DNA-Sequenz gemäß SEQ ID NO: 9 und eine Proteinsequenz gemäß SEQ ID NO: 10 auf. Das Präprotein umfasst eine N- terminale Signalpeptid-Sequenz verbrückt mit vier aufeinander folgenden durch Prozessierung trennbaren Pheromon-Peptidsequenzen (vgl. Figur 3).
In bevorzugten erfindungsgemäßen Konstrukten ist das prozessierbares Shuttlepeptidkonstrukt so ausgebildet, dass es ein Signalpolypeptid (Sig) enthält, das mit dem N- terminalen Ende eines C-terminal prozessierbaren Pheromonpolypeptides (Pher) prozessierbar verknüpft ist.
Insbesondere umfasst das Signalpolypeptid das proteolytisch abspaltbare native Signalpolypeptid (z.B. SEQ ID NO:4 kodiert von SEQ ID NO:3) des Pheromon-Präproteins oder ist damit identisch.
Bevorzugt ist weiterhin, dass das C-terminal prozessierte Pheromonpolypeptid eine C~ terminale Proteaseschnittstelle umfasst.
Vorzugsweise umfasst das Expressionskonstrukt weiterhin die kodierende Nukleinsäuresequenz für ein homologes oder heterologes Zielprotein (Targ), prozessierbar verknüpft mit dem C-Terminus des Shuttlepeptidkonstrukts (Sig-SP).
Gegenstand der Erfindung sind bevorzugt Expressionskonstrukte der oben bezeichneten Art, umfassend die kodierende Nukleinsäuresequenz für ein von Hefezellen prozessierbares Fusionsprotein der allgemeinen Formel
Sig-L1 n-Pher-L2m-Targ
worin
Sig, Pher und Targ wie oben definiert sind,
L1 und L2 für prozessierbare Linker oder Adaptor-Sequenzen stehen und n und m unabhängig voneinander für 0 oder 1 stehen. Bevorzugt steht aber n für 1 und m für O.
L1 und L2 können dabei natürliche oder synthetische Linker sein. Sie umfassen zumindest eine proteolytisch prozessierbare Peptidsequenz. Gegebenenfalls können mit L1 und/oder L2 weitere, wie z.B. die Prozessierung, Sezernierung, Transkription und/oder Translation fördernde, Effektorfunktionen assoziiert sein.
Besonders bevorzugt sind Expressionskonstrukte, wobei die kodierende Nukleinsäuresequenz für das prozessierbare Shuttlepeptidkonstrukt eine für ein Signalpolypeptid (Sig) kodierende Sequenz gemäß SEQ ID NO: 3 oder ein funktionales Äquivalent da- von, operativ verknüpft mit der für den reifen P-Faktor Pheromon (Pher) kodierenden Nukleinsäuresequenz gemäß SEQ ID NO:5 oder ein funktionales Äquivalent davon umfasst.
Der Linker L2 ist dabei vorzugsweise nicht vorhanden. Der Linker L1 ist dagegen vor- zugsweise vorgesehen und umfasst die kodierende Sequenz für ein Polypeptid gemäß den Aminosäurereste 21 bis 30 in SEQ ID NO: 10. L1 verbrückt dabei das Signalpolypeptid mit dem ersten Pheromon-Baustein (Position 31 bis 57 in SEQ ID NO: 10) der Prähormons. Das C-terminale Ende von L1 entspricht einer Erkennungssequenz der für die proteolytische Prozessierung erforderlichen Protease.
In einer besonders bevorzugten Ausführungsform umfasst die kodierende Nukleinsäuresequenz für das prozessierbares Shuttlepeptidkonstrukt eine Sequenz gemäß SEQ ID NO:1.
Grundsätzlich ist die gleiche Vorgehensweise auch mit Hilfe des M-Faktors - des zweiten in S. pombe vorkommenden Pheromons - einsetzbar und auf die Expression beliebiger homo- und heterologer Zielproteine (Targetproteine) anwendbar. Genomisch gibt es drei Gene (mfmf, SEQ ID N0:42; mfm2 SEQ ID NO: 45; und mfm3+, SEQ ID NO:48 ) welche jeweils den M-Faktor, das Pheromon der Zellen mit Minus- Paarungstyp, kodieren. Von jedem Gen wird zunächst ein Präprotein (SEQ ID NO: 43, 46 und 49) gebildet, welches im Rahmen der Sekretion prozessiert wird. Letztlich wird der M-Faktor (YTPKVPYMC; SEQ ID NO:51), codiert von SEQ ID NO: 44, 47 bzw. 50) als reifes Pheromon in das Medium abgegeben, (vgl. Figur 9 ).
Weitere erfindungsgemäß geeignete Shuttlepeptid-Konstrukte könnten daher von den kodierenden Sequenzen gemäß SEQ ID NO:42, 45 oder 48 abgeleitet sein, welche für M-Faktor Signalpeptid, funktional verknüpft mit einem M-Faktor-Pheromon, kodieren. Nichtlimitierende Beispiele für entsprechende kodierende Shuttlepeptid-Sequenzen umfassen z.B. Nukleotidreste 1 bis 117 gemäß SEQ ID NO:42; Nukleotidreste 1 bis 123 gemäß SEQ ID NO:45; oder Nukleotidreste 1 bis 114 gemäß SEQ ID NO:48; oder davon abgeleitete funktional äquivalente Konstrukte, welche die Sekretion und Prozessierung des M-Faktor-Pheromons und eines mit dem Pheromon C-terminal und proteolytisch abspaltbar verknüpften homo- oder heterologen Zielproteins steuern. Funktionale Äquivalente können dabei die 5'-stromaufwärts von der kodierenden Sequenz des reifen M-Faktors (SEQ ID NO:44, 47 oder 50) gelegenen Sequenzabschnitte unverändert oder abgewandelt (z.B. durch Deletion einzelner oder mehrerer Nukleinsäurereste) enthalten, und somit für ein in seiner Aminosäuresequenz verändertes Shuttlepeptid kodieren, welches die mature M-Faktor-Peptidsequenz funktional verknüpft mit einem, z.B. C-terminal verkürzten, Signalsequenzabschnitt umfasst.
Ein erfindungsgemäß exprimiertes Zielprotein (Targ) kann von jedem beliebigen proka- ryotischen oder eukaryotischen Organismus, insbesondere Mensch, Tier oder Hefen, abgeleitet sein, solange es in der erfindungsgemäßen Weise als Bestandteil eines Fusionsproteins mit dem Shuttlepeptid (SP) von der Wirtszelle exprimierbar, sezernierbar und prozessierbar ist. Das sezemierte und prozessierte Produkt kann therapeutisch nützlich sein oder andere vorteilhafte anwendungstechnische Eigenschaften besitzen. Als Beispiele für therapeutisch nützliche Proteine sind zu nennen Immunglobuline,
Peptidhormone, Wachstumsfaktoren, Lymphokine, Protease-Inhibitoren und dergleichen. Als Beispiel für Zielproteine mit anderen anwendungstechnisch interessanten Eigenschaften sind insbesondere Hydrophobine zu nennen.
In einer besonders bevorzugten Ausfü rungsform der Erfindung ist das Zielprotein ein Hydrophobin, insbesondere ein Hydrophobin der Klasse I.
Typische Hydrophobine sind relativ kleine (100+25 Aminosäuren) moderat hydrophobe Proteine mit einem konservierten Motiv von 8 Cysteinen (X2-38-C-X5-9-C-C-X11-39-C-X8- 23-C-X5-9-C-C-X6.18-C-X2-ι3). Hydrophobine können an hydrophilen-hydrophoben Grenzflächen zu Proteinfilmen assemblieren. Solche Aggregate von Hydrophobinen der Klasse I sind in SDS unlöslich, während Aggregate der Klasse II Hydrophobine in SDS löslich sind (Wessels, J.G.H. (1997) Hydrophobins: Proteins that change the nature of the fungal surface. Adv Microb Physiol 38:1-45).
Erfindungsgemäß brauchbare Hydrophobine sind dabei insbesondere aus Pilzen abgeleitet, z.B. aus Ascomyceten, wie solchen der Gattung Aspergillus, insbesondere A. nidulans.
Brauchbare Hydrophobine sind auch aus dem oben genannten Stand der Technik bekann und nicht auf solche aus Pilzen beschränkt.
Nichtlimitierende Beispiele für brauchbare Hydrophobine sind ausgewählt unter SEQ ID NO: 14 (DewA), SEQ ID NO:19 (RdIA) SEQ ID NO:20 (RdlB) SEQ ID NO:21 (HYP1) SEQ ID NO:22 (HYP4) und SEQ ID NO:56 (RodA).
p52750 (DewA)
MRFIVSLLAF TAAATATALP ASAAKNAKLA TSAAFAKQAE GTTCNVGSIA CCNSPAETNN DSLLSGLLGA GLLNGLSGNT GSACAKASLI DQLGLLALVD HTEEGPVCKN IVACCPEGTT NCVAVDNAGA GTKAE
q9l 190 (RdIA)
MLKKAMVAAA AAASVIGMSA AAAPQALAIG DDNGPAVANG NGAESAFGNS ATKGDMSPQLSLVEGTLNKP CLGVEDVNVA VINLVPIQDI NVLADDLNQQ CADNSTQAKR DGALSHVLED LSVLSANGEG R
q934f8 (RdlB)
MIKKWAYAA IAASVMGASA AAAPQAMAIG DDSGPVSANG NGASQYFGNS MTTGNMSPQM ALIQGSFNKP CIAVSDIPVS VIGLVPIQDL NVLGDDMNQQ CAENSTQAKR DGALAHLLED VSILSSNGEG GKG
HYP1_AGAB1 (P49072)
MISRVLVAAL VALPALVTAT PAPGKPKASS QCDVGE1HCC DTQQTPDHTS AAASGLLGVP INLGAFLGFD CTPISVLGVG GNNCAAQPVC CTGNQFTALI NALDCSPVNV NL
HYP4_AGABI (043122)
MVSTFITVAK TLLVALLFVN INIVVGTATT GKHCSTGPIE CCKQVMDSKS PQATELLTKN GLGLGVLAGV KGLVGANCSP ITAIGIGSGS QCSGQTVCCQ NNNFNGWAI CTPINANV
RodA
LPPAHDSQFA GNGVGNKGNS NVKFPVPENV TVKQASDKCG DQAQLSCCNK ATYAGDTTTV DEGLLSGALS GLIGAGSGAE GLGLFDQCSK LDVAVLIGIQ DLVNQKCKQN IACCQNSPSS ADGNLIGVGL PCVALGSIL
Das RodA-Protein ist zusammen mit dem DewA-Protein Bestandteil der äußeren Sporenhülle von A. nidulans.
Gegenstand der Erfindung sind außerdem Expressionsvektoren, umfassend in operativer Verknüpfung mit wenigstens einer regulativen Nukleinsäuresequenz ein Expressionskonstrukt nach obiger Definition.
Gegenstand der Erfindung sind auch rekombinante Mikroorganismen, enthaltend, ge- gebenenfalls stabil in das Wirtsgenom integriert, wenigstens einen Expressionsvektor oder ein Expressionskonstrukt gemäß obiger Definition.
Ein „rekombinanter Mikroorganismus im Sinne der vorliegenden Erfindung umfasst wenigstens einen erfindungsgemäßen Expressionsvektor oder ein erfindungsgemäßes Expressionskonstrukt und ist abgeleitet von Hefen im weitesten Sinn. Insbesondere sind die Hefen abgeleitet von Ascomyceten. Bevorzugte Hefen sind ausgewählt aus der Klasse der Archiascomycetes, der Ordnung der Schizosaccharomycetales, und besonders bevorzugt ausgewählt unter Hefen des Genus Schizosaccharomyces, wie S. pombe.
Ein weiterer Gegenstand der Erfindung betrifft von Hefezellen prozessierbare Shuttle- peptidkonstrukte, abgeleitet von einem Pheromon-Präprotein aus einer Hefe, wobei das Pheromon durch N- und C-terminale Prozessierung aus dem Präprotein ableitbar und sezemierbar ist.
Bevorzugt sind solche Shuttlepeptidkonstrukte, enthaltend ein Signalpolypeptid N- terminai prozessierbar verknüpft mit dem C-terminal prozessierten Pheromonpolypeptid.
Vorzugsweise ist dabei das Signalpolypeptid das proteolytisch abspaltbare native Signalpolypeptid des Pheromon-Präproteins und das C-terminal prozessierte Pheromon- polypeptid umfasst die C-terminale Proteaseschnittstelle.
Bevorzugte Shuttlepeptidkonstrukte sind dabei abgeleitet von Pheromon-Präproteinen, aus Hefen, insbesondere Präproteinen der Faktoren P und M aus S. pombe. Besonders bevorzugte Shuttlepeptide umfassen eine Aminosäuresequenz nach SEQ ID NO:2 oder ein funktionales Äquivalent davon.
Ein weiterer Gegenstand der Erfindung betrifft ein Verfahren zur rekombinanten Herstellung eines Zielproteins, wobei man einen rekombinanten Mikroorganismus nach obiger Definition kultiviert, die das Zielprotein kodierende Nukleinsäuresequenz expri- miert und das in das Kulturmedium sezernierte Zielprotein, wie z.B. ein Hydrophobin gemäß obiger Definition, isoliert.
Gegenstand der Erfindung sind weiterhin Nukleinsäuren, kodierend für ein Shuttlepeptidkonstrukt nach obiger Definition; sowie Nukleinsäuren, kodierend für ein von Hefe- Zeilen prozessierbares, ein Zielprotein u fassendes Fusionsprotein gemäß obiger Definition.
Gegenstand der Erfindung sind auch Hydrophobine, erhältlich nach einem erfindungsgemäßen Verfahren.
Schließlich betrifft die Erfindung die Verwendung eines solchen Hydrophobins zur O- berflächenbehandlung, wobei man insbesondere die Oberfläche von Gegenständen, ausgewählt unter Glas, Fasern, Geweben, Leder, lackierten Gegenständen, wie z.B. Kraftfahrzeugkarosserien, Folien, Fassaden behandelt.
