DE69721833T2 - Verwendung von sibutramine analogen zur senkung des fettspiegels - Google Patents
Verwendung von sibutramine analogen zur senkung des fettspiegelsInfo
- Publication number
- DE69721833T2 DE69721833T2 DE69721833T DE69721833T DE69721833T2 DE 69721833 T2 DE69721833 T2 DE 69721833T2 DE 69721833 T DE69721833 T DE 69721833T DE 69721833 T DE69721833 T DE 69721833T DE 69721833 T2 DE69721833 T2 DE 69721833T2
- Authority
- DE
- Germany
- Prior art keywords
- compound
- formula
- sibutramine
- enantiomers
- pharmaceutically acceptable
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Lifetime
Links
- UNAANXDKBXWMLN-UHFFFAOYSA-N sibutramine Chemical class C=1C=C(Cl)C=CC=1C1(C(N(C)C)CC(C)C)CCC1 UNAANXDKBXWMLN-UHFFFAOYSA-N 0.000 title description 15
- 150000001875 compounds Chemical class 0.000 claims abstract description 54
- 150000003839 salts Chemical class 0.000 claims abstract description 17
- 150000002632 lipids Chemical class 0.000 claims abstract description 14
- 208000031226 Hyperlipidaemia Diseases 0.000 claims abstract description 8
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims abstract description 6
- 208000035150 Hypercholesterolemia Diseases 0.000 claims abstract description 5
- 208000006575 hypertriglyceridemia Diseases 0.000 claims abstract description 5
- UWAOJIWUVCMBAZ-UHFFFAOYSA-N [1-[1-(4-chlorophenyl)cyclobutyl]-3-methylbutyl]-dimethylazanium;chloride Chemical compound Cl.C=1C=C(Cl)C=CC=1C1(C(N(C)C)CC(C)C)CCC1 UWAOJIWUVCMBAZ-UHFFFAOYSA-N 0.000 claims abstract description 3
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 claims description 11
- 208000029078 coronary artery disease Diseases 0.000 claims description 9
- 238000011282 treatment Methods 0.000 claims description 9
- 238000004519 manufacturing process Methods 0.000 claims description 8
- 239000003814 drug Substances 0.000 claims description 7
- 201000001320 Atherosclerosis Diseases 0.000 claims description 5
- 238000011321 prophylaxis Methods 0.000 claims description 4
- 241000282412 Homo Species 0.000 claims description 3
- -1 N,N-dimethyl-1-[1-(4-chlorophenyl)cyclobutyl]-3-methylbutylbutylamine hydroride monohydrate Chemical class 0.000 claims description 2
- 108010023302 HDL Cholesterol Proteins 0.000 claims 1
- 108010028554 LDL Cholesterol Proteins 0.000 claims 1
- 229940126601 medicinal product Drugs 0.000 claims 1
- 238000008214 LDL Cholesterol Methods 0.000 abstract description 6
- 150000004682 monohydrates Chemical class 0.000 abstract description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 38
- 108010010234 HDL Lipoproteins Proteins 0.000 description 14
- 102000015779 HDL Lipoproteins Human genes 0.000 description 14
- 239000000203 mixture Substances 0.000 description 14
- KFNNPQDSPLWLCX-UHFFFAOYSA-N 1-[1-(4-chlorophenyl)cyclobutyl]-n,n,3-trimethylbutan-1-amine;hydron;chloride;hydrate Chemical compound O.Cl.C=1C=C(Cl)C=CC=1C1(C(N(C)C)CC(C)C)CCC1 KFNNPQDSPLWLCX-UHFFFAOYSA-N 0.000 description 13
- 235000012000 cholesterol Nutrition 0.000 description 13
- 229940068196 placebo Drugs 0.000 description 12
- 239000000902 placebo Substances 0.000 description 12
- 229960005303 sibutramine hydrochloride monohydrate Drugs 0.000 description 12
- UFTFJSFQGQCHQW-UHFFFAOYSA-N triformin Chemical compound O=COCC(OC=O)COC=O UFTFJSFQGQCHQW-UHFFFAOYSA-N 0.000 description 10
- 108010007622 LDL Lipoproteins Proteins 0.000 description 9
- 102000007330 LDL Lipoproteins Human genes 0.000 description 9
- 238000000034 method Methods 0.000 description 7
- 229960004425 sibutramine Drugs 0.000 description 7
- 239000003826 tablet Substances 0.000 description 6
- 239000002552 dosage form Substances 0.000 description 5
