WO2015112886A2 - Binding proteins and methods of use thereof - Google Patents

Binding proteins and methods of use thereof Download PDF

Info

Publication number
WO2015112886A2
WO2015112886A2 PCT/US2015/012731 US2015012731W WO2015112886A2 WO 2015112886 A2 WO2015112886 A2 WO 2015112886A2 US 2015012731 W US2015012731 W US 2015012731W WO 2015112886 A2 WO2015112886 A2 WO 2015112886A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
acid sequence
antibody
region
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/012731
Other languages
English (en)
French (fr)
Other versions
WO2015112886A3 (en
Inventor
Kalyani MONDAL
Betty Chan LI
Yu Chen
Taruna Arora
Hugo Matern
Wenyan Shen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
NGM Biopharmaceuticals Inc
Original Assignee
NGM Biopharmaceuticals Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to DK15740600.0T priority Critical patent/DK3097122T3/da
Priority to SI201531230T priority patent/SI3097122T1/sl
Priority to CA2937898A priority patent/CA2937898C/en
Priority to ES15740600T priority patent/ES2808340T3/es
Priority to EP20170906.0A priority patent/EP3738981A1/en
Priority to KR1020167022746A priority patent/KR102489475B1/ko
Priority to CN201580016315.8A priority patent/CN106662577B/zh
Priority to LTEP15740600.0T priority patent/LT3097122T/lt
Priority to UAA201608576A priority patent/UA119863C2/uk
Priority to RS20200912A priority patent/RS60593B1/sr
Priority to JP2016548190A priority patent/JP6837840B2/ja
Priority to HRP20200881TT priority patent/HRP20200881T1/hr
Priority to AU2015209131A priority patent/AU2015209131B2/en
Priority to MYPI2016001386A priority patent/MY191944A/en
Priority to BR112016017248-5A priority patent/BR112016017248B1/pt
Application filed by NGM Biopharmaceuticals Inc filed Critical NGM Biopharmaceuticals Inc
Priority to EP15740600.0A priority patent/EP3097122B9/en
Priority to MX2016009555A priority patent/MX375032B/es
Priority to NZ722377A priority patent/NZ722377A/en
Priority to SG11201606018UA priority patent/SG11201606018UA/en
Priority to RU2016130128A priority patent/RU2701434C2/ru
Priority to PL15740600T priority patent/PL3097122T3/pl
Publication of WO2015112886A2 publication Critical patent/WO2015112886A2/en
Publication of WO2015112886A3 publication Critical patent/WO2015112886A3/en
Priority to ZA2016/05151A priority patent/ZA201605151B/en
Priority to IL246921A priority patent/IL246921B/en
Anticipated expiration legal-status Critical
Priority to PH12016501644A priority patent/PH12016501644B1/en
Priority to CY20201100699T priority patent/CY1123163T1/el
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001154Enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/06Antihyperlipidemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/48Drugs for disorders of the endocrine system of the pancreatic hormones
    • A61P5/50Drugs for disorders of the endocrine system of the pancreatic hormones for increasing or potentiating the activity of insulin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/66Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving blood sugars, e.g. galactose

Definitions

  • the present disclosure relates generally to binding proteins, such as antibodies, that bind to beta klotho, including human beta klotho, and methods of their use.
  • Beta klotho which belongs to the Klotho family, is a single-pass type I membrane protein. Beta klotho has an extracellular domain consisting of two internal repeats which share homology with members of the family 1 glycosidases but lack glucosidase catalytic activity. Beta klotho expression is primarily detected in the liver, pancreas and adipose tissue. Ito and colleagues have reported that beta klotho-deficient (KLB-/-) mice have elevated mRNA levels of CYP7A1 and CY8B1 and exhibit increased synthesis and excretion of bile acid (Ito et ai, 2005, J Clin Invest 1 15: 2202-2208). Beta klotho forms a complex with fibroblast growth factor (FGF) receptors and functions as a co-receptor for FGFs, including FGF19 and FGF21 .
  • FGF fibroblast growth factor
  • FGF19 transgenic mice have decreased adiposity, increased metabolic rate, reduced liver triglycerides, increased fatty acid oxidation, reduced glucose levels and increased insulin sensitivity (Tomlinson et al., 2002, Endocrinology 143: 1741 -1747). In addition, these transgenic mice were reported not to become obese or diabetic on a high-fat diet (Tomlinson et al., 2002, Endocrinology 143: 1741 -1747).
  • FGF19 treatment prevented or reversed diabetes in mice made obese by genetic ablation of brown adipose tissue or the genetic absence of leptin (Fu et al., 2004, Endocrinology 145: 2594-2603).
  • FGF21 acts through the interaction of FGFRs and beta klotho.
  • FGFR1 is an abundant receptor in white adipose tissue and is most likely the main functional receptor for FGF21 in white adipose tissue.
  • FGF21 expression is detected in the liver, thymus, adipose tissue, and islet beta-cells in the pancreas.
  • FGF19 and FGF21 require both FGFRs and beta klotho for cell signaling, agents which mimic FGF19 and/or FGF21 may be desirable for their effects or glucose metabolism or lipid metabolism. However, it is not clear what features are required for an agent to confer FGF19-like or FGF21 -like cell signaling activity.
  • the present disclosure provides proteins that bind to beta klotho, including binding proteins such as antibodies that bind to beta klotho.
  • binding proteins such as antibodies that bind to beta klotho.
  • Such binding proteins including antibodies may bind to a beta klotho polypeptide, a beta klotho fragment and/or a beta klotho epitope.
  • binding proteins, including antibodies may be agonists ⁇ e.g., induce FGF19-like or FGF21 -like signaling of a FGF receptor or activate a beta klotho/FGF receptor complex).
  • the present disclosure also provides binding proteins, including antibodies or fragments thereof, that (i) bind to human beta klotho, (ii) induce FGF19-like signaling and/or FGF21 -like signaling, and (iii) do not compete with FGF19 and/or FGF21 for the interaction with beta klotho.
  • the anti-beta klotho antibodies are humanized antibodies that bind to a beta klotho polypeptide, a beta klotho fragment, or a beta klotho epitope.
  • an anti-beta klotho antibody comprises a VH CDR1 , VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and/or VL CDR3 of a monoclonal antibody designated 5H23, 1 C17, 1 D19, 2L12, 3L3, 3N20, 4P5, 5C23, 5F7 or 1 G19 as described herein, or a humanized variant thereof.
  • an anti-beta klotho antibody can further comprise a VH FR1 , VH FR2, VH FR3, VH FR4, VL FR1 , VL FR2, VL FR3, and/or VL FR4 of a human
  • immunoglobulin amino acid sequence or a variant thereof.
  • a binding protein ⁇ e.g., an anti-beta klotho antibody comprises six CDRs or less than six CDRs.
  • a binding protein ⁇ e.g., an anti-beta klotho antibody comprises one, two, three, four, five, or six CDRs selected from VH CDR1 , VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and/or VL CDR3.
  • a binding protein ⁇ e.g., an anti-beta klotho antibody
  • a binding protein ⁇ e.g., an anti-beta klotho antibody
  • a scaffold region or frame work region including a VH FR1 , VH FR2, VH FR3, VH FR4, VL FR1 , VL FR2, VL FR3, and/or VL FR4 of a human immunoglobulin amino acid sequence or a variant thereof.
  • the antibody is a humanized antibody, a monoclonal antibody, a recombinant antibody, an antigen binding fragment or any combination thereof.
  • the antibody is a humanized monoclonal antibody, or antigen binding fragment thereof, that binds to a beta klotho polypeptide ⁇ e.g., a cell surface-expressed or soluble beta klotho), a beta klotho fragment, or a beta klotho epitope.
  • binding proteins such as anti-beta klotho antibodies (i) that competitively block ⁇ e.g., in a dose-dependent manner) an anti-beta klotho antibody provided herein from binding to a beta klotho polypeptide ⁇ e.g., a cell surface-expressed or soluble beta klotho), a beta klotho fragment, or a beta klotho epitope and/or (ii) that bind to a beta klotho epitope that is bound by an anti-beta klotho antibody provided herein.
