WO2016073380A1 - Method and biomarkers for predicting efficacy and evaluation of an ox40 agonist treatment - Google Patents
Method and biomarkers for predicting efficacy and evaluation of an ox40 agonist treatment Download PDFInfo
- Publication number
- WO2016073380A1 WO2016073380A1 PCT/US2015/058677 US2015058677W WO2016073380A1 WO 2016073380 A1 WO2016073380 A1 WO 2016073380A1 US 2015058677 W US2015058677 W US 2015058677W WO 2016073380 A1 WO2016073380 A1 WO 2016073380A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- hvr
- antibody
- amino acid
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6883—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
- C12Q1/6886—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57484—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M3/00—Automatic or semi-automatic exchanges
- H04M3/42—Systems providing special services or facilities to subscribers
- H04M3/50—Centralised arrangements for answering calls; Centralised arrangements for recording messages for absent or busy subscribers ; Centralised arrangements for recording messages
- H04M3/51—Centralised call answering arrangements requiring operator intervention, e.g. call or contact centers for telemarketing
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/106—Pharmacogenomics, i.e. genetic variability in individual responses to drugs and drug metabolism
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/158—Expression markers
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M2203/00—Aspects of automatic or semi-automatic exchanges
- H04M2203/40—Aspects of automatic or semi-automatic exchanges related to call centers
- H04M2203/402—Agent or workforce management
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04M—TELEPHONIC COMMUNICATION
- H04M3/00—Automatic or semi-automatic exchanges
- H04M3/42—Systems providing special services or facilities to subscribers
- H04M3/50—Centralised arrangements for answering calls; Centralised arrangements for recording messages for absent or busy subscribers ; Centralised arrangements for recording messages
- H04M3/51—Centralised call answering arrangements requiring operator intervention, e.g. call or contact centers for telemarketing
- H04M3/523—Centralised call answering arrangements requiring operator intervention, e.g. call or contact centers for telemarketing with call distribution or queueing
- H04M3/5238—Centralised call answering arrangements requiring operator intervention, e.g. call or contact centers for telemarketing with call distribution or queueing with waiting time or load prediction arrangements
Definitions
- the present disclosure relates to methods of predicting or monitoring
- OX40 (also known as CD34, TNFRSF4 and ACT35) is a member of the tumor necrosis factor receptor superfamily. OX40 is not constitutively expressed on naive T cells, but is induced after engagement of the T cell receptor (TCR). The ligand for OX40, OX40L, is predominantly expressed on antigen presenting cells. OX40 is highly expressed by activated CD4+ T cells, activated CD8+ T cells, memory T cells, and regulatory T cells. OX40 signaling can provide costimulatory signals to CD4 and CD8 T cells, leading to enhanced cell proliferation, survival, effector function and migration. OX40 signaling also enhances memory T cell development and function.
- Regulatory T cells are highly enriched in tumors and tumor draining lymph nodes derived from multiple cancer indications, including melanoma, NSCLC, renal, ovarian, colon, pancreatic, hepatocellular, and breast cancer. In a subset of these indications, increased intratumoral T reg cell densities are associated with poor patient prognosis, suggesting that these cells play an important role in suppressing antitumor immunity. OX40 positive tumor infiltrating lymphocytes have been described. [0006] It is clear that there continues to be a need for diagnostic, prognostic, and predictive methods to identify patients that are more likely to benefit from anti-tumor treatments that modulate OX40 activity. The invention described herein meets these needs and provides other benefits.
- the present disclosure describes methods and biomarkers for predicting efficacy and evaluation of an OX40 agonist treatment, including methods for predicting
- the present disclosure provides a method for predicting responsiveness of a subject having cancer to an OX40 agonist treatment, comprising: (a) measuring the expression level of one or more marker genes in a sample comprising leukocytes obtained from the subject, wherein said one or more marker genes are selected from the group consisting of CD8a, CD8b, H2-d, CTLA4, CD64, CXCL9, IFNg, IDOl, GZMA, GZMB, PRF1, PDCA1, KLRK1, PTPRC, CXCLl, ITGAM, and IL7R; and (b) classifying the subject as a responsive or non-responsive subject based on the expression level of said one or more marker genes in the sample obtained from the subject, as compared with a reference, wherein an increased expression level of the one or more marker genes as compared with the reference indicates the subject may be responsive to an OX40 agonist treatment.
- the present disclosure provides a method for treating or delaying progression of cancer in a subject, comprising: (a) measuring the expression level of one or more marker genes in a sample comprising leukocytes obtained from the subject, wherein said one or more marker genes are selected from the group consisting of CD8a, CD8b, H2-d, CTLA4, CD64, CXCL9, IFNg, IDOl, GZMA, GZMB, PRF1, PDCA1, KLRK1, PTPRC, CXCLl, ITGAM, and IL7R; and (b) if the expression level of said one or more marker genes in the sample obtained from the subject is higher than a reference, administering to the subject an effective amount of an OX40 agonist.
- the present disclosure provides a method for treating or delaying progression of cancer in a subject, comprising administering to the subject an effective amount of an OX40 agonist, wherein a sample comprising leukocytes obtained from the subject has increased expression of one or more marker genes are selected from the group consisting of CD8a, CD8b, H2-d, CTLA4, CD64, CXCL9, IFNg, IDOl, GZMA, GZMB, PRFl, PDCAl, KLRKl, PTPRC, CXCLl, ITGAM, and IL7R, as compared with a reference.
- said one or more marker genes are selected from the group consisting of CD8a, CD8b, IFNg, GZMA, GZMB, PRFl, and PDCAl.
- said one or more marker genes are selected from the group consisting of H2-d, CTLA4, CXCL9, PTPRC, IL7R, KLRKl, and CXCLl. In some embodiments, said one or more marker genes are selected from the group consisting of CD64, IDOl, and ITGAM.
- the present disclosure provides a method for predicting responsiveness of a subject having cancer to an OX40 agonist treatment, comprising: (a) measuring the expression level of one or more marker genes in a sample comprising leukocytes obtained from the subject, wherein said one or more marker genes are selected from the group consisting of CSF2, CCL22, EPCAM, GATA3, IL13, and VTCN1; and (b) classifying the subject as a responsive or non-responsive subject based on the expression level of said one or more marker genes in the sample obtained from the subject, as compared with a reference, wherein a decreased expression level of the one or more marker genes as compared with the reference indicates the subject may be responsive to an OX40 agonist treatment.
- the present disclosure provides a method for treating or delaying progression of cancer in a subject, comprising: (a) measuring the expression level of one or more marker genes in a sample comprising leukocytes obtained from the subject, wherein said one or more marker genes are selected from the group consisting of CSF2, CCL22, EPCAM, GAT A3, IL13, and VTCN1; and (b) if the expression level of said one or more marker genes in the sample obtained from the subject is lower than a reference, administering to the subject an effective amount of an OX40 agonist.
- the present disclosure provides a method for treating or delaying progression of cancer in a subject, comprising administering to the subject an effective amount of an OX40 agonist, wherein a sample comprising leukocytes obtained from the subject has decreased expression of one or more marker genes are selected from the group consisting of CSF2, CCL22, EPCAM, GATA3, IL13, and VTCN1, as compared with a reference.
- the present disclosure provides a method for monitoring pharmacodynamic activity of an OX40 agonist treatment, comprising: (a) measuring the expression level of one or more marker genes in a sample comprising leukocytes obtained from the subject, wherein the subject has been treated with an OX40 agonist, and wherein said one or more marker genes are selected from the group consisting of ARG1, CCL2, CCL22, CCL5, CCR5, CD226, CD27, CD274, CD28, CD3E, CD40, CD8A, CD8b,
- said one or more marker genes are selected from the group consisting of CD3, CD8, IFNg, GZMA, GZMB, PRFl
- the present disclosure provides a method for monitoring responsiveness of a subject to an OX40 agonist treatment, comprising: (a) measuring the expression level of one or more marker genes in a sample comprising leukocytes obtained from the subject, wherein the subject has been treated with an OX40 agonist, and wherein said one or more marker genes are selected from the group consisting of BTLA, CD4, CD69, CD80, CD83, CD86, CSF2, CTLA4, CXCR3, Fcgr2b/CD32, Fcgr3/CD16, H2-aa, H2-d, H2- k, ICOS, IL10, PDCAl, and TNFRSF18; and (b) classifying the subject as responsive or non- responsive to said treatment based on the expression level of said one or more marker genes in the sample obtained from the subject, as compared with a reference, wherein an increased expression level of the one or more marker genes as compared with the reference indicates a responsive subject.
- said one or more marker genes are selected from the group consisting of
- the sample comprising leukocytes is from a tumor sample obtained from the subject. In some embodiments, the sample comprising leukocytes is from a peripheral blood sample obtained from the subject. In some embodiments, the expression level of said one or more marker genes is normalized to the expression level of a reference gene in the sample. In some embodiments, the reference gene is a housekeeping gene. In some embodiments, the expression level of said one or more marker genes is mRNA expression level. In some embodiments, the mRNA expression level is measured by an assay selected from the group consisting of quantitative PCR, semi-quantitative PCR, nucleotide microarray, RNA-seq, in situ hybridization, and Northern blotting.
- the expression level of said one or more marker genes is protein expression level.
- the protein expression level is measured by Western blotting, peptide microarray, immunohistochemistry, flow cytometry, or mass spectrometry.
- the cancer is selected from the group consisting of colorectal cancer, non-small cell lung cancer, renal cell carcinoma, bladder cancer, ovarian cancer, glioblastoma, neuroblastoma, melanoma, breast carcinoma, gastric cancer, and hepatocellular carcinoma.
- the breast carcinoma is triple-negative breast carcinoma.
- the OX40 agonist is an agonist anti-human OX40 antibody.
- the antibody is a monoclonal antibody.
- the antibody is a humanized or human antibody. In some embodiments, the antibody comprises an IgGl Fc region. In some embodiments, the antibody comprises an IgG4 Fc region. In some embodiments, the antibody comprises an Fc region comprising a mutation that decreases binding to an Fc receptor.
- the antibody comprises (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2, 8 or 9; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3, 10, 11, 12, 13, or 14; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4, 15 or 19; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (f) HVR-L3 comprising an amino acid sequence selected from SEQ ID NO:7, 22, 23, 24, 25, 26, 27 or 28.
- the antibody comprises (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (f) HVR-L3 comprising an amino acid sequence selected from SEQ ID NO:7.
- the antibody comprises (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (f) HVR-L3 comprising an amino acid sequence selected from SEQ ID NO:26.
- the antibody comprises (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:5; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (f) HVR-L3 comprising an amino acid sequence selected from SEQ ID NO:27.
- the antibody is MEDI6469 or MEDI0562.
- the OX40 agonist comprises one or more extracellular domains of OX40L.
- the OX40 agonist is MEDI6383.
- FIGS. 1A & IB show the effects of anti-OX40 treatment on T cell function.
- the graphs depict T cell proliferation (FIG. 1A) and IFNy production (FIG. IB) in response to activation with anti-CD3 and anti-OX40 treatment.
- FIG. 2 shows the effect of anti-OX40 treatment on Treg activity in an in vitro Treg suppression assay, as compared to control treatment.
- FIGS. 3A-3C show the effect of anti-OX40 treatment on tumor volume in syngeneic mouse tumor models. Results from the EMT6 breast (FIG. 3A), Cloudman melanoma (FIG. 3B), and CT26 CRC (FIG. 3C) tumor models are shown.
- FIGS. 4A-4C show the effect of anti-OX40 treatment on tumor volume in syngeneic mouse tumor models. Results from the MC38 CRC (FIG. 4A), 51BlimlO CRC (FIG. 4B), and JC breast (FIG. 4C) tumor models are shown.
- FIG. 5 provides a heat-map of gene expression in mouse tumor models (as labeled) prior to anti-OX40 treatment.
- FIGS. 6A & 6B demonstrate a dose-dependent effect of anti-OX40 treatment on peripheral blood cells in EMT6 tumor-bearing mice. Shown are the percentages of Tregs (FIG. 6A) and CD8 T cells (FIG. 6B) in peripheral blood following treatment with the labeled concentration of anti-OX40 antibody.
- FIGS. 7A & 7B show the effect of anti-OX40 treatment on numbers of Treg (FIG. 7A) and CD8 (FIG. 7B) cell infiltrates in EMT6 tumors, compared to control treatment.
- FIGS. 8A & 8B show the effect of anti-OX40 treatment on numbers of Treg (FIG. 8A) and CD8 (FIG. 8B) cell infiltrates in JC tumors, compared to control treatment.
- FIGS. 9A-9D show genes that are upregulated following anti-OX40 treatment, compared to control treatment, in both EMT6 and JC tumor models. Shown are relative expression levels of IFNg (FIG. 9A), granzyme A (FIG. 9B), perforin (FIG. 9C), and TNFa (FIG. 9D).
- FIGS. 10A-10D show genes that are upregulated following anti-OX40 treatment, compared to control treatment, in an EMT6 tumor model. Shown are relative expression levels of H2-aa (FIG. 10A), CD86 (FIG. 10B), ICOS (FIG. IOC), and CXCR3 (FIG. 10D).
- Reference to "about” a value or parameter herein includes (and describes) variations that are directed to that value or parameter per se. For example, description referring to "about X” includes description of "X”.
- disfunction in the context of immune dysfunction, refers to a state of reduced immune responsiveness to antigenic stimulation.
- disfunctional also includes refractory or unresponsive to antigen recognition, specifically, impaired capacity to translate antigen recognition into downstream T-cell effector functions, such as proliferation, cytokine production ⁇ e.g., gamma interferon) and/or target cell killing.
- Enhancing T cell function means to induce, cause or stimulate an effector or memory T cell to have a renewed, sustained or amplified biological function.
- Examples of enhancing T-cell function include: increased secretion of ⁇ -interferon from CD8 + effector T cells, increased secretion of ⁇ -interferon from CD4+ memory and/or effector T-cells, increased proliferation of CD4+ effector and/or memory T cells, increased proliferation of CD8+ effector T-cells, increased antigen responsiveness ⁇ e.g., clearance), relative to such levels before the intervention.
- the level of enhancement is at least 50%, alternatively 60%, 70%, 80%, 90%, 100%, 120%, 150%, 200%. The manner of measuring this enhancement is known to one of ordinary skill in the art.
- Tumor immunity refers to the process in which tumors evade immune recognition and clearance. Thus, as a therapeutic concept, tumor immunity is “treated” when such evasion is attenuated, and the tumors are recognized and attacked by the immune system. Examples of tumor recognition include tumor binding, tumor shrinkage and tumor clearance.
- Immunogenicity refers to the ability of a particular substance to provoke an immune response. Tumors are immunogenic and enhancing tumor immunogenicity aids in the clearance of the tumor cells by the immune response.
- an "acceptor human framework” for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below.
- An acceptor human framework "derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
- the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
- binding affinity refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen).
- binding affinity refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described in the following.
- An "agonist antibody,” as used herein, is an antibody which activates a biological activity of the antigen it binds.
- an "anti- angiogenic agent” refers to a compound which blocks, or interferes with to some degree, the development of blood vessels.
- An anti-angiogenic agent may, for instance, be a small molecule or antibody that binds to a growth factor or growth factor receptor involved in promoting angiogenesis.
- an anti-angiogenic agent is an antibody that binds to vascular endothelial growth factor (VEGF), such as bevacizumab (AVASTIN).
- VEGF vascular endothelial growth factor
- ADCC antibody-dependent cell-mediated cytotoxicity
- FcRs Fc receptors
- cytotoxic cells e.g. NK cells, neutrophils, and macrophages
- NK cells e.g. NK cells, neutrophils, and macrophages
- FcRIII The primary cells for mediating ADCC, NK cells, express FcyRIII only, whereas monocytes express FcyRI, FcyRII, and FcyRIII.
- FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev.
- ADCC activity of a molecule of interest an in vitro ADCC assay, such as that described in US Patent No. 5,500,362 or 5,821,337 or U.S. Patent No. 6,737,056 (Presta), may be performed.
- Useful effector cells for such assays include PBMC and NK cells.
- ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. PNAS (USA) 95:652-656 (1998).
- An exemplary assay for assessing ADCC activity is provided in the examples herein.
- anti-OX40 antibody and "an antibody that binds to OX40” refer to an antibody that is capable of binding OX40 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting OX40.
- the extent of binding of an anti-OX40 antibody to an unrelated, non-OX40 protein is less than about 10% of the binding of the antibody to OX40 as measured, e.g., by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an antibody that binds to OX40 has a dissociation constant (Kd) of ⁇ ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 10 ⁇ 8 M or less, e.g. from 10 ⁇ 8 M to 10 "13 M, e.g., from 10 "9 M to 10 "13 M).
- Kd dissociation constant
- an anti-OX40 antibody binds to an epitope of OX40 that is conserved among OX40 from different species.
- the term "binds”, “specifically binds to” or is “specific for” refers to measurable and reproducible interactions such as binding between a target and an antibody, which is determinative of the presence of the target in the presence of a heterogeneous population of molecules including biological molecules.
- an antibody that binds to or specifically binds to a target is an antibody that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets.
- the extent of binding of an antibody to an unrelated target is less than about 10% of the binding of the antibody to the target as measured, e.g., by a radioimmunoassay (RIA).
- an antibody that specifically binds to a target has a dissociation constant (Kd) of ⁇ ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, or ⁇ 0.1 nM.
- Kd dissociation constant
- an antibody specifically binds to an epitope on a protein that is conserved among the protein from different species.
- specific binding can include, but does not require exclusive binding.
- antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
- an "antibody fragment” refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds.
- antibody fragments include but are not limited to Fv, Fab, Fab', Fab'-SH, F(ab') 2 ; diabodies; linear antibodies; single-chain antibody molecules (e.g. scFv); and multispecific antibodies formed from antibody fragments.
- an "antibody that binds to the same epitope" as a reference antibody refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more.
- An exemplary competition assay is provided herein.
- binding domain refers to the region of a polypeptide that binds to another molecule.
- the binding domain can comprise a portion of a polypeptide chain thereof (e.g. the alpha chain thereof) which is responsible for binding an Fc region.
- One useful binding domain is the extracellular domain of an FcR alpha chain.
- a polypeptide with a variant IgG Fc with "altered" FcR, ADCC or phagocytosis activity is one which has either enhanced or diminished FcR binding activity (e.g, FcyR) and/or ADCC activity and/or phagocytosis activity compared to a parent polypeptide or to a polypeptide comprising a native sequence Fc region.
- OX40 refers to any native OX40 from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats), unless otherwise indicated.
- the term encompasses "full-length,” unprocessed OX40 as well as any form of OX40 that results from processing in the cell.
- the term also encompasses naturally occurring variants of OX40, e.g., splice variants or allelic variants.
- the amino acid sequence of an exemplary human OX40 is shown in SEQ ID NO: l .
- OX40 activation refers to activation, of the OX40 receptor. Generally, OX40 activation results in signal transduction.
- cancer refers to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
- examples of cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include, but not limited to, squamous cell cancer (e.g.
- lung cancer including small-cell lung cancer, non- small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer and gastrointestinal stromal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, cancer of the urinary tract, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, melanoma, superficial spreading melanoma, lentigo maligna melanoma, acral lentiginous melanomas, nodular melanomas, multiple myeloma and B-cell lymphoma; chronic lymphocytic
- cancers that are amenable to treatment by the antibodies of the invention include breast cancer, colorectal cancer, rectal cancer, non- small cell lung cancer, glioblastoma, non-Hodgkins lymphoma (NHL), renal cell cancer, prostate cancer, liver cancer, pancreatic cancer, soft-tissue sarcoma, kaposi's sarcoma, carcinoid carcinoma, head and neck cancer, ovarian cancer, mesothelioma, and multiple myeloma.
- the cancer is selected from: non-small cell lung cancer, glioblastoma, neuroblastoma, melanoma, breast carcinoma (e.g.
- the cancer is selected from: non- small cell lung cancer, colorectal cancer, glioblastoma and breast carcinoma (e.g. triple-negative breast cancer), including metastatic forms of those cancers.
- tumor refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
- cancer refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
- cancer refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
- cell proliferative disorder and “proliferative disorder” refer to disorders that are associated with some degree of abnormal cell proliferation.
- the cell proliferative disorder is cancer.
- the term "chimeric" antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
- the "class" of an antibody refers to the type of constant domain or constant region possessed by its heavy chain. There are five major classes of antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGi, IgG 2 , IgG 3 , IgG 4 , IgAi, and IgA 2 .
- the heavy chain constant domains that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
- “Complement dependent cytotoxicity” or “CDC” refers to the lysis of a target cell in the presence of complement. Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (Clq) to antibodies (of the appropriate subclass), which are bound to their cognate antigen.
- a CDC assay e.g., as described in Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996), may be performed.
- Polypeptide variants with altered Fc region amino acid sequences polypeptides with a variant Fc region
- increased or decreased Clq binding capability are described, e.g., in US Patent No. 6,194,551 Bl and WO 1999/51642. See also, e.g., Idusogie et al. J. Immunol. 164: 4178-4184 (2000).
- cytostatic agent refers to a compound or composition which arrests growth of a cell either in vitro or in vivo.
- a cytostatic agent may be one which significantly reduces the percentage of cells in S phase.
- Further examples of cytostatic agents include agents that block cell cycle progression by inducing G0/G1 arrest or M-phase arrest.
- the humanized anti-Her2 antibody trastuzumab (HERCEPTIN®) is an example of a cytostatic agent that induces G0/G1 arrest.
- Classical M-phase blockers include the vincas (vincristine and vinblastine), taxanes, and topoisomerase II inhibitors such as doxorubicin, epirubicin, daunorubicin, etoposide, and bleomycin.
- Certain agents that arrest Gl also spill over into S-phase arrest, for example, DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
- Taxanes are anticancer drugs both derived from the yew tree.
- Docetaxel (TAXOTERE®, Rhone- Poulenc Rorer), derived from the European yew, is a semisynthetic analogue of paclitaxel (TAXOL®, Bristol-Myers Squibb). Paclitaxel and docetaxel promote the assembly of microtubules from tubulin dimers and stabilize microtubules by preventing depolymerization, which results in the inhibition of mitosis in cells.
- cytotoxic agent refers to a substance that inhibits or prevents a cellular function and/or causes cell death or destruction. Cytotoxic agents include, but are not limited to, radioactive isotopes (e.g., At 211 , 1 131 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 ,
- Bi 212 , P 32 , Pb 212 and radioactive isotopes of Lu chemotherapeutic agents or drugs (e.g., methotrexate, adriamicin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents); growth inhibitory agents; enzymes and fragments thereof such as nucleolytic enzymes; antibiotics; toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof; and the various antitumor or anticancer agents disclosed below.
- chemotherapeutic agents or drugs e.g., methotrexate, adriamicin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin
- a "depleting anti-OX40 antibody,” is an anti-OX40 antibody that kills or depletes OX40-expressing cells. Depletion of OX40 expressing cells can be achieved by various mechanisms, such as antibody-dependent cell-mediated cytotoxicity and/or phagocytosis. Depletion of OX40-expressing cells may be assayed in vitro, and exemplary methods for in vitro ADCC and phagocytosis assays are provided herein.
- the OX40- expressing cell is a human CD4+ effector T cell.
- the OX40-expressing cell is a transgenic BT474 cell that expresses human OX40.
- Antibody effector functions refer to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Examples of antibody effector functions include: Clq binding and complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor); and B cell activation.
- an "effective amount" of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
- Fc receptor or “FcR” describes a receptor that binds to the Fc region of an antibody.
- an FcR is a native human FcR.
- an FcR is a native human FcR.
- FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the
- FcyRI, FcyRII, and FcyRIII subclasses including allelic variants and alternatively spliced forms of those receptors.
- FcyRII receptors include FcyRIIA (an "activating receptor") and
- FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
- Activating receptor FcyRIIA contains an immunoreceptor tyrosine -based activation motif (IT AM) in its cytoplasmic domain.
- IT AM immunoreceptor tyrosine -based activation motif
- Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine-based inhibition motif
- FcRs are reviewed, for example, in Ravetch and Kinet, Annu. Rev. Immunol 9:457- 92 (1991); Capel et al., Immunomethods 4:25-34 (1994); and de Haas et al., J. Lab. Clin. Med. 126:330-41 (1995).
- Other FcRs including those to be identified in the future, are encompassed by the term “FcR” herein.
- the term "Fc receptor” or “FcR” also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al, J. Immunol. 117:587 (1976) and Kim et al, J.
- Binding to human FcRn in vivo and serum half life of human FcRn high affinity binding polypeptides can be assayed, e.g., in transgenic mice or transfected human cell lines expressing human FcRn, or in primates to which the
- polypeptides with a variant Fc region are administered.
- WO 2000/42072 (Presta) describes antibody variants with improved or diminished binding to FcRs. See also, e.g., Shields et al. J. Biol. Chem. 9(2):6591-6604 (2001).