- 238000010197 meta-analysis Methods 0.000 description 5
- 239000002775 capsule Substances 0.000 description 4
- 239000008187 granular material Substances 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 239000000546 pharmaceutical excipient Substances 0.000 description 4
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 206010048214 Xanthoma Diseases 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 210000000214 mouth Anatomy 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 230000004580 weight loss Effects 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 2
- 108010046315 IDL Lipoproteins Proteins 0.000 description 2
- 208000008589 Obesity Diseases 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric Acid Chemical class [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 2
- 108010062497 VLDL Lipoproteins Proteins 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 239000000443 aerosol Substances 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 239000007900 aqueous suspension Substances 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000002425 crystallisation Methods 0.000 description 2
- 230000008025 crystallization Effects 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 239000007884 disintegrant Substances 0.000 description 2
- 239000002702 enteric coating Substances 0.000 description 2
- 238000009505 enteric coating Methods 0.000 description 2
- 150000003840 hydrochlorides Chemical class 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 238000004811 liquid chromatography Methods 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 235000020824 obesity Nutrition 0.000 description 2
- 235000019271 petrolatum Nutrition 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 239000012730 sustained-release form Substances 0.000 description 2
- 239000012049 topical pharmaceutical composition Substances 0.000 description 2
- WQSACWZKKZPCHN-UHFFFAOYSA-N 1-[1-(4-chlorophenyl)cyclobutyl]-3-methylbutan-1-amine Chemical compound C=1C=C(Cl)C=CC=1C1(C(N)CC(C)C)CCC1 WQSACWZKKZPCHN-UHFFFAOYSA-N 0.000 description 1
- PLXKZKLXYHLWHR-UHFFFAOYSA-N 1-[1-(4-chlorophenyl)cyclobutyl]-n,3-dimethylbutan-1-amine Chemical compound C=1C=C(Cl)C=CC=1C1(C(CC(C)C)NC)CCC1 PLXKZKLXYHLWHR-UHFFFAOYSA-N 0.000 description 1
- QCQCHGYLTSGIGX-GHXANHINSA-N 4-[[(3ar,5ar,5br,7ar,9s,11ar,11br,13as)-5a,5b,8,8,11a-pentamethyl-3a-[(5-methylpyridine-3-carbonyl)amino]-2-oxo-1-propan-2-yl-4,5,6,7,7a,9,10,11,11b,12,13,13a-dodecahydro-3h-cyclopenta[a]chrysen-9-yl]oxy]-2,2-dimethyl-4-oxobutanoic acid Chemical compound N([C@@]12CC[C@@]3(C)[C@]4(C)CC[C@H]5C(C)(C)[C@@H](OC(=O)CC(C)(C)C(O)=O)CC[C@]5(C)[C@H]4CC[C@@H]3C1=C(C(C2)=O)C(C)C)C(=O)C1=CN=CC(C)=C1 QCQCHGYLTSGIGX-GHXANHINSA-N 0.000 description 1
- 206010002383 Angina Pectoris Diseases 0.000 description 1
- 235000003911 Arachis Nutrition 0.000 description 1
- 244000105624 Arachis hypogaea Species 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 229920000623 Cellulose acetate phthalate Polymers 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 208000020401 Depressive disease Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 208000002705 Glucose Intolerance Diseases 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical class Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 206010033645 Pancreatitis Diseases 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- 208000018262 Peripheral vascular disease Diseases 0.000 description 1
- 239000004264 Petrolatum Substances 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 240000006394 Sorghum bicolor Species 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 239000012042 active reagent Substances 0.000 description 1