  • the binding proteins such as anti-beta klotho antibody competitively blocks ⁇ e.g., in a dose- dependent manner) monoclonal antibody 5H23 or 1 G19 described herein or a humanized variant thereof from binding to a beta klotho polypeptide ⁇ e.g., a cell surface-expressed or soluble beta klotho ), a beta klotho fragment, or a beta klotho epitope.
  • the binding proteins such as anti-beta klotho antibody binds to a beta klotho epitope that is bound ⁇ e.g., recognized) by monoclonal antibody 5H23, or 1 G19 described herein or a humanized variant thereof.
  • binding proteins including antibodies or fragments thereof, that (i) bind to an epitope of human beta klotho and
  • binding proteins including antibodies or fragments thereof, are provided herein that bind to a region, including an epitope, of human beta klotho or cyno beta klotho.
  • binding proteins bind to a region of human beta klotho or cycno beta klotho including, for example, those that bind to: (i) a KLB2 domain of human beta klotho comprising amino acid residues 509 to 1044 of SEQ ID NO:297; (ii) a glycosyl hydrolase 1 region of a KLB2 domain of human beta klotho comprising amino acid residues 517 to 967 of SEQ ID NO:297; (iii) a region of human beta klotho comprising amino acid residues 657 to 703 of SEQ ID NO:297; or (iv) a region of cyno beta klotho comprising amino acid residues 657 to 703 of SEQ ID NO:299.
  • binding proteins including antibodies or fragments thereof, are provided herein that bind to a specific epitope of human beta klotho, including, for example, those that bind to: (i) an epitope of human beta klotho comprising at least one of amino acid residues 657, 701 and/or 703 of human beta klotho (SEQ ID NO: 297); (ii) an epitope of human beta klotho comprising at least amino acid residue 657 of SEQ ID NO: 297; (iii) an epitope of human beta klotho comprising at least amino acid residue 701 of SEQ ID NO: 297; (iv) an epitope of human beta klotho comprising at least amino acid residue 703 of SEQ ID NO: 297; (v) an epitope of human beta klotho comprising at least amino acid residues 657 and 701 of SEQ ID NO: 297; (vi) an epitope of human beta klotho comprising at least
  • Such antibodies provided above can, in some embodiments, induce FGF19-like signaling and/or FGF21 -like signaling or activate a beta klotho/FGF receptor complex in a cell that expresses human beta klotho and an FGF receptor.
  • the antibody is a monoclonal antibody, for example, a humanized, human or chimeric antibody.
  • the binding proteins such as anti-beta klotho antibodies provided herein are conjugated or recombinantly linked to a diagnostic agent, detectable agent or therapeutic agent.
  • the therapeutic agent is a drug, including one or more drugs such as biguanides and sulphonylureas ⁇ e.g., metformin tolbutamide, chlorpropamide, acetohexamide, tolazamide, glibenclamide, glyburide, and glipizide), thiazolidinediones ⁇ e.g., rosiglitazone, pioglitazone), GLP-1 analogues, PPAR gamma agonists ⁇ e.g., pioglitazone and rosiglitazone), dipeptidyl peptidase-4 (DPP-4) inhibitors, ⁇ e.g., JANUVIN ® ,
  • ONGLYZA ® bromocriptine formulations and bile acid sequestrants ⁇ e.g.,
  • the detectable agent is a radioisotope, an enzyme, a fluorescent compound, a bioluminescent compound or a chemiluminescent compound.
  • compositions comprising a binding protein such as an anti-beta klotho antibody described herein. Also provided herein are pharmaceutical compositions comprising a binding protein such as an beta klotho antibody as described herein.
  • the present disclosure also provides isolated nucleic acid molecules encoding an immunoglobulin heavy chain, an immunoglobulin light chain, VH region, VL region, VH CDR1 , VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and/or VL CDR3 of binding proteins ⁇ e.g., anti-beta klotho antibodies) that bind to a beta klotho polypeptide, a beta klotho polypeptide fragment, or a beta klotho epitope.
  • binding proteins ⁇ e.g., anti-beta klotho antibodies
  • the nucleic acid molecule encodes a VH region, VL region, VH CDR1 , VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and/or VL CDR3 of a monoclonal antibody designated as 5H23, 1 C17, 1 D19, 2L12, 3L3, 3N20, 4P5, 5C23, 5F7 or 1 G19 as described herein, or a humanized variant thereof.
  • the nucleic acid molecule further encodes a scaffold region or a framework region, including VH FR1 , VH FR2, VH FR3, VH FR4, VL FR1 , VL FR2, VL FR3, and/or VL FR4 of a human immunoglobulin amino acid sequence or a variant thereof.
  • vectors and host cells comprising the nucleic acid molecules encoding an a binding protein such as anti-beta klotho antibody, as well as methods of producing a binding protein such as an anti-beta klotho antibody by culturing the host cells provided herein under conditions that promote the production of a binding protein such as an anti-beta klotho antibody.
  • the present disclosure also provides methods of treating, preventing or alleviating a disease, disorder or condition ⁇ e.g., one or more symptoms) comprising administering a therapeutically effective amount of a binding protein such as an anti- beta klotho antibody provided herein to a subject, including a subject in need thereof, thereby treating, preventing or alleviating the disease, disorder or condition.
  • a binding protein such as an anti- beta klotho antibody provided herein
  • the disease, disorder or condition is caused by or otherwise
  • the disease is treatable by lowering blood glucose, insulin or serum lipid levels ⁇ e.g., Type 2 diabetes, obesity,
  • the disease, disorder or condition is related to glucose metabolism or lipid metabolism.
  • the disease, disorder or condition is selected from the group of a hyperglycemic condition, ⁇ e.g., diabetes, such as Type I diabetes, Type 2 diabetes, gestational diabetes, insulin resistance, hyperinsulinemia, glucose intolerance, metabolic syndrome, or obesity).
  • the methods of treating, preventing or ameliorating include methods of improving glucose metabolism and/or methods of improving lipid metabolism.
  • the methods of treating, preventing or ameliorating result in reduced glucose levels (e.g., reduced blood glucose), increased insulin sensitivity, reduced insulin resistance, reduced glycogen, improved glucose tolerance, improved glucose tolerance, improved glucose metabolism, improved homeostasis, improved pancreatic function, reduced triglycerides, reduced cholesterol, reduced IDL, reduced LDL, reduced VLDL, decreased blood pressure, decreased internal thickening of a blood vessel and/or decreased body mass or weight gain.
  • the present disclosure provides methods of treating a disease, disorder or condition associated with human FGF19 and/or human FGF21 , which includes any disease, disorder or condition whose onset in a subject (e.g., a patient) is caused by, at least in part, the induction of FGF19-like and/or FGF21 -like signaling, which is initiated in vivo by the formation of a complex comprising FGFRI c, FGFR2c,
  • FGFR3c or FGFR4 and beta klotho and FGF19 or FGF21 are diseases and conditions that can be treated with the binding proteins such as anti-beta klotho antibodies.
  • binding proteins such as anti-beta klotho antibodies described herein can be used to treat type 2 diabetes, obesity, dyslipidemia (e.g.,
  • hypertriglyceridemia NASH, cardiovascular disease, and/or metabolic syndrome, as well as any disease, disorder, or condition in which it is desirable to mimic or augment the in vivo effects of FGF19 and/or FGF21 , or can be employed as a prophylactic treatment administered, for example, daily, weekly, biweekly, monthly, bimonthly, biannually, etc. to prevent or reduce the frequency and/or severity of symptoms (e.g., elevated plasma glucose levels, elevated triglycerides and cholesterol levels), including, for example, to thereby provide an improved glycemic and/or cardiovascular risk factor profile.
  • symptoms e.g., elevated plasma glucose levels, elevated triglycerides and cholesterol levels
  • the present disclosure provides methods of improving metabolic parameters by administering to a subject a binding protein, including an antibody or fragment thereof as described herein or an pharmaceutical composition described herein, including, for example, wherein the improvement includes a decrease in body weight, body mass index, abdominal circumference, skinfold thickness, glucose, insulin and/or triglycerides.