Gegenstand der Erfindung ist auch die Verwendung von Hydrophobinen zur Oberflä- chenbehandlung von Fasern, Geweben und Leder.
c) Weitere Ausgestaltungen der Erfindung
d) Polypeptide/Proteine
Erfindungsgemäß mit umfasst sind ebenfalls „funktionale Äquivalente" der konkret offenbarten bzw. verwendeten Polypeptid/Proteine. Dies gilt sowohl für die intermediär gebildeten Fusionsproteine als auch deren Komponenten, d.h. Zielproteine (Targ), Shuttlepeptide (SP), wie Pheromone (Pher), aber auch für Signalpeptide (Sig) und Linker. Im folgenden wird als Oberbegriff für Polypeptid/Protein nur noch „Polypeptid" verwendet.
„Funktionale Äquivalente" oder Analoga der konkret offenbarten Polypeptide sind im Rahmen der vorliegenden Erfindung davon verschiedene Polypeptide, welche weiterhin die gewünschte biologische Aktivität besitzen. Analoge Shuttlepeptide sollen weiterhin dazu geeignet sein die Sezernierung und Prozessierung des Zielproteins zu steuern. Entsprechend sollen auch die funktionalen Äquivalente von Komponenten des Shuttlepeptids, wie Signalpolypeptid, Pheromon, Linker, weiterhin die erforderlichen Eigenschaften für eine effektive Sezernierung und Prozessierung des Fusionsproteins unter Freisetzung des Zielproteins aufweisen.
„Funktionale Äquivalente" erfindungsgemäßer Polypeptide, wie Zielproteine, Shuttlepeptide, können insbesondere durch proteolytische Spaltung entstehenden Reste von natürlichen Linker- oder Adaptor-Sequenzen C-und/oder N-terminal enthalten.
Unter "funktionalen Äquivalenten" versteht man erfindungsgemäß insbesondere mutan- te Proteine, welche in wenigstens einer der Sequenzpositionen der oben genannten konkreten Sequenzen eine andere als die konkret genannte Aminosäure aufweisen, aber trotzdem eine der oben genannten biologischen Aktivitäten besitzen. "Funktionale Äquivalente" umfassen somit die durch eine oder mehrere Aminosäure-Additionen, - Substitutionen (vgl. Beispiele in folgender Tabelle), -Deletionen und/oder -Inversionen erhältlichen mutanten Proteine, wobei die genannten Veränderungen in jeglicher Sequenzposition auftreten können, solange sie zxi einem mutanten Protein mit dem erfindungsgemäßen Eigenschaftsprofil führen.
Geeignete Reste für Aminosäuresubstitutionen sind z.B.:
er Rest Beispiele der Substituti on
Ala Ser
Arg Lys
Asn Gin; His
Asp Glu
Cys Ser
Gin Asn
Glu Asp
Gly Pro
His Asn ; Gin
He Leu; Val
Leu He; Val
Lys Arg ; Gin ; Glu
Met Leu ; lle
Phe Met ; Leu ; Tyr
Ser Thr
Thr Ser
Trp Tyr
Tyr Trp ; Phe
Val lle; Leu
Funktionale Äquivalenz ist insbesondere auch dann gegeben, wenn das Aktivitätsmus- ter zwischen mutantem und unverändertem Polypeptid qualitativ übereinstimmen. Die bedeutet z.B. dass abgewandelte Shuttlepeptide das gleiche Zielprotein mit höherer oder niedrigerer Effizienz im gleichen Wirt exprimieren oder sezernieren; oder dass abgewandelte Zielproteine eine erhöhte oder verminderte pharmakologische Wirkung oder modifizierte anwendungstechnische Eigenschaft besitzen.
„Funktionale Äquivalente" im obigen Sinne umfassen auch Präkursoren der beschriebenen Polypeptide sowie funktionale Derivate und Salze der Polypeptide. Unter dem Ausdruck „Salze" versteht man sowohl Salze von Carboxylgruppen als auch Säureadditionssalze von Aminogruppen der erfindungsgemäßen Proteinmoleküle. Salze von Carboxylgruppen können in an sich bekannter Weise hergestellt werden und umfassen anorganische Salze, wie zum Beispiel Natrium-, Calcium-, Ammonium-, Eisen- und Zinksalze, sowie Salze mit organischen Basen, wie zum Beispiel Aminen, wie Trietha- nolamin, Arginin, Lysin, Piperidin und dergleichen. Säureadditionssalze, wie zum Beispiel Salze mit Mineralsäuren, wie Salzsäure oder Schwefelsäure und Salze mit orga- nischen Säuren, wie Essigsäure und Oxalsäure sind ebenfalls Gegenstand der Erfindung.
„Funktionale Derivate" erfindungsgemäßer Polypeptide können an funktioneilen Aminosäure-Seitengruppen oder an deren N- oder C-terminalen Ende mit Hilfe bekannter Techniken ebenfalls hergestellt werden. Derartige Derivate umfassen beispielsweise aliphatische Ester von Carbonsäuregruppen, Amide von Carbonsäuregruppen, erhältlich durch Umsetzung mit Ammoniak oder mit einem primären oder sekundären Amin; N-Acylderivate freier Aminogruppen, hergestellt durch Umsetzung mit Acylgruppen; oder O-Acylderivate freier Hydroxygruppen, hergestellt durch Umsetzung mit Acylgrup- pen.
"Funktionale Äquivalente" umfassen natürlich auch Polypeptide, welche aus anderen als den konkret genannten Organismen, zugänglich sind, sowie natürlich vorkommende Varianten. Beispielsweise lassen sich durch Sequenzvergleich Bereiche homologer Sequenzregionen festlegen und in Anlehnung an die konkreten Vorgaben der Erfindung äquivalente Enzyme ermitteln.
„Funktionale Äquivalente" umfassen ebenfalls Fragmente, vorzugsweise einzelne Domänen oder Sequenzmotive, der erfindungsgemäßen Polypeptide, welche z.B. die gewünschte biologische Funktion aufweisen.
„Funktionale Äquivalente" sind außerdem Fusionsproteine, welche eine der oben genannten Polypeptidsequenzen oder davon abgeleitete funktionale Äquivalente und wenigstens eine weitere, davon funktionell verschiedene, heterologe Sequenz in funk- tioneller N- oder C-terminaler Verknüpfung (d.h. ohne gegenseitigen wesentliche funk- tionelle Beeinträchtigung der Fusionsproteinteile) aufweisen. Nichtlimitierende Beispie-
le für derartige heterologe Sequenzen sind z.B. Signalpeptide, Enzyme, Immunoglobu- line, Oberflächenantigene, Rezeptoren oder Rezeptorliganden.
Erfindungsgemäß mit umfasste „funktionale Äquivalente" sind Homologe zu den kon- kret genannten Polypeptiden. Diese besitzen wenigstens 60 %, vorzugsweise wenigstens 75% ins besondere wenigstens 85 %, wie z.B. 90%, 95% oder 99%, Homologie zu einer der konkret offenbarten Sequenzen, berechnet nach dem Algorithmus von Pearson und Lipman, Proc. Natl. Acad, Sei. (USA) 85(8), 1988, 2444-2448. Eine prozentuale Homologie eines erfindungsgemäßen homologen Polypeptids bedeutet ins- besondere prozentuale Identität der Aminosäurereste bezogen auf die Gesamtlänge einer der hierin konkret beschriebenen Aminosäuresequenzen.
Im Falle einer möglichen Proteinglykosylierung umfassen erfindungsgemäße Äquivalente Polypeptide in deglykosylierter bzw. glykosylierter Form sowie durch Verände- rung des Glykosylierungsmusters erhältliche abgewandelte Formen.
Homologe der erfindungsgemäßen Proteine oder Polypeptide können in an sich bekannter Weise durch Mutagenese erzeugt werden, z.B. durch Punktmutation oder Verkürzung des Proteins.
c2) Nukleinsauresequenzen:
Erfindungsgemäße Nukleinsauresequenzen, insbesondere solche die für eines der obigen Polypeptide und deren funktionalen Äquivalente kodieren, umfassen einzel- und doppelsträngige DNA- und RNA-Sequenzen, wie z.B. auch cDNA und mRNA.
Alle hierin erwähnten Nukleinsauresequenzen sind entweder natürlichen Ursprungs oder sind in an sich bekannter Weise durch chemische Synthese aus Nukleotid- bausteinen, wie beispielsweise durch Fragmentkondensation einzelner überlappender, komplementärer Nukleinsäurebausteine herstellbar.
Die chemische Synthese von Oligonukleotiden kann beispielsweise, in bekannter Weise, nach der Phosphoamiditmethode (Voet, Voet, 2. Auflage, Wiley Press New York, Seiten 896-897) erfolgen. Die Anlagerung synthetischer Oligonukleotide und Auffüllen von Lücken mit Hilfe des Klenow-Fragmentes der DNA-Polymerase und Ligationsreak- tionen sowie allgemeine Klonierungsverfahren werden in Sambrook et al. (1989),
Molecular Cloning: A laboratory manual, Cold Spring Harbor Laboratory Press, beschrieben.
Gegenstand der Erfindung sind auch Nukleinsauresequenzen, kodierend für eines der obigen Polypeptide und deren funktionalen Äquivalente, welche z.B. unter Verwendung künstlicher Nukleotidanaloga zugänglich sind.
Die Erfindung betrifft sowohl isolierte Nukleinsäuremoleküle, welche für erfindungsgemäße Polypeptide oder biologisch aktive Abschnitte davon kodieren, sowie Nuklein- Säurefragmente, die z.B. zur Verwendung als Hybridisierungssonden oder Primer zur Identifizierung oder Amplifizierung von erfindungsgemäßer kodierenden Nukleinsäuren geeignet sind.
Die erfindungsgemäßen Nukleinsäuremoleküle können zudem untranslatierte Sequen- zen vom 3'- und/oder 5'-Ende des kodierenden Genbereichs enthalten.
Ein "isoliertes" Nukleinsäuremolekül wird von anderen Nukleinsäuremolekülen abgetrennt, die in der natürlichen Quelle der Nukleinsäure zugegen sind und kann überdies im wesentlichen frei von anderem zellulären Material oder Kulturmedium sein, wenn es durch rekombinante Techniken hergestellt wird, oder frei von chemischen Vorstufen oder anderen Chemikalien sein, wenn es chemisch synthetisiert wird.
Ein erfindungsgemäßes Nukleinsäuremolekül kann mittels molekularbiologischer Standard-Techniken und der erfindungsgemäß bereitgestellten Sequenzinformation isoliert werden. Beispielsweise kann cDNA aus einer geeigneten cDNA-Bank isoliert werden, indem eine der konkret offenbarten vollständigen Sequenzen oder ein Abschnitt davon als Hybridisierungssonde und Standard-Hybridisierungstechniken (wie z.B. beschrieben in Sambrook, J., Fritsch, E.F. und Maniatis, T. Molecular Cloning: A Laboratory Manual. 2. Aufl., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989) verwendet werden. Überdies lässt sich ein Nukleinsäuremolekül, umfassend eine der offenbarten Sequenzen oder ein Abschnitt davon, durch Polymerasekettenreaktion isolieren, wobei die Oligonukleotidprimer, die auf der Basis dieser Sequenz erstellt wurden, verwendet werden. Die so amplifizierte Nukleinsäure kann in einen geeigneten Vektor kloniert werden und durch DNA- Sequenzanalyse charakterisiert werden.
Die Erfindung umfasst weiterhin die zu den konkret beschriebenen Nukleotidsequen- zen komplementären Nukleinsäuremoleküle oder einen Abschnitt davon.
Die genannten Nukleotidsequenzen ermöglichen die Erzeugung von Sonden und Pri- mern, die zur Identifizierung und/oder Klonierung homologer Sequenzen in anderen Zelltypen und Organismen verwendbar sind. Solche Sonden bzw. Primer umfassen gewöhnlich einen Nukleotidsequenzbereich, der unter stringenten Bedingungen an mindestens etwa 12, vorzugsweise mindestens etwa 25, wie z.B. etwa 40, 50 oder 75 aufeinanderfolgende Nukleotide eines Sense-Stranges einer erfindungsgemäßen Nuk- leinsäuresequenz oder eines entsprechenden Antisense-Stranges hybridisiert.
Weitere erfindungsgemäße Nukleinsauresequenzen sind abgeleitet von den konkret offenbarten Sequenzen und unterscheiden sich davon durch Addition, Substitution, Insertion oder Deletion einzelner oder mehrerer Nukleotide, kodieren aber weiterhin für Polypeptide mit dem gewünschten Eigenschaftsprofil.
Erfindungsgemäß umfasst sind auch solche Nukleinsauresequenzen, die sogenannte stumme Mutationen umfassen oder entsprechend der Codon-Nutzung eins speziellen Ursprungs- oder Wirtsorganismus, im Vergleich zu einer konkret genannten Sequenz verändert sind, ebenso wie natürlich vorkommende Varianten, wie z.B. Spleißvarianten oder Allelvarianten, davon. Gegenstand sind ebenso durch konservative Nukleotid- substutionen (d.h. die betreffende Aminosäure wird durch eine Aminosäure gleicher Ladung, Größe, Polarität und/oder Löslichkeit ersetzt) erhältliche Sequenzen.
Gegenstand der Erfindung sind auch die durch Sequenzpolymorphismen von den konkret offenbarten Nukleinsäuren abgeleiteten Moleküle. Diese genetischen Poly- morphismen können zwischen Individuen innerhalb einer Population aufgrund der natürlichen Variation existieren. Diese natürlichen Variationen bewirken üblicherweise eine Varianz von 1 bis 5 % in der Nukleotidsequenz eines Gens.
Weiterhin umfasst die Erfindung auch Nukleinsauresequenzen, welchen mit oben genannten kodierenden Sequenzen hybridisieren oder dazu komplementär sind. Diese Polynukleotide lassen sich bei Durchmusterung von genomischen oder cDNA-Banken auffinden und gegebenenfalls daraus mit geeigneten Primern mittels PCR vermehren und anschließend beispielsweise mit geeigneten Sonden isolieren.