- 235000001014 amino acid Nutrition 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 230000000489 anti-atherogenic effect Effects 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 238000011914 asymmetric synthesis Methods 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- 235000013871 bee wax Nutrition 0.000 description 1
- 239000012166 beeswax Substances 0.000 description 1
- 150000001558 benzoic acid derivatives Chemical class 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 230000003925 brain function Effects 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-N carbonic acid Chemical class OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 239000003054 catalyst Substances 0.000 description 1
- 229940081734 cellulose acetate phthalate Drugs 0.000 description 1
- 150000005829 chemical entities Chemical class 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 150000001860 citric acid derivatives Chemical class 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 125000001995 cyclobutyl group Chemical group [H]C1([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- POULHZVOKOAJMA-UHFFFAOYSA-N dodecanoic acid Chemical class CCCCCCCCCCCC(O)=O POULHZVOKOAJMA-UHFFFAOYSA-N 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000012458 free base Substances 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-L fumarate(2-) Chemical class [O-]C(=O)\C=C\C([O-])=O VZCYOOQTPOCHFL-OWOJBTEDSA-L 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 238000001030 gas--liquid chromatography Methods 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 208000016361 genetic disease Diseases 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- DKAGJZJALZXOOV-UHFFFAOYSA-N hydrate;hydrochloride Chemical compound O.Cl DKAGJZJALZXOOV-UHFFFAOYSA-N 0.000 description 1
- 150000004677 hydrates Chemical class 0.000 description 1
- 229920003132 hydroxypropyl methylcellulose phthalate Polymers 0.000 description 1
- 229940031704 hydroxypropyl methylcellulose phthalate Drugs 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 108010022197 lipoprotein cholesterol Proteins 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 150000002688 maleic acid derivatives Chemical class 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-M methanesulfonate group Chemical class CS(=O)(=O)[O-] AFVFQIVMOAPDHO-UHFFFAOYSA-M 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 210000003928 nasal cavity Anatomy 0.000 description 1
- 150000002823 nitrates Chemical class 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 239000012053 oil suspension Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 239000003883 ointment base Substances 0.000 description 1
- 239000006186 oral dosage form Substances 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 235000019809 paraffin wax Nutrition 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 229940066842 petrolatum Drugs 0.000 description 1
- 239000002831 pharmacologic agent Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 201000009104 prediabetes syndrome Diseases 0.000 description 1
- 230000000207 pro-atherogenic effect Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 238000000611 regression analysis Methods 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000012453 solvate Substances 0.000 description 1
- 239000008174 sterile solution Substances 0.000 description 1
- 208000023516 stroke disease Diseases 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 150000003890 succinate salts Chemical class 0.000 description 1
- 150000003467 sulfuric acid derivatives Chemical class 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 229920003002 synthetic resin Polymers 0.000 description 1