- Fc region herein is used to define a C-terminal region of an
- immunoglobulin heavy chain that contains at least a portion of the constant region.
- the term includes native sequence Fc regions and variant Fc regions.
- a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain.
- the C-terminal lysine (Lys447) of the Fc region may or may not be present.
- numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
- a "functional Fc region” possesses an "effector function” of a native sequence Fc region.
- effector functions include Clq binding; CDC; Fc receptor binding; ADCC; phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor; BCR), etc.
- Such effector functions generally require the Fc region to be combined with a binding domain ⁇ e.g., an antibody variable domain) and can be assessed using various assays as disclosed, for example, in definitions herein.
- Human effector cells refer to leukocytes that express one or more FcRs and perform effector functions. In certain embodiments, the cells express at least FcyRIII and perform ADCC effector function(s). Examples of human leukocytes which mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, cytotoxic T cells, and neutrophils.
- PBMC peripheral blood mononuclear cells
- NK natural killer cells
- monocytes cytotoxic T cells
- neutrophils neutrophils.
- the effector cells may be isolated from a native source, e.g., from blood.
- FR refers to variable domain residues other than hypervariable region (HVR) residues.
- the FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
- full length antibody “intact antibody,” and “whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.
- Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages.
- Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
- a "human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody- encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
- a "human consensus framework” is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
- the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
- the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), vols. 1-3.
- the subgroup is subgroup kappa I as in Kabat et al., supra.
- the subgroup is subgroup III as in Kabat et al., supra.
- a “humanized” antibody refers to a chimeric antibody comprising amino acid residues from non-human HVRs and amino acid residues from human FRs.
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
- a humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody.
- a "humanized form" of an antibody, e.g., a non-human antibody refers to an antibody that has undergone humanization.
- hypervariable region refers to each of the regions of an antibody variable domain which are hypervariable in sequence
- CDRs complementarity determining regions
- hypervariable loops structurally defined loops
- antigen-contacting residues antigen-contacting residues
- antibodies comprise six HVRs: three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3).
- HVRs herein include:
- HVR residues and other residues in the variable domain are numbered herein according to Kabat et al., supra.
- an “immunoconjugate” is an antibody conjugated to one or more heterologous molecule(s), including but not limited to a cytotoxic agent.
- An "individual” or “subject” is a mammal. Mammals include, but are not limited to, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats). In certain embodiments, the individual or subject is a human.
- "Promoting cell growth or proliferation” means increasing a cell's growth or proliferation by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%.
- an "isolated" antibody is one which has been separated from a component of its natural environment.
- an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC).
- electrophoretic e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis
- chromatographic e.g., ion exchange or reverse phase HPLC
- An "isolated" nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment.
- An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
- isolated nucleic acid encoding an anti-OX40 antibody refers to one or more nucleic acid molecules encoding antibody heavy and light chains (or fragments thereof), including such nucleic acid molecule(s) in a single vector or separate vectors, and such nucleic acid molecule(s) present at one or more locations in a host cell.
- the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
- polyclonal antibody preparations typically include different antibodies directed against different determinants (epitopes)
- each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
- the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
- a “naked antibody” refers to an antibody that is not conjugated to a heterologous moiety (e.g., a cytotoxic moiety) or radiolabel. The naked antibody may be present in a pharmaceutical formulation.
- Native antibodies refer to naturally occurring immunoglobulin molecules with varying structures.
- native IgG antibodies are heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light chains and two identical heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CHI, CH2, and CH3).
- VH variable region
- CHI variable heavy domain
- CH2 constant domains
- CL constant light
- the light chain of an antibody may be assigned to one of two types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequence of its constant domain.
- a "native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature.
- Native sequence human Fc regions include a native sequence human IgGl Fc region (non-A and A allotypes); native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
- package insert is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
- Percent ( ) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2.
- the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office,
- the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, California, or may be compiled from the source code.
- the ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows:
- pharmaceutical formulation refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
- a "pharmaceutically acceptable carrier” refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject.
- pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
- treatment refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
- antibodies of the invention are used to delay development of a disease or to slow the progression of a disease.
- tumor refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
- cancer refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
- cancer refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
- variable region refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen.
- the variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HVRs).
- FRs conserved framework regions
- HVRs hypervariable regions
- antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).
- a “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification, preferably one or more amino acid substitution(s).
- the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, e.g. from about one to about ten amino acid substitutions, and preferably from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide.
- the variant Fc region herein will preferably possess at least about 80% homology with a native sequence Fc region and/or with an Fc region of a parent polypeptide, and most preferably at least about 90% homology therewith, more preferably at least about 95% homology therewith.
- vector refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked.
- the term includes the vector as a self- replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
- Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as "expression vectors.”
- a "VH subgroup III consensus framework" comprises the consensus sequence obtained from the amino acid sequences in variable heavy subgroup III of Kabat et al.
- the VH subgroup III consensus framework amino acid sequence comprises at least a portion or all of each of the following sequences:
- VL subgroup I consensus framework comprises the consensus sequence obtained from the amino acid sequences in variable light kappa subgroup I of Kabat et al.
- the VH subgroup I consensus framework amino acid sequence comprises at least a portion or all of each of the following sequences:
- DIQMTQSPSSLSASVGDRVTITC SEQ ID N0:218)-L1-WYQQKPGKAPKLLIY (SEQ ID NO:219)-L2-GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO:220)-L3- FGQGTKVEIK (SEQ ID NO:221).
- cytotoxic agent refers to a substance that inhibits or prevents a cellular function and/or causes cell death or destruction.
- Cytotoxic agents include, but are not limited to, radioactive isotopes (e.g., At211, 1131, 1125, Y90, Rel86, Rel88, Sml53, Bi212, P32, Pb212 and radioactive isotopes of Lu); chemotherapeutic agents; growth inhibitory agents; enzymes and fragments thereof such as nucleolytic enzymes; and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof.
- radioactive isotopes e.g., At211, 1131, 1125, Y90, Rel86, Rel88, Sml53, Bi212, P32, Pb212 and radioactive isotopes of Lu
- chemotherapeutic agents e.g., At211, 1131, 1125,
- Exemplary cytotoxic agents can be selected from anti-microtubule agents, platinum coordination complexes, alkylating agents, antibiotic agents, topoisomerase II inhibitors, antimetabolites, topoisomerase I inhibitors, hormones and hormonal analogues, signal transduction pathway inhibitors, nonreceptor tyrosine kinase angiogenesis inhibitors, immunotherapeutic agents, proapoptotic agents, inhibitors of LDH-A; inhibitors of fatty acid biosynthesis; cell cycle signalling inhibitors; HDAC inhibitors, proteasome inhibitors; and inhibitors of cancer metabolism.
- the cytotoxic agent is selected from anti-microtubule agents, platinum coordination complexes, alkylating agents, antibiotic agents, topoisomerase II inhibitors, antimetabolites, topoisomerase I inhibitors, hormones and hormonal analogues, signal transduction pathway inhibitors, non-receptor tyrosine kinase angiogenesis inhibitors, immunotherapeutic agents, proapoptotic agents, inhibitors of LDH-A, inhibitors of fatty acid biosynthesis, cell cycle signalling inhibitors, HDAC inhibitors, proteasome inhibitors, and inhibitors of cancer metabolism.
- the cytotoxic agent is a taxane.
- the taxane is paclitaxel or docetaxel.
- the cytotoxic agent is a platinum agent. In one embodiment the cytotoxic agent is an antagonist of EGFR. In one embodiment the antagonist of EGFR is N-(3-ethynylphenyl)-6,7-bis(2- methoxyethoxy)quinazolin-4-amine (e.g., erlotinib). In one embodiment the cytotoxic agent is a RAF inhibitor. In one embodiment, the RAF inhibitor is a BRAF and/or CRAF inhibitor. In one embodiment the RAF inhibitor is vemurafenib. In one embodiment the cytotoxic agent is a PI3K inhibitor.
- chemotherapeutic agent includes chemical compounds useful in the treatment of cancer.
- chemotherapeutic agents include erlotinib (TARCEVA®,
- pancratistatin a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlomaphazine, chlorophosphamide, estramustine, ifosfamide, mechlorethamine,
- mechlorethamine oxide hydrochloride mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine,
- prednimustine, trofosfamide, uracil mustard nitrosoureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine
- antibiotics such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin ⁇ and calicheamicin coll (Angew Chem. Intl. Ed. Engl. 1994 33:183-186); dynemicin, including dynemicin A;
- bisphosphonates such as clodronate; an esperamicin; as well as neocarzinostatin
- chromophore and related chromoprotein enediyne antibiotic chromophores aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L- norleucine, ADRIAMYCIN® (doxorubicin), morpholino-doxorubicin, cyanomorpholino- doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, porfiromycin, puromycin, quelamycin, rodorubi
- methotrexate, pteropterin, trimetrexate purine analogs such as fludarabine, 6- mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; dia
- TAXOL paclitaxel
- ABRAXANE® Cremophor-free
- albumin-engineered nanoparticle formulations of paclitaxel American Pharmaceutical Partners, Schaumberg, 111.
- TAXOTERE® docetaxel, doxetaxel; Sanofi-Aventis
- chloranmbucil GEMZAR® (gemcitabine)
- 6-thioguanine mercaptopurine
- methotrexate platinum analogs such as cisplatin and carboplatin; vinblastine; etoposide (VP-16); ifosfamide; mitoxan
- vincristine vincristine; NAVELBINE® (vinorelbine); novantrone; teniposide; edatrexate; daunomycin; aminopterin; capecitabine (XELODA®); ibandronate; CPT-11; topoisomerase inhibitor RFS 2000; difluoromethylomi thine (DMFO); retinoids such as retinoic acid; and pharmaceutically acceptable salts, acids and derivatives of any of the above.
- NAVELBINE® vinorelbine
- novantrone teniposide
- edatrexate daunomycin
- aminopterin capecitabine
- ibandronate CPT-11
- topoisomerase inhibitor RFS 2000 difluoromethylomi thine
- retinoids such as retinoic acid
- Chemotherapeutic agent also includes (i) anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEX®;
- SERMs selective estrogen receptor modulators
- aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, MEGASE®
- Chemotherapeutic agent also includes antibodies such as alemtuzumab (Campath), bevacizumab (AVASTIN®, Genentech); cetuximab (ERBITUX®, Imclone); panitumumab (VECTIBIX®, Amgen), rituximab (RITUXAN®, Genentech/Biogen pie), pertuzumab (OMNITARG®, 2C4, Genentech), trastuzumab (HERCEPTIN®, Genentech), tositumomab (Bexxar, Corixia), and the antibody drug conjugate, gemtuzumab ozogamicin
- Additional humanized monoclonal antibodies with therapeutic potential as agents in combination with the compounds of the invention include: apolizumab, aselizumab, atlizumab, bapineuzumab, bivatuzumab mertansine, cantuzumab mertansine, cedelizumab, certolizumab pegol, cidfusituzumab, cidtuzumab, daclizumab, eculizumab, efalizumab, epratuzumab, erlizumab, felvizumab, fontolizumab, gemtuzumab ozogamicin, inotuzumab ozogamicin, ipilimumab, labetuzumab, lintuzumab, matuzumab, mepolizumab, motavizumab, motovizumab, natalizumab, n
- rovelizumab ruplizumab, sibrotuzumab, siplizumab, thankuzumab, tacatuzumab tetraxetan, tadocizumab, talizumab, tefibazumab, tocilizumab, toralizumab, tucotuzumab celmoleukin, tucusituzumab, umavizumab, urtoxazumab, ustekinumab, visilizumab, and the anti- interleukin-12 (ABT-874/J695, Wyeth Research and Abbott Laboratories) which is a recombinant exclusively human- sequence, full-length IgGl ⁇ antibody genetically modified to recognize interleukin-12 p40 protein.
- ABT-874/J695 Wyeth Research and Abbott Laboratories
- Chemotherapeutic agent also includes "EGFR inhibitors,” which refers to compounds that bind to or otherwise interact directly with EGFR and prevent or reduce its signaling activity, and is alternatively referred to as an "EGFR antagonist.”
- EGFR inhibitors refers to compounds that bind to or otherwise interact directly with EGFR and prevent or reduce its signaling activity
- Examples of such agents include antibodies and small molecules that bind to EGFR.
- antibodies which bind to EGFR include MAb 579 (ATCC CRL HB 8506), MAb 455 (ATCC CRL HB8507), MAb 225 (ATCC CRL 8508), MAb 528 (ATCC CRL 8509) (see, US Patent No.
- EMD 55900 Stragliotto et al. Eur. J. Cancer 32A:636-640 (1996)
- EMD7200 a humanized EGFR antibody directed against EGFR that competes with both EGF and TGF- alpha for EGFR binding
- EMD/Merck human EGFR antibody
- HuMax-EGFR HuMax-EGFR
- the anti-EGFR antibody may be conjugated with a cytotoxic agent, thus generating an immunoconjugate (see, e.g.,
- EGFR antagonists include small molecules such as compounds described in US Patent Nos: 5,616,582, 5,457,105, 5,475,001, 5,654,307, 5,679,683, 6,084,095, 6,265,410, 6,455,534, 6,521,620, 6,596,726, 6,713,484, 5,770,599, 6,140,332, 5,866,572, 6,399,602, 6,344,459, 6,602,863, 6,391,874, 6,344,455, 5,760,041, 6,002,008, and 5,747,498, as well as the following PCT publications: W098/14451, WO98/50038, WO99/09016, and WO99/24037.
- EGFR antagonists include OSI-774 (CP-358774, erlotinib, TARCEVA® Genentech/OSI Pharmaceuticals); PD 183805 (CI 1033, 2-propenamide, N-[4-[(3-chloro-4-fluorophenyl)amino]-7-[3-(4- morpholinyl)propoxy]-6-quinazolinyl]-, dihydrochloride, Pfizer Inc.); ZD1839, gefitinib (IRESSA®) 4-(3'-Chloro-4'-fluoroanilino)-7-methoxy-6-(3-morpholinopropoxy)quinazoline, AstraZeneca); ZM 105180 ((6-amino-4-(3-methylphenyl-amino)-quinazoline, Zeneca);
- BIBX-1382 N8-(3-chloro-4-fluoro-phenyl)-N2-(l-methyl-piperidin-4-yl)-pyrimido[5,4- d]pyrimidine-2,8-diamine, Boehringer Ingelheim); PKI-166 ((R)-4-[4-[(l- phenylethyl)amino]-lH-pyrrolo[2,3-d]pyrimidin-6-yl]-phenol); (R)-6-(4-hydroxyphenyl)-4- [(l-phenylethyl)amino]-7H-pyrrolo[2,3-d]pyrimidine); CL-387785 (N-[4-[(3- bromophenyl)amino]-6-quinazolinyl]-2-butynamide); EKB-569 (N-[4-[(3-chloro-4- fluorophenyl)amino]-3-cyano-7-ethoxy-6-quino
- Chemotherapeutic agents also include "tyrosine kinase inhibitors" including the EGFR-targeted drugs noted in the preceding paragraph; small molecule HER2 tyrosine kinase inhibitor such as TAK165 available from Takeda; CP-724,714, an oral selective inhibitor of the ErbB2 receptor tyrosine kinase (Pfizer and OSI); dual-HER inhibitors such as EKB-569 (available from Wyeth) which preferentially binds EGFR but inhibits both HER2 and EGFR-overexpressing cells; lapatinib (GSK572016; available from Glaxo-SmithKline), an oral HER2 and EGFR tyrosine kinase inhibitor; PKI-166 (available from Novartis); pan- HER inhibitors such as canertinib (CI- 1033; Pharmacia); Raf-1 inhibitors such as antisense agent ISIS-5132 available from ISIS Pharmaceuticals which inhibit Raf-1 signaling;
- PTK787/ZK222584 available from Novartis/Schering AG
- MAPK extracellular regulated kinase I inhibitor CI-1040 available from Pharmacia
- quinazolines such as PD 153035,4- (3-chloroanilino) quinazoline
- pyridopyrimidines such as PD 153035,4- (3-chloroanilino) quinazoline
- pyridopyrimidines such as pyrimidopyrimidines
- pyrrolopyrimidines such as CGP 59326, CGP 60261 and CGP 62706
- pyrazolopyrimidines 4-(phenylamino)-7H- pyrrolo[2,3-d] pyrimidines
- curcumin diiferuloyl methane, 4,5-bis (4- fluoroanilino)phthalimide
- tyrphostines containing nitrothiophene moieties PD-018380
- Chemotherapeutic agents also include dexamethasone, interferons, colchicine, metoprine, cyclosporine, amphotericin, metronidazole, alemtuzumab, alitretinoin, allopurinol, amifostine, arsenic trioxide, asparaginase, BCG live, bevacuzimab, bexarotene, cladribine, clofarabine, darbepoetin alfa, denileukin, dexrazoxane, epoetin alfa, elotinib, filgrastim, histrelin acetate, ibritumomab, interferon alfa-2a, interferon alfa-2b, lenalidomide, levamisole, mesna, methoxsalen, nandrolone, nelarabine, nofetumomab, oprel
- Chemotherapeutic agents also include hydrocortisone, hydrocortisone acetate, cortisone acetate, tixocortol pivalate, triamcinolone acetonide, triamcinolone alcohol, mometasone, amcinonide, budesonide, desonide, fluocinonide, fluocinolone acetonide, betamethasone, betamethasone sodium phosphate, dexamethasone, dexamethasone sodium phosphate, fluocortolone, hydrocortisone- 17-butyrate, hydrocortisone-17-valerate, aclometasone dipropionate, betamethasone valerate, betamethasone dipropionate,
- ImSAIDs immune selective anti-inflammatory peptides
- FEG phenylalanine-glutamine-glycine
- FeG D-isomeric form
- anti-rheumatic drugs such as azathioprine, ciclosporin (cyclosporine A), D-penicillamine, gold salts, hydroxychloroquine,
- leflunomideminocycline, sulfasalazine, tumor necrosis factor alpha (TNFa) blockers such as etanercept (Enbrel), infliximab (Remicade), adalimumab (Humira), certolizumab pegol (Cimzia), golimumab (Simponi), Interleukin 1 (IL-1) blockers such as anakinra (Kineret), T cell co stimulation blockers such as abatacept (Orencia), Interleukin 6 (IL-6) blockers such as tocilizumab (ACTEMERA®); Interleukin 13 (IL-13) blockers such as lebrikizumab;
- TNFa tumor necrosis factor alpha
- Interferon alpha (IFN) blockers such as Rontalizumab; Beta 7 integrin blockers such as rhuMAb Beta7; IgE pathway blockers such as Anti-Mi prime; Secreted homotrimeric LTa3 and membrane bound heterotrimer LTal/p2 blockers such as Anti-lymphotoxin alpha (LTa); radioactive isotopes (e.g., At211, 1131, 1125, Y90, Rel86, Rel88, Sml53, Bi212, P32, Pb212 and radioactive isotopes of Lu); miscellaneous investigational agents such as thioplatin, PS- 341, phenylbutyrate, ET-18- OCH3, or farnesyl transferase inhibitors (L-739749, L-744832); polyphenols such as quercetin, resveratrol, piceatannol, epigallocatechine gallate, theaflavins, flavanols, procyani
- lapachol lapachol
- colchicines betulinic acid
- acetylcamptothecin scopolectin
- Targetedron® bisphosphonates such as clodronate (for example, BONEFOS® or OSTAC®), etidronate (DIDROCAL®), NE-58095, zoledronic acid/zoledronate
- SKELID® or risedronate (ACTONEL®); and epidermal growth factor receptor (EGF-R); vaccines such as THERATOPE® vaccine; perifosine, COX-2 inhibitor (e.g. celecoxib or etoricoxib), proteosome inhibitor (e.g. PS341); CCI-779; tipifarnib (R11577); orafenib, ABT510; Bcl-2 inhibitor such as oblimersen sodium (GENASENSE®); pixantrone;
- COX-2 inhibitor e.g. celecoxib or etoricoxib
- proteosome inhibitor e.g. PS341
- CCI-779 e.g. tipifarnib (R11577); orafenib, ABT510
- Bcl-2 inhibitor such as oblimersen sodium (GENASENSE®); pixantrone;
- farnesyltransferase inhibitors such as lonafarnib (SCH 6636, SARASARTM); and
- CHOP an abbreviation for a combined therapy of cyclophosphamide, doxorubicin, vincristine, and prednisolone
- FOLFOX an abbreviation for a treatment regimen with oxaliplatin (ELOXATINTM) combined with 5-FU and leucovorin.
- Chemotherapeutic agents also include non-steroidal anti-inflammatory drugswith analgesic, antipyretic and anti-inflammatory effects.
- NSAIDs include non-selective inhibitors of the enzyme cyclooxygenase.
- Specific examples of NSAIDs include aspirin, propionic acid derivatives such as ibuprofen, fenoprofen, ketoprofen, flurbiprofen, oxaprozin and naproxen, acetic acid derivatives such as indomethacin, sulindac, etodolac, diclofenac, enolic acid derivatives such as piroxicam, meloxicam, tenoxicam, droxicam, lornoxicam and isoxicam, fenamic acid derivatives such as mefenamic acid, meclofenamic acid, flufenamic acid, tolfenamic acid, and COX-2 inhibitors such as celecoxib, etoricoxib, lumirac
- NSAIDs can be indicated for the symptomatic relief of conditions such as rheumatoid arthritis, osteoarthritis, inflammatory arthropathies, ankylosing spondylitis, psoriatic arthritis, Reiter's syndrome, acute gout, dysmenorrhoea, metastatic bone pain, headache and migraine, postoperative pain, mild-to-moderate pain due to inflammation and tissue injury, pyrexia, ileus, and renal colic.
- conditions such as rheumatoid arthritis, osteoarthritis, inflammatory arthropathies, ankylosing spondylitis, psoriatic arthritis, Reiter's syndrome, acute gout, dysmenorrhoea, metastatic bone pain, headache and migraine, postoperative pain, mild-to-moderate pain due to inflammation and tissue injury, pyrexia, ileus, and renal colic.
- cytokine is a generic term for proteins released by one cell population that act on another cell as intercellular mediators. Examples of such cytokines are
- lymphokines monokines
- interleukins ILs
- ILs interleukins
- ILs interleukins
- IL-1 interleukins
- IL-2 interleukins
- IL-3 interleukins
- IL-4 interleukins
- IL-5 IL-6
- IL-7 IL-8
- IL-9 IL-11
- IL-12 IL-15
- tumor necrosis factor such as TNF-a or TNF- ⁇
- KL kit ligand
- cytokine includes proteins from natural sources or from recombinant cell culture and biologically active equivalents of the native-sequence cytokines, including synthetically produced small-molecule entities and pharmaceutically acceptable derivatives and salts thereof.
- PD-1 axis binding antagonist is a molecule that inhibits the interaction of a PD-1 axis binding partner with either one or more of its binding partner, so as to remove T-cell dysfunction resulting from signaling on the PD-1 signaling axis - with a result being to restore or enhance T-cell function (e.g., proliferation, cytokine production, target cell killing).
- a PD-1 axis binding antagonist includes a PD-1 binding antagonist, a PD-L1 binding antagonist and a PD-L2 binding antagonist.
- PD-1 binding antagonists is a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of PD-1 with one or more of its binding partners, such as PD-L1, PD-L2.
- the PD-1 binding antagonist is a molecule that inhibits the binding of PD-1 to its binding partners.
- the PD-1 binding antagonist inhibits the binding of PD-1 to PD-L1 and/or PD-L2.
- PD-1 binding antagonists include anti-PD-1 antibodies, antigen binding fragments thereof, immunoadhesins, fusion proteins, oligopeptides and other molecules that decrease, block, inhibit, abrogate or interfere with signal transduction resulting from the interaction of PD-1 with PD-L1 and/or PD-L2.
- a PD-1 binding antagonist reduces the negative co- stimulatory signal mediated by or through cell surface proteins expressed on T lymphocytes mediated signaling through PD-1 so as render a dysfunctional T-cell less dysfunctional (e.g. , enhancing effector responses to antigen recognition).
- the PD-1 binding antagonist is an anti-PD-1 antibody.
- a PD-1 binding antagonist is MDX- 1 106 described herein.
- a PD-1 binding antagonist is Merck 3745 described herein.
- a PD-1 binding antagonist is CT-011 described herein.
- PD-Ll binding antagonists is a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of PD-Ll with either one or more of its binding partners, such as PD-1, B7-1.
- a PD- Ll binding antagonist is a molecule that inhibits the binding of PD-Ll to its binding partners.
- the PD-Ll binding antagonist inhibits binding of PD-Ll to PD-1 and/or B7-1.
- the PD-Ll binding antagonists include anti-PD-Ll antibodies, antigen binding fragments thereof, immunoadhesins, fusion proteins, oligopeptides and other molecules that decrease, block, inhibit, abrogate or interfere with signal transduction resulting from the interaction of PD-Ll with one or more of its binding partners, such as PD-1, B7- 1.