Unter der Eigenschaft, an Polynukleotide „hybridisieren" zu können, versteht man die Fähigkeit eines Poly- oder Oligonukleotids unter stringenten Bedingungen an eine nahezu komplementäre Sequenz zu binden, während unter diesen Bedingungen unspezifische Bindungen zwischen nicht-komplementären Partnern unterbleiben. Dazu sollten die Sequenzen zu 70-100%, vorzugsweise zu 90-100%, komplementär sein. Die Eigenschaft komplementärer Sequenzen, spezifisch aneinander binden zu können, macht man sich beispielsweise in der Northern- oder Southern-Blot-Technik oder bei der Primerbindung in PCR oder RT-PCR zunutze. Üblicherweise werden dazu Oligo- nukleotide ab einer Länge von 30 Basenpaaren eingesetzt. Unter stringenten Bedin- gungen versteht man beispielsweise in der Northern-Blot-Technik die Verwendung einer 50 - 70 °C, vorzugsweise 6O - 65 °C warmen Waschlösung, beispielsweise 0,1x SSC-Puffer mit 0,1 % SDS (20x SSC: 3M NaCI, 0,3M Na-Citrat, pH 7,0) zur Elution unspezifisch hybridisierter cDNA-Sonden oder Oligonukleotide. Dabei bleiben, wie o- ben erwähnt, nur in hohem Maße komplementäre Nukleinsäuren aneinander gebun- den. Die Einstellung stringenter Bedingungen ist dem Fachmann bekannt und ist z:B. in Ausubel et al., Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6. beschrieben.
c3) Expressionskonstrukte und Vektoren:
Gegenstand der Erfindung sind außerdem Expressionskonstrukte, enthaltend unter der genetischen Kontrolle regulativer Nukleinsauresequenzen eine für ein erfindungsgemäß zu exprimierendes Polypeptid kodierende Nukleinsäuresequenz; sowie Vektoren, umfassend wenigstens eines dieser Expressionskonstrukte.
Vorzugsweise umfassen solche erfindungsgemäßen Konstrukte 5'-stromaufwärts von der jeweiligen kodierenden Sequenz einen Promotor und 3'-stromabwärts eine Terminatorsequenz sowie gegebenenfalls weitere übliche regulative Elemente, und zwar jeweils operativ verknüpft mit der kodierenden Sequenz.
Unter einer „operativen Verknüpfung" versteht man die sequentielle Anordnung von Promotor, kodierender Sequenz, Terminator und gegebenenfalls weiterer regulativer Elemente derart, dass jedes der regulativen Elemente seine Funktion bei der Expression der kodierenden Sequenz bestimmungsgemäß erfüllen kann.
Beispiele für operativ verknüpfbare Sequenzen sind Targeting-Sequenzen sowie En- hancer, Polyadenylierungssignale und dergleichen. Weitere regulative Elemente um-
fassen selektierbare Marker, Amplifikationssignale, Replikationsursprünge und dergleichen. Geeignete regulatorische Sequenzen sind z.B. beschrieben in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990).
Die kodierenden Nukleinsauresequenzen können in einer oder mehreren Kopien im Genkonstrukt enthalten sein.
Beispiele für brauchbare Promotoren sind die Hefepromotoren ADC1 , MFalpha , AC, P-60, CYC1 , GAPDH, nmt1 , nmt41 und nmt81.
Für die Hefe S. pombe sind als geeignete Promotoren z.B. zu nennen: nmtl , nmt41 , nmt81 , adhl , fbpl , SV40 oder CaMV. Weitere Angaben unter (http://pinqu.salk.edU/~forsburq/vectors.html#exp). Die Promotoren unterscheiden sich bezüglich ihrer Transkriptionsrate. Die Auswahl richtet sich nach der gewünschten Expressionshöhe. Entsprechendes gilt für andere Hefen.
Geeignete Hefe-Promotoren sind beispielsweise beschrieben in der veröffentlichten US-Patentanmeldung 2003/0077831 , worauf hiermit ausdrücklich Bezug genommen wird.
Geeignet ist auch die Verwendung induzierbarer Promotoren, wie z.B. licht- und insbesondere temperaturinduzierbarer Promotoren.
Die genannten regulatorischen Sequenzen sollen die gezielte Expression der Nukleinsauresequenzen ermöglichen. Dies kann beispielsweise je nach Wirtsorganismus bedeuten, dass das Gen erst nach Induktion exprimiert oder überexprimiert wird, oder dass es sofort exprimiert und/oder überexprimiert wird.
Die regulatorischen Sequenzen bzw. Faktoren können dabei vorzugsweise die Expression positiv beeinflussen und dadurch erhöhen oder erniedrigen. So kann eine Verstärkung der regulatorischen Elemente vorteilhafterweise auf der Transkriptionsebene erfolgen, indem starke Transkriptionssignale wie Promotoren und/oder "Enhancer" ver- wendet werden. Daneben ist aber auch eine Verstärkung der Translation möglich, indem beispielsweise die Stabilität der mRNA verbessert wird.
Die Herstellung einer Expressionskassette erfolgt durch Fusion eines geeigneten Promotors mit einer geeigneten kodierenden Nukleotidsequenz sowie einem Terminatoroder Polyadenylierungssignal. Dazu verwendet man gängige Rekombinations- und Klonierungstechniken, wie sie beispielsweise in T. Maniatis, E.F. Fritsch und J. Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1982) sowie in T.J. Silhavy, M.L. Berman und L.W. Enquist, Experiments with Gene Fusions, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1984) und in Ausübet, F.M. et al., Current Protocols in Molecular Biology, Greene Publishing Assoc. and Wiley Interscience (1987) beschrieben sind.
Das rekombinante Nukleinsäurekonstrukt bzw. Genkonstrukt wird zur Expression in einem geeigneten Wirtsorganismus vorteilhafterweise in einen wirtsspezifischen Vektor insertiert, der eine optimale Expression der Gene im Wirt ermöglicht. Vektoren sind dem Fachmann wohl bekannt und können beispielsweise aus "Cloning Vectors" (Pou- weis P. H. et al., Hrsg, Elsevier, Amsterdam-New York-Oxford, 1985) entnommen werden. Unter Vektoren sind außer Plasmiden auch alle anderen dem Fachmann bekannten Vektoren, wie beispielsweise Phagen, Viren, wie SV40, CMV, Baculovirus und A- denovirus, Transposons, IS-Elemente, Phasmide, Cosmide, und lineare oder zirkuläre DNA zu verstehen. Diese Vektoren können autonom im Wirtsorganismus repliziert oder chromosomal repliziert werden.
Als Beispiele für erfindungsgemäß geeignete Expressionsvektoren können insbesondere für die Hefe S. pombe geeignete Konstrukte genannt werden (siehe z.B.: (http://pinqu.salk.edU/~forsburq/vectors.html#exp).
Weitere Beispiele sind: pART1 (McLeod, M., Stein, M., and Beach, D. (1987) The product of the mei3+ gene expressed under control of the mating type locus, induces meiosis and sporulation in fission yeast. EMBO J. 6:729-736 pCHY21 (Hoffman, C. S. and Winston, F. (1991). Glucose repression of transcription of the schizosaccharomyces pombe fbpl gene occurs by a camp signaling pathway. Genes Dev. 5:561-571 )
REP1 ,REP3, REP4 (Maundrell, K. (1990). nmtl of fission yeast: a highly transcribed gene completely repressed by thiarnine. J. Biol. Chem. 265:10857-10864) REP41, REP42, REP81 , REP82 (Basi, G., Schmid, E. and Maundrell, K. (1993). TATA box mutations in the Schizosaccharomyces pombe nmtl promoter affect transcription
efficiency but not the transcription start point or thiamine repressibility. Gene 123:131- 136)
Hefe-Expressionsvektoren zur Expression in der Hefe S. cerevisiae , wie pYEpSed (Baldari et al., (1987) Embo J. 6:229-234), pMFa (Kurjan und Herskowitz (1982) Cell 30:933-943), pJRY88 (Schultz et al. (1987) Gene 54:113-123) sowie pYES2 (Invitrogen Corporation, San Diego, CA). Vektoren und Verfahren zur Konstruktion von Vektoren, die sich zur Verwendung in anderen Pilzen, wie filamentösen Pilzen, eignen, umfassen diejenigen, die eingehend beschrieben sind in: van den Hondel, C.A.M.J.J. & Punt, P.J. (1991 ) "Gene transfer Systems and vector development for filamentous fungi, in: Applied Molecular Genetics of Fungi, J.F. Peberdy et al., Hrsg., S. 1-28, Cambridge Uni- versity Press: Cambridge.
Weitere geeignete Expressionssysteme sind in Kapitel 16 und 17 von Sambrook, J., Fritsch, E.F. und Maniatis, T., Molecular cloning: A Laboratory Manual, 2. Auflage, Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989 beschrieben
c4) Rekombinante Mikroorganismen:
Mit Hilfe der erfindungsgemäßen Vektoren sind rekombinante Mikroorganismen herstellbar, welche beispielsweise mit wenigstens einem erfindungsgemäßen Vektor transformiert sind und zur Produktion der erfindungsgemäßen Polypeptide eingesetzt werden können.
Vorteilhafterweise werden die oben beschriebenen erfindungsgemäßen rekombinanten Konstrukte in ein geeignetes Wirtssystem eingebracht und exprimiert. Dabei werden vorzugsweise dem Fachmann bekannte geläufige Klonierungs- und Transfektions- methoden, wie beispielsweise Co-Präzipitation, Protoplastenfusion, Elektroporation, retrovirale Transfektion und dergleichen, verwendet, um die genannten Nukleinsäuren im jeweiligen Expressionssystem zur Expression zu bringen. Geeignete Systeme werden beispielsweise in Current Protocols in Molecular Biology, F. Ausubel et al., Hrsg., Wiley Interscience, New York 1997, oder Sambrook et al. Molecular Cloning: A Laboratory Manual. 2. Aufl., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989 beschrieben.
Als Wirtsorganismen sind prinzipiell alle Organismen geeignet, die eine Expression der erfindungsgemäßen Nukleinsäuren, ihrer Allelvarianten, ihrer funktionellen Äquivalente oder Derivate ermöglichen. Bevorzugte Wirtsorganismen sind Hefen.
Verfahren zur Einführung von exogener DNA in Hefezellen sind aus dem Stand der
Technik bekannt. Beispielsweise kann diese durch Sphäroplasten-Transformation nach
Hinnen et al. (1978, Proc. Natl. Acad. Sei., USA, 75: 1919-1935) erfolgen.
Chemische Transformationsmethoden finden sich z.B. für S. pombe bei Alfa et al.
(Alfa, C, Fantes, P., Hyams, J., McLeod, M. and Warbrick, E. (1993) Experiments with fission yeast. Cold Spring Harbor Laboratory Press, New York) oder für S. cerevisiae bei Kaiser et al. (Kaiser, C, Michaelis, S. and Mitchell, A. (1994) Methods in Yeast
Genetics. Cold Spring Harbor Laboratory Press, New York).
In Hefen werden zur Selektion von Transformanden häufig auxotrophe Marker genutzt.
Hierbei fehlt dem zu transformierenden Stamm ein Protein, welches zur Herstellung bestimmter Stoffwechselprodukte notwendig ist. Das entsprechende aktive Protein wird durch den genutzten Vektor in die Zelle eingebracht. Häufig genutzte Marker sind
Gene z.B. der Uracil-, Leucin-, Histidin- oder Tryptophan-Biosynthese.
Die Selektion erfolgreich transformierter Organismen kann durch Markergene erfolgen, die ebenfalls im Vektor oder in der Expressionskassette enthalten sind. Beispiele für solche Markergene sind Gene für Antibiotikaresistenz und für Enzyme, die eine farb- gebende Reaktion katalysieren, die ein Anfärben der transformierten Zelle bewirkt. Diese können dann mittels automatischer Zellsortierung selektiert werden. Erfolgreich mit einem Vektor transformierte Mikroorganismen, die ein entsprechendes Antibiotika- resistenzgen (z.B. G418 oder Hygromycin) tragen, lassen sich durch entsprechende Antibiotika-enthaltende Medien oder Nährböden selektieren. Markerproteine, die an der Zelloberfläche präsentiert werden, können zur Selektion mittels Affinitätschromatographie genutzt werden.
Die Kombination aus den Wirtsorganismen und den zu den Organismen passenden Vektoren, wie Plasmide, Viren oder Phagen, wie beispielsweise Plasmide mit dem RNA-Polymerase/Promotor-System, die Phagen 8 oder : oder andere temperente Phagen oder Transposons und/oder weiteren vorteilhaften regulatorischen Sequenzen bildet ein Expressionssystem.
c5) Rekombinante Herstellung von Zielproteinen
Gegenstand der Erfindung sind weiterhin Verfahren zur rekombinanten Herstellung eines Zielproteins gemäß obiger Definition.
Der rekombinante Mikroorganismus kann nach bekannten Verfahren kultiviert und fermentiert werden. Im Einzelnen werden geeignete Kultivierungsbedingungen beispielsweise für S. pombe in Alfa etal. (Alfa, C, Fantes, P., Hyams, J., McLeod, M. and Warbrick, E. (1993) Experiments with fission yeast. Cold Spring Harbor Laboratory Press, New York) und Gutz et al. (Gutz, H., Heslot, H., Leupold, U. and Loprieno, U. (1974) Schizosaccharomyces pombe. In: Handbook of Genetics 1, pp 395-446, Plenum Press, New York) oder für S. cerevisiae in Kaiser et al. (Kaiser, C, Michaelis, S. and Mitchell, A. (1994) Methods in Yeast Genetics. Cold Spring Harbor Laboratory Press, New York) beschrieben.
Die Zellen werden, falls das Zielprotein in den Kulturüberstand sezerniert wird, von diesem abgetrennt und das Zielprotein wird aus dem Überstand nach bekannten Proteinisolierungsverfahren gewonnen.
Eine Aufreinigung des Zielproteins kann mit bekannten, chromatographischen Verfahren erzielt werden, wie Molekularsieb-Chromatographie (Gelfiltration), lonenaustausch- Chromatographie, wie Q-Sepharose-Chromatographie, und hydrophobe Chromatographie, sowie mit anderen üblichen Verfahren wie Ultrafiltration, Kristallisation, Aussalzen, Dialyse und nativer Gelelektrophorese. Geeignete Verfahren werden beispielsweise in Cooper, T. G., Biochemische Arbeitsmethoden, Verlag Walter de Gruy- ter, Berlin, New York oder in Scopes, R., Protein Purification, Springer Verlag, New York, Heidelberg, Berlin beschrieben.