- 239000000057 synthetic resin Substances 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 150000003892 tartrate salts Chemical class 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 235000020852 very low calorie diet Nutrition 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
- A61K31/135—Amines having aromatic rings, e.g. ketamine, nortriptyline
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
Landscapes
- Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Diabetes (AREA)
- General Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Epidemiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Cardiology (AREA)
- Vascular Medicine (AREA)
- Emergency Medicine (AREA)
- Endocrinology (AREA)
- Urology & Nephrology (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Materials For Medical Uses (AREA)
- Fats And Perfumes (AREA)
- Heterocyclic Carbon Compounds Containing A Hetero Ring Having Nitrogen And Oxygen As The Only Ring Hetero Atoms (AREA)
- Oscillators With Electromechanical Resonators (AREA)
- Magnetic Resonance Imaging Apparatus (AREA)
- Analogue/Digital Conversion (AREA)
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB9619961.7A GB9619961D0 (en) | 1996-09-25 | 1996-09-25 | Medical treatment |
| PCT/EP1997/005040 WO1998013034A1 (en) | 1996-09-25 | 1997-09-15 | Use of sibutramine analogues to lower lipid levels |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| DE69721833D1 DE69721833D1 (de) | 2003-06-12 |
| DE69721833T2 true DE69721833T2 (de) | 2003-12-24 |
Family
ID=10800447
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DE69721833T Expired - Lifetime DE69721833T2 (de) | 1996-09-25 | 1997-09-15 | Verwendung von sibutramine analogen zur senkung des fettspiegels |
Country Status (26)
| Country | Link |
|---|---|
| US (1) | US6187820B1 (https=) |
| EP (1) | EP0973511B1 (https=) |
| JP (1) | JP4143126B2 (https=) |
| KR (1) | KR100573333B1 (https=) |
| CN (1) | CN1173696C (https=) |
| AT (1) | ATE239459T1 (https=) |
| AU (1) | AU724645B2 (https=) |
| BG (1) | BG64472B1 (https=) |
| BR (1) | BR9711411A (https=) |
| CA (1) | CA2266378C (https=) |
| CZ (1) | CZ291879B6 (https=) |
| DE (1) | DE69721833T2 (https=) |
| DK (1) | DK0973511T3 (https=) |
| ES (1) | ES2199354T3 (https=) |
| GB (1) | GB9619961D0 (https=) |
| HU (1) | HU224711B1 (https=) |
| IL (1) | IL128820A (https=) |
| NO (1) | NO991424D0 (https=) |
| NZ (1) | NZ334550A (https=) |
| PL (1) | PL190017B1 (https=) |
| PT (1) | PT973511E (https=) |
| RU (1) | RU2197959C2 (https=) |
| SK (1) | SK284282B6 (https=) |
| TR (1) | TR199900648T2 (https=) |
| UA (1) | UA63916C2 (https=) |
| WO (1) | WO1998013034A1 (https=) |
Families Citing this family (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6974838B2 (en) | 1998-08-24 | 2005-12-13 | Sepracor Inc. | Methods of treating or preventing pain using sibutramine metabolites |
| US6476078B2 (en) | 1999-08-11 | 2002-11-05 | Sepracor, Inc. | Methods of using sibutramine metabolites in combination with a phosphodiesterase inhibitor to treat sexual dysfunction |
| AU2007200334B8 (en) * | 1998-08-24 | 2010-10-21 | Sepracor, Inc. | Methods of using and compositions comprising dopamine reuptake inhibitors |
| US6339106B1 (en) | 1999-08-11 | 2002-01-15 | Sepracor, Inc. | Methods and compositions for the treatment and prevention of sexual dysfunction |
| US6331571B1 (en) | 1998-08-24 | 2001-12-18 | Sepracor, Inc. | Methods of treating and preventing attention deficit disorders |
| US6046242A (en) * | 1998-11-27 | 2000-04-04 | Basf Aktiengesellschaft | Use of aryl-substituted cyclobutylalkylamines for treating urinary incontinence |