  • the present disclosure also provides methods of inducing FGF19-like or FGF21 -like signaling of cells having cell surface expression of beta klotho and one or more FGF receptors, such as FGFR1 , FGFR2, FGFR3, or FGFR4 comprising contacting the cells with an effective amount of a binding protein ⁇ e.g., an antibody) that binds to beta klotho as described herein.
  • a binding protein ⁇ e.g., an antibody
  • the cell is an adipocyte or hepatocyte.
  • the cell is a cell transfected with a gene encoding beta klotho and optionally a gene encoding an FGF receptor.
  • Additional methods provided include using an anti-beta klotho antibody as described herein, with activity to mediate FGF19-like and/or FGF21 like signaling effects.
  • the present disclosure also provides methods of modulating an FGF19-like or FGF21 -like signaling in a subject comprising administering an effective amount of a binding protein such as an anti-beta klotho antibody as described herein to a subject, including a subject in need thereof.
  • the modulating comprises FGF19-like activation.
  • the modulating comprises FGF21 -like activation.
  • the modulating comprises increasing glucose metabolism (e.g., reducing glucose levels such as blood glucose levels).
  • the present disclosure also provideds methods for detecting beta klotho in a sample comprising contacting the sample with a binding protein such as an anti- beta klotho antibody as described herein, that comprises a detectible agent.
  • a binding protein such as an anti- beta klotho antibody as described herein, that comprises a detectible agent.
  • the sample comprises a cell expressing beta klotho on its surface.
  • kits comprising a binding protein such as an anti-beta klotho antibody that binds to a beta klotho polypeptide, a beta klotho fragment or a beta klotho epitope as described herein.
  • a binding protein such as an anti-beta klotho antibody that binds to a beta klotho polypeptide, a beta klotho fragment or a beta klotho epitope as described herein.
  • Figure 1 A-1 B shows a sequence alignment of the heavy chain variable regions and light chain variable regions of the anti-beta klotho antibodies designated 5H23, 1 C17, 1 D19, 2L12, 3L3, 3N20, 4P5, 5C23, 5F7 and 1 G19. Boundaries of CDRs are indicated by Kabat, AbM, Chothia, Contact and IMGT numbering.
  • Figure 2A-1 and 2A-2 shows sequence alignments of the heavy chain variable regions of the anti-beta klotho antibodies providing consensus CDR sequences.
  • Top grouping consists of antibodies designated 5H23, 1 D19, 2L12, 3L3, 4P5, 5C23 and 5F7.
  • Lower grouping consists of antibodies designated 1 C17 and 1 G19.
  • Bottom grouping consists only of the antibody designated 3N20 Variable residues are presented by "X.” Boundaries of CDRs are indicated by Kabat, AbM, Chothia, Contact and IMGT numbering.
  • Figure 2B-1 and 2B-2 shows sequence alignments of the light chain variable regions of the anti-beta klotho antibodies providing consensus CDR sequences.
  • Top grouping consists of antibodies designated 5H23, 1 D19, 2L12, 3L3, 4P5, 5C23 and 5F7.
  • Lower grouping consists of antibodies designated 1 C17 and 1 G19.
  • Bottom grouping consists only of the antibody designated 3N20.
  • Variable residues are presented by "X.” Boundaries of CDRs are indicated by Kabat, AbM, Chothia, Contact and IMGT numbering.
  • Figure 3A-1 and 3A-2 shows a sequence alignment of the heavy chain variable region of anti-beta klotho antibody designated 5H23 with the humanized sequences (vH1 -vH9). Residues that are bolded indicate exemplary residues that have been modified from the original antibody. Residues that are bolded and underlined indicate residues altered back to a mouse residue.
  • Figure 3B shows a sequence alignment of the light chain variable region of anti-beta klotho antibody designated 5H23 with the humanized sequences (vL1 -vL5). Residues that are bolded indicate exemplary residues that have been modified.
  • Residues that are bolded and underlined indicate residues altered back to a mouse residue.
  • Figure 3C-1 and 3C-2 shows a sequence alighnment of the light chain variable region of anti-beta klotho antibody designated 5H23 with the humanized sequences (v1 -39a- v1 -39p). Residues that are bolded indicate exemplary residues that have been modified.
  • Figure 3D-1 and 3D-2 shows a sequence alignment of a light chain variable region of anti-beta klotho antibody designated 5H23 with various humanized sequences (v3-20a- v3-20j). Residues that are bolded indicate exemplary residues that have been modified.
  • FIG. 4A-4C shows a sequence alignment between human, mouse and chimeric beta klotho polypeptides.
  • Chimeric polypeptide chMoHu indicates mouse KLB(M1 -F506)-human KLB(S509-S1044).
  • Chimeric polypeptide chHuMo indicates human KLB (M1 -F508)-mouse KLB (P507-S1043). Residues corresponding to mouse residues are bolded and italicized.
  • Figure 5A-5F shows a sequence alignment between beta klotho
  • polypeptides from various species described herein are polypeptides from various species described herein.
  • Figure 6 shows a three-dimentional model of the three identified binding residues (dark spheres) at the equivalent positions on human cytosolic beta- glucosidase.
  • the structure shows the equivalent of Klotho-beta residues 521 -963.
  • Binding proteins such as antibodies that bind beta klotho, including human and/or cyno beta klotho, are provided herein.
  • a unique property of such binding proteins, including antibodies disclosed herein, is their agonistic nature, including the ability to mimic the in vivo effect of FGF19 and/or FGF21 and to induce FGF19- like signaling and/or FGF21 -like signaling.
  • some of the binding proteins such as antibodies to beta klotho disclosed herein (i) bind to human and cyno beta klotho, (ii) do not compete for binding with FGF19 and/or FGF21 , and (iii) induce FGF19-like signaling and/or FGF21 -like signaling, including, for example, in several in vitro cell-based assays.
  • Such assays may include (1 ) an ELK-luciferase reporter assay (see, e.g., Example 4); (2) a recombinant FGF19 receptor mediated cell assay for ERK-phosphorylation (see, e.g., Example 4); and (3) a human adipocyte assay for ERK-phosphorylation (see, e.g., Example 5).
  • Binding proteins such as anti-beta klotho antibodies, as described herein, therefore are expected to exhibit activities in vivo that are consistent with the natural biological function of FGF19 and/or FGF21 .
  • This property makes the disclosed binding proteins, including anti-beta klotho antibodies, viable therapeutics for the treatment of metabolic diseases (e.g., Type 2 diabetes, obesity, dyslipidemia, NASH, cardiovascular disease, metabolic syndrome) and broadly any disease, disorder, or condition in which it is desirable to mimic or augment the in vivo effects of FGF19 and/or FGF21 .
  • metabolic diseases e.g., Type 2 diabetes, obesity, dyslipidemia, NASH, cardiovascular disease, metabolic syndrome
  • the binding proteins such as antibodies that bind beta klotho, that are provided herein share the common feature of competing with each other for the bindng of beta klotho (see, e.g., Example 3 describing antibodies in the 5H23 epitope bin). This competitive inhibition indicates that each antibody binds to the same region of beta klotho ⁇ e.g., the same epitope), thereby asserting similar effects.
  • the anti-beta klotho antibodies provided herein include humanized anti-beta klotho antibodies, including humanized anti-beta klotho antibodies derived from or based on 5H23, 1 C17, 1 D19, 2L12, 3L3, 3N20, 4P5, 5C23, 5F7 and/or 1 G19 having CDR sequence as described in Tables 1 -10 or Figures 1 -3, such as anti-beta klotho antibodies, including humanized anti-beta klotho antibodies, bind to a specific domain of human beta klotho ⁇ e.g., KL2 (residues S509-S1044); see Example 9).
  • binding can be largely attributed to particular amino acid residues within the KL2 region ⁇ e.g., H657, Y701 and R703), which comprise the epitope recognized by the anti-beta klotho antibodies described herein.