Zur Erleichterung der Isolierung des rekombinanten Proteins können auch Vektorsysteme verwendet werden, die für veränderte Polypeptide oder Fusionsproteine kodieren, die einer einfacheren Reinigung dienen. Derartige geeignete Modifikationen sind bei- spielsweise als Anker fungierende sogenannte "Tags", wie z.B. die als Hexa-Histidin- Anker bekannte Modifikation oder Epitope, die als Antigene von Antikörpern erkannt werden können (beschrieben zum Beispiel in Harlow, E. and Lane, D., 1988, Antibo- dies: A Laboratory Manual. Cold Spring Harbor (N.Y.) Press). Diese Anker können zur Anheftung der Proteine an einen festen Träger, wie z.B. eine Polymermatrix, dienen, die beispielsweise in einer Chromatographiesäule eingefüllt sein kann, oder an einer Mikrotiterplatte oder an einem sonstigen Träger verwendet werden kann.
Gleichzeitig können diese Anker auch zur Erkennung der Proteine verwendet werden. Zur Erkennung der Proteine können außerdem übliche Marker, wie Fluoreszenzfarbstoffe, Enzymmarker, die nach Reaktion mit einem Substrat ein detektierbares Reaktionsprodukt bilden, oder radioaktive Marker, allein oder in Kombination mit den Ankern zur Derivatisierung der Proteine verwendet werden.
c6) Oberflächenbehandlung mit Hydrophobin
Die Behandlung von Oberflächen mit Hydrophobinen zur Veränderung, z.B. zur Hydrophobierung oder Hydrophilisierung , der Oberflächeneigenschaften ist prinzipiell bekannt. Sie wird nun erfindungsgemäß dadurch wesentlich vereinfacht, dass mit deren rekombinanter Herstellung der Hydrophobine ausreichend Ausgangsmaterial zur Verfügung steht.
Unter Berücksichtigung der Lehre des Standes der Technik (wie z.B. der WO-A- 01/57066, die die Stabilisierung, Solubilisierung und die damit verbundene bessere Anwendung von Hydrophobinen durch Sulfitbehandlung beschreibt; der WO-A- 01/57076, die die Reinigung von Hydrophobin durch Adsorption an Teflon-Kügelchen und die Elution mittels Detergens, wie Tween, bei niedrigen Temperaturen beschreibt; oder der WO-A-01/57528, die die Fixierung von Hydrophobinen auf Oberflächen durch die Anwendung von Tween und Temperaturen bis 85 Grad Celsius beschreibt) sind die unterschiedlichsten festen Materialen, wie Glas, Fasern, Geweben, Leder, lackierte Gegenständen, Folien, Fassaden, Hydrophobin-beschichtbar.
Die Erfindung wird nun durch folgende nicht-limitierende Beispiele unter Bezugnahme auf beiliegende Figuren näher beschrieben. Dabei zeigt
Figur 1 verschiedene erfindungsgemäß hergestellte Konstrukte zur Sekretion der Hydrophobine aus S. pombe.
Figur 2 A) die genomische Sequenz des DewA-Gens (SEQ ID NO:39); die Sequenzen der beiden Introns sind unterstrichen; B) die Aminosäuresequenz und in Klammern die entsprechende DNA-Sequenz des DewA-Proteins aus Aspergillus nidulans; die Signalsequenz ist fettgedruckt, die auf die Signalsequenz folgende Teilsequenz entspricht der Sequenz von maturem DewA; C) die Aminosäuresequenz und in Klammern die entsprechende DNA-Sequenz des HA-Tag.
Figur 3 A) die Aminosäuresequenz und in Klammern die entsprechende DNA-Sequenz des P-Faktor Präproteins; die Signalsequenz ist fettgedruckt; die auf die Signalsequenz folgenden unterstrichenen Teilsequenzen entsprechen den Sequenzen der vier matu- ren Pheromon-Peptide; das dem Signalpeptid nächstgelegene Pheromon wird als P- Faktor bezeichnet; B) Aminosäuresequenz und in Klammern die entsprechende DNA- Sequenz des abspaltbaren Signalpeptides und der sich daran anschließenden 6 Aminosäuren (unterstrichen) des P-Faktor Präproteins; C) Aminosäuresequenz und in Klammern die entsprechende DNA-Sequenz zum erfindungsgemäßen "P-Shuttle"; die Signalsequenz ist fettgedruckt die auf die Signalsequenz folgende unterstrichene Teil- sequenz entspricht der Sequenz von matu rem P-Faktor;
Figur 4 ein erfindungsgemäßes Fusionsprotein bestehend aus der "P-Shuttle"-Sequenz (Signalsequenz fett; matures P-Protein unterstrichen), dem maturen DewA (doppelt unterstrichen) und dem C-terminal fusionierten HA-Tag (SEQ ID NO: 18; kodiert von SEQ ID NO: 17);
Figur 5 den immunologischen Nachweis von Hydrophobinen in S. pombe*
Die Hydrophobingene DewA und RodA aus A. nidulans wurden zum immunologischen
Nachweis mit einem HA-tag fusioniert, in den Expressionsvektor pJR1-3XL kloniert und in S. pombe transformiert. "Membranfraktion" und "cytosolische Proteine" wurden durch SDS-PAGE aufgetrennt. Der Nachweis in der Westem-Analyse erfolgte mit HA- Antikörpern. Der Größenstandard in kDa ist links angegeben. A: aufgetragen sind Proben einer Kultur mit dem Insert-freien Vektor (pJR1-3XL, Negativkontrolle), mit einem HA-getaggten Kontroll-Protein (Positivkontrolle) sowie mit einem Vektor, der das HA- getaggte DewA Gen mit Introns (DewA-HA(+ Introns)) enthält. B: aufgetragen sind jeweils Proben einer Kultur mit dem Vektor (pJR1-3XL, Negativkontrolle), mit einem Vektor, der das HA-getaggte DewA Gen ohne Introns (DewA-HA(-lntrons)) bzw. das HA- getaggte RodA Gen mit Introns (RodA-HA(-Hntrons)) enthält.
Figur 6 den immunologischen Nachweis der Expression von Hydrophobinen in S. pombe. Das PDewAHA-Protein wurde in S\ pombe exprimiert. Die Zellen wurden geerntet, der Kulturüberstand aliquotiert und ein Teil TCA-gefällt. Der Nachweis des Proteins erfolgte nach SDS-PAGE und Western-Blot mit Hilfe von HA-Antikörpern. Die mit * gekennzeichneten Banden entsprechen dem Precursor-Protein (ca. 18 kD, obere Bande) und der maturen Form (ca. 17 kD untere Bande).
Figur 7 den Nachweis der Expression von Hydrophobinen in S. pombe.
S. pombe Zellen wurden mit Plasmiden transformiert, welche P+6DewA durch einem starken Promotor (pJR1-3XL) bzw. schwächeren Promotor (pJR1-81XL) exprimieren. Die Zellen tragen chromosomal eine Version des prp7-Gens mit einem c-myc-Tag. Dieses dient als Kontrolle um auszuschließen, dass der Kulturüberstand durch lysierte Zellen verunreinigt wurde. Zellen wurden geerntet (Pellet), der Kultυrüberstand TCA- gefällt (Überstand). Der Nachweis der Proteine erfolgte nach SDS-PAGE und Western- Blot mit Hilfe von Antikörpern gegen HA (A) bzw. gegen c-myc (B).
Figur 8 den Nachweis der Sekretion mit Hilfe des "P-Shuttle"-Verfahrens. S. pombe Zellen wurden mit Plasmiden transformiert, welche PfakDewA durch einen schwächeren Promotor (pJR1-81XL) exprimieren. Die Zellen wurden geerntet (Pellet), der Kulturüberstand TCA-gefällt (US). Der Nachweis des Proteins erfolgte nach SDS- PAGE und Westem-Blot mit Hilfe von Antikörpern gegen HA.
Figur 9 die drei Gene, welche jeweils den M-Faktor (SEQ ID NO:51 für maturen Faktor) aus S. pombe kodieren: A) Sequenzen für das mfm1+'Gen; B) Sequenzen für das tr7t/772+"Gen; und C) Sequenzen für das mfm3*'Gen.
Figur 10 das RodA-Gen. Die genomische Sequenz (SEQ ID NO:52) des RodA-Gens enthält zwei Introns (unterstrichen), welche im entsprechenden kodierenden ORF (SEQ ID NO:53) nicht vorhanden sind. Das Präprotein (SEQ ID NO:54) enthält eine abspaltbare Signalsequenz (fett gedruckt), welche im maturen Protein (SEQ ID NO:56; kodiert von SEQ ID NO:55) fehlt.
Experimenteller Teil
Allgemeine experimentelle Angaben:
a) Allgemeine Klonierungsverfahren
Die im Rahmen der vorliegenden Erfindung durchgeführten Klonierungsschritte wie z.B. Restriktionsspaltungen, Agarose Gelelektrophorese, Reinigung von DNA- Fragmenten, Transfer von Nukleinsäuren auf Nitrozellulose und Nylonmembranen, Verknüpfen von DNA-Fragmenten, Transformation von E. coli Zellen, Anzucht von
Bakterien, Vermehrung von Phagen und Sequenzanalyse rekombinanter DNA wurden,
wenn keine abweichenden Angaben gemacht werden, wie bei Sambrook et al. (1989) a.a.O. beschrieben durchgeführt.
Die Aufreinigung von DNA aus Reaktionsgemischen oder nach Gelelektrophorese er- folgte mittels des NucleoSpin Extract Kit (Machery-Nagel, Düren) und die Isolierung von Plasmid DNA aus E. coli mit Hilfe des NucleoSpin Plasmid Quick Pure Kit (Machery-Nagel, Düren) nach den Angaben des Herstellers.
Restriktionsenzyme (Invitrogen) wurden nach Angaben des Herstellers eingesetzt. Li- gationen von DNA erfolgten mit Hilfe der T4-Ligase (Promega, Mannheim) nach Angaben des Herstellers.
Transformationen in E. coli erfolgten mittels Elektroporation mit dem Gene Pulser II Gerät (BIO-RAD, München) unter Verwendung von 2 mm Elektroporationsküvetten (Biozym Diagnostik, Hess. Oldendorf) nach Angaben der Hersteller. Transformanden wurden auf Ampicillin-haltigem (150 mg/l) LB Medium (Lennox, 1955, Virology, 1 :190) selektiert.
b) Polymerasekettenreaktion (PCR)
PCR-Amplifikationen wurden mit Hilfe der Combizyme-DNA-Polymerase (lnvitek, Berlin, Deutschland) nach den Angaben des Herstellers durchgeführt. Es wurden je 100 μl Reaktionsvolumen je 1 pmol der entsprechenden Primer eingesetzt.
c) Kultivierung
Die Kultivierung von S. pombe wurde wie in Alfa et al. (Alfa, C, Fantes, P., Hyams, J., McLeod, M. and Warbrick, E. (1993) Experiments with fission yeast. Cold Spring Harbor Laboratory Press, New York) und Gutz et al. (Gutz, H., Heslot, H., Leupold, U. and Loprieno, U. (1974) Schizosaccharomyces pombe. In: Handbook of Genetics 1 , pp 395-446, Plenum Press, New York) beschrieben durchgeführt.
Die Kultivierung von rekombinanten Stämmen erfolgte wie in Alfa et al. (Alfa, C, Fantes, P., Hyams, J., McLeod, M. and Warbrick, E. (1993) Experiments with fission yeast. Cold Spring Harbor Laboratory Press, New York) und Gutz et. al. (Gutz, H., Heslot, H., Leupold, U. and Loprieno, U. (1974) Schizosaccharomyces pombe. In: Handbook of Genetics 1 , pp 395-446, Plenum Press, New York) beschrieben.
d) Zellaufschluss
Für rasche Expressionskontrollen wurden Zellen abzentrifugiert (5 min, 3.500xg) und das Zellpellet direkt in Laemmli-Puffer (Laernmli, U.K. (1970) Cleavage of structural proteins during the assembly of the head of bacteriophage T4 (Nature 227:680-685)) für die Gelelektrophorese aufgenommen.
Für den Zellaufschluss wurden Zellen durch Zentrifugation bei 3.500xg für 5 min geern- tet. Die Zellpellets wurden in 1ml 1xPBS resuspendiert und 1 Volumen Glasperlen zugegeben. Der Ansatz wurde für 5 min gevortext, der Überstand über den Glasperlen abgenommen.
e) Verwendete Organismen
Für Arbeiten mit E. coli wurden die Stämme DH5α (Invitrogen), XL10-Gold (Stratage- ne) oder BL21 (BioLabs) verwendet.
Verwendete S. pombe Stämme sind der Spalthefe-Stammsammlung der Arbeitsgruppe von Prof. Dr. G. Rodel des Institutes für Genetik der Technischen Universität Dresden entnommen.
Beispiel 1 : Herstellung des Expressionskonstrukts DewA und DewAHA und Klonie- rung in den Vektor pJR1-3XL
a) Isolierung der genomischen DNA Sequenz des DewA-Gens und Entfernung der Introns
Chromosomale DNA, die wie in Kaiser ef al. (Kaiser, C, Michaelis, S. and Mitchell, A. (1994) Methods in Yeast Genetics. Cold Spring Harbor Laboratory Press, New York) aus A. nidulans isoliert worden war, wurde freundlicherweise von Herrn Prof. Dr. A. Brakhage (Hannover) zur Verfügung gestellt.
Mit chromosomaler DNA als Template unter Verwendung der Primer SpDewBamrev und ScDewBamfor wurde das ca. 550 bp lange genomische DNA Fragment PCR amplifiziert.
ScDewBamfor:
5' . TAA TAA GGA TCC ATG CGC TTC ATC GTC TCT CTC C - 3' (SEQ ID NO:41 )
SpDewBamrev:
5' . TAA TAA GGA TCC TTA CTC AGC CTT GGT ACC GGC - 3' (SEQ ID NO:28)
Das Reaktionsgemisch wurde gelelektrophoretisch aufgetrennt und die entsprechende DNA Bande wie oben beschrieben eluiert. Das Fragment, welches an beiden Seiten von einer Sa/πHI-Schnittstelle, welche durch die Primer eingefügt wurde, flankiert wird, wurde mit der Restriktionsendonuclease ßamHI (Invitrogen) nach Angaben des Herstellers geschnitten und aus dem Reaktionsgemisch aufgereinigt (siehe oben).