- a PD-Ll binding antagonist reduces the negative co-stimulatory signal mediated by or through cell surface proteins expressed on T lymphocytes mediated signaling through PD-Ll so as to render a dysfunctional T-cell less dysfunctional (e.g. , enhancing effector responses to antigen recognition).
- a PD-Ll binding antagonist is an anti-PD-Ll antibody.
- an anti-PD-Ll antibody is YW243.55.S70 described herein.
- an anti-PD-Ll antibody is MDX- 1 105 described herein.
- an anti-PD-Ll antibody is MPDL3280A described herein.
- PD-L2 binding antagonists is a molecule that decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of PD-L2 with either one or more of its binding partners, such as PD-1.
- a PD-L2 binding antagonist is a molecule that inhibits the binding of PD-L2 to its binding partners.
- the PD-L2 binding antagonist inhibits binding of PD-L2 to PD-1.
- the PD-L2 antagonists include anti-PD-L2 antibodies, antigen binding fragments thereof, immunoadhesins, fusion proteins, oligopeptides and other molecules that decrease, block, inhibit, abrogate or interfere with signal transduction resulting from the interaction of PD-L2 with either one or more of its binding partners, such as PD-1.
- a PD-L2 binding antagonist reduces the negative co- stimulatory signal mediated by or through cell surface proteins expressed on T lymphocytes mediated signaling through PD-L2 so as render a dysfunctional T-cell less dysfunctional (e.g., enhancing effector responses to antigen recognition).
- a PD-L2 binding antagonist is an immunoadhesin.
- phagocytosis means the internalization of cells or particulate matter by cells.
- the phagocytic cells or phagocytes are macrophages or neutrophils.
- the cells are cells that express human OX40.
- Methods for assaying phagocytosis are known in the art and include use of microscopy to detect the presence of cells internalized within another cells.
- phagocytosis is detected using FACS, e.g., by detecting presence of a detectably labeled cell within another cell (which may be detectably labeled, e.g., with a different label than the first cell).
- the phrase "does not possess substantial activity” or “substantially no activity” with respect to an antibody, as used herein, means the antibody does not exhibit an activity that is above background level (in some embodiments, that is above background level that is statistically significant).
- the phrase “little to no activity” with respect to an antibody, as used herein, means the antibody does not display a biologically meaningful amount of a function.
- the function can be measured or detected according to any assay or technique known in the art, including, e.g., those described herein.
- antibody function is stimulation of effector T cell proliferation and/or cytokine secretion.
- biomarker refers generally to a molecule, including a gene, mRNA, protein, carbohydrate structure, or glycolipid, the expression of which in or on a tissue or cell or secreted can be detected by known methods (or methods disclosed herein) and is predictive or can be used to predict (or aid prediction) for a cell, tissue, or patient's responsiveness to treatment regimes.
- a biomarker may refer to a gene or protein, e.g., the level of expression of the gene or protein detected in one or more cells.
- a biomarker may refer to a cell type of interest, e.g., the number of a cell type of interest detected in one or more samples.
- patient sample is meant a collection of cells or fluids obtained from a cancer patient.
- the source of the tissue or cell sample may be solid tissue as from a fresh, frozen and/or preserved organ or tissue sample or biopsy or aspirate; blood or any blood
- tissue sample may contain compounds which are not naturally intermixed with the tissue in nature such as preservatives, anticoagulants, buffers, fixatives, nutrients, antibiotics, or the like.
- tumor samples herein include, but are not limited to, tumor biopsy, fine needle aspirate, bronchiolar lavage, pleural fluid, sputum, urine, a surgical specimen, circulating tumor cells, serum, plasma, circulating plasma proteins, ascitic fluid, primary cell cultures or cell lines derived from tumors or exhibiting tumor-like properties, as well as preserved tumor samples, such as formalin-fixed, paraffin-embedded tumor samples or frozen tumor samples.
- the phrase "based on expression of when used herein means that information about expression level or presence or absence of expression (e.g., presence or absence or prevalence of (e.g., percentage of cells displaying) of the one or more biomarkers herein (e.g., presence or absence of or amount or prevalence of FcR-expressing cells, or e.g., presence or absence or amount or prevalence of human effector cells) is used to inform a treatment decision, information provided on a package insert, or marketing/promotional guidance etc.
- information about expression level or presence or absence of expression e.g., presence or absence or prevalence of (e.g., percentage of cells displaying) of the one or more biomarkers herein (e.g., presence or absence of or amount or prevalence of FcR-expressing cells, or e.g., presence or absence or amount or prevalence of human effector cells) is used to inform a treatment decision, information provided on a package insert, or marketing/promotional guidance etc.
- a cancer or biological sample which "has human effector cells” is one which, in a diagnostic test, has human effector cells present in the sample (e.g., infiltrating human effector cells).
- a cancer or biological sample which "has FcR-expressing cells" is one which, in a diagnostic test, has FcR-expressing present in the sample (e.g., infiltrating FcR-expressing cells).
- FcR is FcyR.
- FcR is an activating FcyR.
- the phrase "recommending a treatment” as used herein refers to using the information or data generated relating to the level or presence of c-met in a sample of a patient to identify the patient as suitably treated or not suitably treated with a therapy.
- the therapy may comprise c-met antibody (e.g., onartuzumab).
- the therapy may comprise VEGF antagonist (e.g., bevacizumab).
- the therapy may comprise anti-human OX40 agonist antibody.
- the information or data may be in any form, written, oral or electronic.
- using the information or data generated includes communicating, presenting, reporting, storing, sending, transferring, supplying, transmitting, delivering, dispensing, or combinations thereof.
- communicating, presenting, reporting, storing, sending, transferring, supplying, transmitting, delivering, dispensing, or combinations thereof are performed by a computing device, analyzer unit or combination thereof.
- communicating, presenting, reporting, storing, sending, transferring, supplying, transmitting, dispensing, or combinations thereof are performed by an individual (e.g., a laboratory or medical professional).
- the information or data includes a comparison of the amount or prevalence of FcR expressing cells to a reference level. In some embodiments, the information or data includes a comparison of the amount or prevalence of human effector cells to a reference level. In some embodiments, the
- information or data includes an indication that human effector cells or FcR-expressing cells are present or absent in the sample.
- the information or data includes an indication that FcR-expressing cells and/or human effector cells are present in a particular percentage of cells (e.g., high prevalence).
- the information or data includes an indication that the patient is suitably treated or not suitably treated with a therapy comprising anti-human OX40 agonist antibody.
- detection includes any means of detecting, including direct and indirect detection.
- the "amount” or “level” of a biomarker associated with an increased clinical benefit to an individual is a detectable level in a biological sample. These can be measured by methods known to one skilled in the art and also disclosed herein. The expression level or amount of biomarker assessed can be used to determine the response to the treatment.
- Elevated expression refers to an increased expression or increased levels of a biomarker in an individual relative to a control, such as an individual or individuals who are not suffering from the disease or disorder (e.g., cancer), a tumor with a known responsiveness to a treatment (e.g., with an OX40 agonist), an internal control (e.g., housekeeping biomarker), or a reference number (e.g., a set threshold amount, such as a threshold based on clinical outcome data).
- a control such as an individual or individuals who are not suffering from the disease or disorder (e.g., cancer), a tumor with a known responsiveness to a treatment (e.g., with an OX40 agonist), an internal control (e.g., housekeeping biomarker), or a reference number (e.g., a set threshold amount, such as a threshold based on clinical outcome data).
- a control such as an individual or individuals who are not suffering from the disease or disorder (e.g., cancer), a tumor with
- Reduced expression refers to a decrease expression or decreased levels of a biomarker in an individual relative to a control, such as an individual or individuals who are not suffering from the disease or disorder (e.g., cancer), a tumor with a known responsiveness to a treatment (e.g., with an OX40 agonist), an internal control (e.g., housekeeping biomarker), or a reference number (e.g., a set threshold amount, such as a threshold based on clinical outcome data).
- a control such as an individual or individuals who are not suffering from the disease or disorder (e.g., cancer), a tumor with a known responsiveness to a treatment (e.g., with an OX40 agonist), an internal control (e.g., housekeeping biomarker), or a reference number (e.g., a set threshold amount, such as a threshold based on clinical outcome data).
- reduced expression is little or no expression.
- housekeeping gene or “housekeeping biomarker” as used herein may refer to any gene or genes thought to be constitutively expressed in a cell in normal and/or pathological states. Such a gene may be used, for example, as a reference, since its expression is detectable at a consistent amount across different physiological conditions. In some embodiments, a housekeeping gene may encode a protein required for basic cellular function and/or maintenance.
- diagnosis is used herein to refer to the identification or classification of a molecular or pathological state, disease or condition (e.g., cancer).
- a molecular or pathological state e.g., cancer
- diagnosis may refer to identification of a particular type of cancer. “Diagnosis” may also refer to the classification of a particular subtype of cancer, e.g., by histopathological criteria, or by molecular features (e.g., a subtype characterized by expression of one or a combination of biomarkers (e.g., particular genes or proteins encoded by said genes)).
- biomarkers e.g., particular genes or proteins encoded by said genes
- a method of aiding diagnosis of a disease or condition can comprise measuring certain biomarkers in a biological sample from an individual.
- sample refers to a composition that is obtained or derived from a subject and/or individual of interest that contains a cellular and/or other molecular entity that is to be characterized and/or identified, for example based on physical, biochemical, chemical and/or physiological characteristics.
- disease sample and variations thereof refers to any sample obtained from a subject of interest that would be expected or is known to contain the cellular and/or molecular entity that is to be characterized.
- Samples include, but are not limited to, primary or cultured cells or cell lines, cell supernatants, cell lysates, platelets, serum, plasma, vitreous fluid, lymph fluid, synovial fluid, follicular fluid, seminal fluid, amniotic fluid, milk, whole blood, blood-derived cells, urine, cerebrospinal fluid, saliva, sputum, tears, perspiration, mucus, tumor lysates, and tissue culture medium, tissue extracts such as homogenized tissue, tumor tissue, cellular extracts, and combinations thereof.
- tissue sample or “cell sample” is meant a collection of similar cells obtained from a tissue of a subject or individual.
- the source of the tissue or cell sample may be solid tissue as from a fresh, frozen and/or preserved organ, tissue sample, biopsy, and/or aspirate; blood or any blood constituents such as plasma; bodily fluids such as cerebral spinal fluid, amniotic fluid, peritoneal fluid, or interstitial fluid; cells from any time in gestation or development of the subject.
- the tissue sample may also be primary or cultured cells or cell lines.
- the tissue or cell sample is obtained from a disease tissue/organ.
- the tissue sample may contain compounds which are not naturally intermixed with the tissue in nature such as preservatives, anticoagulants, buffers, fixatives, nutrients, antibiotics, or the like.
- a "section" of a tissue sample is meant a single part or piece of a tissue sample, e.g. a thin slice of tissue or cells cut from a tissue sample. It is understood that multiple sections of tissue samples may be taken and subjected to analysis according to the present invention, provided that it is understood that the present invention comprises a method whereby the same section of tissue sample is analyzed at both morphological and molecular levels, or is analyzed with respect to protein or nucleic acid.
- correlate or “correlating” is meant comparing, in any way, the performance and/or results of a first analysis or protocol with the performance and/or results of a second analysis or protocol.
- polypeptide analysis or protocol one may use the results of the polypeptide expression analysis or protocol to determine whether a specific therapeutic regimen should be performed.
- polynucleotide analysis or protocol one may use the results of the polynucleotide expression analysis or protocol to determine whether a specific therapeutic regimen should be performed.
- “Individual response” or “response” can be assessed using any endpoint indicating a benefit to the individual, including, without limitation, (1) inhibition, to some extent, of disease progression (e.g., cancer progression), including slowing down and complete arrest; (2) a reduction in tumor size; (3) inhibition (i.e., reduction, slowing down or complete stopping) of cancer cell infiltration into adjacent peripheral organs and/or tissues; (4) inhibition (i.e.
- an "effective response" of a patient or a patient's “responsiveness" to treatment with a medicament and similar wording refers to the clinical or therapeutic benefit imparted to a patient at risk for, or suffering from, a disease or disorder, such as cancer.
- a disease or disorder such as cancer.
- such benefit includes any one or more of: extending survival (including overall survival and progression free survival); resulting in an objective response (including a complete response or a partial response); or improving signs or symptoms of cancer.
- extending survival is meant increasing overall or progression free survival in a treated patient relative to an untreated patient (i.e. relative to a patient not treated with the medicament), or relative to a patient who does not express a biomarker at the designated level, and/or relative to a patient treated with an approved anti-tumor agent.
- An objective response refers to a measurable response, including complete response (CR) or partial response (PR).
- OX40 Agonists Provided herein are methods for predicting responsiveness of a subject having cancer to an OX40 agonist treatment. These methods are based in part on the discovery described herein that the expression level of specific biomarkers correlates with
- responsiveness to OX40 agonist treatment For example, an increased expression level of genes such as CD8a, CD8b, H2-d, CTLA4, CD64, CXCL9, IFNg, IDOl, GZMA, GZMB, PRF1, PDCA1, KLRK1, PTPRC, CXCL1, ITGAM, and IL7R correlates with responsiveness to OX40 agonist treatment. Additionally, a decreased expression level of genes such as CSF2, CCL22, EPCAM, GAT A3, IL13, and VTCN1 was also found to correlate with responsiveness to OX40 agonist treatment.
- RNA samples obtained from the subject where the subject has been treated with an OX40 agonist, and where the one or more marker genes are selected from ARG1, CCL2, CCL22, CCL5, CCR5, CD226, CD27, CD274, CD28, CD3E, CD40, CD8A, CD8b, CXCL10, CXCL9, EOMES, FasL, Fcgrl/CD64, FOXP3, GZMA, GZMB, HAVCR2, ICAM1, IDOl, IFNg, IL10, IL12A (TD02), IL13, IL2, IL7R, ITGAM, KLRK1, LAG3, MAP4K1, MS4A1, PDCD1, PDCD1LG2, PRF1, PTPRC, TNF, TNFRSF14, TNFRSF9, and TNFSF4;
- Yet further provided herein are methods monitoring responsiveness of a subject to an OX40 agonist treatment by measuring the expression level of one or more marker genes in a sample containing leukocytes obtained from the subject, where the subject has been treated with an OX40 agonist, and where the one or more marker genes are selected from BTLA, CD4, CD69, CD80, CD83, CD86, CSF2, CTLA4, CXCR3, Fcgr2b/CD32, Fcgr3/CD16, H2- aa, H2-d, H2-k, ICOS, IL10, PDCA1, and TNFRSF18; and classifying the subject as responsive or non-responsive to said treatment based on the expression level of said one or more marker genes in the sample obtained from the subject, as compared with a reference, wherein an increased expression level of the one or more marker genes as compared with the reference indicates a responsive subject.
- These methods are based in part on the discovery described herein that the expression level of specific biomarkers is upregulated upon OX40 agonist
- an OX40 agonist is an isolated antibody that binds to human OX40.
- Antibodies suitable for use in the methods of the invention include antibodies that bind to human OX40. Descriptions of anti-OX40 antibodies (e.g., anti-human OX40 agonist antibodies) may be found in US PG Pub. No. US2015/0307617 and International Publication No. WO/2015/153513, which are each incorporated by reference herein in their entirety.
- the anti-human OX40 agonist antibody binds human OX40 with an affinity of less than or equal to about 0.45 nM. In some embodiments, the anti-human OX40 antibody binds human OX40 with an affinity of less than or equal to about 0.4 nM. In some embodiments, the anti-human OX40 antibody binds human OX40 with an affinity of less than or equal to about 0.5nM. In some embodiments, the binding affinity is determined using radioimmunoassay.
- the anti-human OX40 agonist antibody binds human OX40 and cynomolgus OX40. In some embodiments, binding is determined using a FACS assay. In some embodiments, binding to human OX40 has an EC50 of about 0.2 ug/ml. In some embodiments, binding to human OX40 has an EC50 of about 0.3 ug/ml or lower. In some embodiments, binding to cynomolgus OX40 has an EC50 of about 1.5 ug/ml. In some embodiments, binding to cynomolgus OX40 has an EC50 of about 1.4 ug/ml.
- the anti-human OX40 agonist antibody does not bind to rat OX40 or mouse OX40.
- the anti-human OX40 agonist antibody is a depleting anti- human OX40 antibody (e.g., depletes cells that express human OX40).
- a depleting anti- human OX40 antibody e.g., depletes cells that express human OX40.
- the human OX40 expressing cells are CD4+ effector T cells. In some embodiments, the human OX40 expressing cells are Treg cells. In some embodiments, depleting is by ADCC and/or phagocytosis. In some embodiments, the antibody mediates ADCC by binding FcyR expressed by a human effector cell and activating the human effector cell function. In some embodiments, the antibody mediates phagocytosis by binding FcyR expressed by a human effector cell and activating the human effector cell function.
- Exemplary human effector cells include, e.g., macrophage, natural killer (NK) cells, monocytes, neutrophils.
- the human effector cell is macrophage.
- the human effector cell is NK cells.
- depletion is not by apoptosis.
- the anti-human OX40 agonist antibody has a functional Fc region.
- effector function of a functional Fc region is ADCC.
- effector function of a functional Fc region is phagocytosis.
- effector function of a functional Fc region is ADCC and phagocytosis.
- the Fc region is human IgGl.
- the Fc region is human IgG4.
- the anti-human OX40 agonist antibody does not induce apoptosis in OX40-expressing cells (e.g., Treg).
- apoptosis is assayed using an antibody concentration of 30ug/ml, e.g., by determining whether apoptosis has occurred using annexin V and proprodium iodide stained Treg.
- the anti-human OX40 agonist antibody enhances CD4+ effector T cell function, for example, by increasing CD4+ effector T cell proliferation and/or increasing gamma interferon production by the CD4+ effector T cell (for example, as compared to proliferation and/or cytokine production prior to treatment with anti-human OX40 agonist antibody).
- the cytokine is gamma interferon.
- the anti-human OX40 agonist antibody increases number of intratumoral (infiltrating) CD4+ effector T cells (e.g., total number of CD4+ effector T cells, or e.g., percentage of CD4+ cells in CD45+ cells), e.g., as compared to number of intratumoral (infiltrating) CD4+ T cells prior to treatment with anti-human OX40 agonist antibody.
- the anti-human OX40 agonist antibody increases number of intratumoral (infiltrating) CD4+ effector T cells that express gamma interferon (e.g., total gamma interferon expressing CD4+ cells, or e.g., percentage of gamma interferon expressing CD4+ cells in total CD4+ cells), e.g., as compared to number of intratumoral (infiltrating) CD4+ T cells that express gamma interferon prior to treatment with anti-human OX40 agonist antibody.
- gamma interferon e.g., total gamma interferon expressing CD4+ cells, or e.g., percentage of gamma interferon expressing CD4+ cells in total CD4+ cells
- the anti-human OX40 agonist antibody increases number of intratumoral (infiltrating) CD8+ effector T cells (e.g., total number of CD8+ effector T cells, or e.g., percentage of CD8+ in CD45+ cells), e.g., as compared to number of intratumoral (infiltrating) CD8+ T effector cells prior to treatment with anti-human OX40 agonist antibody.
- the anti-human OX40 agonist antibody increases number of intratumoral (infiltrating) CD8+ effector T cells that express gamma interferon (e.g., percentage of CD8+ cells that express gamma interferon in total CD8+ cells), e.g., compared to number of intratumoral (infiltrating) CD8+ T cells that express gamma interferon prior to treatment with anti-human OX40 agonist antibody.
- the anti-human OX40 agonist antibody enhances memory T cell function, for example by increasing memory T cell proliferation and/or increasing cytokine production by the memory cell.
- the cytokine is gamma interferon.
- the anti-human OX40 agonist antibody inhibits Treg function, for example, by decreasing Treg suppression of effector T cell function (e.g., effector T cell proliferation and/or effector T cell cytokine secretion).
- the effector T cell is a CD4+ effector T cell.
- the anti-human OX40 agonist antibody reduces the number of intratumoral (infiltrating) Treg (e.g., total number of Treg or e.g., percentage of Fox3p+ cells in CD4+ cells).
- the anti-human OX40 agonist antibody is engineered to increase effector function (e.g., compared to effector function in a wild-type IgGl).
- the antibody has increased binding to a Fey receptor.
- the antibody lacks fucose attached (directly or indirectly) to the Fc region.
- the amount of fucose in such antibody may be from 1% to 80%, from 1% to 65%, from 5% to 65% or from 20% to 40%.
- the Fc region comprises bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc.
- the antibody comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
- the anti-human OX40 agonist antibody increases OX40 signal transduction in a target cell that expresses OX40.
- OX40 signal transduction is detected by monitoring NFkB downstream signaling.
- the anti-human OX40 agonist antibody is stable after treatment at 40C for two weeks.
- the anti-human OX40 agonist antibody binds human effector cells, e.g., binds FcyR (e.g., an activating FcyR) expressed by human effector cells.
- FcyR e.g., an activating FcyR
- the human effector cell performs (is capable of performing) ADCC effector function.
- the human effector cell performs (is capable of performing) phagocytosis effector function.
- the anti-human OX40 agonist antibody comprising a variant IgGl Fc polypeptide comprising a mutation that eliminates binding to human effector cells has diminished activity (e.g., CD4+ effector T cell function, e.g., proliferation), relative to anti-human OX40 agonist antibody comprising native sequence IgGl Fc portion.
- the anti-human OX40 agonist antibody comprising a variant IgGl Fc polypeptide comprising a mutation that eliminates binding to human effector cells does not possess substantial activity (e.g., CD4+ effector T cell function, e.g., proliferation).
- antibody cross-linking is required for anti-human OX40 agonist antibody function.
- function is stimulation of CD4+ effector T cell proliferation.
- antibody cross-linking is determined by providing anti-human OX40 agonist antibody adhered on a solid surface (e.g., a cell culture plate).
- antibody cross-linking is determined by introducing a mutation in the antibody's IgGl Fc portion (e.g., a DANA mutation) and testing function of the mutant antibody.
- the anti-human OX40 agonist antibody competes for binding to human OX40 with OX40L.
- addition of OX40L does not enhance anti-human OX40 antibody function in an in vitro assay.
- the anti-human OX40 agonist antibodies include any one, any combination, or all of the following properties: (1) binds human OX40 with an affinity of less than or equal to about 0.45 nM, in some embodiments, binds human OX40 with an affinity of less than or equal to about 0.4 nM, in some embodiments, binds human OX40 with an affinity of less than or equal to about 0.5nM, in some embodiments, the binding affinity is determined using radioimmunoassay; (2) binds human OX40 and cynomolgus OX40, in some embodiments, binding is determined using a FACS assay, (3) binds human OX40 with an EC50 of about 0.2 ug/ml, in some embodiments, binds to human OX40 has an EC50 of about 0.3 ug/ml or lower, in some embodiments, binds to cynomolgus OX40 with an EC50 of about 1.5 ug
- the effector T cell is a CD4+ effector T cell, (10) increases OX40 signal transduction in a target cell that expresses OX40 (in some embodiments, OX40 signal transduction is detected by monitoring NFkB downstream signaling), (11) is stable after treatment at 40C for two weeks, (12) binds human effector cells, e.g., binds FcyR expressed by human effector cells, (13) anti-human OX40 agonist antibody comprising a variant IgGl Fc polypeptide comprising a mutation that eliminates binding to human effector cells (e.g., N297G) has diminished activity (e.g., CD4+ effector T cell function, e.g., proliferation), relative to anti-human OX40 agonist antibody comprising native sequence IgGl Fc portion, in some embodiment, the anti-human OX40 agonist antibody comprising a variant IgGl Fc polypeptide comprising a mutation that eliminates binding to human effector cells (e.g.
- the invention provides an anti-human OX40 agonist antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:7.
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:2
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:3
- HVR-H3 comprising the amino acid sequence of SEQ ID NO:4
- HVR-L1 comprising the amino acid sequence of SEQ ID NO:5
- HVR-L2
- the invention provides an anti-human OX40 agonist antibody comprising at least one, at least two, or all three VH HVR sequences selected from (a) HVR- Hl comprising the amino acid sequence of SEQ ID NO:2; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:4.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:4 and HVR-L3 comprising the amino acid sequence of SEQ ID NO:7.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:4, HVR-L3 comprising the amino acid sequence of SEQ ID NO:7, and HVR-H2 comprising the amino acid sequence of SEQ ID NO:3.
- the antibody comprises (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4.
- the invention provides an anti-human OX40 agonist antibody comprising at least one, at least two, or all three VL HVR sequences selected from (a) HVR- Ll comprising the amino acid sequence of SEQ ID NO:5; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:7.
- the antibody comprises (a) HVR-Ll comprising the amino acid sequence of SEQ ID NO:5; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:7.