  • Example 8 the in vitro activities of antibodies as shown in Examples 4-7 and 9, as well as the in vivo effects demonstrated in Example 8 for an exemplary humanized anti-beta klotho antibody, are representative of the activites and effects of the the anti-beta klotho antibodies described herein.
  • the binding proteins such as anti-beta klotho antibodies may comprise immunoglobulin variable regions which comprise one or more complementary determining regions (CDRs) as described in Tables 1 -10.
  • CDRs complementary determining regions
  • the CDRs may be joined with one or more scaffold regions or framework regions, which orient(s) the CDR(s) such that the proper antigen binding properties of the CDR(s) is achieved.
  • Such binding proteins including anti-beta klotho antibodies as described herein, can facilitate or enhance the interaction between FGFRI c and beta klotho, and can induce FGF19-like and/or FGF21 -like signaling.
  • Beta klotho or “beta klotho polypeptide” and similar terms refers to a polypeptide ("polypeptide,” and “protein” are used interchangeably herein) or any native beta klotho from any vertebrate source, including mammals such as primates (e.g., humans, cynomolgus monkey (cyno)), dogs, and rodents (e.g., mice and rats), unless otherwise indicated, and, in certain embodiments, included related beta klotho polypeptides, including SNP variants thereof.
  • Beta klotho comprises two domains, beta klotho 1 (KLB1 ) and beta klotho 2 (KLB2).
  • Each beta klotho domain comprises a glycosyl hydrolase 1 region.
  • the KLB1 domain of human beta klotho comprises amino acid residues 1 -508 with the glycosyl hydrolase 1 region comprising amino acid residues 77-508, and the KLB2 domain of human beta klotho comprises amino acid residues 509-1044 with the glycosyl hydrolase 1 region comprising amino acid residues 517-967.
  • the amino acid sequence of human beta klotho is provided below:
  • nucleic acid sequence of cyno beta klotho is provided below: atgaagcctggatgtgccgccggaagccccggcaacgagtggatcttcttcagcaccgacga gatcaecatccggtacagaaacaccatgagcaacggcggcctgcagcggagcgtgatcctgt ctgctgaccctgctgagagccgtgaccggcttcagcggagatggcagagccgtgtggtcc aagaaccccaacttcaccccccgtgaacgagagccagctgttcctgtacgataccttccccaa gaacttcttctggggcgtgggcacaggcgccctgcaggtggaaa
  • Oryctolagus cuniculus is provided below:
  • human/mouse beta klotho chimeric protein (human KLB (M1 -F508)-mouse KLB (P507-S1043)) is provided below:
  • mouse KLB M1 -F506
  • human KLB S509-S1044
  • AAG GC AG GTGCTG AACTG G ATTAAACTG G AATACG ATG ACCCTCAAATCTTG AT
  • Beta klotho polypeptides include allelic variants ⁇ e.g., SNP variants); splice variants; fragments; derivatives; substitution, deletion, and insertion variants; fusion polypeptides; and interspecies homologs, preferably, which retain beta klotho activity and/or are sufficient to generate an anti-beta klotho immune response.
  • an anti-beta klotho antibody provided herein can bind to a beta klotho polypeptide, a beta klotho polypeptide fragment, a beta klotho antigen, and/or a beta klotho epitope.
  • Beta klotho antigen may be part of a larger beta klotho antigen, which may be part of a larger beta klotho polypeptide fragment, which, in turn, may be part of a larger beta klotho polypeptide.
  • Beta klotho may exist in a native or denatured form.
  • Beta klotho polypeptides described herein may be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods.
  • a beta klotho polypeptide may comprise a polypeptide having the same amino acid sequence as a corresponding beta klotho polypeptide derived from nature.
  • Beta klotho polypeptides encompass truncated or secreted forms of a beta klotho polypeptide (e.g., an extracellular domain sequence), variant forms (e.g., alternatively spliced forms) and allelic variants of the polypeptide. Orthologs to the beta klotho polypeptide are also well known in the art.
  • beta klotho encompasses "full-length,” unprocessed beta klotho as well as any form of beta klotho that results from processing in the cell.
  • the term also encompasses naturally occurring variants or mutations of beta klotho (e.g., splice variants, allelic variants, SNP variants and isoforms).
  • the beta klotho polypeptides described herein may be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods.
  • FGF19-like signaling and “induces FGF19-like signaling,” when applied to a binding protein such an antibody that binds to beta klotho of the present disclosure, means that the binding protein (e.g., antibody) mimics, or modulates, an in vivo biological effect induced by the binding of (i) beta klotho; (ii) FGFRI c, FGFR2c, FGFR3c, and FGFR4; or (iii) a complex comprising beta klotho and one of FGFRI c, FGFR2c, FGFR3c, and FGFR4 and induces a biological response that otherwise would result from FGF19 binding to (i) beta klotho; (ii) FGFRI c, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising beta klotho and one of FGFRI c, FGFR2c, FGFR2c, FGFR
  • an antibody or fragment thereof is deemed to induce a biological response when the response is equal to or greater than 5%, and preferably equal to or greater than 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 95%, of the activity of a wild type FGF19 standard comprising the mature form of SEQ ID NO:304 (e.g., the mature form of human FGF19) and has the following properties: exhibiting an efficacy level of equal to or more than 5% of an FGF19 standard, with an EC50 of equal to or less than 100 nM, e.g., 90 nM, 80 nM, 70 nM, 60 nM, 50 nM, 40 nM, 30 nM
  • FGF19R may refer to a multimeric receptor complex that FGF19 is known or suspected to form in vivo.
  • FGF19R comprises (i) an FGFR, e.g., FGFRI c, FGFR2c, FGFR3c or FGFR4, and (ii) beta klotho.
  • FGF21 -like signaling and “induces FGF21 -like signaling,” when applied to a binding protein such an antibody that binds to beta klotho of the present disclosure, means that the binding protein ⁇ e.g., antibody) mimics, or modulates, an in vivo biological effect induced by the binding of (i) beta klotho; (ii) FGFRI c,
  • FGFR2c, FGFR3c, and FGFR4 or (iii) a complex comprising beta klotho and one of FGFRI c, FGFR2c, FGFR3c, and FGFR4 and induces a biological response that otherwise would result from FGF21 binding to (i) beta klotho; (ii) FGFRI c, FGFR2c, FGFR3c or FGFR4; or (iii) a complex comprising beta klotho and one of FGFRI c, FGFR2c, FGFR3c, and FGFR4 in vivo.
  • an antibody or fragment thereof is deemed to induce a biological response when the response is equal to or greater than 5%, and preferably equal to or greater than 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 95%, of the activity of a wild type FGF21 standard comprising the mature form of SEQ ID NO:306 or 429 ⁇ e.g., the mature form of the human FGF21 sequence) and has the following properties: exhibiting an efficacy level of equal to or more than 5% of an FGF21 standard, with an EC50 of equal to or less than 100 nM, e.g., 90 nM, 80 nM, 70 nM, 60 nM, 50 nM, 40
  • FGF21 R may refer to a multimeric receptor complex that FGF21 is known or suspected to form in vivo.
  • FGF21 R comprises (i) an FGFR, e.g., FGFRI c, FGFR2c, FGFR3c or FGFR4, and (ii) beta klotho.
  • binding protein refers to a protein comprising a portion (e.g., one or more binding regions such as CDRs) that binds to beta klotho, including human and/or cyno beta klotho and, optionally, a scaffold or framework portion [e.g., one or more scaffold or framework regions) that allows the binding portion to adopt a conformation that promotes binding of the binding protein to a beta klotho
  • binding proteins include antibodies, such as a human antibody, a humanized antibody; a chimeric antibody; a recombinant antibody; a single chain antibody; a diabody; a triabody; a tetrabody; a Fab fragment; a F(ab') 2 fragment; an IgD antibody; an IgE antibody; an IgM antibody; an lgG1 antibody; an lgG2 antibody; an lgG3 antibody; or an lgG4 antibody, and fragments thereof.