| US6696495B2 (en) | 1998-12-02 | 2004-02-24 | Snowden Pharmaceuticals, Llc | Treatment of disorders secondary to organic impairments |
| US6323242B1 (en) | 1998-12-02 | 2001-11-27 | Peter Sterling Mueller | Treatment of disorders secondary to organic impairments |
| US6552087B1 (en) | 1999-03-19 | 2003-04-22 | Abbott Gmbh & Co. Kg | Therapeutic agent comprising (+)-sibutramine |
| AU3894500A (en) * | 1999-03-19 | 2000-10-09 | Knoll Pharmaceutical Company | Prevention of cardiovascular disease |
| US6399826B1 (en) | 1999-08-11 | 2002-06-04 | Sepracor Inc. | Salts of sibutramine metabolites, methods of making sibutramine metabolites and intermediates useful in the same, and methods of treating pain |
| FR2814678B1 (fr) * | 2000-10-04 | 2002-12-20 | Aventis Pharma Sa | Association d'un antagoniste du recepteur cb1 et de sibutramine, les compositions pharmaceutiques les contenant et leur utilisation pour la traitement de l'obesite |
| US6610887B2 (en) | 2001-04-13 | 2003-08-26 | Sepracor Inc. | Methods of preparing didesmethylsibutramine and other sibutramine derivatives |
| JP4278652B2 (ja) * | 2002-10-05 | 2009-06-17 | ハンミ ファーム. シーオー., エルティーディー. | 結晶性シブトラミンメタンスルホン酸塩半水和物を含む医薬組成物 |
| EP1622600A1 (en) * | 2003-04-28 | 2006-02-08 | Cipla Ltd. | Pharmaceutical formulation comprising anti-obesity agent and acidulant |
| US20050032908A1 (en) * | 2003-08-04 | 2005-02-10 | Beckman Kristen M. | Methods for treating metabolic syndrome |
| US20050131074A1 (en) * | 2003-08-04 | 2005-06-16 | Beckman Kristen M. | Methods for treating metabolic syndrome |
| KR100618176B1 (ko) | 2004-12-02 | 2006-09-01 | 휴먼팜 주식회사 | 시부트라민 주석산염, 이의 제조 방법 및 이를 포함하는약학적 조성물 |
| KR20060080817A (ko) | 2005-01-06 | 2006-07-11 | 씨제이 주식회사 | 시부트라민의 디카복실산염 |
| WO2006073292A1 (en) * | 2005-01-06 | 2006-07-13 | Cj Corporation | Inorganic acid salts of sibutramine |
| KR20060080818A (ko) * | 2005-01-06 | 2006-07-11 | 씨제이 주식회사 | 시부트라민의 술폰산염 |
| KR20060093564A (ko) * | 2005-02-22 | 2006-08-25 | 종근당바이오 주식회사 | 무수 시부트라민 말산염 및 이의 제조 방법 |
| KR100627687B1 (ko) * | 2005-04-20 | 2006-09-25 | 주식회사 씨티씨바이오 | 시부트라민 유리염기 함유 조성물 및 이의 제조방법 |
| KR100814384B1 (ko) * | 2006-02-10 | 2008-03-18 | 대화제약 주식회사 | 시부트라민 염을 함유하는 약학 조성물 및 이의 제조방법 |
| WO2008034142A2 (en) | 2006-09-15 | 2008-03-20 | Reviva Pharmaceuticals, Inc. | Synthesis, methods of using, and compositions of cycloalkylmethylamines |
| US8604244B2 (en) | 2010-07-02 | 2013-12-10 | Reviva Pharmaceuticals, Inc. | Compositions, synthesis, and methods of using cycloalkylmethylamine derivatives |
| KR20080046601A (ko) * | 2006-11-22 | 2008-05-27 | 에스케이케미칼주식회사 | 보관안정성이 우수한 시부트라민 함유 포접복합체 |
| WO2010082216A2 (en) * | 2008-12-08 | 2010-07-22 | Matrix Laboratories Ltd | Novel salts of sibutramine and their crystal forms |
| RU2642074C2 (ru) | 2011-12-30 | 2018-01-24 | Ревива Фармасьютикалс, Инк. | Композиции, синтез и способы применения производных фенилциклоалкилметиламина |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IE52768B1 (en) | 1981-04-06 | 1988-02-17 | Boots Co Ltd | 1-arylcyclobutylalkylamine compounds useful as therapeutic agents |
| GB8531071D0 (en) * | 1985-12-17 | 1986-01-29 | Boots Co Plc | Therapeutic compound |
| GB8704777D0 (en) * | 1987-02-28 | 1987-04-01 | Boots Co Plc | Medical treatment |
| JP2675573B2 (ja) * | 1988-03-31 | 1997-11-12 | 科研製薬株式会社 | 脳機能改善剤 |
| IE61928B1 (en) * | 1988-11-29 | 1994-11-30 | Boots Co Plc | Treatment of obesity |
| US5459164A (en) * | 1994-02-03 | 1995-10-17 | Boots Pharmaceuticals, Inc. | Medical treatment |
-
1996
- 1996-09-25 GB GBGB9619961.7A patent/GB9619961D0/en active Pending
-
1997
- 1997-09-15 SK SK320-99A patent/SK284282B6/sk unknown