- an anti-human OX40 agonist antibody of the invention comprises (a) a VH domain comprising at least one, at least two, or all three VH HVR sequences selected from (i) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2, (ii) HVR- H2 comprising the amino acid sequence of SEQ ID NO:3, and (iii) HVR-H3 comprising an amino acid sequence selected from SEQ ID NO:4; and (b) a VL domain comprising at least one, at least two, or all three VL HVR sequences selected from (i) HVR-Ll comprising the amino acid sequence of SEQ ID NO:5, (ii) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6, and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:7.
- the invention provides an anti-human OX40 agonist antibody comprising (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:5; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (f) HVR-L3 comprising an amino acid sequence selected from SEQ ID NO:7.
- the invention provides an anti-human OX40 agonist antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:5; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:26.
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:2
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:3
- HVR-H3 comprising the amino acid sequence of SEQ ID NO:4
- HVR-Ll comprising the amino acid sequence of SEQ ID NO:5
- HVR-L2
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:4 and HVR-L3 comprising the amino acid sequence of SEQ ID NO:26.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:4, HVR-L3 comprising the amino acid sequence of SEQ ID NO:26, and HVR-H2 comprising the amino acid sequence of SEQ ID NO:3.
- an antibody of the invention comprises (a) a VH domain comprising at least one, at least two, or all three VH HVR sequences selected from (i) HVR- Hl comprising the amino acid sequence of SEQ ID NO:2, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3, and (iii) HVR-H3 comprising an amino acid sequence selected from SEQ ID NO:4; and (b) a VL domain comprising at least one, at least two, or all three VL HVR sequences selected from (i) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5, (ii) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6, and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:26.
- the invention provides an antibody comprising (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (f) HVR-L3 comprising an amino acid sequence selected from SEQ ID NO:26.
- the invention provides an anti-human OX40 agonist antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:27.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:4 and HVR-L3 comprising the amino acid sequence of SEQ ID NO:27.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:4, HVR-L3 comprising the amino acid sequence of SEQ ID NO:27, and HVR-H2 comprising the amino acid sequence of SEQ ID NO:3.
- an antibody of the invention comprises (a) a VH domain comprising at least one, at least two, or all three VH HVR sequences selected from (i) HVR- Hl comprising the amino acid sequence of SEQ ID NO:2, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3, and (iii) HVR-H3 comprising an amino acid sequence selected from SEQ ID NO:4; and (b) a VL domain comprising at least one, at least two, or all three VL HVR sequences selected from (i) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5, (ii) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6, and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:27.
- the invention provides an antibody comprising (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (f) HVR-L3 comprising an amino acid sequence selected from SEQ ID NO:27.
- the invention provides an anti-human OX40 agonist antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2, 8 or 9; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3, 10, 11, 12, 13 or 14; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4, 15, or 19; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:7, 22, 23, 24, 25, 26, 27, or 28.
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:2, 8 or 9
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:3, 10, 11, 12, 13 or 14
- HVR-H3 comprising the amino acid sequence of SEQ ID
- the invention provides an antibody comprising at least one, at least two, or all three VH HVR sequences selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 2, 8 or 9; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 3, 10, 11, 12, 13 or 14; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 4, 15, or 19.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO: 4, 15, or 19.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:4, 15, or 19 and HVR-L3 comprising the amino acid sequence of SEQ ID NO: 7, 22, 23, 24, 25, 26, 27, or 28.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO: 4, 15, or 19, HVR-L3 comprising the amino acid sequence of SEQ ID NO: 7, 22, 23, 24, 25, 26, 27, or 28, and HVR-H2 comprising the amino acid sequence of SEQ ID NO: 3, 10, 11, 12, 13 or 14.
- the antibody comprises (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 2, 8 or 9; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 3, 10, 11, 12, 13 or 14; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 4, 15, or 19.
- the invention provides an antibody comprising at least one, at least two, or all three VL HVR sequences selected from (a) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 5; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 7, 22, 23, 24, 25, 26, 27, or 28.
- the antibody comprises (a) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 7, 22, 23, 24, 25, 26, 27, or 28.
- an antibody of the invention comprises (a) a VH domain comprising at least one, at least two, or all three VH HVR sequences selected from (i) HVR- Hl comprising the amino acid sequence of SEQ ID NO: 2, 8 or 9, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 3, 10, 11, 12, 13 or 14, and (iii) HVR-H3 comprising an amino acid sequence selected from SEQ ID NO: 4, 15, or 19; and (b) a VL domain comprising at least one, at least two, or all three VL HVR sequences selected from (i) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5, (ii) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6, and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 7, 22, 23, 24, 25, 26, 27, or 28.
- the invention provides an antibody comprising (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 2, 8 or 9; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 3, 10, 11, 12, 13 or 14; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 4, 15, or 19; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (f) HVR-L3 comprising an amino acid sequence selected from SEQ ID NO: 7, 22, 23, 24, 25, 26, 27, or 28.
- the invention provides an anti-human OX40 agonist antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 172; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 173; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 174; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 175.
- HVR-H2 is not
- HVR-H3 is not APRWAAAA (SEQ ID NO:223).
- HVR-L3 is not QAAAAAAAT (SEQ ID NO:224).
- the invention provides an antibody comprising at least one, at least two, or all three VH HVR sequences selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 172; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 173; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 174.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO: 174.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO: 174 and HVR-L3 comprising the amino acid sequence of SEQ ID NO: 175.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO: 174, HVR-L3 comprising the amino acid sequence of SEQ ID NO: 175, and HVR-H2 comprising the amino acid sequence of SEQ ID NO: 173.
- the antibody comprises (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 172; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 173; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 174.
- HVR-H2 is not DMYPDAAAASYNQKFRE (SEQ ID NO:222).
- HVR-H3 is not APRWAAAA (SEQ ID NO:223).
- HVR-L3 is not QAAAAAAAT (SEQ ID NO:224).
- the invention provides an antibody comprising (a) HVR-Ll comprising the amino acid sequence of SEQ ID NO:5; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 175.
- HVR-L3 is not QAAAAAAAT (SEQ ID NO:224).
- an antibody of the invention comprises (a) a VH domain comprising at least one, at least two, or all three VH HVR sequences selected from (i) HVR- Hl comprising the amino acid sequence of SEQ ID NO: 172, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 173, and (iii) HVR-H3 comprising an amino acid sequence selected from SEQ ID NO: 174; and (b) a VL domain comprising at least one, at least two, or all three VL HVR sequences selected from (i) HVR-Ll comprising the amino acid sequence of SEQ ID NO:5, (ii) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6, and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 175.
- the invention provides an antibody comprising (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 172; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 173; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 174; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:5; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (f) HVR-L3 comprising an amino acid sequence selected from SEQ ID NO: 175.
- HVR-H2 is not
- HVR-H3 is not APRWAAAA (SEQ ID NO:223).
- HVR-L3 is not QAAAAAAAT (SEQ ID NO:224).
- the invention provides an anti-human OX40 agonist antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:29; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:30; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:37; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:39; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42.
- the invention provides an antibody comprising at least one, at least two, or all three VH HVR sequences selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:29; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:30; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:33.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:33 and HVR-L3 comprising the amino acid sequence of SEQ ID NO:42.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:33, HVR-L3 comprising the amino acid sequence of SEQ ID NO:42, and HVR-H2 comprising the amino acid sequence of SEQ ID NO:30.
- the antibody comprises (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:29; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:30; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33.
- the invention provides an antibody comprising at least one, at least two, or all three VL HVR sequences selected from (a) HVR-L1 comprising the amino acid sequence of SEQ ID NO:37; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:39; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:42.
- the antibody comprises (a) HVR-L1 comprising the amino acid sequence of SEQ ID NO:37; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:39; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:42.
- an antibody of the invention comprises (a) a VH domain comprising at least one, at least two, or all three VH HVR sequences selected from (i) HVR- Hl comprising the amino acid sequence of SEQ ID NO:29, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO:30, and (iii) HVR-H3 comprising an amino acid sequence selected from SEQ ID NO:33; and (b) a VL domain comprising at least one, at least two, or all three VL HVR sequences selected from (i) HVR-L1 comprising the amino acid sequence of SEQ ID NO:37, (ii) HVR-L2 comprising the amino acid sequence of SEQ ID NO:39, and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:42.
- the invention provides an antibody comprising (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:29; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:30; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:37; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:39; and (f) HVR-L3 comprising an amino acid sequence selected from SEQ ID NO:42.
- the invention provides an anti-human OX40 agonist antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:29; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:30; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:37; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:40; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42.
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:29
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:30
- HVR-H3 comprising the amino acid sequence of SEQ ID NO:33
- HVR-Ll comprising the amino acid sequence of SEQ ID NO:37
- HVR-L2
- the invention provides an antibody comprising at least one, at least two, or all three VL HVR sequences selected from (a) HVR-Ll comprising the amino acid sequence of SEQ ID NO:37; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:40; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:42.
- the antibody comprises (a) HVR-Ll comprising the amino acid sequence of SEQ ID NO:37; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:40; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:42.
- an antibody of the invention comprises (a) a VH domain comprising at least one, at least two, or all three VH HVR sequences selected from (i) HVR- Hl comprising the amino acid sequence of SEQ ID NO:29, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO:30, and (iii) HVR-H3 comprising an amino acid sequence selected from SEQ ID NO:33; and (b) a VL domain comprising at least one, at least two, or all three VL HVR sequences selected from (i) HVR-Ll comprising the amino acid sequence of SEQ ID NO:37, (ii) HVR-L2 comprising the amino acid sequence of SEQ ID NO:40, and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:42.
- the invention provides an antibody comprising (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:29; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:30; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:37; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:40; and (f) HVR-L3 comprising an amino acid sequence selected from SEQ ID NO:42.
- the invention provides an anti-human OX40 agonist antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:29; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:30, 31, or 32; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:37; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:39, 40 or 41; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:42, 43, or 44.
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:29
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:30, 31, or 32
- HVR-H3 comprising the amino acid sequence of SEQ ID NO:33
- HVR-Ll comprising the
- the invention provides an antibody comprising at least one, at least two, or all three VH HVR sequences selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:29; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 30, 31, or 32; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:33 and HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42, 43, or 44.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:33, HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42, 43, or 44, and HVR-H2 comprising the amino acid sequence of SEQ ID NO: 39, 40 or 41.
- the antibody comprises (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:29; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:30, 31, or 32; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33.
- the invention provides an antibody comprising at least one, at least two, or all three VL HVR sequences selected from (a) HVR-Ll comprising the amino acid sequence of SEQ ID NO:37; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 39, 40 or 41; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42, 43, or 44.
- the antibody comprises (a) HVR-Ll comprising the amino acid sequence of SEQ ID NO:37; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 39, 40 or 41; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42, 43, or 44.
- an antibody of the invention comprises (a) a VH domain comprising at least one, at least two, or all three VH HVR sequences selected from (i) HVR- Hl comprising the amino acid sequence of SEQ ID NO:29, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 30, 31, or 32, and (iii) HVR-H3 comprising an amino acid sequence selected from SEQ ID NO:33; and (b) a VL domain comprising at least one, at least two, or all three VL HVR sequences selected from (i) HVR-L1 comprising the amino acid sequence of SEQ ID NO:37, (ii) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 39, 40 or 41, and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42, 43, or 44.
- the invention provides an antibody comprising (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:29; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 30, 31, or 32; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:37; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 39, 40 or 41; and (f) HVR-L3 comprising an amino acid sequence selected from SEQ ID NO: 42, 43, or 44.
- the invention provides an anti-human OX40 agonist antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:29; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 175; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:37; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 177; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 178.
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:29
- HVR-H2 comprising the amino acid sequence of SEQ ID NO: 175
- HVR-H3 comprising the amino acid sequence of SEQ ID NO:33
- HVR-L1 comprising the amino acid sequence of SEQ ID NO:37
- the invention provides an antibody comprising at least one, at least two, or all three VH HVR sequences selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:29; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 175; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:33 and HVR-L3 comprising the amino acid sequence of SEQ ID NO: 177.
- the antibody comprises HVR-H3 comprising the amino acid sequence of SEQ ID NO:33, HVR-L3 comprising the amino acid sequence of SEQ ID NO: 178, and HVR-H2 comprising the amino acid sequence of SEQ ID NO: 176.
- the antibody comprises (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:29; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 176; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33.
- the invention provides an antibody comprising at least one, at least two, or all three VL HVR sequences selected from (a) HVR-L1 comprising the amino acid sequence of SEQ ID NO:37; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 177; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 177.
- the antibody comprises (a) HVR-Ll comprising the amino acid sequence of SEQ ID NO:37; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 177; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 178.
- an antibody of the invention comprises (a) a VH domain comprising at least one, at least two, or all three VH HVR sequences selected from (i) HVR- Hl comprising the amino acid sequence of SEQ ID NO:29, (ii) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 176, and (iii) HVR-H3 comprising an amino acid sequence selected from SEQ ID NO:33; and (b) a VL domain comprising at least one, at least two, or all three VL HVR sequences selected from (i) HVR-Ll comprising the amino acid sequence of SEQ ID NO:37, (ii) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 177, and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 178.
- the invention provides an antibody comprising (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:29; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 176; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:37; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 177; and (f) HVR-L3 comprising an amino acid sequence selected from SEQ ID NO: 178.
- an anti-OX40 agonist antibody is humanized.
- an anti-OX40 antibody comprises HVRs as in any of the above
- an anti-OX40 antibody comprises HVRs as in any of the above embodiments, and further comprises a VH and/or VL comprising an FR sequence shown in Figure 11.
- an anti-human OX40 agonist antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 108, 114 or 116.
- VH heavy chain variable domain
- a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-human OX40 agonist antibody comprising that sequence retains the ability to bind to OX40.
- a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO:56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 108, 114 or 116.
- substitutions, insertions, or deletions occur in regions outside the HVRs (i.e., in the FRs).
- the anti-human OX40 agonist antibody comprises the VH sequence in SEQ ID NO: SEQ ID NO:56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 108, 114 or 116, including post-translational modifications of that sequence.
- the VH comprises one, two or three HVRs selected from: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2, (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3, and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4.
- an anti-human OX40 agonist antibody comprising a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95, 97,
- VL light chain variable domain
- a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-human OX40 agonist antibody comprising that sequence retains the ability to bind to OX40.
- a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 109, 115 or 117.
- the substitutions, insertions, or deletions occur in regions outside the HVRs (i.e., in the FRs).
- the anti-human OX40 agonist antibody comprises the VL sequence in SEQ ID NO: 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 109, 115 or 117, including post-translational modifications of that sequence.
- the VL comprises one, two or three HVRs selected from (a) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:7.
- an anti-human OX40 agonist antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:56.
- VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-human OX40 agonist antibody comprising that sequence retains the ability to bind to OX40.
- the anti-human OX40 agonist antibody comprises the VH sequence in SEQ ID NO:56, including post-translational modifications of that sequence.
- the VH comprises one, two or three HVRs selected from: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2, (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3, and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4.
- an anti-human OX40 agonist antibody comprising a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:57.
- VL light chain variable domain
- a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-human OX40 agonist antibody comprising that sequence retains the ability to bind to OX40.
- the anti-human OX40 agonist antibody comprises the VL sequence in SEQ ID NO: 57, including post-translational modifications of that sequence.
- the VL comprises one, two or three HVRs selected from (a) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:7.
- an anti-human OX40 agonist antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:94.
- VH heavy chain variable domain
- a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-human OX40 agonist antibody comprising that sequence retains the ability to bind to OX40.
- the anti-human OX40 agonist antibody comprises the VH sequence in SEQ ID NO:94, including post-translational modifications of that sequence.
- the VH comprises one, two or three HVRs selected from: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2, (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3, and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4.
- an anti-human OX40 agonist antibody comprising a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:95.
- VL light chain variable domain
- a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-human OX40 agonist antibody comprising that sequence retains the ability to bind to OX40.
- the anti-human OX40 agonist antibody comprises the VL sequence in SEQ ID NO:95, including post-translational modifications of that sequence.
- the VL comprises one, two or three HVRs selected from (a) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:26.
- an anti-human OX40 agonist antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:96.
- VH heavy chain variable domain
- a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-human OX40 agonist antibody comprising that sequence retains the ability to bind to OX40.
- the anti-human OX40 agonist antibody comprises the VH sequence in SEQ ID NO:96, including post-translational modifications of that sequence.
- the VH comprises one, two or three HVRs selected from: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:2, (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:3, and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:4.
- an anti-human OX40 agonist antibody comprising a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO:97.
- VL light chain variable domain
- a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-human OX40 agonist antibody comprising that sequence retains the ability to bind to OX40.
- the anti-human OX40 agonist antibody comprises the VL sequence in SEQ ID NO:97, including post-translational modifications of that sequence.
- the VL comprises one, two or three HVRs selected from (a) HVR-L1 comprising the amino acid sequence of SEQ ID NO:5; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:6; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:27.
- an anti-human OX40 agonist antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148.
- VH heavy chain variable domain
- a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-human OX40 agonist antibody comprising that sequence retains the ability to bind to OX40.
- a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148.
- the anti-human OX40 agonist antibody comprises the VH sequence in SEQ ID NO: SEQ ID NO: 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, including post-translational modifications of that sequence.
- the VH comprises one, two or three HVRs selected from: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 29, (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:30, and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:33.
- an anti-human OX40 agonist antibody comprising a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149.
- VL light chain variable domain
- a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-human OX40 agonist antibody comprising that sequence retains the ability to bind to OX40.
- a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149.
- the substitutions, insertions, or deletions occur in regions outside the HVRs (i.e., in the FRs).
- the anti-human OX40 agonist antibody comprises the VL sequence in SEQ ID NO: 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, including post-translational modifications of that sequence.
- the VL comprises one, two or three HVRs selected from (a) HVR-L1 comprising the amino acid sequence of SEQ ID NO:37; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO:39; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:42.
- the antibody comprises the VH and VL sequences in SEQ ID NO:56 and SEQ ID NO:57, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:58 and SEQ ID NO:59, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:60 and SEQ ID NO:61, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:62 and SEQ ID NO:63, respectively, including post-translational modifications of those sequences.
- the antibody comprises the VH and VL sequences in SEQ ID NO:64 and SEQ ID NO:65, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:66 and SEQ ID NO:67, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:68 and SEQ ID NO:69, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:70 and SEQ ID NO:71, respectively, including post-translational modifications of those sequences.
- the antibody comprises the VH and VL sequences in SEQ ID NO:72 and SEQ ID NO:73, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:74 and SEQ ID NO:75, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:76 and SEQ ID NO:77, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:78 and SEQ ID NO:79, respectively, including post-translational modifications of those sequences.
- the antibody comprises the VH and VL sequences in SEQ ID NO: 80 and SEQ ID NO:81, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:82 and SEQ ID NO:83, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:84 and SEQ ID NO:85, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:86 and SEQ ID NO:87, respectively, including post-translational modifications of those sequences.
- the antibody comprises the VH and VL sequences in SEQ ID NO:88 and SEQ ID NO:89, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:90 and SEQ ID NO:91, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:92 and SEQ ID NO:93, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:94 and SEQ ID NO:95, respectively, including post-translational modifications of those sequences.
- the antibody comprises the VH and VL sequences in SEQ ID NO:96 and SEQ ID NO:97, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:98 and SEQ ID NO:99, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO:100 and SEQ ID NO:101, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO: 108 and SEQ ID NO: 109, respectively, including post-translational modifications of those sequences.
- the antibody comprises the VH and VL sequences in SEQ ID NO: 114 and SEQ ID NO: 115, respectively, including post- translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO: 116 and SEQ ID NO: 117, respectively, including post-translational modifications of those sequences.
- the antibody comprises the VH and VL sequences in SEQ ID NO:118 and SEQ ID NO:119, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO: 120 and SEQ ID NO: 121, respectively, including post-translational
- the antibody comprises the VH and VL sequences in SEQ ID NO: 122 and SEQ ID NO: 123, respectively, including post- translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO: 124 and SEQ ID NO: 125, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO: 126 and SEQ ID NO: 127, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO: 128 and SEQ ID NO: 129, respectively, including post-translational modifications of those sequences.
- the antibody comprises the VH and VL sequences in SEQ ID NO: 130 and SEQ ID NO:131, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO: 132 and SEQ ID NO: 133, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO: 134 and SEQ ID NO: 135, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO: 136 and SEQ ID NO: 137, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO: 138 and SEQ ID NO: 139, respectively, including post-translational
- the antibody comprises the VH and VL sequences in SEQ ID NO: 140 and SEQ ID NO: 141, respectively, including post- translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO: 142 and SEQ ID NO: 143, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO: 144 and SEQ ID NO: 145, respectively, including post-translational modifications of those sequences. In one embodiment, the antibody comprises the VH and VL sequences in SEQ ID NO: 146 and SEQ ID NO: 147, respectively, including post-translational modifications of those sequences.
- an anti-human OX40 agonist antibody comprising a VH as in any of the embodiments provided above, and a VL as in any of the embodiments provided above.
- the OX40 agonist antibody is MED 16469. In some embodiments, the OX40 agonist antibody is MED 16469. In some
- the OX40 agonist antibody is MED 10562.
- the invention provides an antibody that binds to the same epitope as an anti-human OX40 antibody provided herein.
- the antibody is an anti-human OX40 agonist antibody.
- an anti-OX40 antibody is a monoclonal antibody, including a chimeric, humanized or human antibody.
- an anti-OX40 antibody is an antibody fragment, e.g., a Fv, Fab, Fab', scFv, diabody, or F(ab')2 fragment.
- the antibody is a full length antibody, e.g., an intact IgGl antibody or other antibody class or isotype as defined herein. In some embodiments, the antibody is a full length intact IgG4 antibody.
- V L VKLLIYYTSRLRSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQGHTLPPTFGQGTKVEIK
- V L VKLLIYYTSRLRSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQGHTLPPTFGQGTKVEIK
- V L VKLLIYYTSRLRSGVPSRFSGSGSGKDYTLTISSLQPEDFATYFC
- V L VKLLIYYTSRLRSGVPSRFSGSGSGKDYTLTISSLQPEDFATYFC
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Analytical Chemistry (AREA)
- Pathology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Hospice & Palliative Care (AREA)
- Oncology (AREA)
- Urology & Nephrology (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Biophysics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Food Science & Technology (AREA)
- General Physics & Mathematics (AREA)
- General Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Business, Economics & Management (AREA)
- Signal Processing (AREA)
- Marketing (AREA)
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP15791886.3A EP3215637B1 (en) | 2014-11-03 | 2015-11-02 | Methods and biomarkers for predicting efficacy and valuation of an ox40 agonist treatment |
| BR112017009159-3A BR112017009159A2 (pt) | 2014-11-03 | 2015-11-02 | métodos e biomarcadores para predizer a eficácia e avaliação de um tratamento com agonista de ox40 |
| SG11201703521UA SG11201703521UA (en) | 2014-11-03 | 2015-11-02 | Methods and biomarkers for predicting efficacy and evaluation of an ox40 agonist treatment |
| CN202111487428.XA CN114381521A (zh) | 2014-11-03 | 2015-11-02 | 用于ox40激动剂治疗的功效预测和评估的方法和生物标志物 |
| JP2017542822A JP2017536842A (ja) | 2014-11-03 | 2015-11-02 | Ox40アゴニスト治療薬の有効性及び評価を予測するための方法及びバイオマーカー |
| HK18102676.7A HK1243738A1 (zh) | 2014-11-03 | 2015-11-02 | 用於ox40激动剂治疗的功效预测和评估的方法和生物标志物 |
| KR1020177014849A KR20170074246A (ko) | 2014-11-03 | 2015-11-02 | Ox40 효능제 치료의 효능 예측 및 평가용 방법 및 바이오마커 |
| RU2017119231A RU2017119231A (ru) | 2014-11-03 | 2015-11-02 | Способы и биомаркеры для прогнозирования эффективности и оценки лечения агонистом ох40 |
| AU2015343339A AU2015343339A1 (en) | 2014-11-03 | 2015-11-02 | Methods and biomarkers for predicting efficacy and evaluation of an OX40 agonist treatment |
| CN201580064147.XA CN107109484B (zh) | 2014-11-03 | 2015-11-02 | 用于ox40激动剂治疗的功效预测和评估的方法和生物标志物 |
| MX2017005751A MX2017005751A (es) | 2014-11-03 | 2015-11-02 | Métodos y biomarcadores para predecir la eficacia y evaluación de un tratamiento con agonista de ox40. |
| CA2966507A CA2966507A1 (en) | 2014-11-03 | 2015-11-02 | Methods and biomarkers for predicting efficacy and evaluation of an ox40 agonist treatment |
| IL251969A IL251969A0 (en) | 2014-11-03 | 2017-04-27 | Methods and biomarkers for predicting efficacy and evaluating treatment with an ox40 agonist |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462074612P | 2014-11-03 | 2014-11-03 | |
| US62/074,612 | 2014-11-03 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2016073380A1 true WO2016073380A1 (en) | 2016-05-12 |
| WO2016073380A8 WO2016073380A8 (en) | 2017-04-06 |
Family
ID=54479025
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/058677 Ceased WO2016073380A1 (en) | 2014-11-03 | 2015-11-02 | Method and biomarkers for predicting efficacy and evaluation of an ox40 agonist treatment |
Country Status (15)
| Country | Link |
|---|---|
| US (3) | US20160160290A1 (enExample) |
| EP (1) | EP3215637B1 (enExample) |
| JP (2) | JP2017536842A (enExample) |
| KR (1) | KR20170074246A (enExample) |
| CN (2) | CN107109484B (enExample) |
| AR (1) | AR102518A1 (enExample) |
| AU (1) | AU2015343339A1 (enExample) |
| BR (1) | BR112017009159A2 (enExample) |
| CA (1) | CA2966507A1 (enExample) |
| HK (1) | HK1243738A1 (enExample) |
| IL (1) | IL251969A0 (enExample) |
| MX (1) | MX2017005751A (enExample) |
| RU (1) | RU2017119231A (enExample) |
| SG (1) | SG11201703521UA (enExample) |
| WO (1) | WO2016073380A1 (enExample) |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016200836A1 (en) * | 2015-06-08 | 2016-12-15 | Genentech, Inc. | Methods of treating cancer using anti-ox40 antibodies |
| US9644032B2 (en) | 2015-05-29 | 2017-05-09 | Bristol-Myers Squibb Company | Antibodies against OX40 and uses thereof |
| US9975957B2 (en) | 2014-03-31 | 2018-05-22 | Genentech, Inc. | Anti-OX40 antibodies and methods of use |
| EP3333268A1 (en) * | 2016-12-09 | 2018-06-13 | Institut Paoli Calmettes | Biomarker panel for prognosis of bladder cancer |
| WO2018112346A1 (en) * | 2016-12-15 | 2018-06-21 | Abbvie Biotherapeutics Inc. | Anti-ox40 antibodies and their uses |
| WO2018177326A1 (en) * | 2017-03-29 | 2018-10-04 | Crown Bioscience Inc. (Taicang) | System and method for determining karenitecin sensitivity on cancer |
| WO2019224275A1 (en) | 2018-05-23 | 2019-11-28 | Adc Therapeutics Sa | Molecular adjuvant |
| JP2019537436A (ja) * | 2017-03-14 | 2019-12-26 | ノヴォミクス・カンパニー・リミテッド | 進行性胃癌患者の手術後の予後または抗癌剤適合性予測システム |
| US10526413B2 (en) | 2015-10-02 | 2020-01-07 | Hoffmann-La Roche Inc. | Bispecific antibodies specific for OX40 |
| US10544223B2 (en) | 2017-04-20 | 2020-01-28 | Adc Therapeutics Sa | Combination therapy with an anti-axl antibody-drug conjugate |
| US10767232B2 (en) | 2014-11-03 | 2020-09-08 | Genentech, Inc. | Methods and biomarkers for predicting efficacy and evaluation of an OX40 agonist treatment |
| US10845364B2 (en) | 2014-11-03 | 2020-11-24 | Genentech, Inc. | Assays for detecting T cell immune subsets and methods of use thereof |
| GB202102396D0 (en) | 2021-02-19 | 2021-04-07 | Adc Therapeutics Sa | Molecular adjuvant |
| WO2021104834A1 (en) | 2019-11-27 | 2021-06-03 | Adc Therapeutics Sa | Combination therapy |
| US11059893B2 (en) | 2015-04-15 | 2021-07-13 | Bergenbio Asa | Humanized anti-AXL antibodies |
| US11318211B2 (en) | 2017-06-14 | 2022-05-03 | Adc Therapeutics Sa | Dosage regimes for the administration of an anti-CD19 ADC |
| RU2771760C1 (ru) * | 2021-12-29 | 2022-05-11 | Федеральное государственное бюджетное учреждение "Российский научный центр радиологии и хирургических технологий имени академика А.М. Гранова" Министерства здравоохранения Российской Федерации | Способ оценки чувствительности опухоли к иммуноонкологическим препаратам |
Families Citing this family (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20160006168A (ko) | 2013-03-18 | 2016-01-18 | 바이오서오엑스 프로덕스 비.브이. | 인간화 항-cd134(ox40) 항체 및 이의 용도 |
| WO2018027204A1 (en) | 2016-08-05 | 2018-02-08 | Genentech, Inc. | Multivalent and multiepitopic anitibodies having agonistic activity and methods of use |
| AU2018253950A1 (en) | 2017-04-20 | 2019-09-19 | Adc Therapeutics Sa | Combination therapy with an anti-CD25 antibody-drug conjugate |
| EP3681536A4 (en) * | 2017-09-13 | 2021-06-09 | Kira Biotech Pty Limited | TREATMENT PROCEDURES |
| JP2021501801A (ja) * | 2017-11-01 | 2021-01-21 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | 癌の処置に用いるための免疫刺激アゴニスト抗体 |
| CN115851605A (zh) * | 2019-04-18 | 2023-03-28 | 上海交通大学 | 间充质干细胞靶向运输趋化因子和细胞因子的免疫疗法 |
| US11706339B2 (en) | 2019-07-05 | 2023-07-18 | Talkdesk, Inc. | System and method for communication analysis for use with agent assist within a cloud-based contact center |
| US11328205B2 (en) | 2019-08-23 | 2022-05-10 | Talkdesk, Inc. | Generating featureless service provider matches |
| US20220390433A1 (en) * | 2019-09-12 | 2022-12-08 | Providence Health & Services - Oregon | Methods of treatment with cd8 t cell-mediated immune therapy |
| US20210117882A1 (en) | 2019-10-16 | 2021-04-22 | Talkdesk, Inc | Systems and methods for workforce management system deployment |
| US12271848B2 (en) | 2019-10-29 | 2025-04-08 | Talkdesk, Inc. | Systems and methods for recommending rules for routing calls |
| US20210136220A1 (en) | 2019-10-31 | 2021-05-06 | Talkdesk, Inc. | Monitoring and listening tools across omni-channel inputs in a graphically interactive voice response system |
| KR20220127859A (ko) * | 2020-01-13 | 2022-09-20 | 사이토딘 인크. | Ccr5 양성 전이성 암 치료를 위한 ccr5 결합제 |
| US11736615B2 (en) | 2020-01-16 | 2023-08-22 | Talkdesk, Inc. | Method, apparatus, and computer-readable medium for managing concurrent communications in a networked call center |
| US11941651B2 (en) * | 2020-03-25 | 2024-03-26 | Cdw Llc | LCP pricing tool |
| US11089162B1 (en) * | 2020-05-28 | 2021-08-10 | Nice Ltd. | Dynamic metric optimization in predictive behavioral routing |
| US10951757B1 (en) * | 2020-06-29 | 2021-03-16 | Ringcentral, Inc. | Systems and methods for shifting call handling across multi-region service clusters |
| US11478927B1 (en) * | 2021-04-01 | 2022-10-25 | Giant.Ai, Inc. | Hybrid computing architectures with specialized processors to encode/decode latent representations for controlling dynamic mechanical systems |
| US11677875B2 (en) | 2021-07-02 | 2023-06-13 | Talkdesk Inc. | Method and apparatus for automated quality management of communication records |
| US12072793B2 (en) * | 2021-12-16 | 2024-08-27 | International Business Machines Corporation | Function result prediction |
| US11856140B2 (en) | 2022-03-07 | 2023-12-26 | Talkdesk, Inc. | Predictive communications system |
| US11736616B1 (en) | 2022-05-27 | 2023-08-22 | Talkdesk, Inc. | Method and apparatus for automatically taking action based on the content of call center communications |
| US11971908B2 (en) | 2022-06-17 | 2024-04-30 | Talkdesk, Inc. | Method and apparatus for detecting anomalies in communication data |
| US11791038B1 (en) | 2022-11-02 | 2023-10-17 | Zengine Limited | Machine learning system for asymmetrical matching of care givers and care receivers |
| US11943391B1 (en) | 2022-12-13 | 2024-03-26 | Talkdesk, Inc. | Method and apparatus for routing communications within a contact center |
| US12381983B2 (en) | 2023-03-06 | 2025-08-05 | Talkdesk, Inc. | System and method for managing communications in a networked call center |
| WO2024254199A1 (en) * | 2023-06-05 | 2024-12-12 | Gmp Biotechnology Limited | Anti-cancer tgfb2 agents with immunotherapeutics |
| US12395588B2 (en) | 2023-08-28 | 2025-08-19 | Talkdesk, Inc. | Method and apparatus for creating a database of contact center response records |
| US12395411B1 (en) * | 2024-02-06 | 2025-08-19 | Toyota Motor Engineering & Manufacturing North America, Inc. | Systems and methods for selecting edge nodes for task performance |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013119202A1 (en) * | 2012-02-06 | 2013-08-15 | Providence Health & Services - Oregon | Cancer treatment and monitoring methods using ox40 agonists |
| WO2014009535A2 (en) * | 2012-07-12 | 2014-01-16 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Methods for predicting the survival time and treatment responsiveness of a patient suffering from a solid cancer with a signature of at least 7 genes |
| WO2015095423A2 (en) * | 2013-12-17 | 2015-06-25 | Genentech, Inc. | Combination therapy comprising ox40 binding agonists and pd-1 axis binding antagonists |
Family Cites Families (538)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CU22545A1 (es) | 1994-11-18 | 1999-03-31 | Centro Inmunologia Molecular | Obtención de un anticuerpo quimérico y humanizado contra el receptor del factor de crecimiento epidérmico para uso diagnóstico y terapéutico |
| US4048452A (en) | 1976-05-28 | 1977-09-13 | Bell Telephone Laboratories, Incorporated | Automatic call distribution system |
| US4286118A (en) | 1979-07-02 | 1981-08-25 | Solid State Systems, Inc. | Data distribution system for private automatic branch exchange |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4943533A (en) | 1984-03-01 | 1990-07-24 | The Regents Of The University Of California | Hybrid cell lines that produce monoclonal antibodies to epidermal growth factor receptor |
| US5375161A (en) | 1984-09-14 | 1994-12-20 | Accessline Technologies, Inc. | Telephone control system with branch routing |
| US5588037A (en) | 1984-09-14 | 1996-12-24 | Accessline Technologies, Inc. | Remote access telephone control system |
| US4677663A (en) | 1985-07-05 | 1987-06-30 | Melita Electronic Labs, Inc. | Telephone answering and call forwarding improvement |
| US5014298A (en) | 1985-07-10 | 1991-05-07 | First Data Resources Inc. | Voice-data telephonic control system |
| US5048075A (en) | 1985-07-10 | 1991-09-10 | First Data Resources Inc. | Telephonic-interface statistical analysis system |
| US5251252A (en) | 1985-07-10 | 1993-10-05 | First Data Resources Inc. | Telephone interface call processing system with call selectivity |
| US5073929A (en) | 1988-05-16 | 1991-12-17 | First Data Resources Inc. | Voice-data telephonic control system |
| US4930150A (en) | 1985-07-10 | 1990-05-29 | First Data Resources Inc. | Telephonic interface control system |
| US5359645A (en) | 1985-07-10 | 1994-10-25 | First Data Corporation Inc. | Voice-data telephonic interface control system |
| US5793846A (en) | 1985-07-10 | 1998-08-11 | Ronald A. Katz Technology Licensing, Lp | Telephonic-interface game control system |
| US5224153A (en) | 1985-07-10 | 1993-06-29 | First Data Resouces Inc. | Voice-data telephonic interface control system |
| US5128984A (en) | 1985-07-10 | 1992-07-07 | First Data Resources Inc. | Telephone interface call processing system with call selectivity |
| US5898762A (en) | 1985-07-10 | 1999-04-27 | Ronald A. Katz Technology Licensing, L.P. | Telephonic-interface statistical analysis system |
| US5365575A (en) | 1985-07-10 | 1994-11-15 | First Data Resources Inc. | Telephonic-interface lottery system |
| US5351285A (en) | 1985-07-10 | 1994-09-27 | First Data Resources Inc. | Multiple format telephonic interface control system |
| US20040071278A1 (en) | 1985-07-10 | 2004-04-15 | Ronald A. Katz | Multiple format telephonic interface control system |
| US5828734A (en) | 1985-07-10 | 1998-10-27 | Ronald A. Katz Technology Licensing, Lp | Telephone interface call processing system with call selectivity |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4737983A (en) | 1985-10-02 | 1988-04-12 | American Telephone And Telegraph Company Communications, Inc. | Automatic call distributor telephone service |
| GB8528951D0 (en) | 1985-11-25 | 1986-01-02 | British Telecomm | Signalling detection |
| US4757529A (en) | 1986-02-28 | 1988-07-12 | American Telephone And Telegraph Company, At&T Bell Laboratories | Call distribution arrangement |
| US6548640B1 (en) | 1986-03-27 | 2003-04-15 | Btg International Limited | Altered antibodies |
| JPS6331342A (ja) | 1986-07-25 | 1988-02-10 | Hashimoto Corp | 遠隔操作可能な電話転送先変更装置 |
| US4768221A (en) | 1986-10-20 | 1988-08-30 | Planum Technology Corp. | Remote reprogramming system for telephone call forwarding service |
| US4807279A (en) | 1987-01-07 | 1989-02-21 | H&M Communications | Remotely programmable call forwarding control device |
| IL85035A0 (en) | 1987-01-08 | 1988-06-30 | Int Genetic Eng | Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same |
| US5081711A (en) | 1987-02-24 | 1992-01-14 | Rickman Jr James D | Computer peripheral device control and communication system |
| AU600575B2 (en) | 1987-03-18 | 1990-08-16 | Sb2, Inc. | Altered antibodies |
| US4894857A (en) | 1987-06-16 | 1990-01-16 | Inuentions Inc. | Method and apparatus for customer account servicing |
| US4797911A (en) | 1987-06-16 | 1989-01-10 | Inventions, Inc. | Customer account online servicing system |
| US5770701A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Process for preparing targeted forms of methyltrithio antitumor agents |
| US5606040A (en) | 1987-10-30 | 1997-02-25 | American Cyanamid Company | Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methyl-trithio group |
| US5077789A (en) | 1987-12-24 | 1991-12-31 | Clark Jr Milas G | Remotely commanded telephone switch enhancing system |
| JPH01176150A (ja) | 1987-12-30 | 1989-07-12 | Hashimoto Corp | 電話自動応対録音裝置 |
| US5063522A (en) | 1988-03-15 | 1991-11-05 | Intellisystems, Inc. | Multi-user, artificial intelligent expert system |
| US4958371A (en) | 1988-04-19 | 1990-09-18 | Control Data Corporation | Method and apparatus for determining when a telephone handset is off-hook |
| US4935956A (en) | 1988-05-02 | 1990-06-19 | Telequip Ventures, Inc. | Automated public phone control for charge and collect billing |
| US4893301A (en) | 1988-06-27 | 1990-01-09 | Teknekron Infoswitch Corporation | Automatic call distribution (ACD) switching system having distributed processing capability |
| US4852149A (en) | 1988-06-29 | 1989-07-25 | Dialogic Corporation | Automated call filter |
| US5297146A (en) | 1988-07-01 | 1994-03-22 | Kabushiki Kaisha Toshiba | Communication terminal apparatus and its control method |
| US4941168A (en) | 1988-09-21 | 1990-07-10 | U.S. Telecom International Inc. | System for the recognition of automated telephone answering devices and delivery of prerecorded messages to such devices |
| US5420852A (en) | 1988-09-29 | 1995-05-30 | American Tel-A-Systems, Inc. | Digital switching system connecting buses with incompatible protocols and telephone answering system and private automatic branch exchange with integrated voice and textual message recording |
| USRE35758E (en) | 1988-10-06 | 1998-03-31 | Golden Enterprises, Inc. | Voice/data-formatted telephone information storage and retrieval system |
| WO1990005144A1 (en) | 1988-11-11 | 1990-05-17 | Medical Research Council | Single domain ligands, receptors comprising said ligands, methods for their production, and use of said ligands and receptors |
| US5166974A (en) | 1988-11-16 | 1992-11-24 | Dytel Corporation | Interactive call processor to facilitate completion of queued calls |
| US5020095A (en) | 1988-11-16 | 1991-05-28 | Dytel Corporation | Interactive call distribution processor |
| JP2542247B2 (ja) | 1988-11-18 | 1996-10-09 | アンリツ株式会社 | 公衆電話機 |
| US5530101A (en) * | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5073890A (en) | 1988-12-30 | 1991-12-17 | At&T Bell Laboratories | Remote agent operation for automatic call distributors |
| US4975841A (en) | 1989-03-03 | 1990-12-04 | American Colloid Company | Method and apparatus for reporting customer data |
| US5168517A (en) | 1989-03-13 | 1992-12-01 | Herbert Waldman | Apparatus and methods for selectively forwarding telephone calls |
| US5016270A (en) | 1989-04-03 | 1991-05-14 | First Data Resources Inc. | Expanded telephone data organization system |
| US4977595A (en) | 1989-04-03 | 1990-12-11 | Nippon Telegraph And Telephone Corporation | Method and apparatus for implementing electronic cash |
| JPH02281861A (ja) | 1989-04-24 | 1990-11-19 | Matsushita Electric Ind Co Ltd | 音声蓄積装置 |
| US5007078A (en) | 1989-04-28 | 1991-04-09 | American Communications & Engineering, Inc. | Automated order entry recording method and apparatus |
| US4979171A (en) | 1989-05-03 | 1990-12-18 | Rockwell International Corporation | Announcement and tone code generator for telephonic network and method |
| US4998272A (en) | 1989-06-15 | 1991-03-05 | Digital Voice Technologies, Inc. | Personal voice mail system |
| FR2648661B1 (fr) | 1989-06-19 | 1994-03-04 | Alcatel Business Systems | Detecteur de signaux alternatifs basse frequence notamment pour joncteur telephonique |
| DE3920358A1 (de) | 1989-06-22 | 1991-01-17 | Behringwerke Ag | Bispezifische und oligospezifische, mono- und oligovalente antikoerperkonstrukte, ihre herstellung und verwendung |
| US5007000A (en) | 1989-06-28 | 1991-04-09 | International Telesystems Corp. | Classification of audio signals on a telephone line |
| US4933964A (en) | 1989-07-25 | 1990-06-12 | International Telesystems Corporation | Pacing of telephone calls for call origination management systems |
| US4987587A (en) | 1989-07-26 | 1991-01-22 | International Business Machines Corporation | Method and apparatus for providing 800 number service |
| US5392353A (en) | 1989-08-07 | 1995-02-21 | Tv Answer, Inc. | Interactive satellite broadcast network |
| ATE135373T1 (de) | 1989-09-08 | 1996-03-15 | Univ Johns Hopkins | Modifikationen der struktur des egf-rezeptor-gens in menschlichen glioma |
| US5006983A (en) * | 1989-09-12 | 1991-04-09 | Addax, Inc. | Service allocation system |
| US4953204A (en) | 1989-10-17 | 1990-08-28 | At&T Bell Laboratories | Multilocation queuing for telephone calls |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| CA2026147C (en) | 1989-10-25 | 2006-02-07 | Ravi J. Chari | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| US5103449A (en) | 1989-11-03 | 1992-04-07 | International Business Machines Corporation | Pbx transparent ani and dnis using vru |
| US5040208A (en) | 1989-11-03 | 1991-08-13 | International Business Machines Corporation | Coordinated voice and data display having temporary storage of transaction data |
| US5274700A (en) * | 1989-11-27 | 1993-12-28 | Unifi Communications Corporation | Methods of automatically rerouting an incoming telephone call placed over a network |
| US5036535A (en) | 1989-11-27 | 1991-07-30 | Unifi Communications Corporation | Switchless automatic call distribution system |
| US5161181A (en) | 1990-01-10 | 1992-11-03 | Dialogic Corporation | Automatic number identification blocking system |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5255349A (en) | 1990-01-26 | 1993-10-19 | The United States Of America As Represented By The Administrator Of The National Aeronautics And Space Administration | Electronic neural network for solving "traveling salesman" and similar global optimization problems |
| US5070525A (en) | 1990-02-12 | 1991-12-03 | Inventions, Inc. | Method for avoiding call blocking |
| US5623547A (en) | 1990-04-12 | 1997-04-22 | Jonhig Limited | Value transfer system |
| US5222120A (en) | 1990-04-23 | 1993-06-22 | Mci Communications Corporation | Long distance telephone switching system with enhanced subscriber services |
| US5313516A (en) | 1990-05-31 | 1994-05-17 | Phonemate Inc. | Telephone answering device with automatic function |
| US5164981A (en) | 1990-06-04 | 1992-11-17 | Davox | Voice response system with automated data transfer |
| US5214688A (en) | 1990-06-05 | 1993-05-25 | Inventions, Inc. | Method and apparatus for dynamic and interdependent processing of inbound calls and outbound calls |
| JPH0626395B2 (ja) | 1990-07-04 | 1994-04-06 | 村田機械株式会社 | 端末接続装置 |
| US5070526A (en) | 1990-08-08 | 1991-12-03 | Active Voice, Inc. | Signal analyzing system |
| US5448624A (en) | 1990-08-22 | 1995-09-05 | Mci Communications Corporation | Telephone network performance monitoring method and system |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5113430A (en) | 1990-10-01 | 1992-05-12 | United States Advanced Network, Inc. | Enhanced wide area audio response network |
| US5193110A (en) | 1990-10-09 | 1993-03-09 | Boston Technology, Incorporated | Integrated services platform for telephone communication system |
| US5325292A (en) | 1990-10-12 | 1994-06-28 | Crockett Gary B | Tour/schedule generation for a force management system |
| US5163083A (en) | 1990-10-12 | 1992-11-10 | At&T Bell Laboratories | Automation of telephone operator assistance calls |
| US5185786A (en) | 1990-11-13 | 1993-02-09 | Dialogic Corporation | Automatic call center overflow retrieval system |
| WO1992009690A2 (en) | 1990-12-03 | 1992-06-11 | Genentech, Inc. | Enrichment method for variant proteins with altered binding properties |
| US5239574A (en) | 1990-12-11 | 1993-08-24 | Octel Communications Corporation | Methods and apparatus for detecting voice information in telephone-type signals |