  • the binding protein can comprise, for example, an alternative protein scaffold or artificial scaffold with grafted CDRs or CDR derivatives.
  • Such scaffolds include, but are not limited to, antibody-derived scaffolds comprising mutations introduced to, for example, stabilize the three-dimensional structure of the binding protein as well as wholly synthetic scaffolds comprising, for example, a biocompatible polymer. See, e.g., Korndorfer et al., 2003, Proteins: Structure, Function, and Bioinformatics, 53(1 ):121 -129 (2003); Roque et ai, Biotechnol. Prog. 20:639-654 (2004).
  • PAMs peptide antibody mimetics
  • scaffolds based on antibody mimetics utilizing fibronectin components as a scaffold.
  • a binding protein is said to specifically bind or selectively bind to beta klotho, for example, when the dissociation constant (K D ) is ⁇ 10 "8 M.
  • the binding protein e.g., antibody
  • the binding protein may specifically bind beta klotho with high affinity when the K D is ⁇ 10 "9 M or K D is ⁇ 10 "10 M.
  • the binding proteins ⁇ e.g., antibodies may bind to beta klotho or a complex comprising FGFRI c and beta klotho, including with a K D of between about 10 "7 M and about 10 "12 M and in other embodiments, the binding proteins ⁇ e.g., antibodies) may bind with a K D of 1 -2 x 10 "9 M.
  • antibody and "immunoglobulin” or “Ig” are used interchangeably herein, and is used in the broadest sense and specifically covers, for example, individual anti-beta klotho monoclonal antibodies (including agonist, antagonist, neutralizing antibodies, full length or intact monoclonal antibodies), anti-beta klotho antibody compositions with polyepitopic or monoepitopic specificity, polyclonal or monovalent antibodies, multivalent antibodies, multispecific antibodies ⁇ e.g., bispecific antibodies so long as they exhibit the desired biological activity), formed from at least two intact antibodies, single chain anti-beta klotho antibodies, and fragments of anti-beta klotho antibodies, as described below.
  • individual anti-beta klotho monoclonal antibodies including agonist, antagonist, neutralizing antibodies, full length or intact monoclonal antibodies
  • anti-beta klotho antibody compositions with polyepitopic or monoepitopic specificity polyclonal or monovalent
  • an antibody can be human, humanized, chimeric and/or affinity matured as well as an antibody from other species, for example mouse, rabbit etc.
  • the term "antibody” is intended to include a polypeptide product of B cells within the immunoglobulin class of polypeptides that is able to bind to a specific molecular antigen and is composed of two identical pairs of polypeptide chains, wherein each pair has one heavy chain (about 50-70 kDa) and one light chain (about 25 kDa) and each amino-terminal portion of each chain includes a var/able region of about 100 to about 130 or more amino acids and each carboxy-terminal portion of each chain includes a constant region (See, Borrebaeck (ed.) (1995) Antibody Engineering, Second Ed., Oxford University Press.; Kuby (1997) Immunology, Third Ed., W.H. Freeman and
  • the specific molecular antigen can be bound by an antibody provided herein includes a beta klotho polypeptide, beta klotho fragment or beta klotho epitope.
  • Antibodies also include, but are not l/ ' m/ ' ted to, synthetic anti£>oc//es, monoclonal antibodies, recombinantly produced antibodies, multispecific antibodies (including bi-specific antibodies), human antibodies, humanized antibodies, camelized antibodies, chimeric antibodies, intrabodies, antiidiotype (anti-Id) antibodies, and functional fragments ⁇ e.g., antigens-binding fragments such as beta klotho binding fragments) of any of the above, which refers a portion of an antibody heavy or light chain polypeptide thai retains some or all of the binding activity of the antibody from which the fragment was derived.
  • functional fragments ⁇ e.g., antigens-binc// ' ng fragments such
  • antibodies provided herein include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, for example, antigen binding domains or molecules that contain an antigen-binding site that binds to a beta klotho antigen ⁇ e.g., one or more
  • CDRs complementarity determining regions
  • the antibodies provided herein can be of any type ⁇ e.g., IgG, IgE, IgM, IgD, IgA and IgY), any class ⁇ e.g., lgG1 , lgG2, lgG3, lgG4, lgA1 and lgA2), or any subclass ⁇ e.g., lgG2a and lgG2b) of immunoglobulin molecule.
  • Anti-beta klotho antibodies may be agonistic antibodies or antagonistic antibodies.
  • agonistic antibodies to beta klotho including antibodies that induce FGF19-like signaling and/or FGF21 -like signaling.
  • Preferred agonistic antibodies to beta klotho do not compete for the binding of FGF19 and/or FGF21 to an FGF receptor including, for example, FGFRI c, FGFR2c, FGFR3c, or FGFR4c.
  • fibroblast growth factors refers to a family of growth factors, including twenty-two members of the human FGF family.
  • the FGF19 subfamily of fibroblast growth factors consists of human FGF21 , FGF23 and FGF19 and mouse FGF15.
  • the effects of FGF family members are the result of their heparin- dependent binding to one or more members of the FGF receptor tyrosine kinase (FGFR) family, which includes four members each having a tyrosine kinase domain, FGFR1 , FGFR2, FGFR3 and FGFR4, as well as two splice variants each of FGFR1 , FGFR2 and FGFR3.
  • FGFR FGF receptor tyrosine kinase
  • FGFRI b, FGFR2b, FGFR3c, FGFRI c, FGFR2c and FGFR3c which are also known as FGFR1 (lll)b, FGFR2(lll)b, FGFR3(lll)c, FGFR1 (lll)c, FGFR2(lll)c and FGFR3(lll)c, respectively).
  • FGF19 targets and has effects on both adipocytes and hepatocytes.
  • mice treated with recombinant human FGF19 show increased metabolic rates, increased lipid oxidation, a lower respiratory quotient and weight loss. Moreover, such mice showed lower serum levels of leptin, insulin, cholesterol and triglycerides, and normal levels of blood glucose despite the high-fat diet and without appetite diminishment.
  • obese mice that lacked leptin but included a FGF19 transgene showed weight loss, lowered cholesterol and triglycerides, and did not develop diabetes.
  • obese, diabetic mice that lack leptin, when injected with rhFGF19 showed reversal of their metabolic characteristics in the form of weight loss and lowered blood glucose.
  • FGF21 is expressed primarily by the liver and has metabolic effects similar to that of FGF19, such as increased metabolism via its effects on adipose tissue, weight loss, lowered blood glucose levels, and resistance to obesity and diabetes.
  • FGF21 - transgenic mice were also resistant to diet-induced obesity, and, in diabetic rodent models, FGF21 administration lowered blood glucose and triglyceride levels.
  • FGF19 and FGF21 metabolic effects occur via their binding FGF receptors, including the FGFRI c, FGFR2c and FGFR3c receptors, and required beta klotho for the binding, for the binding. The binding of FGF19 and FGF21 to FGFR1 c and FGFR2c are significant.
  • FGF19 has also been shown to have metabolic effects distinct from FGF21 , including regulating bile production by the liver via its liver-specific effects, negatively regulating bile production in response to postprandial bile-production, and liver mitogenic effects that are not observed with respect to FGF21 .
  • FGF19 transgenic mice develop hepatic adenocarcinoma due to increased proliferation and dysplasia of hepatocytes, and rhFGF19-treated mice exhibit hepatocyte proliferation of hepatocytes.
  • FGF19 can bind FGFR4 in both a beta klotho-dependent and beta klotho-independent manner.
  • FGF21 has also been shown to bind FGFR4 in a beta klotho-dependent manner, efficient signaling has not previously been observed from the binding of FGF21 to FGFR4.
  • Binding proteins such as anti-beta klotho antibodies, as disclosed herein can induce FGF19-like signaling, as described herein.
  • FGF19 In vivo, the mature form of FGF19 is the active form of the molecule.
  • a nucleic acid sequence encoding full length FGF19 is provided below; the nucleotides encoding the signal sequence are underlined.