Der Vektor pUC18 (Yanisch-Pron, C, Vieira, J. and Messing, J. (1985) Improved M13 phage cloning vectors and host strains: Nucleotide sequences of M13mp18 and pUC19 vectors. Gene 33:103) wurde ebenfalls mit ßamHI geschnitten, gelelektrophoretisch aufgetrennt und nachfolgend aus dem Gel eluiert (siehe oben).
Vektor und Fragment wurden ligiert (siehe oben) und die Ligationsmischung in E. coli transformiert. Rekombinante Plasmide wurden nach Plasmid-Präparation und anschließendem Restriktionsverdau identifiziert. Die korrekte DNA-Sequenz der klonier- ten PCR-Produkte wurde - wie auch bei allen im Folgenden hergestellten Konstrukten - nach Klonierung durch Sequenzierung verifiziert. Sequenzierungsreaktionen wurden nach Sanger et al. (Sanger, F., Nicklen, S. and Coulson, A.R. (1977) DNA sequencing with chain terminating inhibitors. Proc NatI Acad Sei USA 74:5463-5467) durchgeführt. Die Sequenzierreaktionen wurden mit Hilfe des "Thermo-Sequenase fluorescent labelled primer cycle sequencing kit with 7-deaza-dGTP" (Amesham Pharamacia Biotech, Freiburg) und S'-seitig IRD800 markierten Primern (MWG Biotech AG, Ebersberg) durchgeführt. Die Auftrennung der Produkte und Sequenzauswertung er- folgte mit dem automatischen LI-COR 4000/4200 (MWG Biotech AG, Ebersberg) Sequenziersystem.
Ein Konstrukt, welches das intronhaltige, genomische DewA-Gen in die ßamHI- Schnittstelle des Vektors pUC18 kloniert enthält, wurde pDewAgen genannt.
Die in der genomischen DNA von DewA befindlichen zwei Introns (siehe genomische Dew>A-Sequenz SEQ ID NO: 39) wurden mittels „Overlap Extension PCR" (OEP) (vgl.
Pogulis, R.J., Vallejo, A.N. and Pease, L.R. In vitro recombination and mutagenesis by overlap extension PCR. Methods Mol Biol. 1996;57:167-76) entfernt.
Zunächst wurden unter Verwendung von DNA des Konstruktes pDewAgen als Templa- te mit Hilfe der Primerpaare ScDewBamfor/DewUrev, Dewl1for/Dewl2rev und De- wl2for/SpDewBamrev Subfragmente des offenen Leserahmes (ORF) von DewA PCR amplifiziert.
ScDewBamfor: 5' - TAA TAA GGA TCC ATG CGC TTC ATC GTC TCT CTC C - 3' (SEQ ID NO:41 )
DewUrev:
5' - GT GTG GTC GAC GAG AGC GAG CAG ACC CAG CTG - 3' (SEQ ID NO:24)
DewHfor:
5' - CAG CTG GGT CTG CTC GCT CTC GTC GAC CAC AC - 3' (SEQ ID NO:23)
Dewl2rev:
5' - GTC GAC GGC AAC ACA GTT GGT GGT TCC CTC - 3' (SEQ ID NO:26)
Dewl2for:
5" - GAG GGA ACC ACC AAC TGT GTT GCC GTC GAC - 3' (SEQ ID NO:25)
SpDewBamrev: 5' - TAA TAA GGA TCC TTA CTC AGC CTT GGT ACC GGC - 3' (SEQ ID NO:28)
Diese Subfragmente wurden gelelektrophoretisch aufgetrennt und aufgereinigt. In der finalen PCR wurde der intronlose ORF mit den Subfragmenten als Template und den distalen Primern ScDewBamfor und SpDewBamrev amplifiziert. Das ca. 410 bp lange PCR Produkt wurde gelelektrophoretisch aufgetrennt, aufgereinigt und mit der Restrik- tionsendonuclease ßamHI geschnitten. Durch die distalen Primer waren entsprechende Schnittstellen eingefügt worden. Das geschnittene Fragment wurde aufgereinigt und in den ebenfalls mit ßamHI geschnittenen Vektor pUC18 kloniert. Vektor und Fragment wurden ligiert (siehe oben) und die Ligationsmischung in E. coli transformiert. Rekom- binante Plasmide wurden nach Plasmid-Minipräparation identifiziert und die korrekte Sequenz des klonierten ORF durch Sequenzierung verifiziert. Das so erhaltene Kon-
strukt (pDewAORF) diente als Template für die Konstruktion entsprechender Expressi- onsplamide.
b) Herstellung der Expressionskonstrukte von DewHA(+lntrons) und DewHA(-lntrons) und Einführung eines C-terminalen Hämagglutinin-Tags
Da keine spezifischen Antikörper gegen DewA zur Verfügung stehen, wurde zum Nachweis der heterologen Expression DewA mit dem HA-Epitop durch OEP fusioniert. Zunächst wurden in den primären PCRs die Primerpaare SpDewXhofor/DewAHArev und DewAHAfor/DewAHANcorev genutzt.
SpDewXhofor:
5' - TAA TAA CTC GAG ATG CGC TTC ATC GTC TCT CTC C - 3' (SEQ ID NO:27) De AHArev:
5' - TCC ACG CGG AAC CAG CTC AGC CTT GGT ACC - 3' (SEQ ID NO:30)
DewAHAfor:
5' - GGT ACC AAG GCT GAG CTG GTT CCG CGT GGA - 3' (SEQ ID NO:29) DewAHANcorev:
5' - ATT ATT CCA TGG CTA TTA GCG GCC GCA CTG AGC AGC - 3' (SEQ ID NO:31)
Als Template für die Herstellung von DewHA(+lntrons) diente DNA des Konstruktes pDewAgen, für die Herstellung von DewHA(-lntrons) DNA des Konstruktes pDewA- ORF. Als Template für die PCR mit DewAHAfor/DewAHANcorev wurde der die DNA- Sequenz des HA-tag tragende Vektor yEP351 HA (Kettner, K., Friederichs, S., Schlapp, T. and Rodel G (2001) Expression of a VEGF-like protein from Parapoxvirus ovis in the yeasts Saccharomyces cerevisiae and Schizosaccharomyces pombe. Protein Expr Purif Aug;22(3):479-83) genutzt. In den finalen PCRs mittels des Primerpaares
SpDewXhofor/ DewAHANcorev und den respektiven Subfragmenten erfolgte die Fusion der für das HA-Epitop kodierenden DNA an die jeweilige DewA-DNA. Die so ampli- fizierten Fragmente werden 5'-seitig von einer Xho\ Restriktionsschnittstelle und 3'- seitig von einer Λ/col Restriktionsschnittstelle flankiert, welche mit Hilfe der distalen Primer eingeführt wurden. Die Fragmente wurden gelelektrophoretisch aufgetrennt, aufgereinigt und mit den Restriktionsendonucleasen Xho\ und Ncol geschnitten und aus dem Reaktionsgemisch aufgereinigt.
Der Vektor pJR1-3XL (Moreno, M.B., Duran, A. and Ribas, J.C. Afamily of multifunctional thiamine-repressible expression vectors for fission yeast. Yeast. 2000 Jun 30;16(9):861-72) wurde ebenfalls mit den Restriktionsenzymen Xho\ und Λ/col ge- schnitten, gelelektrophoretisch aufgetrennt und aufgereinigt. Vektor und Fragment wurden ligiert (siehe oben) und die Ligationsmischung durch Elektroporation in E. coli transformiert. Rekombinante Plasmide wurden nach Plasmid-Minipräparation identifiziert und die korrekte Sequenz des klonierten ORF durch Sequenzierung verifiziert. In den so erhaltenen Expressionsplamiden DewA-HA(+lntrons) und DewA-HA(-lntrons) steht die Expression der Fusionskonstrukte in S. pombe unter der Kontrolle des starken nmt7-Promotors.
c) Expression von DewA-HA(+lntron) und DewA-HA(-lntron)
Die gemäß a) und b) erhaltenen Vektoren DewA-HA(+lntrons) und DewA-HA(-lntrons) wurden in den S. pombe Wirtsstamm K0103 (t?"s ade6-M210 leu1-32 his7-366) wie von Schiestl und Gietz (Schiestl, R.H. and Gietz, R.D. (1989) High efficency transformation of intact yeast cells using Single stranded nucleic acids as a carrier. Curr Genet 16:339- 346) beschrieben transformiert. Die durch die feι/7-32-Mutation bedingte Leucin- auxotrophie des S. pombe Stammes wird durch das auf den Expressionsvektoren vorhandene LEl/2-Gen aus S. cerevisiae komplementiert. Transformanden können so auf Minimalmedium ohne Leucin selektiert werden. Die Expression der Fusionsproteine in entsprechenden Hefetransformanden wurde mittels Westem-Blot-Analysen untersucht.
Die Antikörper Anti-HA (Artikel 1 583816, Anti-HA (12CA5)-mouse monoclonal Antikörper) und Anti-c-myc (Artikel 1 667 149, Anti-c-myc Antikörper) wurden von Röche Diagnostics (Mannheim) bezogen.
Hefetransformanden wurden nach der Kultivierung geerntet, mit Glasperlen aufge- schlössen und der 3.500xg Überstand der Zentrifugation abgenommen. Es wurden je 50 μg des 20.000xg Pellets ("Membranfraktion") und des Überstands ("cytosolische Proteine") aufgetragen und im SDS-PAGE aufgetrennt. Der Nachweis in der Western- Analyse erfolgte mit HA-Antikörpern. Das Ergebnis ist in Figur 5 gezeigt. Der Größenstandard in kDa ist links angegeben. In Figur 5A sind Proben einer Kultur mit dem In- sert-freien Vektor (pJR1-3XL, Negativkontrolle), mit einem HA-getaggten Kontroll- Protein (Positivkontrolle) sowie mit einem Vektor, der das HA-getaggte DewA Gen mit Introns (DewA-HA(+lntrons)) enthält, aufgetragen. In Figur 5B sind jeweils Proben ei-
ner Kultur mit dem Vektor (pJR1-3XL, Negativkontrolle), mit einem Vektor, der das HA- getaggte DewA Gen ohne Introns (DewA-HA(-lntrons)) bzw. das HA-getaggte RodA Gen mit Introns (Rod-AHA(+lntrons)) enthält, aufgetragen.
Die Herstellung von RodAHA(+lntrons) erfolgte in Analogie zu den Angaben von Beispiel 1a) und 1 b). RodA ist ein weiteres Hydrophobin aus A. nidulans.
Beispiel 2: Herstellung von Expressionsvektoren zur Sekretion des exprimierten DewA - Vektor enthaltend das Konstrukt PDewAHA
a) Herstellung des Konstrukts PDewAHA, enthaltend die kodierende Sequenz für das P-Faktor Signalpeptid
Um die Sekretion des Proteins aus S. pombe Zellen zu optimieren, wurde das authentische Sekretionssignal des A. nidulans Proteins, welches in der Spalthefe nicht effektiv ist, zunächst durch das abspaltbare Signalpeptid des P-Faktors aus S. pombe ersetzt. Der P-Faktor wird als Peptid-Pheromon von den Zellen in das Medium sezerniert. Er wird in der Zelle als Vorläuferprotein (Präprotein) bestehend aus einer abspaltbaren N- terminalen Signalsequenz, und vier P-Faktor Kopien, jeweils durch kurze Spacerse- quenzen getrennt, synthetisiert und durchläuft im Rahmen der Sekretion eine Reifung, darunter die Abspaltung der Signalsequenz und die proteolytische Freisetzung der vier P-Faktor Peptide.
Zunächst wurde die P-Faktor-Signalsequenz mittels PCR und genomischer DNA von S. pombe als Template unter Verwendung des Primerpaares SigPXhofor/PDewArev amplifiziert und das entsprechende PCR-Produkt aufgereinigt.
SigPXhofor: 5' - TAA TTT CTC GAG ATG AAG ATC ACC GCT GTC ATT GCC CTT TTA TTC TCA C - 3' (SEQ ID NO:34) PDewArev: 5' - GGC AGA GGC CGG GAG TGG AAT AGG TGA GGC - 3' (SEQ ID NO:33)
Ebenfalls wurde das PCR-Produkt des Primerpaares PDewfor/DewAHANcorev und DNA des Konstruktes DewA-HA(-Introns) als Template gelelektrophoretisch aufgetrennt und aufgereinigt.
PDewfor:
5' - GCC TCA CCT ATT CCA CTC CCG GCC TCT GCC - 3' (SEQ ID NO:32) DewAHANcorev: 5' - ATT ATT CCA TGG CTA TTA GCG GCC GCA CTG AGC AGC - 3' (SEQ ID NO:31)
Diese beiden primären PCR-Produkte wurden in der finalen PCR mit den distalen Primern SigPXhofor/DewAHANcorev als Template genutzt. Das so amplifi- zierte PDewAHA-Fragment wird 5'-seitig von einer Xho\ Restriktionsschnittstelle und an seinem 3'-Ende von einer Nco\ Restriktionsschnittstelle flankiert, welche mit Hilfe obiger Primer eingeführt wurden. In dem von diesem Fragment kodierten Fusionsprotein (PDewAHA) ist die abspaltbare Signalsequenz des DewA aus A. nidulans durch das abspaltbare Signalpeptid des P-Faktor-Vorläuferproteins ersetzt.
Das PDewAHA-Fragment wurde mit den Restriktionsendonucleasen Xho\ und Λ/col geschnitten, gelelektrophoretisch aufgetrennt und in den mit den mit den gleichen Restriktionsendonucleasen geschnittenen Vektor pJR1-3XL (siehe oben) ligiert. Vektor und Fragment wurden ligiert (siehe oben) und die Ligationsmischung durch E- lektroporation in E. coli transformiert. Rekombinante Plasmide wurden nach Plasmid-Minipräparation identifiziert und die korrekte Sequenz des klonierten ORF durch Sequenzierung verifiziert. Das erhaltene Konstrukt wurde PDewAHA genannt.
b) Expression
Die Experimente wurden in Analogie zu Beispiel 1c) durchgeführt.