| US5291550A (en) | 1990-12-26 | 1994-03-01 | At&T Bell Laboratories | Dynamic network call distributor |
| US5206903A (en) | 1990-12-26 | 1993-04-27 | At&T Bell Laboratories | Automatic call distribution based on matching required skills with agents skills |
| US5163087A (en) | 1990-12-31 | 1992-11-10 | At&T Bell Laboratories | Delivery of customer data base key using automatic number identification |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5327490A (en) * | 1991-02-19 | 1994-07-05 | Intervoice, Inc. | System and method for controlling call placement rate for telephone communication systems |
| US5097528A (en) | 1991-02-25 | 1992-03-17 | International Business Machines Corporation | System for integrating telephony data with data processing systems |
| US5430792A (en) | 1991-05-03 | 1995-07-04 | Electronic Information Systems, Inc. | Automated telephone calling system |
| US5309505A (en) | 1991-05-20 | 1994-05-03 | Inventions, Inc. | Automated voice system for improving agent efficiency and improving service to parties on hold |
| US5381470A (en) | 1991-05-28 | 1995-01-10 | Davox Corporation | Supervisory management center with parameter testing and alerts |
| US5278898A (en) | 1991-05-30 | 1994-01-11 | Davox Corporation | System for managing a hold queue |
| GB9111947D0 (en) | 1991-06-04 | 1991-07-24 | Telsis Limited | Apparatus for voice services equipment |
| US5479501A (en) | 1991-06-05 | 1995-12-26 | Rolm Systems | Far-end disconnect detector for telephony systems |
| EP0590058B1 (en) | 1991-06-14 | 2003-11-26 | Genentech, Inc. | HUMANIZED Heregulin ANTIBODy |
| US5224162A (en) | 1991-06-14 | 1993-06-29 | Nippon Telegraph And Telephone Corporation | Electronic cash system |
| GB9114948D0 (en) | 1991-07-11 | 1991-08-28 | Pfizer Ltd | Process for preparing sertraline intermediates |
| US5237159A (en) | 1991-07-17 | 1993-08-17 | J. D. Carreker And Associates | Electronic check presentment system |
| US5289530A (en) | 1991-07-23 | 1994-02-22 | Morris Reese | Method and apparatus for vocally communicating to a caller at a remote telephone station synthesized speech of stored special service information |
| US5276732A (en) | 1991-08-22 | 1994-01-04 | Davox Corporation | Remote workstation use with database retrieval system |
| WO1993006217A1 (en) | 1991-09-19 | 1993-04-01 | Genentech, Inc. | EXPRESSION IN E. COLI OF ANTIBODY FRAGMENTS HAVING AT LEAST A CYSTEINE PRESENT AS A FREE THIOL, USE FOR THE PRODUCTION OF BIFUNCTIONAL F(ab')2 ANTIBODIES |
| US5297195A (en) | 1991-10-02 | 1994-03-22 | Teledirect International, Inc. | Method and apparatus for automatic telephone scheduling system |
| FI941572L (fi) | 1991-10-07 | 1994-05-27 | Oncologix Inc | Anti-erbB-2-monoklonaalisten vasta-aineiden yhdistelmä ja käyttömenetelmä |
| US5341412A (en) | 1991-10-10 | 1994-08-23 | Executone Information Systems, Inc. | Apparatus and a method for predictive call dialing |
| US5815566A (en) | 1991-10-10 | 1998-09-29 | Executone Information Systems, Inc. | Apparatus and method for dynamic inbound/outbound call management and for scheduling appointments |
| JPH05100699A (ja) | 1991-10-11 | 1993-04-23 | Sharp Corp | 音声記録再生装置 |
| US5311574A (en) | 1991-10-23 | 1994-05-10 | At&T Bell Laboratories | Automatic customer call back for automatic call distribution systems |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| US5453601A (en) | 1991-11-15 | 1995-09-26 | Citibank, N.A. | Electronic-monetary system |
| US5309504A (en) | 1991-11-18 | 1994-05-03 | Syntellect Acquisition Corp. | Automated identification of attendant positions in a telecommunication system |
| JPH05176275A (ja) | 1991-11-29 | 1993-07-13 | Minolta Camera Co Ltd | フィルムプレーヤ |
| US5903454A (en) | 1991-12-23 | 1999-05-11 | Hoffberg; Linda Irene | Human-factored interface corporating adaptive pattern recognition based controller apparatus |
| US8352400B2 (en) | 1991-12-23 | 2013-01-08 | Hoffberg Steven M | Adaptive pattern recognition based controller apparatus and method and human-factored interface therefore |
| US8032477B1 (en) | 1991-12-23 | 2011-10-04 | Linda Irene Hoffberg | Adaptive pattern recognition based controller apparatus and method and human-factored interface therefore |
| US7006881B1 (en) | 1991-12-23 | 2006-02-28 | Steven Hoffberg | Media recording device with remote graphic user interface |
| US5875108A (en) | 1991-12-23 | 1999-02-23 | Hoffberg; Steven M. | Ergonomic man-machine interface incorporating adaptive pattern recognition based control system |
| US6850252B1 (en) | 1999-10-05 | 2005-02-01 | Steven M. Hoffberg | Intelligent electronic appliance system and method |
| US7242988B1 (en) | 1991-12-23 | 2007-07-10 | Linda Irene Hoffberg | Adaptive pattern recognition based controller apparatus and method and human-factored interface therefore |
| US5901246A (en) | 1995-06-06 | 1999-05-04 | Hoffberg; Steven M. | Ergonomic man-machine interface incorporating adaptive pattern recognition based control system |
| US5369695A (en) | 1992-01-06 | 1994-11-29 | At&T Corp. | Method of redirecting a telephone call to an alternate destination |
| US5247569A (en) * | 1992-01-13 | 1993-09-21 | Intervoice, Inc. | System and method for controlling outbound and inbound calls in a telephone communication system |
| US5333190A (en) | 1992-01-15 | 1994-07-26 | Eyster Kurt G | Telephone ring detection method and apparatus |
| GB9300059D0 (en) | 1992-01-20 | 1993-03-03 | Zeneca Ltd | Quinazoline derivatives |
| FR2686757B1 (fr) | 1992-01-29 | 1997-03-28 | Sgs Thomson Microelectronics | Modulateur du courant d'une ligne telephonique. |
| US5341414A (en) | 1992-02-05 | 1994-08-23 | Fred Popke | Calling number verification service |
| ATE419355T1 (de) | 1992-02-06 | 2009-01-15 | Novartis Vaccines & Diagnostic | Marker für krebs und biosynthetisches bindeprotein dafür |
| US5515421A (en) | 1992-03-02 | 1996-05-07 | Harris Corporation | Automatic batch broadcast system |
| CA2086694C (en) | 1992-03-05 | 1996-12-31 | Steven K. Miller | System, data processing method and program to provide a programmable interface between a workstation and an archive server to automatically store telephone transaction information |
| US5311577A (en) | 1992-03-06 | 1994-05-10 | International Business Machines Corporation | Data processing system, method and program for constructing host access tables for integration of telephony data with data processing systems |
| US5452350A (en) | 1992-03-09 | 1995-09-19 | Advantis | Subscriber call routing processing system |
| JP3080262B2 (ja) | 1992-03-27 | 2000-08-21 | キヤノン株式会社 | 交換制御装置 |
| US5390236A (en) | 1992-03-31 | 1995-02-14 | Klausner Patent Technologies | Telephone answering device linking displayed data with recorded audio message |
| US5283818A (en) | 1992-03-31 | 1994-02-01 | Klausner Patent Technologies | Telephone answering device linking displayed data with recorded audio message |
| US5321745A (en) | 1992-05-26 | 1994-06-14 | Vmx, Inc. | Adaptive efficient single/dual tone decoder apparatus and method for identifying call-progression signals |
| US5319703A (en) | 1992-05-26 | 1994-06-07 | Vmx, Inc. | Apparatus and method for identifying speech and call-progression signals |
| US5400393A (en) | 1992-06-05 | 1995-03-21 | Phonemate, Inc. | Voice mail digital telephone answering device |
| US5581602A (en) | 1992-06-19 | 1996-12-03 | Inventions, Inc. | Non-offensive termination of a call detection of an answering machine |
| EP0647381B1 (en) | 1992-06-25 | 1999-05-19 | Apropos Technology, Inc. | Call distributor |
| US5729600A (en) | 1992-06-25 | 1998-03-17 | Rockwell International Corporation | Automatic call distributor with automated voice responsive call servicing system and method |
| US5309513A (en) | 1992-07-02 | 1994-05-03 | Rockwell International Corporation | Telephone system with ubiquitous agents |
| US5329579A (en) | 1992-07-27 | 1994-07-12 | At&T Bell Laboratories | Modular adjunct processor made of identical multi-function modules adaptable under direction of one of them to perform any of the adjunct-processor functions |
| US5495528A (en) | 1992-08-25 | 1996-02-27 | Rolm Systems | Digital telephone control interface system |
| EP0657076B1 (en) | 1992-08-26 | 1999-06-09 | Bellsouth Corporation | Personal number communications method |
| JPH084281B2 (ja) | 1992-09-30 | 1996-01-17 | 橋本コーポレイション株式会社 | オンフック後相手の声を拡声する電話装置 |
| US5448631A (en) | 1992-10-13 | 1995-09-05 | U S West Advanced Technologies, Inc. | Apparatus for handling features in a telephone network |
| CA2147601C (en) | 1992-10-21 | 1998-08-25 | Norman J. Donaghue, Jr. | Integrated intelligent call blending |
| JP3589665B2 (ja) | 1992-10-23 | 2004-11-17 | イミュネックス・コーポレーション | 可溶性オリゴマー蛋白質の調製法 |
| US5590188A (en) | 1992-11-09 | 1996-12-31 | Iex Corporation | Rules-based call routing |
| ES2091684T3 (es) | 1992-11-13 | 1996-11-01 | Idec Pharma Corp | Aplicacion terapeutica de anticuerpos quimericos y radiomarcados contra el antigeno de diferenciacion restringida de los linfocitos b humanos para el tratamiento del linfoma de las celulas b. |
| CA2103204C (en) | 1992-11-17 | 2002-11-12 | Daniel F. Baker | Call distributor with automatic preannouncement system and method |
| US5574784A (en) | 1992-11-20 | 1996-11-12 | Lucent Technologies Inc. | Dynamic admission control for telecommunications relay service with text-to-speech synthesis |
| JP3334972B2 (ja) | 1992-11-20 | 2002-10-15 | キヤノン株式会社 | 構内交換装置 |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US5594790A (en) | 1993-01-14 | 1997-01-14 | Davox Corporation | Method for selecting and controlling the automatic dialing of a call record campaign |
| US5588049A (en) | 1993-01-25 | 1996-12-24 | Detering; Greig R. | Method for the automatic insertion of removal of a calling number identification (CNID) blocking prefix from within a telephone number in a personal computer based telephone management system |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| US5479487A (en) | 1993-02-11 | 1995-12-26 | Intervoice Limited Partnership | Calling center employing unified control system |
| US5982868A (en) | 1993-02-22 | 1999-11-09 | Murex Securities, Ltd. | Automatic routing and information system for telephonic services |
| US5425093A (en) | 1993-02-23 | 1995-06-13 | International Telesystems Corporation | System for integrating a stand alone inbound automatic call distributor and a outbound automatic call dialer |
| CA2110352C (en) | 1993-02-26 | 1998-02-24 | Bruce Merrill Bales | Calling terminal controlled call coverage |
| US5586179A (en) | 1993-03-17 | 1996-12-17 | Davox Corporation | System and method for adding and integrating outbound calling and overall system control to an existing inbound telephone system |
| US5802502A (en) | 1993-05-24 | 1998-09-01 | British Telecommunications Public Limited Company | System for selective communication connection based on transaction pricing signals |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| JP2833964B2 (ja) | 1993-06-28 | 1998-12-09 | 日本電気株式会社 | 折畳型携帯電話機 |
| GB9314893D0 (en) | 1993-07-19 | 1993-09-01 | Zeneca Ltd | Quinazoline derivatives |
| US5568540A (en) | 1993-09-13 | 1996-10-22 | Active Voice Corporation | Method and apparatus for selecting and playing a voice mail message |
| US5434906A (en) | 1993-09-13 | 1995-07-18 | Robinson; Michael J. | Method and apparatus for processing an incoming call in a communication system |
| US5625676A (en) | 1993-09-13 | 1997-04-29 | Active Voice Corporation | Method and apparatus for monitoring a caller's name while using a telephone |
| JPH07107526A (ja) | 1993-09-29 | 1995-04-21 | Toshiba Corp | ボタン電話装置 |
| CA2129942C (en) | 1993-09-30 | 1998-08-25 | Steven Todd Kaish | Telecommunication network with integrated network-wide automatic call distribution |
| JP2693108B2 (ja) | 1993-10-19 | 1997-12-24 | 財団法人ニューメディア開発協会 | コンピュータシステム |
| US5636267A (en) | 1994-02-04 | 1997-06-03 | Jintec Corporation | Cleaning system for telephone number list |
| US5442693A (en) | 1993-12-22 | 1995-08-15 | At&T Bell Laboratories | Integrated operator console |
| ATE207366T1 (de) | 1993-12-24 | 2001-11-15 | Merck Patent Gmbh | Immunokonjugate |
| US5485506A (en) | 1994-01-05 | 1996-01-16 | Motorola, Inc. | Method for designating recorded messages |
| US5638436A (en) | 1994-01-12 | 1997-06-10 | Dialogic Corporation | Voice detection |
| US5459781A (en) | 1994-01-12 | 1995-10-17 | Dialogic Corporation | Selectively activated dual tone multi-frequency detector |
| IL112249A (en) | 1994-01-25 | 2001-11-25 | Warner Lambert Co | Pharmaceutical compositions containing di and tricyclic pyrimidine derivatives for inhibiting tyrosine kinases of the epidermal growth factor receptor family and some new such compounds |
| US5679683A (en) | 1994-01-25 | 1997-10-21 | Warner-Lambert Company | Tricyclic compounds capable of inhibiting tyrosine kinases of the epidermal growth factor receptor family |
| IL112248A0 (en) | 1994-01-25 | 1995-03-30 | Warner Lambert Co | Tricyclic heteroaromatic compounds and pharmaceutical compositions containing them |
| US5436967A (en) | 1994-02-01 | 1995-07-25 | At&T Corp. | Held party call-back arrangement |
| US5535257A (en) | 1994-02-07 | 1996-07-09 | Motorola, Inc. | Method and apparatus for managing telephone calls in a selective call radio system controller |
| US5655014A (en) | 1994-02-18 | 1997-08-05 | Aurora Systems, Inc. | Switching device independent computer-telephone integration system |
| US5511121A (en) | 1994-02-23 | 1996-04-23 | Bell Communications Research, Inc. | Efficient electronic money |
| CA2143057C (en) | 1994-02-28 | 2002-07-16 | Anthony J. Dezonno | Automatic call distributor with automated postconversation message system |
| US5533107A (en) | 1994-03-01 | 1996-07-02 | Bellsouth Corporation | Method for routing calls based on predetermined assignments of callers geographic locations |
| US5561711A (en) | 1994-03-09 | 1996-10-01 | Us West Technologies, Inc. | Predictive calling scheduling system and method |
| CA2119086C (en) | 1994-03-15 | 1998-06-16 | Thomas A. Gray | Help desk improvement |
| JPH07264309A (ja) | 1994-03-18 | 1995-10-13 | Fujitsu Ltd | 着信制御装置 |
| US5703935A (en) | 1994-03-29 | 1997-12-30 | Mci Communications Corporation | Automated telephone operator services |
| US5537470A (en) | 1994-04-06 | 1996-07-16 | At&T Corp. | Method and apparatus for handling in-bound telemarketing calls |
| US5655013A (en) | 1994-04-19 | 1997-08-05 | Gainsboro; Jay L. | Computer-based method and apparatus for controlling, monitoring, recording and reporting telephone access |
| US5799087A (en) | 1994-04-28 | 1998-08-25 | Citibank, N.A. | Electronic-monetary system |
| US5533103A (en) | 1994-04-28 | 1996-07-02 | Electronic Information Systems, Inc. | Calling system and method |
| US5500513A (en) | 1994-05-11 | 1996-03-19 | Visa International | Automated purchasing control system |
| US5559878A (en) | 1994-05-23 | 1996-09-24 | Teltrust, Inc. | Telephonic communications answering and callback processing system |
| US5465286A (en) | 1994-05-24 | 1995-11-07 | Executone Information Systems, Inc. | Apparatus for supervising an automatic call distribution telephone system |
| US5481596A (en) | 1994-05-26 | 1996-01-02 | At&T Corp. | Auxiliary baseband telephone interface for an answering machine |
| US5761285A (en) | 1994-06-01 | 1998-06-02 | Davox Corporation | Universal telephony application client that is configurable from a profile for a telphone call campaign |
| US5592543A (en) | 1994-06-01 | 1997-01-07 | Davox Corporation | Method and system for allocating agent resources to a telephone call campaign |
| US5517566A (en) | 1994-06-01 | 1996-05-14 | Smith; B. Scott | Method for allocating agent resources to multiple telephone call campaigns |
| US5495523A (en) | 1994-06-01 | 1996-02-27 | Davox Corporation | Method for low priority telephony system assisted dialing |
| US5773001A (en) | 1994-06-03 | 1998-06-30 | American Cyanamid Company | Conjugates of methyltrithio antitumor agents and intermediates for their synthesis |
| US5519773A (en) | 1994-06-07 | 1996-05-21 | Siemens Colm Communications Inc. | Call sharing for inbound and outbound call center agents |
| US5502762A (en) | 1994-06-10 | 1996-03-26 | Andrew; Brian J. | System and method for simultaneously controlling ringing at local and remote telephones |
| US5559867A (en) | 1994-06-20 | 1996-09-24 | Sigma/Micro Corporation | Automated calling system with database updating |
| US5912947A (en) | 1994-06-20 | 1999-06-15 | Sigma/Micro Corporation | Public notification system and method |
| US5666523A (en) | 1994-06-30 | 1997-09-09 | Microsoft Corporation | Method and system for distributing asynchronous input from a system input queue to reduce context switches |
| US5528666A (en) | 1994-07-01 | 1996-06-18 | Motorola, Inc. | Personal phone expansion system |
| US5590171A (en) | 1994-07-07 | 1996-12-31 | Bellsouth Corporation | Method and apparatus for communications monitoring |
| US5600710A (en) | 1994-07-08 | 1997-02-04 | Bellsouth Corporation | Method for providing a recorded message to a telephone caller when called number is busy |
| US5506898A (en) | 1994-07-12 | 1996-04-09 | At&T Corp. | Expected wait-time indication arrangement |
| JP3308718B2 (ja) | 1994-07-28 | 2002-07-29 | 富士通株式会社 | 自動発信制御方法および装置 |
| NL9401245A (nl) | 1994-07-29 | 1996-03-01 | Nederland Ptt | Communicatiestelsel met wachtrijen. |
| EP0696125A3 (en) | 1994-08-02 | 1999-06-02 | Rockwell International Corporation | Telecommunication system with inbound call responsive predictive outdialing system and method |
| US5511117A (en) | 1994-09-26 | 1996-04-23 | Zazzera; Andre C. | Integrated voice and business transaction reporting for telephone call centers |
| US6333980B1 (en) * | 1994-09-28 | 2001-12-25 | Rockwell International Corporation | Automatic call distributor and method for routing incoming telephone calls based on proficiency ratings of agents |
| US5533109A (en) | 1994-09-30 | 1996-07-02 | Rockwell International Corporation | Telecommunication system with user modifiable PBX terminating call feature controller and method |
| US5594791A (en) | 1994-10-05 | 1997-01-14 | Inventions, Inc. | Method and apparatus for providing result-oriented customer service |
| US5804396A (en) | 1994-10-12 | 1998-09-08 | Sugen, Inc. | Assay for agents active in proliferative disorders |
| US5530931A (en) | 1994-10-20 | 1996-06-25 | Telefonaktiebolaget L M Ericsson | Method and apparatus for providing a look ahead feature for enhanced call forwarding in a telecommunications system |
| US5789199A (en) | 1994-11-03 | 1998-08-04 | Genentech, Inc. | Process for bacterial production of polypeptides |
| US5579377A (en) | 1994-11-18 | 1996-11-26 | Rogers; Laurence S. | Remote-control telephone answering system and method |
| US5633917A (en) | 1994-11-18 | 1997-05-27 | Rogers; Laurence S. | Remote-control telephone answering system and method |
| US5758257A (en) | 1994-11-29 | 1998-05-26 | Herz; Frederick | System and method for scheduling broadcast of and access to video programs and other data using customer profiles |
| US5679938A (en) | 1994-12-02 | 1997-10-21 | Telecheck International, Inc. | Methods and systems for interactive check authorizations |
| JP3501860B2 (ja) | 1994-12-21 | 2004-03-02 | 日本碍子株式会社 | 圧電/電歪膜型素子及びその製造方法 |
| US5610978A (en) | 1994-12-30 | 1997-03-11 | Mitel Corporation | Ring discriminator |
| US6052441A (en) | 1995-01-11 | 2000-04-18 | Fujitsu Limited | Voice response service apparatus |
| US5524147A (en) | 1995-02-02 | 1996-06-04 | Aspect Telecommunications Corporation | Method for forming a virtual call center |
| US5840523A (en) | 1995-03-01 | 1998-11-24 | Genetech, Inc. | Methods and compositions for secretion of heterologous polypeptides |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5546452A (en) | 1995-03-02 | 1996-08-13 | Geotel Communications Corp. | Communications system using a central controller to control at least one network and agent system |
| GB2299482B (en) | 1995-03-24 | 1999-03-17 | Northern Telecom Ltd | Telephone circuit |
| DE69536015D1 (de) | 1995-03-30 | 2009-12-10 | Pfizer Prod Inc | Chinazolinone Derivate |
| US5677955A (en) | 1995-04-07 | 1997-10-14 | Financial Services Technology Consortium | Electronic funds transfer instruments |
| US5740240A (en) | 1995-04-10 | 1998-04-14 | Edify Corporation | Computer telephony integration system and method |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5574782A (en) * | 1995-04-14 | 1996-11-12 | Lucent Technologies Inc. | Minimizing service disruptions in handling call request messages where new message formats are needed in a telecommunication network |
| ATE330416T1 (de) | 1995-04-24 | 2006-07-15 | Ibm | Verfahren und gerät zur auf geschicklichkeit basierten leitweglenkung in einer anrufzentrale |
| GB9508537D0 (en) | 1995-04-27 | 1995-06-14 | Zeneca Ltd | Quinazoline derivatives |
| GB9508538D0 (en) | 1995-04-27 | 1995-06-14 | Zeneca Ltd | Quinazoline derivatives |
| GB9508565D0 (en) | 1995-04-27 | 1995-06-14 | Zeneca Ltd | Quiazoline derivative |
| US5727154A (en) | 1995-04-28 | 1998-03-10 | Fry; Shawn C. | Program synchronization on first and second computers by determining whether information transmitted by first computer is an acceptable or unacceptable input to second computer program |
| US5884277A (en) | 1995-05-01 | 1999-03-16 | Vinod Khosla | Process for issuing coupons for goods or services to purchasers at non-secure terminals |
| US5675637A (en) | 1995-05-16 | 1997-10-07 | Inventions, Inc. | Method for automatically obtaining and presenting data from multiple data sources |
| US5555295A (en) | 1995-05-16 | 1996-09-10 | At&T Corp. | Service and information management system for a telecommunications network |
| US5815554A (en) | 1995-05-24 | 1998-09-29 | Burgess; Ken L. | Method and system for indicating operator availability |
| US5701295A (en) | 1995-05-26 | 1997-12-23 | Lucent Technologies Inc. | Variable communication bandwidth for providing automatic call back and call hold |
| US5907601A (en) | 1995-05-26 | 1999-05-25 | Eis International Inc. | Call pacing method |
| US5640445A (en) | 1995-05-26 | 1997-06-17 | Eis International, Inc | Outbound call pacing method which statistically matches the number of calls dialed to the number of available operators |
| US5747498A (en) | 1996-05-28 | 1998-05-05 | Pfizer Inc. | Alkynyl and azido-substituted 4-anilinoquinazolines |
| US5748711A (en) | 1995-06-07 | 1998-05-05 | Matrixx Marketing Inc. | Telephone transaction processing as a part of call transport |
| US5712374A (en) | 1995-06-07 | 1998-01-27 | American Cyanamid Company | Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates |
| US5832089A (en) | 1995-06-07 | 1998-11-03 | Sandia Corporation | Off-line compatible electronic cash method and system |
| US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
| AU6267896A (en) | 1995-06-07 | 1996-12-30 | Imclone Systems Incorporated | Antibody and antibody fragments for inhibiting the growth oftumors |
| US5696908A (en) | 1995-06-07 | 1997-12-09 | Southeast Phonecard, Inc. | Telephone debit card dispenser and method |