  • Binding proteins such as anti-beta klotho antibodies, as described herein can induce FGF21 -like signaling, as described herein.
  • FGF21 -like signaling
  • a nucleic acid sequence encoding a full length FGF21 is provided; the nucleotides encoding the signal sequence are underlined:
  • a nucleic acid sequence also encoding a full length FGF21 is provided; the nucleotides encoding the signal sequence are underlined:
  • amino acid sequence also encoding a full length FGF21 is provided; the amino acids encoding the signal sequence are underlined: mdsdetqfehsqlwvsylaqlllqacqaHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIR
  • Binding proteins such as anti-beta klotho antibodies, as described herein bind to beta klotho alone or in complex with an FGF receptor, such as FGFRIc.
  • FGFRIc an FGF receptor
  • Binding proteins such as anti-beta klotho antibodies, described herein may bind to beta klotho in complex with the extracellular portion of an FGF receptor such as FGFR1 c.
  • An example of an extracellular region of FGFR1 c is:
  • RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADS GLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAA KTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWS I IMDSVVPSDKGNYTCIVENEYGS INHTYQLD WERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDK EMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYE .
  • FGFRI c proteins can also include fragments.
  • the terms are used interchangeably to mean a receptor, in particular and unless otherwise specified, a human receptor, that upon association with beta klotho and FGF21 induces FGF21 -like signaling activity.
  • FGFRI c also includes post-translational modifications of the FGFRI c amino acid sequence, for example, possible N-linked glycosylation sites.
  • the antigen binding proteins can bind to or be generated from proteins glycosylated at one or more of the positions.
  • Binding proteins such as anti-beta klotho antibodies, as described herein bind to beta klotho alone or in complex with an FGF receptor, such as FGFR2c.
  • An encoding nucleic acid sequence of human FGFR2c is provided below:
  • Binding proteins such as anti-beta klotho antibodies, as described herein bind to beta klotho alone or in complex with an FGF receptor, such as FGFR3c.
  • An encoding nucleic acid sequence of human FGFR3c (GenBank Accession Number NP 000133) is provided below:
  • amino acid sequences of human FGFR3c is provided below; the amino acids that make-up the signal sequence are underlined:
  • Binding proteins such as anti-beta klotho antibodies, as described herein bind to beta klotho alone or in complex with an FGF receptor, such as FGFR4.
  • An encoding nuclic acid sequence of human FGFR4 is provided below:
  • An "antigen" is a predetermined antigen to which an antibody can selectively bind.
  • a target antigen may be a polypeptide, carbohydrate, nucleic acid, lipid, hapten or other naturally occurring or synthetic compound.
  • the target antigen is a polypeptide.
  • antigen binding fragment refers to that portion of an antibody which comprises the amino acid residues that interact with an antigen and confer on the binding agent its specificity and affinity for the antigen ⁇ e.g., the complementarity determining regions (CDRs)).
  • CDRs complementarity determining regions
  • binding refers to an interaction between molecules including, for example, to form a complex. Interactions can be, for example, non- covalent interactions including hydrogen bonds, ionic bonds, hydrophobic
  • a complex can also include the binding of two or more molecules held together by covalent or non-covalent bonds, interactions or forces.
  • the strength of the total non-covalent interactions between a single antigen-binding site on an antibody and a single epitope of a target molecule, such as beta klotho, is the affinity of the antibody or functional fragment for that epitope.
  • the ratio of association (k1 ) to dissociation (k-1 ) of an antibody to a monovalent antigen (k1/ k-1 ) is the association constant K, which is a measure of affinity.
  • the value of K varies for different complexes of antibody and antigen and depends on both k1 and k-1 .
  • the association constant K for an antibody provided herein can be determined using any method provided herein or any other method well known to those skilled in the art.
  • the affinity at one binding site does not always reflect the true strength of the interaction between an antibody and an antigen.
  • the avidity of an antibody can be a better measure of its binding capacity than is the affinity of its individual binding sites. For example, high avidity can compensate for low affinity as is sometimes found for pentameric IgM antibodies, which can have a lower affinity than IgG, but the high avidity of IgM, resulting from its multivalence, enables it to bind antigen effectively.
  • antibodies that specifically bind to beta klotho refer to antibodies that specifically bind to a beta klotho polypeptide, such as a beta klotho antigen, or fragment, or epitope (e.g., human beta klotho such as a human beta klotho polypeptide, antigen or epitope).
  • a beta klotho polypeptide such as a beta klotho antigen, or fragment, or epitope
  • epitope e.g., human beta klotho such as a human beta klotho polypeptide, antigen or epitope.
  • beta klotho ⁇ e.g., human beta klotho
  • beta klotho antigen ⁇ e.g., human beta klotho
  • an antibody that specifically binds to a beta klotho antigen may be cross-reactive with related antigens (e.g.,cyno beta klotho).
  • an antibody that specifically binds to a beta klotho antigen does not cross-react with other antigens.
  • An antibody that specifically binds to a beta klotho antigen can be identified, for example, by immunoassays, Biacore, or other techniques known to those of skill in the art.
  • An antibody binds specifically to a beta klotho antigen when it binds to a beta klotho antigen with higher affinity than to any cross reactive antigen as determined using experimental techniques, such as radioimmunoassays (RIA) and enzyme linked immunosorbent assays (ELISAs).
  • RIA radioimmunoassays
  • ELISAs enzyme linked immunosorbent assays
  • a specific or selective reaction will be at least twice background signal or noise and may be more than 10 times background. See, e.g., Paul, ed., 1989,
  • an antibody "which binds" an antigen of interest ⁇ e.g., a target antigen such as beta klotho
  • an antigen of interest ⁇ e.g., a target antigen such as beta klotho
  • a target antigen such as beta klotho
  • the extent of binding of the antibody to a "non-target" protein will be less than about 10% of the binding of the antibody to its particular target protein, for example, as determined by fluorescence activated cell sorting (FACS) analysis or radioimmunoprecipitation (RIA).
  • the term “specific binding” or “specifically binds to” or is “specific for” a particular polypeptide or an epitope on a particular polypeptide target means binding that is measurably different from a non-specific interaction.
  • Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule, which generally is a molecule of similar structure that does not have binding activity.
  • specific binding can be determined by competition with a control molecule that is similar to the target, for example, an excess of non-labeled target. In this case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by excess unlabeled target.
  • telomere binding or “specifically binds to” or is “specific for” a particular polypeptide or an epitope on a particular polypeptide target as used herein can be exhibited, for example, by a molecule having a Kd for the target of at least about 10 "4 M, alternatively at least about 10 "5 M, alternatively at least about 10 "6 M, alternatively at least about 10 "7 M, alternatively at least about 10 "8 M, alternatively at least about 10 "9 M, alternatively at least about 10 "10 M, alternatively at least about 10 "11 M, alternatively at least about 10 "12 M, or greater.
  • the term "specific binding” refers to binding where a molecule binds to a particular polypeptide or epitope on a particular polypeptide without substantially binding to any other polypeptide or polypeptide epitope.
  • an antibody that binds to beta klotho has a dissociation constant (Kd) of less than or equal to 10 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM, 0.9 nM, 0.8 nM, 0.7 nM, 0.6 nM, 0.5 nM, 0.4 nM, 0.3 nM, 0.2 nM, or 0.1 nM.
  • anti-beta klotho antibody binds to an epitope of beta klotho that is conserved among beta klotho from different species ⁇ e.g., between human and cyno beta klotho).
  • anti-beta klotho antibodies ⁇ e.g., agonistic antibodies and binding proteins that bind to (i) beta klotho; or (ii) a complex comprising beta klotho and one of FGFRI c, FGFR2c, FGFR3c, and
  • FGFR4 that compete for the same epitope or binding site on a target means competition between as determined by an assay in which the antibody (or binding fragment) thereof under study prevents or inhibits the specific binding of a reference molecule ⁇ e.g., a reference ligand, or reference antigen binding protein, such as a reference antibody) to a common antigen ⁇ e.g., beta klotho or a fragment thereof).