Das PDewAHA-Protein wurde in S. pombe exprimiert. Die Zellen wurden geerntet, der Kulturüberstand aliquotiert und ein Teil TCA-gefällt. Der TCA-Niederschlag wurde in Laemmli-Puffer (Laemmli, U.K. (1970) Cleavage of structural proteins during the assembly of the head of bacteriophage T4 (Nature 227:680-685)) aufgenommen. Zellpellet, Überstand und TCA-gefällter Überstand wurden untersucht. Der Nachweis des Proteins erfolgte nach SDS-PAGE und Westem-Blot mit Hilfe von HA-Antikörpern. Das Ergebnis ist in Figur 6 dargestellt. Die mit * gekennzeichneten Banden entsprechen
dem Precursor-Protein (ca. 18 kD, obere Bande) und der maturen Form (ca. 17 kD untere Bande).
Die Analyse ergab, dass keine effektive Sekretion zu beobachten war. Die N-terminale Fusion des abspaltbaren Signalpeptides des P-Faktors ist für eine Sekretion des fusionierten Hydrophobin nicht hinreichend.
Beispiel 3: Herstellung von Expressionsvektoren zur Sekretion des exprimierten DewA - Vektor enthaltend das Konstrukt P+6DewAHA
a) Herstellung des Konstrukts P+6DewAHA, enthaltend die kodierende Sequenz für- das P-Faktor Signalpeptid, C-terminal verlängert um 6 Aminosäuren
Um eine für die Sekretion möglicherweise wichtige authentische Sequenzumgebung des Signalpetides zu gewährleisten, wurde die Sequenz des Signalpetides im Fusionsprotein mittels OEP unter Verwendung der Primerpaare SigPXhofor/P+6DewArev und P+6DewAfor/DewAHANcorev mit DNA des Konstruktes PDewAHA als Template in den primären PCR-Reaktionen
SigPXhofor:
5' - TAA TTT CTC GAG ATG AAG ATC ACC GCT GTC ATT GCC CTT TTA TTC TCA
C - 3' (SEQ ID NO:34)
P+6DewArev: 5' - CAC ACC AGG ATC GGC AAC TGG AAT AGG TGA GGC - 3' (SEQ ID NO:36)
P+6DewAfor:
5' - GTT GCC GAT CCT GGT GTG CTC CCG GCC TCT GCC - 3' (SEQ ID NO:35) DewAHANcorev: 5' - ATT ATT CCA TGG CTA TTA GCG GCC GCA CTG AGC AGC - 3' (SEQ ID NO:31)
und dem Primerpaar SigPXhofor/DewAHANcorev in der finalen PCR-Reaktion um die 6 sich C-terminal anschließenden Aminosäuren erweitert (P+6DewA).
Das P+6DewA-Fragment wurde mit den Restriktionsendonucleasen Xho\ und Λ/col geschnitten, gelelektrophoretisch aufgetrennt und in den mit den gleichen Restriktion-
sendonucleasen geschnittenen Vektor pJR1-3XL (siehe oben) ligiert und die Ligati- onsmischung durch Elektroporation in E. coli transformiert. Rekombinante Plasmide wurden nach Plasmid-Minipräparation identifiziert und die korrekte Sequenz des Monierten ORF durch Sequenzierung verifiziert. Ebenso wurde das P+6DewA-Fragment in den Vektor pJR-81XL kloniert. Hier steht die Transkription des Fusionsgens unter der Kontrolle des schwachen nmtδ -Promotors. Mit diesem Kon- strukt sollte ein negativer Einfluss der sehr hohen Transkription in pJR1-3XL Konstanten auf die Sekretion getestet werden.
Die entsprechenden Konstrukte wurden P+6DewA/pJR1-3XL und P+6DewA/pJR1- 81XL genannt.
Die Durchführung des Experiments erfolgte in Analogie zu Beispiel 2a. Die Klonierung der amplifizierten Sequenzen in pJR1-3XI erfolgt analog zu Beispiel 2a.
b) Expression
Die Expression erfolgte in Analogie zu Beispiel 2b).
S. pombe Zellen wurden mit den beiden Plasmiden transformiert, welche P+6DewA durch einem starken Promotor (pJR1-3XL) bzw. schwächeren Promotor (pJR1-81XL) exprimieren. Die Zellen tragen chromosomal eine Version des prpl-Gens mit einem c- myc-Tag. Dieses dient als Kontrolle um auszuschließen, dass der Kulturüberstand durch lysierte Zellen verunreinigt wurde. Zellen wurden geerntet (Pellet), der Kulturüberstand TCA-gefällt (Überstand). Der Niederschlag wurde in Laemmli-Puffer aufge- nommen und ebenfalls analysiert. Der Nachweis der Proteine erfolgte nach SDS- PAGE und Western-Blot mit Hilfe von Antikörpern gegen HA (Figur 7A) bzw. gegen c- myc (Röche Diagnostics) (Figur 7B).
Wie man in Figur 7 sieht, ist auch diese Konstruktion für eine effektive Sekretion nicht geeignet.
Beispiel 4: Herstellung von Expressionsvektoren zur Sekretion des exprimierten DewA - Vektor enthaltend das Konstrukt PfakDewAHA
a) Herstellung des Konstrukts PfakDewAHA, enthaltend die kodierende Sequenz für den reifen ersten P-Faktor einschließlich dem P-Faktor-Signalpeptid
Es wurde DewAHA mittels OEP an das carboxylterminale Ende der Sequenz des maturen P-Faktors fusioniert. Die in den primären PCR-Reaktionen unter Verwendung der Primerpaare SigPXhofor/PfakDewArev und genomischer DNA von S. pombe als Template
SigPXhofor:
5' . TAA TTT CTC GAG ATG AAG ATC ACC GCT GTC ATT GCC CTT TTA TTC TCA C - 3' (SEQ ID NO:34) PfakDewArev: 5' - GGC AGA GGC CGG GAG GCG CTT TTT CAA GTT GGG TC - 3' (SEQ ID NO:38)
und PfakDewAfor/DewAHANcorev und DNA des Konstruktes P+6DewA/pJR1-81XL als Template
PfakDewAfor:
5' - AAC TTG AAA AAG CGC CTC CCG GCC TCT GCC - 3' (SEQ ID NO:37)
DewAHANcorev:
5' - ATT ATT CCA TGG CTA TTA GCG GCC GCA CTG AGC AGC - 3' (SEQ ID NO:31)
erhaltenen PCR-Fragmente wurden gelelektrophoretisch getrennt, aufgereinigt und als Template für die finale PCR mit Hilfe des Primerpaares SigPXhofor/ DewAHANcorev genutzt. Das so erhaltene PfakDewA-Fragment wurde mit den Restriktionsendonuc- leasen Xho\ und Λ/col geschnitten, gelelektrophoretisch aufgetrennt und in den mit den gleichen Restriktionsendonucleasen geschnittenen Vektor pJR1-81XL (siehe oben) ligiert. Die Ligationsmischung wurde durch Elektroporation in E. coli transformiert. Rekombinante Plasmide wurden nach Plasmid-Minipräparation identifiziert und die korrekte Sequenz des klonierten ORF durch Sequenzierung verifi- ziert. Ein solches Konstrukt wurde PfakDewA/pJR1-81XL genannt. In diesem Konstrukt steht die für das P-Faktor Präprotein einschließlich des ersten aminoterminalen Pheromons und die für das Hydrophobin kodierende fusionierte Sequenz, unter der Kontrolle des nmt81 Promotors.
Die Durchführung des Experiments erfolgte in Analogie zu Beispiel 2a, wobei jedoch der Expressionsvektor pJR1-81XL verwendet wurde.
Die Klonierung der amplifizierten Sequenzen in pJR1 -81XL erfolgte analog zu Beispiel 2a. Die amplifizierte und mit den Restriktionsendonucleasen Xho\ und Λ/col geschnittene DNA wurde dazu in die Xho\ und Λ/col Schnittstellen des Expressionsvektors pJR1- 81XL kloniert.
b) Expression
Die Expression erfolgte in Analogie zu Beispiel 3b)
Die Zellen wurden pelletiert, der Kulturüberstand TCA-gefällt. Der Niederschlag wurde in Laemmli-Puffer aufenommen und ebenfalls analysiert. Der Nachweis des Proteins erfolgte nach SDS-PAGE und Western-Blot mit Hilfe von Antikörpern gegen HA. Das Ergebnis ist in Figur 8 gezeigt. Wie man sieht wird mit Hilfe dieser Konstruktion eine effektive Sekretion des Hydrophobins in das Medium erreicht. In dem entsprechenden Fusionsprotein liegen somit alle für die Sekretion notwendigen Sequenzen des P- Faktor Präproteins in ihrem authentischen Kontext vor. Der P-Faktor selbst wird proteolytisch abgespalten.
Beispiel 5: Mikroskopischer Nachweis der Adsorption von exprimiertem Hydrophobin an Teflon
Für den mikroskopischen Nachweis der Adsorption von exprimiertem Hydrophobin an Teflon wird ein fluoreszenzmarkierter HA-Antikörper (Molecular Probes, Kat.-Nr. A- 21287) verwendet.
Transformierte Wirtszellen, hergestellt nach einem der Beispiele 1 bis 4 werden kultiviert. Zellen und gegebenenfalls Überstand werden getrennt geerntet. Als Referenzprobe dienen Zellen, welche mit einem entsprechenden Vektor ohne Hydrophobingen transformiert und kultiviert wurden, bzw. entsprechende Kulturüberstände.
Die Zellen werden mechanisch aufgeschlosssen (Schwingmühle). Teflonplättchen werden bei Raumtemperatur für 18 h im Zellaufschluss bzw. Überstand inkubiert, mit Wasser gespült (3 x 10 min). Anschließend erfolgt die Inkubation des behandelten Teflons in PBS mit fluoreszenzmarkiertem Antikörper. Dann wird erneut mit PBS (3 x
15 min) gespült und im N2-Strahl getrocknet. Schließlich erfolgt die fluoreszenzmikroskopische Auswertung.
Man beobachtet (Ergebnisse nicht gezeigt) keine Fluoreszenz auf Referenzprobe, da- gegen spotförmige Fluoreszenz nach Inkubation in Zellhomogenat oder Kulturüberstand (bei Sezernierung des Hydrophobins durch die exprimierenden Zellen).
Claims
1. Expressionskonstrukt, umfassend die kodierende Nukleinsäuresequenz für ein von Hefezellen prozessierbares Shuttlepeptidkonstrukt der allgemeinen Formel
(Sig-SP),
enthaltend in 5'-3'-Richtung die kodierenden Nukleinsauresequenzen für a) ein Signalpeptid (Sig), prozessierbar verknüpft mit b) wenigstens einem von den Hefezellen sezemierbaren Shuttlepeptid
(SP).
2. Expressionskonstrukt nach Anspruch 1 , wobei das Shuttlepeptidkonstrukt (Sig-SP) von einem von Hefen der Gattung Schizosaccharomyces, insbeson- dere von S. pombe prozessierten Polypeptid abgeleitet ist.
3. Expressionskonstrukt nach einem der vorhergehenden Ansprüche, wobei das Shuttlepeptidkonstrukt (Sig-SP) von einem Pheromon-Präprotein aus einer Hefe abgeleitet ist, wobei das Pheromon (Pher) durch N- und C-terminale Prozessierung aus dem Präprotein ableitbar und sezernierbar ist.
4. Expressionskonstrukt nach Anspruch 3, wobei das Signalpolypeptid (Sig) das proteolytisch abspaltbare native Signalpolypeptid des Pheromon-Präproteins ist
5. Expressionskonstrukt nach Anspruch 4, wobei das C-terminal prozessierte Pheromon (Pher) eine C-terminale Proteaseschnittstelle umfasst.
6. Expressionskonstrukt nach einem der vorhergehenden Ansprüche, weiterhin enthaltend die kodierende Nukleinsäuresequenz für ein homologes oder he- terologes Zielprotein (Targ), prozessierbar verknüpft mit dem C-Terminus des Shuttlepeptidkonstrukts (Sig-SP).
7. Expressionskonstrukt nach einem der vorhergehenden Ansprüche, umfas- send die kodierende Nukleinsäuresequenz für ein von Hefezellen prozessierbares Fusionsprotein der allgemeinen Formel
Sig-L1n-Pher-L2m-Targ
worin Sig, Pher und Targ wie oben definiert sind,
L1 und L2 für prozessierbare Linker stehen und n und m unabhängig voneinander für 0 oder 1 stehen.
8. Expressionskonstrukt nach einem der vorhergehenden Ansprüche, wobei die kodierende Nukleinsäuresequenz für das Shuttlepeptidkonstrukt (Sig-SP)eine für ein Signalpolypeptid kodierende Sequenz gemäß SEQ ID NO: 3 oder ein funktionales Äquivalent davon, operativ verknüpft mit der für ein reifes Phe- romon-Protein (P-Faktor) kodierenden Nukleinsäuresequenz gemäß SEQ ID NO:5 oder ein funktionales Äquivalent davon umfasst.
9. Expressionskonstrukt nach einem der vorhergehenden Ansprüche, wobei die kodierende Nukleinsäuresequenz für das Shuttlepeptidkonstrukt eine Sequenz gemäß SEQ ID NO:1 umfasst, am 3'-Ende gegebenenfalls verlängert um die kodierende Sequenz für ein Zielprotein (Targ)
10. Expressionskonstrukt nach einem der vorhergehenden Ansprüche, wobei das Zielprotein ein Hydrophobin, insbesondere ein Hydrophobin der Klasse I, ist.
11. Expressionskonstrukt nach Anspruch 10, wobei das Hydrophobin ausgewählt ist unter SEQ ID NO: 14 (DewA), SEQ ID NO:19 (RdIA) SEQ ID NO:20 (RdlB) SEQ ID NO:21 (HYP1) und SEQ ID NO: 22 (HYP4) oder von einer Nukleinsäuresequenz gemäß SEQ ID NO:13 kodiert wird.
12. Expressionsvektor, umfassend in operativer Verknüpfung mit wenigstens einer regulativen Nukleinsäuresequenz ein Expressionskonstrukt nach einem der vorhergehenden Ansprüche.