| US5696809A (en) | 1995-06-22 | 1997-12-09 | Bell Atlantic Network Services, Inc. | Advanced intelligent network based computer architecture for concurrent delivery of voice and text data using failure management system |
| US5854832A (en) | 1995-06-26 | 1998-12-29 | Rockwell International Corp. | Monitoring system and method used in automatic call distributor for timing incoming telephone calls |
| EP0777372B1 (en) | 1995-06-26 | 2004-12-22 | Jintec Corporation | Device and method for cleaning telephone number list |
| DK0836605T3 (da) | 1995-07-06 | 2002-05-13 | Novartis Ag | Pyrrolopyrimidiner og fremgangsmåder til deres fremstilling |
| US5619557A (en) | 1995-07-10 | 1997-04-08 | Rockwell International Corporation | Telephone switching system and method for controlling incoming telephone calls to remote agents and for collecting and providing call data |
| US5812642A (en) | 1995-07-12 | 1998-09-22 | Leroy; David J. | Audience response monitor and analysis system and method |
| US5889862A (en) | 1995-07-17 | 1999-03-30 | Nippon Telegraph And Telephone Corporation | Method and apparatus for implementing traceable electronic cash |
| US5806071A (en) | 1995-08-21 | 1998-09-08 | Info America, Inc. | Process and system for configuring information for presentation at an interactive electronic device |
| KR0144388B1 (ko) | 1995-08-24 | 1998-08-01 | 김광호 | 키폰시스템에서 언어다중화 표시방법 |
| US5768385A (en) | 1995-08-29 | 1998-06-16 | Microsoft Corporation | Untraceable electronic cash |
| US5687225A (en) | 1995-09-11 | 1997-11-11 | Eis International, Inc. | System for adding outbound dialing to inbound call distributors |
| US5696818A (en) | 1995-09-13 | 1997-12-09 | Rockwell International Corp. | Delay announcement group and time controller for a telephone system |
| JP3813210B2 (ja) | 1995-09-14 | 2006-08-23 | 富士通株式会社 | オンライン広告システムおよび方法 |
| US5742675A (en) | 1995-09-26 | 1998-04-21 | Telefonaktiebolaget Lm Ericsson | Method and apparatus for automatically distributing calls to available logged-in call handling agents |
| US5666416A (en) | 1995-10-24 | 1997-09-09 | Micali; Silvio | Certificate revocation system |
| US5793868A (en) | 1996-08-29 | 1998-08-11 | Micali; Silvio | Certificate revocation system |
| US5717757A (en) | 1996-08-29 | 1998-02-10 | Micali; Silvio | Certificate issue lists |
| US5661283A (en) | 1995-10-03 | 1997-08-26 | Ncr Corporation | Automated patching between ATM and consultant |
| US5570419A (en) | 1995-10-13 | 1996-10-29 | Intervoice Limited Partnership | System and method for an improved predictive dialer |
| US5867572A (en) | 1995-10-17 | 1999-02-02 | British Telecommunications Public Limited Company | Customer queuing arrangement |
| US5933492A (en) | 1997-01-21 | 1999-08-03 | Genesys Telecommunications Laboratories, Inc. | Method and system for determining and using multiple object states in a computer telephony integration system |
| US5740233A (en) | 1995-11-02 | 1998-04-14 | Intervoice Limited Partnership | System and method for statistical diagnosis of the operation of an automated telephone system |
| US5901229A (en) | 1995-11-06 | 1999-05-04 | Nippon Telegraph And Telephone Corp. | Electronic cash implementing method using a trustee |
| AU1119097A (en) | 1995-11-13 | 1997-06-05 | Answersoft, Inc. | Intelligent information routing system and method |
| US5878126A (en) | 1995-12-11 | 1999-03-02 | Bellsouth Corporation | Method for routing a call to a destination based on range identifiers for geographic area assignments |
| US5918213A (en) | 1995-12-22 | 1999-06-29 | Mci Communications Corporation | System and method for automated remote previewing and purchasing of music, video, software, and other multimedia products |
| US5841852A (en) | 1995-12-29 | 1998-11-24 | Mci Communications Corporation | Method and system for telecommunications language support |
| US5633922A (en) | 1995-12-29 | 1997-05-27 | At&T | Process and apparatus for restarting call routing in a telephone network |
| US5646986A (en) | 1995-12-29 | 1997-07-08 | At&T | Network communication system with global event calendar information and trunk allocation |
| US5905975A (en) | 1996-01-04 | 1999-05-18 | Ausubel; Lawrence M. | Computer implemented methods and apparatus for auctions |
| US5822410A (en) | 1996-01-11 | 1998-10-13 | Gte Telecom Services Inc | Churn amelioration system and method therefor |
| JP2000503154A (ja) | 1996-01-11 | 2000-03-14 | エムアールジェイ インコーポレイテッド | デジタル所有権のアクセスと分配を制御するためのシステム |
| US5692033A (en) | 1996-01-22 | 1997-11-25 | Bell Atlantic Network Services, Inc. | AIN queuing for call-back system |
| US5790935A (en) | 1996-01-30 | 1998-08-04 | Hughes Aircraft Company | Virtual on-demand digital information delivery system and method |
| US5760041A (en) | 1996-02-05 | 1998-06-02 | American Cyanamid Company | 4-aminoquinazoline EGFR Inhibitors |
| GB9603095D0 (en) | 1996-02-14 | 1996-04-10 | Zeneca Ltd | Quinazoline derivatives |
| US5893902A (en) | 1996-02-15 | 1999-04-13 | Intelidata Technologies Corp. | Voice recognition bill payment system with speaker verification and confirmation |
| GB9603256D0 (en) | 1996-02-16 | 1996-04-17 | Wellcome Found | Antibodies |
| US5867559A (en) | 1996-02-20 | 1999-02-02 | Eis International, Inc. | Real-time, on-line, call verification system |
| US5787159A (en) | 1996-02-27 | 1998-07-28 | Hamilton; Chris | Use of caller ID information |
| US5835896A (en) | 1996-03-29 | 1998-11-10 | Onsale, Inc. | Method and system for processing and transmitting electronic auction information |
| JPH09326858A (ja) | 1996-04-03 | 1997-12-16 | Sharp Corp | 留守番電話機 |
| US5867799A (en) | 1996-04-04 | 1999-02-02 | Lang; Andrew K. | Information system and method for filtering a massive flow of information entities to meet user information classification needs |
| SK284073B6 (sk) | 1996-04-12 | 2004-09-08 | Warner-Lambert Company | Polycyklické zlúčeniny, ich použitie a farmaceutické kompozície na ich báze |
| US5914951A (en) | 1996-04-16 | 1999-06-22 | At&T Corp | System and method for controlling and monitoring communication between customers and customer service representatives |
| US5963924A (en) | 1996-04-26 | 1999-10-05 | Verifone, Inc. | System, method and article of manufacture for the use of payment instrument holders and payment instruments in network electronic commerce |
| US5815657A (en) | 1996-04-26 | 1998-09-29 | Verifone, Inc. | System, method and article of manufacture for network electronic authorization utilizing an authorization instrument |
| US5903651A (en) | 1996-05-14 | 1999-05-11 | Valicert, Inc. | Apparatus and method for demonstrating and confirming the status of a digital certificates and other data |
| US5768355A (en) | 1996-05-16 | 1998-06-16 | Science Dynamics Corporation | Three-way call detection system |
| JP3329432B2 (ja) | 1996-05-29 | 2002-09-30 | 日本電信電話株式会社 | 階層型電子現金実施方法およびこれに用いられる装置 |
| US5802156A (en) | 1996-06-05 | 1998-09-01 | David Felger | Method for billing and controlling fraud in providing pay information services |
| US5901214A (en) | 1996-06-10 | 1999-05-04 | Murex Securities, Ltd. | One number intelligent call processing system |
| US5812668A (en) | 1996-06-17 | 1998-09-22 | Verifone, Inc. | System, method and article of manufacture for verifying the operation of a remote transaction clearance system utilizing a multichannel, extensible, flexible architecture |
| US5889863A (en) | 1996-06-17 | 1999-03-30 | Verifone, Inc. | System, method and article of manufacture for remote virtual point of sale processing utilizing a multichannel, extensible, flexible architecture |
| US5850446A (en) | 1996-06-17 | 1998-12-15 | Verifone, Inc. | System, method and article of manufacture for virtual point of sale processing utilizing an extensible, flexible architecture |
| US5943424A (en) | 1996-06-17 | 1999-08-24 | Hewlett-Packard Company | System, method and article of manufacture for processing a plurality of transactions from a single initiation point on a multichannel, extensible, flexible architecture |
| US5905979A (en) | 1996-07-02 | 1999-05-18 | Electronic Data Systems Corporation | Abstract manager system and method for managing an abstract database |
| US5890138A (en) | 1996-08-26 | 1999-03-30 | Bid.Com International Inc. | Computer auction system |
| EP0912559B1 (en) | 1996-07-13 | 2002-11-06 | Glaxo Group Limited | Fused heterocyclic compounds as protein tyrosine kinase inhibitors |
| US5850428A (en) | 1996-07-17 | 1998-12-15 | Day; Robert Allen | Message management system and method |
| US5903880A (en) | 1996-07-19 | 1999-05-11 | Biffar; Peter C. | Self-contained payment system with circulating digital vouchers |
| DE19629614A1 (de) | 1996-07-23 | 1998-01-29 | Cardiotools Herzchirurgietechn | Linksherzassistpumpe |
| US5940813A (en) | 1996-07-26 | 1999-08-17 | Citibank, N.A. | Process facility management matrix and system and method for performing batch, processing in an on-line environment |
| US5896446A (en) | 1996-07-29 | 1999-04-20 | Mars Incorporated | Coin operated telephone auditor |
| US5828840A (en) | 1996-08-06 | 1998-10-27 | Verifone, Inc. | Server for starting client application on client if client is network terminal and initiating client application on server if client is non network terminal |
| US5822400A (en) | 1996-08-19 | 1998-10-13 | Davox Corporation | Call record scheduling system and method |
| US5898759A (en) | 1996-08-27 | 1999-04-27 | Chaw Khong Technology Co., Ltd. | Telephone answering machine with on-line switch function |
| US5923746A (en) | 1996-09-18 | 1999-07-13 | Rockwell International Corp. | Call recording system and method for use with a telephonic switch |
| US5839119A (en) | 1996-09-27 | 1998-11-17 | Xerox Corporation | Method of electronic payments that prevents double-spending |
| ID18494A (id) | 1996-10-02 | 1998-04-16 | Novartis Ag | Turunan pirazola leburan dan proses pembuatannya |
| US5913203A (en) | 1996-10-03 | 1999-06-15 | Jaesent Inc. | System and method for pseudo cash transactions |
| US5796791A (en) | 1996-10-15 | 1998-08-18 | Intervoice Limited Partnership | Network based predictive dialing |
| US5930339A (en) | 1996-11-05 | 1999-07-27 | Lucent Technologies Inc. | Leaving a message on a held connection |
| US5952638A (en) | 1996-11-25 | 1999-09-14 | Xerox Corporation | Space efficient method of electronic payments |
| US5857023A (en) | 1996-11-25 | 1999-01-05 | Xerox Corporation | Space efficient method of redeeming electronic payments |
| US5940493A (en) | 1996-11-26 | 1999-08-17 | Bellsouth Corporation | System and method for providing directory assistance information |
| US5949852A (en) | 1996-12-20 | 1999-09-07 | At&T Corp | Method for recording messages for absent parties |
| US5913195A (en) | 1996-12-27 | 1999-06-15 | Intervoice Limited Partnership | System and method for developing VRU voice dialogue |
| US5903641A (en) * | 1997-01-28 | 1999-05-11 | Lucent Technologies Inc. | Automatic dynamic changing of agents' call-handling assignments |
| US5937055A (en) | 1997-01-28 | 1999-08-10 | Lucent Technologies Inc. | Method and apparatus for routing telephone calls between alternate telephone service providers |
| US5926539A (en) | 1997-09-12 | 1999-07-20 | Genesys Telecommunications Laboratories, Inc. | Method and apparatus for determining agent availability based on level of uncompleted tasks |
| US5946388A (en) | 1997-02-06 | 1999-08-31 | Walker Asset Management Limited Partnership | Method and apparatus for priority queuing of telephone calls |
| US5963632A (en) | 1997-02-10 | 1999-10-05 | Genesys Telecommunications Laboratories, Inc. | Agent-initiated dynamic requeing of misrouted calls in call-routing systems |
| US5953405A (en) | 1997-02-10 | 1999-09-14 | Genesys Telecommunications Laboratories, Inc. | Agent-predictive routing process in call-routing systems |
| US5940496A (en) | 1997-02-10 | 1999-08-17 | Gewesys Telecommunications Laboratories, Inc. | Apparatus and methods enhancing call routing within and between call-centers |
| US6064667A (en) | 1997-02-10 | 2000-05-16 | Genesys Telecommunications Laboratories, Inc. | Apparatus and methods enhancing call routing to and within call centers |
| US5946387A (en) | 1997-02-10 | 1999-08-31 | Genesys Telecommunications Laboratories, Inc, | Agent-level network call routing |
| US5923745A (en) | 1997-02-28 | 1999-07-13 | Teknekron Infoswitch Corporation | Routing calls to call centers |
| US6002008A (en) | 1997-04-03 | 1999-12-14 | American Cyanamid Company | Substituted 3-cyano quinolines |
| UA73073C2 (uk) | 1997-04-03 | 2005-06-15 | Уайт Холдінгз Корпорейшн | Заміщені 3-ціанохіноліни, спосіб їх одержання та фармацевтична композиція |
| US5960073A (en) | 1997-04-03 | 1999-09-28 | Genesys Telecommunications Laboratories , Inc. | Method and apparatus for providing an interactive home agent with access to call center functionality and resources |
| US5930777A (en) | 1997-04-15 | 1999-07-27 | Barber; Timothy P. | Method of charging for pay-per-access information over a network |
| US5915093A (en) | 1997-04-24 | 1999-06-22 | Howard Berlin | Computer network debit disk used for prepayment to transfer information from a central computer |
| US6235883B1 (en) | 1997-05-05 | 2001-05-22 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| DK0980244T3 (da) | 1997-05-06 | 2003-09-29 | Wyeth Corp | Anvendelse af quinazoline forbindelser til behandling af polycystisk nyresygdom |
| US5873071A (en) | 1997-05-15 | 1999-02-16 | Itg Inc. | Computer method and system for intermediated exchange of commodities |
| US5946394A (en) | 1997-06-12 | 1999-08-31 | C. P. Clare Corporation | Isolation amplifier with hook switch control |
| EP0994903B1 (en) | 1997-06-24 | 2005-05-25 | Genentech, Inc. | Methods and compositions for galactosylated glycoproteins |
| US5949045A (en) | 1997-07-03 | 1999-09-07 | At&T Corp. | Micro-dynamic simulation of electronic cash transactions |
| ZA986732B (en) | 1997-07-29 | 1999-02-02 | Warner Lambert Co | Irreversible inhibitiors of tyrosine kinases |
| ZA986729B (en) | 1997-07-29 | 1999-02-02 | Warner Lambert Co | Irreversible inhibitors of tyrosine kinases |
| TW436485B (en) | 1997-08-01 | 2001-05-28 | American Cyanamid Co | Substituted quinazoline derivatives |
| EP0897238A1 (en) | 1997-08-11 | 1999-02-17 | Alcatel | Call distribution system, and method |
| US6040498A (en) | 1998-08-11 | 2000-03-21 | North Caroline State University | Genetically engineered duckweed |
| US6373836B1 (en) | 1997-09-15 | 2002-04-16 | Genesys Telecommunications Laboratories, Inc. | Apparatus and methods in routing internet protocol network telephony calls in a centrally-managed call center system |
| US6804345B1 (en) * | 1997-09-18 | 2004-10-12 | At&T Corp | Virtual contact center with flexible staffing control |
| US5946669A (en) | 1997-09-30 | 1999-08-31 | Lockheed Martin Corporation | Method and apparatus for payment processing using debit-based electronic funds transfer and disbursement processing using addendum-based electronic data interchange |
| AU759779B2 (en) | 1997-10-31 | 2003-05-01 | Genentech Inc. | Methods and compositions comprising glycoprotein glycoforms |
| CA2306155A1 (en) | 1997-11-06 | 1999-05-20 | Philip Frost | Use of quinazoline derivatives as tyrosine kinase inhibitors for treating colonic polyps |
| US6610833B1 (en) | 1997-11-24 | 2003-08-26 | The Institute For Human Genetics And Biochemistry | Monoclonal human natural antibodies |
| JP4460155B2 (ja) | 1997-12-05 | 2010-05-12 | ザ・スクリプス・リサーチ・インステイチユート | マウス抗体のヒト化 |
| US7268700B1 (en) | 1998-01-27 | 2007-09-11 | Hoffberg Steven M | Mobile communication device |
| US6157655A (en) | 1998-02-17 | 2000-12-05 | Genesys Telecommunications Laboratories, Inc. | Method for estimating telephony system-queue waiting time in an agent level routing environment |
| US6801520B2 (en) | 1998-02-17 | 2004-10-05 | Genesys Telecommunications Laboratories, Inc. | Queue prioritization based on competitive user input |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| DE69937291T2 (de) | 1998-04-02 | 2008-07-10 | Genentech, Inc., South San Francisco | Antikörpervarianten und fragmente davon |
| US6173053B1 (en) * | 1998-04-09 | 2001-01-09 | Avaya Technology Corp. | Optimizing call-center performance by using predictive data to distribute calls among agents |
| JP4334141B2 (ja) | 1998-04-20 | 2009-09-30 | グリカート バイオテクノロジー アクチェンゲゼルシャフト | 抗体依存性細胞傷害性を改善するための抗体のグリコシル化操作 |
| US20020021693A1 (en) * | 1998-05-01 | 2002-02-21 | At&T Corp. | Sharing of voice-switched network and internet resources for intelligent session processing |
| US20010011228A1 (en) | 1998-07-31 | 2001-08-02 | Grigory Shenkman | Method for predictive routing of incoming calls within a communication center according to history and maximum profit/contribution analysis |
| US6389400B1 (en) * | 1998-08-20 | 2002-05-14 | Sbc Technology Resources, Inc. | System and methods for intelligent routing of customer requests using customer and agent models |
| WO2000031048A1 (en) | 1998-11-19 | 2000-06-02 | Warner-Lambert Company | N-[4-(3-chloro-4-fluoro-phenylamino)-7-(3-morpholin-4-yl-propoxy)-quinazolin-6-yl]-acrylamide, an irreversible inhibitor of tyrosine kinases |
| BR0008758A (pt) | 1999-01-15 | 2001-12-04 | Genentech Inc | Variantes de polipeptìdeos parentais com funçãoefetora alterada, polipeptìdeos, composição ácidonucleico isolado, vetor, célula hospedeira,método para produzir uma variante depolipeptìdeo, método para o tratamento de umadesordem em mamìferos e método para produziruma região fc variante |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US8364136B2 (en) | 1999-02-01 | 2013-01-29 | Steven M Hoffberg | Mobile system, a method of operating mobile system and a non-transitory computer readable medium for a programmable control of a mobile system |
| US7966078B2 (en) | 1999-02-01 | 2011-06-21 | Steven Hoffberg | Network media appliance system and method |
| US7200219B1 (en) * | 1999-02-10 | 2007-04-03 | Avaya Technology Corp. | Dynamically allocating server resources to competing classes of work based upon achievement of service goals |
| US7373410B2 (en) | 2002-10-23 | 2008-05-13 | Genesys Telecommunications Laboratories, Inc. | Method and system for providing adaptive and proactive interaction management for multiple types of business interactions occurring in a multimedia communications environment |
| US7792773B2 (en) | 2002-10-23 | 2010-09-07 | Genesys Telecommunications Laboratories, Inc. | Method and system for enabling automated and real-time discovery of skills available to agents and systems in a multimedia communications network |
| US6584191B1 (en) | 1999-08-27 | 2003-06-24 | Aspect Communications Corporation | Staffing-based percentage-allocation routing using real-time data |
| CA2369292C (en) | 1999-04-09 | 2010-09-21 | Kyowa Hakko Kogyo Co. Ltd. | Method of modulating the activity of functional immune molecules |
| US6654459B1 (en) * | 1999-05-25 | 2003-11-25 | At&T Corp. | Enhanced agent authentication in virtual contact center |
| US7103806B1 (en) | 1999-06-04 | 2006-09-05 | Microsoft Corporation | System for performing context-sensitive decisions about ideal communication modalities considering information about channel reliability |
| US7127412B2 (en) | 1999-06-07 | 2006-10-24 | Pointserve, Inc. | Method and system for allocating specific appointment time windows in a service industry |
| US6639982B1 (en) * | 1999-08-12 | 2003-10-28 | Six Sigma, Inc. | Method and apparatus for agent forcing and call distribution for large team call servicing |
| CA2383933A1 (en) | 1999-09-14 | 2001-03-22 | Inventions, Inc. | Training, certifying, assigning and collaborating agents among multiple users |
| JP2003512821A (ja) | 1999-10-04 | 2003-04-08 | メディカゴ インコーポレイテッド | 外来性遺伝子の転写調節方法 |
| US7125978B1 (en) | 1999-10-04 | 2006-10-24 | Medicago Inc. | Promoter for regulating expression of foreign genes |
| FR2799593B1 (fr) * | 1999-10-11 | 2002-05-31 | Cit Alcatel | Procede de distribution d'appels |
| WO2001029246A1 (fr) | 1999-10-19 | 2001-04-26 | Kyowa Hakko Kogyo Co., Ltd. | Procede de production d'un polypeptide |
| US20030180714A1 (en) | 1999-12-15 | 2003-09-25 | Genentech, Inc. | Shotgun scanning |
| CA2395660A1 (en) | 1999-12-29 | 2001-07-12 | Immunogen, Inc. | Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use |
| EP1514400B1 (en) | 2000-01-07 | 2018-02-21 | Mitel Communications Inc. | Customer communication service system |
| US6724884B2 (en) * | 2000-01-27 | 2004-04-20 | Avaya Technology Corp. | Call management system using fast response dynamic threshold adjustment |
| US6868525B1 (en) * | 2000-02-01 | 2005-03-15 | Alberti Anemometer Llc | Computer graphic display visualization system and method |
| JP2001216286A (ja) | 2000-02-03 | 2001-08-10 | Sony Corp | 情報処理方法および情報処理装置 |
| US6711253B1 (en) * | 2000-02-04 | 2004-03-23 | Avaya Technology Corp. | Method and apparatus for analyzing performance data in a call center |
| US6324282B1 (en) | 2000-03-02 | 2001-11-27 | Knowlagent, Inc. | Method and system for delivery of individualized training to call center agents |
| US7373310B1 (en) | 2000-04-06 | 2008-05-13 | International Business Machines Corporation | Workflow system matrix organization search engine |
| DK1272647T3 (en) | 2000-04-11 | 2014-12-15 | Genentech Inc | Multivalent antibodies and uses thereof |
| JP2003532955A (ja) | 2000-04-17 | 2003-11-05 | ショーン・イー・ウィーダリン | オンライン・ディレクトリアシスタンス・システム |
| US6978252B2 (en) * | 2000-04-18 | 2005-12-20 | Ideaflood, Inc. | Method and system for transacting with network traffic |
| US7162035B1 (en) | 2000-05-24 | 2007-01-09 | Tracer Detection Technology Corp. | Authentication method and system |
| US7080321B2 (en) | 2000-06-23 | 2006-07-18 | Aspect Software, Inc. | Dynamic help option for internet customers |
| WO2002015081A1 (en) | 2000-08-14 | 2002-02-21 | Yahoo! Inc. | Offline-online incentive points system and method |
| AU2002211532A1 (en) | 2000-10-06 | 2002-04-15 | Argus Information And Advisory Services, Llc | System and method for revolving credit product offer customization |
| US7064191B2 (en) | 2000-10-06 | 2006-06-20 | Kyowa Hakko Kogyo Co., Ltd. | Process for purifying antibody |
| US6946292B2 (en) | 2000-10-06 | 2005-09-20 | Kyowa Hakko Kogyo Co., Ltd. | Cells producing antibody compositions with increased antibody dependent cytotoxic activity |
| EA013563B1 (ru) | 2000-10-06 | 2010-06-30 | Киова Хакко Кирин Ко., Лтд. | Трансгенное животное, продуцирующее антитела с измененными углеводными цепями, способ получения антител и содержащее антитела лекарственное средство |
| US6596541B2 (en) | 2000-10-31 | 2003-07-22 | Regeneron Pharmaceuticals, Inc. | Methods of modifying eukaryotic cells |
| US7415432B1 (en) | 2000-11-17 | 2008-08-19 | D.E. Shaw & Co., Inc. | Method and apparatus for the receipt, combination, and evaluation of equity portfolios for execution by a sponsor at passively determined prices |
| DK1354034T3 (da) | 2000-11-30 | 2008-03-25 | Medarex Inc | Transgene transchromosomale gnavere til fremstilling af humane antistoffer |
| US6683945B1 (en) * | 2000-12-28 | 2004-01-27 | Bellsouth Intellectual Property Corporation | Routing data based on comparative income values |