  • a reference molecule e.g., a reference ligand, or reference antigen binding protein, such as a reference antibody
  • a common antigen e.g., beta klotho or a fragment thereof.
  • Numerous types of competitive binding assays can be used to determine if a test antibody competes with a reference antibody for binding to beta klotho ⁇ e.g., human beta klotho).
  • assays that can be employed include solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme
  • EIA immunoassay
  • sandwich competition assay see, e.g., Stahli et al., (1983) Methods in Enzymology 9:242-253
  • solid phase direct biotin-avidin EIA see, e.g., Kirkland et al., (1986) J. Immunol. 137:3614-3619
  • solid phase direct labeled assay solid phase direct labeled sandwich assay
  • solid phase direct label RIA using 1 -125 label see, e.g., Morel et al., (1988) Molec. Immunol.
  • such an assay involves the use of a purified antigen ⁇ e.g., beta klotho such as human beta klotho) bound to a solid surface or cells bearing either of an unlabelled test antigen binding protein ⁇ e.g., test anti-beta klotho antibody) or a labeled reference antigen binding protein ⁇ e.g., reference anti-beta klotho antibody).
  • a purified antigen ⁇ e.g., beta klotho such as human beta klotho
  • an unlabelled test antigen binding protein e.g., test anti-beta klotho antibody
  • a labeled reference antigen binding protein e.g., reference anti-beta klotho antibody
  • Antibodies identified by competition assay include antibodies binding to the same epitope as the reference antibody and/or antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference for antibodies steric hindrance to occur. Additional details regarding methods for determining competitive binding are described herein. Usually, when a competing antibodies protein is present in excess, it will inhibit specific binding of a reference antibodies to a common antigen by at least 23%, for example 40%, 45%, 50%, 55%, 60%, 65%, 70% or 75%]]. In some instance, binding is inhibited by at least 80%, 85%, 90%, 95%, 96% or 97%, 98%, 99% or more.
  • anti-beta klotho antibody or "an antibody that binds to beta klotho” includes an antibody that is capable of binding beta klotho with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting beta klotho.
  • the extent of binding of an anti-beta klotho antibody to an unrelated, non-beta klotho protein is less than about 10% of the binding of the antibody to beta klotho as measured, for example, by fluorescence activated cell sorting (FACS) analysis or an immunoassay such as a
  • FACS fluorescence activated cell sorting
  • an antibody that "specifically binds to" or is “specific for" beta klotho is Illustrated above.
  • an antibody that binds to beta klotho, as described herein has a dissociation constant (Kd) of less than or equal to 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 0.9 nM, 0.8 nM, 0.7 nM, 0.6 nM, 0.5 nM, 0.4 nM, 0.3 nM, 0.2 nM, or 0.1 nM, and/or is greater than or equal to 0.1 nM.
  • Kd dissociation constant
  • anti-beta klotho antibody binds to an epitope of beta klotho that is conserved among beta klotho from different species ⁇ e.g., between human and cyno beta klotho).
  • An “isolated” antibody is substantially free of cellular material or other contaminating proteins from the cell or tissue source and/or other contaminant components from which the antibody is derived, or substantially free of chemical precursors or other chemicals when chemically synthesized.
  • substantially free of cellular material includes preparations of an antibody in which the antibody is separated from cellular components of the cells from which it is isolated or recombinantly produced.
  • an antibody that is substantially free of cellular material includes preparations of antibody having less than about 30%, 25%, 20%, 15%, 10%, 5%, or 1 % (by dry weight) of heterologous protein (also referred to herein as a "contaminating protein").
  • heterologous protein also referred to herein as a "contaminating protein”
  • when the antibody is recombinantly produced it is substantially free of culture medium, e.g., culture medium represents less than about 20%, 15%, 10%, 5%, or 1 % of the volume of the protein preparation.
  • the antibody when the antibody is produced by chemical synthesis, it is substantially free of chemical precursors or other chemicals, for example, it is separated from chemical precursors or other chemicals which are involved in the synthesis of the protein. Accordingly such preparations of the antibody have less than about 30%, 25%, 20%, 15%, 10%, 5%, or 1 % (by dry weight) of chemical precursors or compounds other than the antibody of interest. Contaminant components can also include, but are not limited to, materials that would interfere with therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes. In certain embodiments, the antibody will be purified (1 ) to greater than 95% by weight of antibody as determined by the Lowry method (Lowry et al. J. Bio.
  • Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step. In specific embodiments, antibodies provided herein are isolated.
  • a 4-chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains.
  • the 4-chain unit is generally about 150,000 daltons.
  • Each L chain is linked to a H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype.
  • Each H and L chain also has regularly spaced intrachain disulfide bridges.
  • Each H chain has at the N- terminus, a variable domain (VH) followed by three constant domains (CH) for each of the a and ⁇ chains and four CH domains for ⁇ and ⁇ isotypes.
  • Each L chain has at the N-terminus, a variable domain (VL) followed by a constant domain (CL) at its other end.
  • VL variable domain
  • CL constant domain
  • the VL is aligned with the VH and the CL is aligned with the first constant domain of the heavy chain (CH1 ).
  • Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
  • the pairing of a VH and VL together forms a single antigen-binding site.
  • variable region refers to a portion of the light or heavy chains of an antibody that is generally located at the amino-terminal of the light or heavy chain and has a length of about 120 to 130 amino acids in the heavy chain and about 100 to 1 10 amino acids in the light chain, and are used in the binding and specificity of each particular antibody for its particular antigen.
  • the variable region of the heavy chain may be referred to as "VH.”
  • the variable region of the light chain may be referred to as "VL.”
  • variable refers to the fact that certain segments of the variable regions differ extensively in sequence among antibodies. The V region mediates antigen binding and defines specificity of a particular antibody for its particular antigen.
  • variable regions consist of less variable ⁇ e.g., relatively invariant) stretches called framework regions (FRs) of about 15-30 amino acids separated by shorter regions of greater variability (e.g., extreme variability) called "hypervariable regions" that are each about 9-12 amino acids long.
  • FRs framework regions
  • hypervariable regions regions of greater variability
  • the variable regions of heavy and light chains each comprise four FRs, largely adopting a ⁇ sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the ⁇ sheet structure.
  • the hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991 )).
  • the constant regions are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC).
  • the variable regions differ extensively in sequence between different antibodies. The variability in sequence is concentrated in the CDRs while the less variable portions in the variable region are referred to as framework regions (FR).
  • the CDRs of the light and heavy chains are primarily responsible for the interaction of the antibody with antigen.
  • the variable region is a human variable region.
  • variable region residue numbering as in Kabat or "amino acid position numbering as in Kabat”, and variations thereof, refers to the numbering system used for heavy chain variable regions or light chain variable regions of the compilation of antibodies in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991 ). Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain.
  • a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g., residues 82a, 82b, and 82c, etc, according to Kabat) after heavy chain FR residue 82.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
  • the Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1 -107 of the light chain and residues 1 -1 13 of the heavy chain) [e.g., Kabat et al., Sequences of Immunological Interest.
  • EU numbering system or "EU index” is generally used when referring to a residue in an immunoglobulin heavy chain constant region (e.g., the EU index reported in Kabat et ai, supra).
  • EU index as in Kabat refers to the residue numbering of the human IgG 1 EU antibody.
  • Other numbering systems have been described, including, for example, by AbM, Chothia, Contact, IMGT and AHon.
  • an "intact” antibody is one comprising an antigen-binding site as well as a CL and at least heavy chain constant regions, CH1 , CH2 and CH3.
  • the constant regions may include human constant regions or amino acid sequence variants thereof.
  • an intact antibody has one or more effector functions.
  • Antibody fragments comprise a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody.