13. Rekombinanter Mikroorganismus, enthaltend, gegebenenfalls stabil in das Wirtsgenom integriert, wenigstens einen Expressionsvektor nach Anspruch
12 oder ein Expressionskonstrukt nach einem der Ansprüche 1 bis 11.
14. Mikroorganismus nach Anspruch 13, ausgewählt unter Hefen.
15. Mikroorganismus nach Anspruch 14, ausgewählt unter Hefen der Gattung
Schizosaccharomyces, insbesondere S. pombe.
16. Von Hefezellen prozessierbares Shuttlepeptidkonstrukt (Sig-SP), abgeleitet von einem Pheromon-Präprotein aus einer Hefe, wobei das Pheromon durch N- und C-terminale Prozessierung aus dem Präprotein ableitbar und sezer- nierbar ist.
17. Shuttlepeptidkonstrukt nach Anspruch 16, enthaltend ein Signalpolypeptid N- terminai prozessierbar verknüpft mit dem C-terminal prozessierten Pheromonpolypeptid.
18. Shuttlepeptidkonstrukt nach Anspruch 17, wobei das Signalpolypeptid das proteolytisch abspaltbare native Signalpolypeptid des Pheromon-Präproteins ist
19. Shuttlepeptidkonstrukt nach Anspruch 17, wobei das C-terminal prozessierte Pheromonpolypeptid die C-terminale Proteaseschnittstelle umfasst.
20. Shuttlepeptidkonstrukt nach einem der Ansprüche 16 bis 19, umfassend eine
Aminosäuresequenz nach SEQ ID NO:2 oder ein funktionales Äquivalent davon.
21. Verfahren zur rekombinanten Herstellung eines Zielproteins, wobei man ei- nen Mikroorganismus nach einem der Ansprüche 13 bis 15 kultiviert, die das
Zielprotein kodierende Nukleinsäuresequenz exprimiert und das in das Kulturmedium sezernierte Zielprotein isoliert.
22. Verfahren nach Anspruch 21 , wobei das Zielprotein ein Hydrophobin gemäß der Definition in Anspruch 10 oder 1 1 ist.
23. Nukleinsäure, kodierend für ein Shuttlepeptidkonstrukt nach einem der Ansprüche 16 bis 20.
24. Nukleinsäure gemäß der Definition in einem der Ansprüche 1 bis 11.
25. Hydrophobin erhältlich nach einem Verfahren gemäß Anspruch 22.
26. Verwendung eines Hydrophobin nach Anspruch 25 zur Oberflächenbehand- lung.
27. Verwendung nach Anspruch 26, wobei man die Oberfläche von Gegenständen, ausgewählt unter Glas, Fasern, Geweben, Leder, lackierten Gegenständen, Folien und Fassaden behandelt.
8. Verwendung eines Hydrophobins gemäß der Definition in Anspruch 10 oder 11 zur Oberflächenbehandlung von Fasern, Geweben und Leder.
1/9
Fig.1
Konstrukte zur Sekretion der Hydrophobine aus S. pombe
Konstrukt
Signalsequenz authentisches
Hydrophobin HA Protein
P-Faktor Signalpeptid
PDe A
P-Faktor Signalpeptid+ 6 Aminosäuren
P-Faktor Signalpeptid einschließlich P-Faktor
PfakDewA
= postulierte Proteaseschnittstellen 2/9
Fig. 2
A) Genomische Sequenz des DewA-Gens:
(Die Sequenzen der zwei Introns sind unterstrichen)
ATGCGCTTCA TCGTCTCTCT CCTCGCCTTC ACTG-CCGCGG CCACCGCAAC CGCCCTCCCG GCCTCTGCCG CAAAGAACGC GAAGCTGGCC ACCTCGGCGG CCTTCGCCAA GCAGGCTGAA GGCACCACCT GCAATGTCGG CTCGATCGCT TGCTGCAACT CCCCCGCTGA GACCAACAAC GACAGTCTGT TGAGCGGTCT GCTCGGTGCT GGCCTTCTCA ACGGGCTCTC GGGCAACACT GGCAGCGCCT GCGCCAAGGC GAGCTTGATT GACCAGCTGG GTCTGCTCGG TACGTGATCC CCACTCAGTC GCTCCCGGAG AGGCTGAGGG AAGACGAGCG ACGGTCTAGA AATGGTGTGC TAATAGATGC ATGTGTGCAG CTCTCGTCGA CCACACTGAG GAAGGCCCCG TCTGCAAGAA CATCGTCGCT TGCTGCCCTG AGGGAACCAC CAACGTACGT CTTTCAGATC TGCTACAAGT GAGGCGATCA AAACTAACAT ATTCCAGTGT GTTG-CCGTCG ACAACGCTGG CGCCGGTACC AAGGCTGAGT AA
B) Sequenz des DewA-Proteins aus Aspergill s nidulans:
MRFIVSLLAF TAAATATALP ASAAKNAKLA TSAAFAKQAE GTTCNVGSIA CCNSPAETNN DSLLSGLLGA GLLNGLSGNT GSACAKASLI DQLGLLALVD HTEEGPVCKN IVACCPEGTT NCVAVDNAGA GTKAE
(ATGCGCTTCA TCGTCTCTCT CCTCGCCTTC ACTGCCGCGG CCACCGCAAC CGCCCTCCCG
GCCTCTGCCG CAAAGAACGC GAAGCTGGCC ACCTCGGCGG CCTTCGCCAA GCAGGCTGAA
GGCACCACCT GCAATGTCGG CTCGATCGCT TGCTGCAACT CCCCCGCTGA GACCAACAAC
GACAGTCTGT TGAGCGGTCT GCTCGGTGCT GGCCTTCTCA ACGGGCTCTC GGGCAACACT
GGCAGCGCCT GCGCCAAGGC GAGCTTGATT GACCAGCTGG GTCTGCTCGC TCTCGTCGAC
CACACTGAGG AAGGCCCCGT CTGCAAGAAC AT7CGTCGCTT GCTGCCCTGA GGGAACCACC AACTGTGTTG CCGTCGACAA CGCTGGCGCC GGTACCAAGG CTGAGTAA)
C) Sequenz des HA-Tag:
LVPRGSIEGR GGRIFYPYDV PDYAGYPYDV PDYAGSYPYD VPDYAAQCGR
( CTGGT TCCGCGTGGA TCCATCGAAG GTCGTGGCGG CCGCATCTTT TACCCATACG
ATGTTCCTGA CTATGCGGGC TATCCCTATG ACGTCCCGGA CTATGCAGGA TCCTATCCAT ATGACGTTCC AGATTACGCT GCTCAGTGCG GCCGCTAATA G) 3/9
Fϊg.3
A) Sequenz des P-Faktor Präproteins:
MKITAVIALL FSLAAASPIP VADPGWSVS KSYADFLRVY QS NTFANPD RPNLKKREFE
AAPAKTYADF LRAYQS NTF VNPDRPNLKK. RE FEAAPEKS YADFLRAYHS NTFVNPDRP
NLKKREFEAA PAKTYADFLR AYQSWNTFVM PDRPNLKKRT EEDEENEEED EEYYRFLQFY I TVPENSTI TDVNITAKFE S
(ATGAAGATCA CCGCTGTCAT TGCCCTTTTA TTCTCACTTG CTGCTGCCTC ACCTATTCCA
GTTGCCGATC CTGGTGTGGT TTCAGTTAGC AAGTCATATG CTGATTTCCT TCGTGTTTAC
CAAAGTTGGA ACACTTTTGC TAATCCTGAT AGACCCAACT TGAAAAAGCG CGAATTCGAA
GCTGCTCCCG CAAAAACTTA TGCTGATTTC CTTCGTGCTT ATCAAAGTTG GAACACTTTT
GTTAATCCTG ACAGACCCAA TTTGAAAAAG CGTGAGTTTG AAGCTGCCCC AGAGAAGAGT
TATGCTGATT TCCTTCGTGC TTACCATAGT TGGAACACTT TTGTTAATCC TGACAGACCC
AACTTGAAAA AGCGCGAATT CGAAGCTGCT CCCGCAAAAA CTTATGCTGA TTTCCTTCGT
GCTTACCAAA GTTGGAACAC TTTTGTTAAT CCTGACAGAC CCAACTTGAA AAAGCGCACT
GAAGAAGATG AAGAGAATGA GGAAGAGGAT GAAGAATACT ATCGCTTTCT TCAGTTTTAT ATCATGACTG TCCCAGAGAA TTCCACTATT ACAGATGTCA ATATTACTGC CAAATTTGAG AGCTAA)
B) Sequenz des abspaltbaren Signalpeptides und der sich daran anschließenden 6 Aminosäuren des P-Faktor Präproteins:
MKITAVIALL FSLAAASPIP VADPGV
(ATGAAGATCA CCGCTGTCAT TGCCCTTTTA TTCTCACTTG CTGCTGCCTC ACCTATTCCA GTTGCCGATC CTGGTGTG)
C) Genutzte Sequenz zum "P-Shuttle":
MKITAVIALL FSLAAASPIP VADPGWSVS KSYADFLRVY QSWNTFANPD RPNLKKR (ATGAAGATCA CCGCTGTCAT TGCCCTTTTA TTCTCACTTG CTGCTGCCTC ACCTATTCCA
GTTGCCGATC CTGGTGTGGT TTCAGTTAGC AAGTCATATG CTGATTTCCT TCGTGTTTAC CAAAGTTGGA ACACTTTTGC TAATCCTGAT AGACCCAACT TGAAAAAGCG C) Fig. 4
Fusionsprotein bestehend aus der "P-Shuttle"-Sequenz, dem maturen DewA und dem C-terminal fusionierten HA-Tag:
MKITAVIALL FSLAAASPIP VADPGWSVS KSYADFLRVY QSWNTFANPD RPNLKKRLPA
SAAKNAKLAT SAAFAKQAEG TTCNVGSIAC CNSPAETNND SLLSGLLGAG LLNGLSGNTG
SACAKASLID OLGLLALVDH TEEGPVCKNI VACCPEGTTN CVAVDNAGAG TKAELVPRGS
IEGRGGRIFY PYDVPDYAGY PYDVPDYAGS YPYDVPDYAA QCGR
(ATGAAGATCA CCGCTGTCAT TGCCCTTTTA TTCTCACTTG CTGCTGCCTC ACCTATTCCA GTTGCCGATC CTGGTGTGGT TTCAGTTAGC AAGTCATATG CTGATTTCCT TCGTGTTTAC CAAAGTTGGA ACACTTTTGC TAATCCTGAT AGACCCAACT TGAAAAAGCG CCTCCCGGCC TCTGCCGCAA AGAACGCGAA GCTGGCCACC TCGGCGGCCT TCGCCAAGCA GGCTGAAGGC ACCACCTGCA ATGTCGGCTC GATCGCTTGC TGCAACTCCC CCGCTGAGAC CAACAACGAC AGTCTGTTGA GCGGTCTGCT CGGTGCTGGC CTTCTCAACG GGCTCTCGGG CAACACTGGC AGCGCCTGCG CCAAGGCGAG CTTGATTGAC CAGCTGGGTC TGCTCGCTCT CGTCGACCAC ACTGAGGAAG GCCCCGTCTG CAAGAACATC GTCGCTTGCT GCCCTGAGGG AACCACCAAC TGTGTTGCCG TCGACAACGC TGGCGCCGGT ACCAAGGCTG AGCTGGTTCC GCGTGGATCC ATCGAAGGTC GTGGCGGCCG CATCTTTTAC CCATACGATG TTCCTGACTA TGCGGGCTAT CCCTATGACG TCCCGGACTA TGCAGGATCC TATCCATATG ACGTTCCAGA TTACGCTGCT CAGTGCGGCC GCTAATAG)
7/9
Fig.8
ÜS Pellet
8/9
Fig. 9
A) mfm1+ Gen
Sequenz des mfm1 -Präprotein
MDS ANSVSSSSWNAGNKPAETLNKTVKNYTPKVPYMCVIA
Sequenz des mfm1*-Gens atggactcaa tggctaactc cgtttcttcc tcctctgtcg tcaacgctgg caacaagcct gctgaaactc ttaacaagac cgttaagaat tataccccca aggttcctta catgtgtgtc attgcataa mfml matures M-Pheromon
YTPKVPYMC
DNA-Sequenz des maturen mfml M-Pheromon tataccccca aggttcctta catgtgt
B) mfm2+-Gen
Sequenz des mfm2-Präprotein DSIATNTHSSSIVNAYNNNPTDWKTQNIKNYTPKVPYMCVIA
Sequenz des mfm2+-Gens atggactcca ttgcaactaa cactcattct tcatccattg tcaatgccta caacaacaat cctaccgatg ttgtaaaaac tcaaaacatt aaaaattata ctccaaaggt tccttatatg tgtgtaattg cttaa mfm2 matures M-Pheromon
YTPKVPYMC
DNA-Sequenz des maturen mfm2 M-Pheromon tata ctccaaaggt tccttatatg tgt
C) mfm3+-Gen
Sequenz des mfm3-Präprotein
MDSMANTVSSSWNTGNKPSΞTLNKTVKNYTPKVPYMCVIA
Sequenz des mfm3*-Gens atggactcaa tggctaacac tgtttcttcc tccgtcgtta acactggcaa caagccttct gaaactctta acaagactgt taagaattat acccccaagg ttccttacat gtgtgtcatt gcataa mfm3 matures M-Pheromon
YTPKVPYMC
DNA-Sequenz des maturen mfm3 M-Pheromon tat acccccaagg ttccttacat gtgt 9/9
Fig. 10
Genomische Sequenz des RodA Gens
ATGAAGTTCT CCATTGCTGC CGCTGTCGTT GCTTTCGCCG CCTCCGTCGC GGCCCTCCCT CCTGCCCATG ATTCCCAGTT CGCTGGCAAT GGTGTTGGCA ACAAGGGCAA CAGCAACGTC AAGTTCCCTG TCCCCGAAAA CGTGACCGTC AAGCAGGCCT CCGACAAGTG CGGTGACCAG GCCCAGCTCT CTTGCTGCAA CAAGGCCACG TACGCCGGTG ACACCACAAC CGTTGATGAG GGTCTTCTGT CTGGTGCCCT CAGCGGCCTC ATCGGCGCCG GGTCTGGTGC CGAAGGTCTT GGTCTCTTCG ATCAGTGCTC CAAGCTTGAT GTTGCTGGTC AGTTCTTCGA AAATCACTTT CGTGATGCCC CAATGCTAAC AATTACCA.GT CCTCATTGGC ATCCAAGATC TTGTCAACCA
GAAGTGCAAG CAAAACATTG CCTGCTGCCA GAACTCCCCC TCCAGCGCGG TATGTTCCCT TGTTTTACAG CTTATTCACT TAAACCGATT AATCTAACAA CGCTCACA.GG ATGGCAACCT TATTGGTGTC GGTCTCCCTT
GCGTTGCCCT TGGCTCCATC CTCTAA
DNA-Sequenz des offenen Leserahmens (ORF) des RodA -Gens
ATGAAGTTCT CCATTGCTGC CGCTGTCGTT GCTTTCGCCG CCTCCGTCGC GGCCCTCCCT CCTGCCCATG
ATTCCCAGTT CGCTGGCAAT GGTGTTGGCA ACAAGGGCAA CAGCAACGTC AAGTTCCCTG TCCCCGAAAA
CGTGACCGTC AAGCAGGCCT CCGACAAGTG CGGTGACCAG GCCCAGCTCT CTTGCTGCAA CAAGGCCACG
TACGCCGGTG ACACCACAAC CGTTGATGAG GGTCTTCTGT CTGGTGCCCT CAGCGGCCTC ATCGGCGCCG
GGTCTGGTGC CGAAGGTCTT GGTCTCTTCG ATCAGTGCTC CAAGCTTGAT GTTGCTGTCC TCATTGGCAT
CCAAGATCTT GTCAACCAGA AGTGCAAGCA AAACATTGCC TGCTGCCAGA ACTCCCCCTC CAGCGCGGAT GGCAACCTTA TTGGTGTCGG TCTCCCTTGC GTTGCCCTTG GCTCCATCCT CTAA
Sequenz des RodA-Proteins
MKFSIAAAW AFAASVAALP PAHDSQFAGN GVGNKGNSNV KPPVPENVTV KQASDKCGDQ AQLSCCNKAT YAGDTTTVDE GLLSGALSGL IGAGSGAEGL GLFDQCSKLD VAVLIGIQDL VNQKCKQNIA CCQNSPSSAD GNLIGVGLPC VALGSIL