- 1997-09-15 DE DE69721833T patent/DE69721833T2/de not_active Expired - Lifetime
- 1997-09-15 CZ CZ1999932A patent/CZ291879B6/cs not_active IP Right Cessation
- 1997-09-15 CA CA002266378A patent/CA2266378C/en not_active Expired - Fee Related
- 1997-09-15 RU RU99108731/14A patent/RU2197959C2/ru active
- 1997-09-15 TR TR1999/00648T patent/TR199900648T2/xx unknown
- 1997-09-15 ES ES97910289T patent/ES2199354T3/es not_active Expired - Lifetime
- 1997-09-15 JP JP51521998A patent/JP4143126B2/ja not_active Expired - Fee Related
- 1997-09-15 CN CNB971982341A patent/CN1173696C/zh not_active Expired - Fee Related
- 1997-09-15 PL PL97332367A patent/PL190017B1/pl not_active IP Right Cessation
- 1997-09-15 AU AU47741/97A patent/AU724645B2/en not_active Ceased
- 1997-09-15 US US09/269,340 patent/US6187820B1/en not_active Expired - Lifetime
- 1997-09-15 EP EP97910289A patent/EP0973511B1/en not_active Expired - Lifetime
- 1997-09-15 IL IL12882097A patent/IL128820A/en not_active IP Right Cessation
- 1997-09-15 NZ NZ334550A patent/NZ334550A/xx not_active IP Right Cessation
- 1997-09-15 KR KR1019997002490A patent/KR100573333B1/ko not_active Expired - Fee Related
- 1997-09-15 UA UA99042290A patent/UA63916C2/uk unknown
- 1997-09-15 WO PCT/EP1997/005040 patent/WO1998013034A1/en not_active Ceased
- 1997-09-15 HU HU9903823A patent/HU224711B1/hu active IP Right Grant
- 1997-09-15 DK DK97910289T patent/DK0973511T3/da active
- 1997-09-15 BR BR9711411A patent/BR9711411A/pt not_active IP Right Cessation
- 1997-09-15 AT AT97910289T patent/ATE239459T1/de not_active IP Right Cessation
- 1997-09-15 PT PT97910289T patent/PT973511E/pt unknown
-
1999
- 1999-03-15 BG BG103249A patent/BG64472B1/bg unknown
- 1999-03-24 NO NO991424A patent/NO991424D0/no not_active Application Discontinuation
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DE69721833T2 (de) | Verwendung von sibutramine analogen zur senkung des fettspiegels | |
| DE69522716T2 (de) | Verbesserung der glukosetoleranz | |
| DE69316660T2 (de) | Terfanadin Metaboliten und deren optisch reine Isomere zur Behandlung von allergischen Krankheiten | |
| US6174925B1 (en) | Use of sibutramine analogues to prevent the development of diabetes | |
| DE69838179T2 (de) | Chronische bolusgabe von d-threo methylphenidat | |
| DE69721838T2 (de) | 1-[1-(4-chlorphenyl)cyclobutyl]-3-methylbutyl amin derivate zur senkung von harnsäurespiegeln beim menschen | |
| DE69824313T2 (de) | Sibutramin und orlistat enthaltende pharmazeutische zusammensetzungen | |
| DE69324025T2 (de) | Transdermale Behandlung der Nesselsucht mit OPTISCH REINEM (+)-CETIRIZIN | |
| DE69908421T2 (de) | Pharmazeutische zusammensetzung enthaltend eine kombination der dextro- und laevo-isomeren von sotalol | |
| DE60019914T2 (de) | Verwendung von Sibutramin oder dessem Derivat zur Behandlung von Schlafstörungen | |
| EP0035597B1 (de) | Pharmazeutische Zubereitungen | |
| DE69023045T2 (de) | Carboxamidderivate. | |
| DE69004529T2 (de) | Verwendung von Sertralin zur Behandlung von Abhängigkeiten von chemischen Stoffen. | |
| EP0669826B1 (de) | (-)-metrifonat enthaltendes arzneimittel | |
| DE60109799T2 (de) | Verwendung von quetiapin für aufmerksamkeitsmangel-hyperaktivitätsstörungen oder verhaltensstörungen | |
| DE69516602T2 (de) | Verwendung von Bifemelan zur Herstellung eines Arzneimittels zur Behandlung der Hyperkinesie | |
| CH669524A5 (https=) | ||
| MXPA99002633A (en) | Use of sibutramine analogues to lower lipid levels | |
| DE3631254A1 (de) | Pharmazeutische zubereitung | |
| DE2227844A1 (de) | Antidepressive verbindungen und verfahren zu deren herstellung |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 8364 | No opposition during term of opposition |