| EP1554691A2 (en) | 2001-01-09 | 2005-07-20 | BRITISH TELECOMMUNICATIONS public limited company | Software tool for heuristic search methods |
| US8031860B2 (en) | 2001-02-21 | 2011-10-04 | Genesys Telecommunications Laboratories, Inc. | Distributed hardware/software system for managing agent status in a communication center |
| US20020116239A1 (en) | 2001-02-21 | 2002-08-22 | Reinsma Jeffrey Dean | Systems and methods for optimizing building materials |
| US7181017B1 (en) | 2001-03-23 | 2007-02-20 | David Felsher | System and method for secure three-party communications |
| US20030055895A1 (en) * | 2001-08-27 | 2003-03-20 | Peters Charles A. | Internet based system designer with live agent assist |
| GB2391984A (en) | 2001-05-17 | 2004-02-18 | Bay Bridge Decision Technologi | System and method for generating forecasts and analysis of contact center behaviour for planning purposes |
| US7398549B2 (en) * | 2001-05-18 | 2008-07-08 | Imprivata, Inc. | Biometric authentication with security against eavesdropping |
| JP2002358402A (ja) | 2001-05-31 | 2002-12-13 | Dentsu Tec Inc | 3指標軸による顧客価値を基準とした売上予測方法 |
| US6842515B2 (en) * | 2001-06-12 | 2005-01-11 | Rockwell Electronic Commerce Technologies, Llc | Multi-site responsibility-based routing |
| US7110525B1 (en) | 2001-06-25 | 2006-09-19 | Toby Heller | Agent training sensitive call routing system |
| US20030002646A1 (en) | 2001-06-27 | 2003-01-02 | Philips Electronics North America Corp. | Intelligent phone router |
| US7953219B2 (en) * | 2001-07-19 | 2011-05-31 | Nice Systems, Ltd. | Method apparatus and system for capturing and analyzing interaction based content |
| CA2455365C (en) | 2001-08-03 | 2014-07-29 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| US6856680B2 (en) * | 2001-09-24 | 2005-02-15 | Rockwell Electronic Commerce Technologies, Llc | Contact center autopilot algorithms |
| ATE430580T1 (de) | 2001-10-25 | 2009-05-15 | Genentech Inc | Glycoprotein-zusammensetzungen |
| US6735299B2 (en) * | 2001-11-08 | 2004-05-11 | Avaya Technology Corp. | Automatic call distribution groups in call center management systems |
| US20030115088A1 (en) | 2001-12-18 | 2003-06-19 | Crossmark, Inc. | System and method of routing, scheduling, and monitoring a workforce |
| US7644144B1 (en) * | 2001-12-21 | 2010-01-05 | Microsoft Corporation | Methods, tools, and interfaces for the dynamic assignment of people to groups to enable enhanced communication and collaboration |
| US20040093621A1 (en) | 2001-12-25 | 2004-05-13 | Kyowa Hakko Kogyo Co., Ltd | Antibody composition which specifically binds to CD20 |
| US7023979B1 (en) * | 2002-03-07 | 2006-04-04 | Wai Wu | Telephony control system with intelligent call routing |
| US7372952B1 (en) | 2002-03-07 | 2008-05-13 | Wai Wu | Telephony control system with intelligent call routing |
| CA2481920A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | Antibody composition-containing medicament |
| CN1930288B (zh) | 2002-04-09 | 2012-08-08 | 协和发酵麒麟株式会社 | 基因组被修饰的细胞 |
| WO2003084570A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM |
| WO2003085119A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa |
| ES2362419T3 (es) | 2002-04-09 | 2011-07-05 | Kyowa Hakko Kirin Co., Ltd. | Células con depresión o deleción de la actividad de la proteína que participa en el transporte de gdp-fucosa. |
| JPWO2003085118A1 (ja) | 2002-04-09 | 2005-08-11 | 協和醗酵工業株式会社 | 抗体組成物の製造方法 |
| CA2488441C (en) | 2002-06-03 | 2015-01-27 | Genentech, Inc. | Synthetic antibody phage libraries |
| CA2489004C (en) | 2002-06-13 | 2013-01-08 | Crucell Holland B.V. | Agonistic binding molecules to the human ox40 receptor |
| US7870240B1 (en) | 2002-06-28 | 2011-01-11 | Microsoft Corporation | Metadata schema for interpersonal communications management systems |
| AU2003272210A1 (en) | 2002-08-16 | 2004-03-03 | Nuasis Corporation | Automatic management of the visual space while performing a task |
| US7361740B2 (en) | 2002-10-15 | 2008-04-22 | Pdl Biopharma, Inc. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| US7217797B2 (en) | 2002-10-15 | 2007-05-15 | Pdl Biopharma, Inc. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| US7184540B2 (en) * | 2002-11-26 | 2007-02-27 | Rockwell Electronic Commerce Technologies, Llc | Personality based matching of callers to agents in a communication system |
| PT1572744E (pt) | 2002-12-16 | 2010-09-07 | Genentech Inc | Variantes de imunoglobulina e utilizações destas |
| US7418094B2 (en) | 2003-01-06 | 2008-08-26 | Genesys Telecommunications Laboratories, Inc. | Method and apparatus for multimedia interaction routing according to agent capacity sets |
| US20050079574A1 (en) | 2003-01-16 | 2005-04-14 | Genentech, Inc. | Synthetic antibody phage libraries |
| US9818136B1 (en) | 2003-02-05 | 2017-11-14 | Steven M. Hoffberg | System and method for determining contingent relevance |
| US7676034B1 (en) * | 2003-03-07 | 2010-03-09 | Wai Wu | Method and system for matching entities in an auction |
| US20040264677A1 (en) | 2003-06-30 | 2004-12-30 | Horvitz Eric J. | Ideal transfer of call handling from automated systems to human operators based on forecasts of automation efficacy and operator load |
| AU2004279742A1 (en) | 2003-10-08 | 2005-04-21 | Kyowa Hakko Kirin Co., Ltd. | Fused protein composition |
| EP1705251A4 (en) | 2003-10-09 | 2009-10-28 | Kyowa Hakko Kirin Co Ltd | PROCESS FOR PRODUCING ANTIBODY COMPOSITION BY RNA INHIBITION OF FUNCTION OF $ G (A) 1,6-FUCOSYLTRANSFERASE |
| US7472080B2 (en) | 2003-10-24 | 2008-12-30 | Sachin Goel | Methods and associated systems for an airline to enhance customer experience and provide options on flights |
| ME01775B (me) | 2003-11-05 | 2011-02-28 | Glycart Biotechnology Ag | Cd20 antitijela sa povećanim afinitetom vezivanja za fc receptor i efektornom funkcijom |
| NZ583292A (en) | 2003-11-06 | 2012-03-30 | Seattle Genetics Inc | Monomethylvaline compounds capable of conjugation to ligands |
| JPWO2005053742A1 (ja) | 2003-12-04 | 2007-06-28 | 協和醗酵工業株式会社 | 抗体組成物を含有する医薬 |
| WO2007008835A2 (en) | 2005-07-10 | 2007-01-18 | Adaptive Spectrum And Signal Alignment, Inc. | Dsl system estimation |
| US8073731B1 (en) | 2003-12-30 | 2011-12-06 | ProcessProxy Corporation | Method and system for improving efficiency in an organization using process mining |
| US7349535B2 (en) | 2004-03-03 | 2008-03-25 | Cisco Technology, Inc. | Method and system for automatic call distribution based on location information for call center agents |
| CA2561686C (en) | 2004-03-31 | 2014-12-02 | Genentech, Inc. | Humanized anti-tgf-beta antibodies |
| US7785903B2 (en) | 2004-04-09 | 2010-08-31 | Genentech, Inc. | Variable domain library and uses |
| BR122019012028B1 (pt) | 2004-04-13 | 2023-09-26 | F. Hoffmann-La Roche Ag | Anticorpos anti-p-selectina, molécula de ácido nucléico, vetor, e composição |
| WO2005109285A2 (en) | 2004-05-04 | 2005-11-17 | Khilmetrics, Inc. | Configurational density process and structure |
| US7590589B2 (en) | 2004-09-10 | 2009-09-15 | Hoffberg Steven M | Game theoretic prioritization scheme for mobile ad hoc networks permitting hierarchal deference |
| TWI380996B (zh) | 2004-09-17 | 2013-01-01 | Hoffmann La Roche | 抗ox40l抗體 |
| US20060062376A1 (en) | 2004-09-22 | 2006-03-23 | Dale Pickford | Call center services system and method |
| ES2579805T3 (es) | 2004-09-23 | 2016-08-16 | Genentech, Inc. | Anticuerpos y conjugados modificados por ingeniería genética con cisteína |
| US7949121B1 (en) | 2004-09-27 | 2011-05-24 | Avaya Inc. | Method and apparatus for the simultaneous delivery of multiple contacts to an agent |
| CA2585776A1 (en) | 2004-10-29 | 2006-05-11 | University Of Southern California | Combination cancer immunotherapy with co-stimulatory molecules |
| US7877304B1 (en) | 2004-12-16 | 2011-01-25 | Coulter David B | System and method for managing consumer information |
| US20060153356A1 (en) | 2005-01-13 | 2006-07-13 | Seatlink, Inc. | Contact-center routing based on incentives and/or agent preferences |
| US7603304B2 (en) | 2005-03-08 | 2009-10-13 | International Business Machines Corporation | Domain specific return on investment model system and method of use |
| US7817796B1 (en) | 2005-04-27 | 2010-10-19 | Avaya Inc. | Coordinating work assignments for contact center agents |
| EP2650020B1 (en) | 2005-05-06 | 2016-08-24 | Providence Health & Services - Oregon | Trimeric OX40-immunoglobulin fusion protein and methods of use |
| CN109485727A (zh) | 2005-05-09 | 2019-03-19 | 小野药品工业株式会社 | 程序性死亡-1(pd-1)的人单克隆抗体及使用抗pd-1抗体来治疗癌症的方法 |
| KR101411165B1 (ko) | 2005-07-01 | 2014-06-25 | 메다렉스, 엘.엘.시. | 예정 사멸 리간드 1 (피디-엘1)에 대한 인간 모노클로날항체 |
| US8774389B2 (en) | 2005-09-13 | 2014-07-08 | International Business Machines Corporation | Call routing between shared service centers |
| US8577015B2 (en) | 2005-09-16 | 2013-11-05 | Avaya Inc. | Method and apparatus for the automated delivery of notifications to contacts based on predicted work prioritization |
| US8874477B2 (en) | 2005-10-04 | 2014-10-28 | Steven Mark Hoffberg | Multifactorial optimization system and method |
| EP2465870A1 (en) | 2005-11-07 | 2012-06-20 | Genentech, Inc. | Binding polypeptides with diversified and consensus VH/VL hypervariable sequences |
| US7475054B2 (en) | 2005-11-30 | 2009-01-06 | The Boeing Company | Integrating multiple information-providing systems |
| US20070237764A1 (en) | 2005-12-02 | 2007-10-11 | Genentech, Inc. | Binding polypeptides with restricted diversity sequences |
| US8300798B1 (en) * | 2006-04-03 | 2012-10-30 | Wai Wu | Intelligent communication routing system and method |
| WO2007134050A2 (en) | 2006-05-09 | 2007-11-22 | Genentech, Inc. | Binding polypeptides with optimized scaffolds |
| ES2399075T3 (es) | 2006-08-30 | 2013-03-25 | Genentech, Inc. | Anticuerpos multiespecíficos |
| US8015073B2 (en) | 2006-09-25 | 2011-09-06 | International Business Machines Corporation | Increasing market efficiency of ticket supply systems |
| US10106619B2 (en) * | 2006-10-04 | 2018-10-23 | La Jolla Institute For Allergy And Immunology | Virus vaccination and treatment methods with OX40 agonist compositions |
| US8566247B1 (en) | 2007-02-19 | 2013-10-22 | Robert H. Nagel | System and method for secure communications involving an intermediary |
| CN100592373C (zh) | 2007-05-25 | 2010-02-24 | 群康科技(深圳)有限公司 | 液晶显示面板驱动装置及其驱动方法 |
| SG186656A1 (en) | 2007-12-14 | 2013-01-30 | Bristol Myers Squibb Co | Binding molecules to the human ox40 receptor |
| PT2235064E (pt) | 2008-01-07 | 2016-03-01 | Amgen Inc | Método de preparação de moléculas heterodiméricas de fc de anticorpos utilizando efeitos de indução eletrostática |
| PL2242773T3 (pl) | 2008-02-11 | 2017-11-30 | Cure Tech Ltd. | Przeciwciała monoklonalne do leczenia nowotworu |
| EP2262837A4 (en) | 2008-03-12 | 2011-04-06 | Merck Sharp & Dohme | PD-1 BINDING PROTEINS |
| CA2735006A1 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Pd-1 antagonists and methods of use thereof |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| US8233918B2 (en) | 2009-08-20 | 2012-07-31 | E-View Connections LLC | Digital content distribution system for delivering location specific content to an ad hoc group of mobile subscribers |
| US20130017199A1 (en) | 2009-11-24 | 2013-01-17 | AMPLIMMUNE ,Inc. a corporation | Simultaneous inhibition of pd-l1/pd-l2 |
| US9132352B1 (en) | 2010-06-24 | 2015-09-15 | Gregory S. Rabin | Interactive system and method for rendering an object |
| EA029793B1 (ru) | 2010-08-23 | 2018-05-31 | Борд Оф Риджентс, Дзе Юниверсити Оф Техас Систем | Антитела к ох40 и способы их применения |
| CA2845810C (en) | 2011-08-23 | 2017-03-28 | Board Of Regents, The University Of Texas System | Anti-ox40 antibodies and methods of using the same |
| GB201116092D0 (en) * | 2011-09-16 | 2011-11-02 | Bioceros B V | Antibodies and uses thereof |
| KR20160006168A (ko) | 2013-03-18 | 2016-01-18 | 바이오서오엑스 프로덕스 비.브이. | 인간화 항-cd134(ox40) 항체 및 이의 용도 |
| RU2016142476A (ru) | 2014-03-31 | 2018-05-07 | Дженентек, Инк. | Комбинированная терапия, включающая антиангиогенезные агенты и агонисты, связывающие ох40 |
| EP3632934A1 (en) | 2014-03-31 | 2020-04-08 | F. Hoffmann-La Roche AG | Anti-ox40 antibodies and methods of use |
| MX2017005750A (es) | 2014-11-03 | 2017-12-15 | Genentech Inc | Ensayos para detectar subgrupos inmunes de células t y sus métodos de uso. |
| CA2966507A1 (en) | 2014-11-03 | 2016-05-12 | Genentech, Inc. | Methods and biomarkers for predicting efficacy and evaluation of an ox40 agonist treatment |
| RU2017119428A (ru) | 2014-11-06 | 2018-12-06 | Дженентек, Инк. | Комбинированная терапия, включающая применение агонистов, связывающихся с ох40, и ингибиторов tigit |
| MX2017006320A (es) | 2014-11-17 | 2017-08-10 | Genentech Inc | Terapia combinada que comprende agonistas de unión de ox40 y antagonistas de unión del eje de pd-1. |
| KR20180011839A (ko) | 2015-06-08 | 2018-02-02 | 제넨테크, 인크. | 항-ox40 항체를 이용한 암의 치료 방법 |
| WO2016200835A1 (en) | 2015-06-08 | 2016-12-15 | Genentech, Inc. | Methods of treating cancer using anti-ox40 antibodies and pd-1 axis binding antagonists |
-
2015
- 2015-11-02 CA CA2966507A patent/CA2966507A1/en not_active Abandoned
- 2015-11-02 HK HK18102676.7A patent/HK1243738A1/zh unknown
- 2015-11-02 CN CN201580064147.XA patent/CN107109484B/zh active Active
- 2015-11-02 BR BR112017009159-3A patent/BR112017009159A2/pt not_active Application Discontinuation
- 2015-11-02 KR KR1020177014849A patent/KR20170074246A/ko not_active Withdrawn
- 2015-11-02 AU AU2015343339A patent/AU2015343339A1/en not_active Abandoned
- 2015-11-02 WO PCT/US2015/058677 patent/WO2016073380A1/en not_active Ceased
- 2015-11-02 JP JP2017542822A patent/JP2017536842A/ja active Pending
- 2015-11-02 US US14/930,597 patent/US20160160290A1/en not_active Abandoned
- 2015-11-02 MX MX2017005751A patent/MX2017005751A/es unknown
- 2015-11-02 RU RU2017119231A patent/RU2017119231A/ru not_active Application Discontinuation
- 2015-11-02 EP EP15791886.3A patent/EP3215637B1/en active Active
- 2015-11-02 CN CN202111487428.XA patent/CN114381521A/zh active Pending
- 2015-11-02 SG SG11201703521UA patent/SG11201703521UA/en unknown
- 2015-11-03 AR ARP150103559A patent/AR102518A1/es unknown
-
2017
- 2017-04-27 IL IL251969A patent/IL251969A0/en unknown
- 2017-12-08 US US15/836,729 patent/US10767232B2/en active Active
-
2019
- 2019-03-18 US US16/356,852 patent/US10718031B1/en not_active Expired - Fee Related
-
2020
- 2020-12-03 JP JP2020200990A patent/JP2021061838A/ja active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013119202A1 (en) * | 2012-02-06 | 2013-08-15 | Providence Health & Services - Oregon | Cancer treatment and monitoring methods using ox40 agonists |
| WO2014009535A2 (en) * | 2012-07-12 | 2014-01-16 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Methods for predicting the survival time and treatment responsiveness of a patient suffering from a solid cancer with a signature of at least 7 genes |
| WO2015095423A2 (en) * | 2013-12-17 | 2015-06-25 | Genentech, Inc. | Combination therapy comprising ox40 binding agonists and pd-1 axis binding antagonists |
Non-Patent Citations (3)
| Title |
|---|
| GARRISON K ET AL: "The small molecule TGF-[beta] signaling inhibitor SM16 synergizes with agonistic OX40 antibody to suppress established mammary tumors and reduce spontaneous metastasis", CANCER IMMUNOLOGY, IMMUNOTHERAPY, SPRINGER, BERLIN, DE, vol. 61, no. 4, 1 April 2012 (2012-04-01), pages 511 - 521, XP002752658, ISSN: 1432-0851, [retrieved on 20111005], DOI: 10.1007/S00262-011-1119-Y * |
| MAHRUKH HUSENI ET AL: "Anti-tumor efficacy and biomarker evaluation of agonistic anti-OX40 antibodies in preclinical models", JOURNAL FOR IMMUNOTHERAPY OF CANCER, BIOMED CENTRAL LTD, LONDON, UK, vol. 2, no. Suppl 3, 6 November 2014 (2014-11-06), pages P253, XP021202522, ISSN: 2051-1426, DOI: 10.1186/2051-1426-2-S3-P253 * |
| WEINBERG A D ET AL: "Science gone translational: the OX40 agonist story", IMMUNOLOGICAL REVIEWS, WILEY-BLACKWELL PUBLISHING, INC, US, vol. 244, no. 1, 1 November 2011 (2011-11-01), pages 218 - 231, XP002739167, ISSN: 0105-2896, [retrieved on 20111021], DOI: 10.1111/J.1600-065X.2011.01069.X * |
Cited By (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10730951B2 (en) | 2014-03-31 | 2020-08-04 | Genentech, Inc. | Anti-OX40 antibodies and methods of use |
| US9975957B2 (en) | 2014-03-31 | 2018-05-22 | Genentech, Inc. | Anti-OX40 antibodies and methods of use |
| US10767232B2 (en) | 2014-11-03 | 2020-09-08 | Genentech, Inc. | Methods and biomarkers for predicting efficacy and evaluation of an OX40 agonist treatment |
| US10845364B2 (en) | 2014-11-03 | 2020-11-24 | Genentech, Inc. | Assays for detecting T cell immune subsets and methods of use thereof |
| US11059893B2 (en) | 2015-04-15 | 2021-07-13 | Bergenbio Asa | Humanized anti-AXL antibodies |
| US11466092B2 (en) | 2015-05-29 | 2022-10-11 | Bristol-Myers Squibb Company | Antibodies against OX-40 and uses thereof |
| US10683357B2 (en) | 2015-05-29 | 2020-06-16 | Bristol-Myers Squibb Company | Antibodies against OX40 and uses thereof |
| US9644032B2 (en) | 2015-05-29 | 2017-05-09 | Bristol-Myers Squibb Company | Antibodies against OX40 and uses thereof |
| WO2016200836A1 (en) * | 2015-06-08 | 2016-12-15 | Genentech, Inc. | Methods of treating cancer using anti-ox40 antibodies |
| US12240911B2 (en) | 2015-10-02 | 2025-03-04 | Hoffmann-La Roche Inc. | Bispecific antibodies specific for OX40 |
| US10526413B2 (en) | 2015-10-02 | 2020-01-07 | Hoffmann-La Roche Inc. | Bispecific antibodies specific for OX40 |
| WO2018104147A1 (en) * | 2016-12-09 | 2018-06-14 | Institut Paoli Calmettes | Biomarker panel for prognosis of bladder cancer |
| EP3333268A1 (en) * | 2016-12-09 | 2018-06-13 | Institut Paoli Calmettes | Biomarker panel for prognosis of bladder cancer |
| KR20190092552A (ko) * | 2016-12-15 | 2019-08-07 | 애브비 바이오테라퓨틱스 인크. | 항-ox40 항체 및 이의 용도 |
| RU2753493C2 (ru) * | 2016-12-15 | 2021-08-17 | Эббви Байотерапьютикс Инк. | Анти-ох40 антитела и их применение |
| US10556962B2 (en) | 2016-12-15 | 2020-02-11 | Abbvie Biotherapeutics Inc. | Anti-OX40 antibodies and their uses |
| WO2018112346A1 (en) * | 2016-12-15 | 2018-06-21 | Abbvie Biotherapeutics Inc. | Anti-ox40 antibodies and their uses |
| EP3725809A1 (en) * | 2016-12-15 | 2020-10-21 | AbbVie Biotherapeutics Inc. | Anti-ox40 antibodies and their uses |
| US10040864B2 (en) | 2016-12-15 | 2018-08-07 | Abbvie Biotherapeutics Inc. | Anti-OX40 antibodies and their uses |
| JP2021019603A (ja) * | 2016-12-15 | 2021-02-18 | アッヴィ・バイオセラピューティクス・インコーポレイテッド | 抗ox40抗体及びそれらの使用 |
| AU2017377036B2 (en) * | 2016-12-15 | 2022-06-23 | Abbvie Biotherapeutics Inc. | Anti-OX40 antibodies and their uses |
| US10604584B2 (en) | 2016-12-15 | 2020-03-31 | Abbvie Biotherapeutics Inc. | Anti-OX40 antibodies and their uses |
| KR102341926B1 (ko) | 2016-12-15 | 2021-12-23 | 애브비 바이오테라퓨틱스 인크. | 항-ox40 항체 및 이의 용도 |
| TWI734879B (zh) * | 2016-12-15 | 2021-08-01 | 美商艾伯維生物醫療股份有限公司 | 抗ox40抗體及其用途 |
| JP2019537436A (ja) * | 2017-03-14 | 2019-12-26 | ノヴォミクス・カンパニー・リミテッド | 進行性胃癌患者の手術後の予後または抗癌剤適合性予測システム |
| US11339447B2 (en) | 2017-03-29 | 2022-05-24 | Crown Bioscience, Inc. (Taicang) | System and method for determining Kareniticin sensitivity on cancer |
| WO2018177326A1 (en) * | 2017-03-29 | 2018-10-04 | Crown Bioscience Inc. (Taicang) | System and method for determining karenitecin sensitivity on cancer |
| US10544223B2 (en) | 2017-04-20 | 2020-01-28 | Adc Therapeutics Sa | Combination therapy with an anti-axl antibody-drug conjugate |
| US11318211B2 (en) | 2017-06-14 | 2022-05-03 | Adc Therapeutics Sa | Dosage regimes for the administration of an anti-CD19 ADC |
| US11938192B2 (en) | 2017-06-14 | 2024-03-26 | Medimmune Limited | Dosage regimes for the administration of an anti-CD19 ADC |
| WO2019224275A1 (en) | 2018-05-23 | 2019-11-28 | Adc Therapeutics Sa | Molecular adjuvant |
| WO2021104834A1 (en) | 2019-11-27 | 2021-06-03 | Adc Therapeutics Sa | Combination therapy |
| GB202102396D0 (en) | 2021-02-19 | 2021-04-07 | Adc Therapeutics Sa | Molecular adjuvant |
| RU2771760C1 (ru) * | 2021-12-29 | 2022-05-11 | Федеральное государственное бюджетное учреждение "Российский научный центр радиологии и хирургических технологий имени академика А.М. Гранова" Министерства здравоохранения Российской Федерации | Способ оценки чувствительности опухоли к иммуноонкологическим препаратам |
Also Published As
| Publication number | Publication date |
|---|---|
| CN107109484A (zh) | 2017-08-29 |
| EP3215637B1 (en) | 2019-07-03 |
| CN107109484B (zh) | 2021-12-14 |
| US20160160290A1 (en) | 2016-06-09 |
| SG11201703521UA (en) | 2017-05-30 |
| RU2017119231A (ru) | 2018-12-06 |
| RU2017119231A3 (enExample) | 2019-06-07 |
| EP3215637A1 (en) | 2017-09-13 |
| JP2021061838A (ja) | 2021-04-22 |
| CN114381521A (zh) | 2022-04-22 |
| HK1243738A1 (zh) | 2018-07-20 |
| IL251969A0 (en) | 2017-06-29 |
| AR102518A1 (es) | 2017-03-08 |
| MX2017005751A (es) | 2018-04-10 |
| AU2015343339A1 (en) | 2017-06-15 |
| US20180195133A1 (en) | 2018-07-12 |
| CA2966507A1 (en) | 2016-05-12 |
| US10718031B1 (en) | 2020-07-21 |
| US10767232B2 (en) | 2020-09-08 |
| JP2017536842A (ja) | 2017-12-14 |
| KR20170074246A (ko) | 2017-06-29 |
| BR112017009159A2 (pt) | 2018-03-06 |
| WO2016073380A8 (en) | 2017-04-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10767232B2 (en) | Methods and biomarkers for predicting efficacy and evaluation of an OX40 agonist treatment | |
| US10845364B2 (en) | Assays for detecting T cell immune subsets and methods of use thereof | |
| TWI680985B (zh) | 抗ox-40抗體及使用方法 | |
| US20180346586A1 (en) | Methods of treating cancer using anti-ox40 antibodies | |
| CN106999583A (zh) | 包含ox40结合激动剂和pd‑1轴结合拮抗剂的组合疗法 | |
| AU2021293038A1 (en) | Methods and compositions for treating triple-negative breast cancer | |
| HK1238715B (zh) | 用於检测t细胞免疫子集的测定法及其使用方法 | |
| HK1232891B (en) | Anti-ox40 antibodies and methods of use | |
| HK1232891A1 (en) | Anti-ox40 antibodies and methods of use | |
| HK1227043B (zh) | 抗ox40抗体和使用方法 | |
| HK1238715A1 (en) | Assays for detecting t cell immune subsets and methods of use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15791886 Country of ref document: EP Kind code of ref document: A1 |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015791886 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015791886 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 251969 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11201703521U Country of ref document: SG |
|
| ENP | Entry into the national phase |
Ref document number: 2966507 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2017542822 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2017/005751 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017009159 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20177014849 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017119231 Country of ref document: RU Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2015343339 Country of ref document: AU Date of ref document: 20151102 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112017009159 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170502 |