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DE10342794A DE10342794A1 (de) | 2003-09-16 | 2003-09-16 | Sekretion von Proteinen aus Hefen |
| PCT/EP2004/010346 WO2005033316A2 (de) | 2003-09-16 | 2004-09-15 | Sekretion von proteinen aus hefen |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1664306A2 true EP1664306A2 (de) | 2006-06-07 |
Family
ID=34352870
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP04765253A Withdrawn EP1664306A2 (de) | 2003-09-16 | 2004-09-15 | Sekretion von proteinen aus hefen |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20070077619A1 (de) |
| EP (1) | EP1664306A2 (de) |
| JP (1) | JP2007505602A (de) |
| CN (1) | CN1852983A (de) |
| CA (1) | CA2537492A1 (de) |
| DE (1) | DE10342794A1 (de) |
| WO (1) | WO2005033316A2 (de) |
Families Citing this family (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| TW200639179A (en) * | 2005-02-07 | 2006-11-16 | Basf Ag | Method for coating surfaces with hydrophobins |
| JP5250264B2 (ja) * | 2005-02-07 | 2013-07-31 | ビーエーエスエフ ソシエタス・ヨーロピア | 新規ハイドロフォビン融合タンパク質、その製造および使用 |
| JP4964227B2 (ja) * | 2005-03-30 | 2012-06-27 | ビーエーエスエフ ソシエタス・ヨーロピア | 硬化無機物建材、自然石、人造石、及びセラミックの表面処理用のハイドロフォビンの使用方法 |
| MX2007012023A (es) * | 2005-03-30 | 2007-11-16 | Basf Ag | Uso de hidrofobina para tratamiento repelente a suciedad de superficies duras. |
| JP4772110B2 (ja) | 2005-03-31 | 2011-09-14 | ビーエーエスエフ ソシエタス・ヨーロピア | 接着促進剤としてのポリペプチド使用方法 |
| BRPI0608681A2 (pt) | 2005-04-01 | 2010-12-07 | Basf Ag | uso de pelo menos uma hidrofobina, processo para estabilizar fases lìquidas em uma composição compreendendo pelo menos duas fases lìquidas, e, formulação |
| US7799741B2 (en) | 2005-04-01 | 2010-09-21 | Basf Se | Drilling mud containing hydrophobin |
| US20090117796A1 (en) * | 2005-06-06 | 2009-05-07 | Basf Aktiengesellschaft | Method for coating fibre substrate surfaces |
| DE102005027139A1 (de) | 2005-06-10 | 2006-12-28 | Basf Ag | Neue Cystein-verarmte Hydrophobinfusionsproteine, deren Herstellung und Verwendung |
| DE102005027039A1 (de) * | 2005-06-10 | 2006-12-21 | Basf Ag | Hydrophobin als Beschichtungsmittel für expandierbare oder expandierte, thermoplastische Polymerpartikel |
| DE102005029704A1 (de) * | 2005-06-24 | 2007-01-11 | Basf Ag | Verwendung von Hydrophobin-Polypeptiden sowie Konjugaten aus Hydrophobin-Polypeptiden mit Wirk-oder Effektstoffen und ihre Herstellung sowie deren Einsatz in der Kosmetik |
| US20080227154A1 (en) * | 2005-07-29 | 2008-09-18 | Soren Kjaerulff | Protein Expression |
| ES2352970T3 (es) * | 2005-08-01 | 2011-02-24 | Basf Se | Empleo de proteínas no enzimáticas superficialmente activas para el lavado de textiles. |
| DE102005048720A1 (de) * | 2005-10-12 | 2007-04-19 | Basf Ag | Verwendung von Proteinen als Antischaum-Komponente in Kraftstoffen |
| CN101501432B (zh) * | 2006-08-15 | 2011-10-12 | 巴斯夫欧洲公司 | 制备干燥的自由流动的疏水蛋白制剂的方法 |
| US8455107B2 (en) | 2007-03-12 | 2013-06-04 | Basf Se | Method of treating cellulosic materials with hydrophobins |
| US20110126143A1 (en) * | 2009-11-24 | 2011-05-26 | Williams Michael D | System and method for interfacing fitness equipment and physiological monitoring |
| WO2012004255A1 (de) * | 2010-07-07 | 2012-01-12 | Basf Se | Zusammensetzung enthaltend ein hydrophobin und verfahren zum reinigen von hydrophoben oberflächen |
| US20130219559A1 (en) | 2012-02-22 | 2013-08-22 | Kimmo Koivu | Method for hydrophobin production in plants and methods to produce hydrophobin multimers in plants and microbes |
| EA202192575A1 (ru) | 2019-03-21 | 2022-01-14 | Онксео | Соединения dbait в сочетании с ингибиторами киназ для лечения рака |
| CN114761006A (zh) | 2019-11-08 | 2022-07-15 | Inserm(法国国家健康医学研究院) | 对激酶抑制剂产生耐药性的癌症的治疗方法 |
| KR102559048B1 (ko) * | 2019-12-02 | 2023-07-26 | 주식회사 엘지화학 | Cho 세포 유래 단백질 분비 인자 및 이를 포함하는 발현 벡터 |
| WO2021148581A1 (en) | 2020-01-22 | 2021-07-29 | Onxeo | Novel dbait molecule and its use |
| KR102466926B1 (ko) * | 2020-05-20 | 2022-11-14 | 전남대학교산학협력단 | 하이드로포빈의 가용성 발현 방법 및 정제 방법 |
| CN115701464B (zh) * | 2021-08-02 | 2024-06-11 | 江苏金太阳纺织科技股份有限公司 | 超疏水整理剂及其制备方法与应用 |
Family Cites Families (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IT1196484B (it) * | 1986-07-11 | 1988-11-16 | Sclavo Spa | Vettore ad espressione e secrezione in lieviti,utile per la preparazione di proteine eterologhe |
| US5010182A (en) * | 1987-07-28 | 1991-04-23 | Chiron Corporation | DNA constructs containing a Kluyveromyces alpha factor leader sequence for directing secretion of heterologous polypeptides |
| JP3508157B2 (ja) * | 1993-05-19 | 2004-03-22 | 旭硝子株式会社 | 分裂酵母接合フェロモン前駆体遺伝子 |
| GB2315347B (en) * | 1993-08-23 | 1998-04-01 | Advanced Risc Mach Ltd | Testing integrated circuits |
| EP0662515B1 (de) * | 1993-12-10 | 2000-11-15 | Korea Institute Of Science And Technology | Signalsequenzen für die Secretion heterologer Proteine von Hefe |
| DE69636536T2 (de) * | 1995-02-03 | 2007-10-25 | Asahi Glass Co., Ltd. | Sekretionssignal-Gen und dieses enthaltender Expressionsvektor |
| AU5914196A (en) * | 1995-06-12 | 1997-01-09 | Proefstation Voor De Champignoncultuur | Hydrophobins from edible fungi, genes, nucleotide sequences and dna-fragments encoding for said hydrophobins, and expression thereof |
| EP1935901A1 (de) * | 1996-12-13 | 2008-06-25 | Novartis Vaccines and Diagnostics, Inc. | Analyse und Trennung von PDGF-Proteinen |
| EP1223219A3 (de) * | 1997-10-31 | 2002-10-23 | Asahi Glass Company Ltd. | Induzierbarer Promoter und Sekretionssignal zur Verwendung in Schizosaccharomyces pombe, Expressionsvektor diese enthaltend und ihre Verwendungen |
| AU2001292574A1 (en) * | 2000-09-06 | 2002-03-22 | Zymogenetics Inc. | Human phermone polypeptide |
| GB0030038D0 (en) * | 2000-12-08 | 2001-01-24 | Univ Warwick | Yeast-based assay |
| FR2833490B1 (fr) * | 2001-12-14 | 2004-12-10 | Oreal | Utilisition cosmetique d'au moins une hydrophobine pour le traitement des matieres keratiniques et compositions mises en oeuvre |
-
2003
- 2003-09-16 DE DE10342794A patent/DE10342794A1/de not_active Withdrawn
-
2004
- 2004-09-15 WO PCT/EP2004/010346 patent/WO2005033316A2/de not_active Ceased
- 2004-09-15 EP EP04765253A patent/EP1664306A2/de not_active Withdrawn
- 2004-09-15 JP JP2006525798A patent/JP2007505602A/ja not_active Withdrawn
- 2004-09-15 CA CA002537492A patent/CA2537492A1/en not_active Abandoned
- 2004-09-15 US US10/572,189 patent/US20070077619A1/en not_active Abandoned
- 2004-09-15 CN CNA2004800265223A patent/CN1852983A/zh active Pending
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2005033316A2 * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2005033316A3 (de) | 2005-10-06 |
| US20070077619A1 (en) | 2007-04-05 |
| CN1852983A (zh) | 2006-10-25 |
| CA2537492A1 (en) | 2005-04-14 |
| DE10342794A1 (de) | 2005-04-21 |
| WO2005033316A2 (de) | 2005-04-14 |
| JP2007505602A (ja) | 2007-03-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP1664306A2 (de) | Sekretion von proteinen aus hefen | |
| DE3885728T2 (de) | Verbesserung der Expression und Sekretion heterologener Proteine in Hefe mittels trunkierter Sequenzen des Alpha-Faktor-Leaders. | |
| DE69822142T2 (de) | Transformation von schimmeln durch agrobacterium, insbesondere von der gattung aspergillus | |
| DE69428719T2 (de) | Für das yap3 signalpeptid kodierendes dna-konstrukt | |
| DE3486491T2 (de) | Hybrid-DNS-Synthesis von reifen insulinähnlichen Wachstumsfaktoren | |
| DE4226971C2 (de) | Modifizierte Pilzzellen und Verfahren zur Herstellung rekombinanter Produkte | |
| DE68922932T2 (de) | Hohe Expression von Proteinen in Hefe. | |
| DE68923123T2 (de) | Herstellung von Proteinen. | |
| DD218118A5 (de) | Verfahren zur herstellung eines hefe- oder nichthefepolypeptids | |
| EP0751995B1 (de) | Riboflavin-biosynthesis in fungi | |
| DE69133066T2 (de) | Verfahren zur Expression heterologischer Gene in der Hefe Pichia Pastoris, Expressionsverfahren und transformierte Mikroorganismen | |
| DD269397A5 (de) | Verfahren zum Herstellen von transformierten Yarrowia Lipolytica | |
| DD267739A5 (de) | Verfahren zur Herstellung eines zu Hefe heterologen Poly-Peptids | |
| DE69805627T2 (de) | Verbesserte stämme für die protein-expression | |
| DD283838A5 (de) | Verfahren zur herstellung eines polypeptids | |
| DE69734449T2 (de) | Alpha-amylase Transkriptionsfaktor | |
| DE69432336T2 (de) | Schimmel-Protease | |
| DE69333249T2 (de) | Neue Schimmel-Protease | |
| DE69735242T2 (de) | N-terminal verlängerte proteine exprimiert in hefe | |
| DE3689918T2 (de) | Verfahren zur Verwendung von BAR1 für die Fremdproteinsekretion. | |
| DE69027970T2 (de) | Hefe-Promoter | |
| DE3782560T2 (de) | Hefestaemme zur expression fremder gene. | |
| DE68907166T2 (de) | Verfahren zur Herstellung von menschlichem Lysozym. | |
| DE69634757T2 (de) | Vektor zur expression von n-terminal verlängerten proteinen in hefezellen | |
| DE69333304T2 (de) | Erhöhte produktion von sekretierten proteinen durch rekombinante eukaryotische zellen |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20060418 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PL PT RO SE SI SK TR |
|
| 17Q | First examination report despatched |
Effective date: 20061025 |
|
| DAX | Request for extension of the european patent (deleted) | ||
| 17Q | First examination report despatched |
Effective date: 20061025 |
|
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: BASF SE |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20071107 |