  • antibody fragments include, without limitation, Fab, Fab', F(ab')2, and Fv fragments; diabodies and di-diabodies (see, e.g., Holliger, P. et al., (1993) Proc. Natl. Acad. Sci. 90:6444- 8; Lu, D. et al., (2005) J. Biol. Chem. 280:19665-72; Hudson et al., Nat. Med. 9:129- 134 (2003); WO 93/1 1 161 ; and U.S. Patent Nos. 5,837,242 and 6,492,123); single- chain antibody molecules (see, e.g., U.S. Patent Nos. 4,946,778; 5,260,203;
  • a "functional fragment” or "binding fragment” or “antigen binding fragment” of a therapeutic antibody will exhibit at least one if not some or all of the biological functions attributed to the intact antibody, the function comprising at least binding to the target antigen, [e.g., a beta klotho binding fragment or fragment that binds to beta klotho).
  • fusion protein refers to a polypeptide that comprises an amino acid sequence of an antibody and an amino acid sequence of a heterologous polypeptide or protein (e.g., a polypeptide or protein not normally a part of the antibody ⁇ e.g., a non-anti-beta klotho antigen binding antibody)).
  • fusion when used in relation to beta klotho or to an anti-beta klotho antibody refers to the joining of a peptide or polypeptide, or fragment, variant and/or derivative thereof, with a heterologous peptide or polypeptide.
  • the fusion protein retains the biological activity of the beta klotho or anti-beta klotho antibody.
  • the fusion protein comprises a beta klotho antibody VH region, VL region, VH CDR (one, two or three VH CDRs), and/or VL CDR (one, two or three VL CDRs), wherein the fusion protein binds to a beta klotho epitope, a beta klotho fragment and/or a beta klotho polypeptide.
  • the term "heavy chain” when used in reference to an antibody refers to a polypeptide chain of about 50-70 kDa, wherein the amino-terminal portion includes a variable region of about 120 to 130 or more amino acids and a carboxy-terminal portion that includes a constant region.
  • the constant region can be one of five distinct types, (e.g., isotypes) referred to as alpha (a), delta ( ⁇ ), epsilon ( ⁇ ), gamma ( ⁇ ) and mu ( ⁇ ), based on the amino acid sequence of the heavy chain constant region.
  • the distinct heavy chains differ in size: ⁇ , ⁇ and ⁇ contain approximately 450 amino acids, while ⁇ and ⁇ contain approximately 550 amino acids. When combined with a light chain, these distinct types of heavy chains give rise to five well known classes (e.g., isotypes) of antibodies, IgA, IgD, IgE, IgG and IgM,
  • a heavy chain can be a human heavy chain.
  • the term "light chain” when used in reference to an antibody refers to a polypeptide chain of about 25 kDa, wherein the amino-terminal portion includes a variable region of about 100 to about 1 10 or more amino acids and a carboxy- terminal portion that includes a constant region.
  • the approximate length of a light chain is 21 1 to 217 amino acids.
  • K kappa
  • lambda
  • Light chain amino acid sequences are well known in the art.
  • a light chain can be a human light chain.
  • the term "host” as used herein refers to an animal, such as a mammal (e.g., a human).
  • the term "host cell” as used herein refers to a particular subject cell that may be transfected with a nucleic acid molecule and the progeny or potential progeny of such a cell. Progeny of such a cell may not be identical to the parent cell transfected with the nucleic acid molecule due to mutations or environmental influences that may occur in succeeding generations or integration of the nucleic acid molecule into the host cell genome.
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, e.g., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts, and each monoclonal antibody will typically recognize a single epitope on the antigen.
  • a "monoclonal antibody,” as used herein is an antibody produced by a single hybridoma or other cell, wherein the antibody binds to only a beta klotho epitope as determined, for example, by ELISA or other antigen-binding or competitive binding assay known in the art.
  • the term “monoclonal” is not limited to any particular method for making the antibody.
  • the monoclonal antibodies useful in the present disclosure may be prepared by the hybridoma methodology first described by Kohler et al., Nature, 256:495 (1975), or may be made using recombinant DNA methods in bacterial, eukaryotic animal or plant cells (see, e.g., U.S. Patent No. 4,816,567).
  • the "monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al., Nature, 352:624-628 (1991 ) and Marks et al., J. Mol. Biol., 222:581 -597 (1991 ), for example.
  • nucleic acid molecules refers to those which are found in nature and not manipulated, modified, and/or changed ⁇ e.g., isolated, purified, selected) by a human being.
  • the antibodies provided herein can include “chimeric” antibodies in which a portion of the heavy and/or light chain is identical with or homologous to
  • Humanized forms of nonhuman ⁇ e.g., murine antibodies are chimeric antibodies that include human immunoglobulins ⁇ e.g., recipient antibody) in which the native CDR residues are replaced by residues from the corresponding CDR of a nonhuman species ⁇ e.g., donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • a nonhuman species e.g., donor antibody
  • one or more FR region residues of the human immunoglobulin are replaced by
  • humanized antibodies can comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
  • a humanized antibody heavy or light chain can comprise substantially all of at least one or more variable regions, in which all or substantially all of the CDRs correspond to those of a nonhuman immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence. In certain embodiments, the
  • humanized antibody will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • a "human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody
  • Human antibodies can be produced using various techniques known in the art, including phage-display libraries (Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991 ); Marks et al., J. Mol. Biol., 222:581 (1991 ) and yeast display libraries (Chao et al., Nature Protocols 1 : 755-768 (2006)). Also available for the preparation of human monoclonal antibodies are methods described in Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boerner et al., J. Immunol., 147(1 ):86-95 (1991 ). See also van Dijk and van de Winkel, Curr. Opin. Pharmacol., 5: 368-74 (2001 ). Human
  • antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., mice (see, e.g., Jakobovits, A., Curr. Opin. Biotechnol. 1995, 6(5):561 -6; Bruggemann and Taussing, Curr. Opin. Biotechnol. 1997, 8(4):455-8; and U.S. Pat. Nos. 6,075,181 and 6,150,584 regarding XENOMOUSETM technology). See also, for example, Li et al., Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006) regarding human antibodies generated via a human B- cell hybridoma technology.
  • CDR refers to one of three hypervariable regions (H1 , H2 or H3) within the non-framework region of the immunoglobulin (Ig or antibody) VH ⁇ -sheet framework, or one of three hypervariable regions (L1 , L2 or L3) within the non- framework region of the antibody VL ⁇ -sheet framework. Accordingly, CDRs are variable region sequences interspersed within the framework region sequences. CDR regions are well known to those skilled in the art and have been defined by, for example, Kabat as the regions of most hypervariability within the antibody variable (V) domains (Kabat et al., J. Biol. Chem. 252:6609-6616 (1977); Kabat, Adv. Prot.
  • CDR region sequences also have been defined structurally by Chothia as those residues that are not part of the conserved ⁇ -sheet framework, and thus are able to adapt different conformations (Chothia and Lesk, J. Mol. Biol. 196:901 -917 (1987)). Both terminologies are well recognized in the art.
  • CDR region sequences have also been defined by AbM, Contact and IMGT.
  • CDR region sequences are illustrated in Figures 1 -3. The positions of CDRs within a canonical antibody variable region have been determined by comparison of numerous structures (Al-Lazikani et al., J. Mol. Biol.
  • hypervariable region when used herein refers to the regions of an antibody variable region that are hypervariable in sequence and/or form structurally defined loops.
  • antibodies comprise six hypervariable regions; three in the VH (H1 , H2, H3), and three in the VL (L1 , L2, L3).
  • a number of hypervariable region delineations are in use and are encompassed herein.
  • the Kabat Complementarity Determining Regions are based on sequence variability and are the most commonly used (see, e.g., Kabat et ai, Sequences of Proteins of Immunological Interest, 5th Ed.
  • Chothia refers instead to the location of the structural loops (see, e.g., Chothia and Lesk, J. Mol. Biol. 196:901 -917 (1987)).
  • the end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34).
  • the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software (see, e.g., Martin, in Antibody Engineering, Vol. 2, Chapter 3, Springer Verlag).
  • the "contact" hypervariable regions are based on an analysis of the available complex crystal structures. The residues from each of these
  • IMGT ImMunoGeneTics
  • IG immunoglobulins
  • TR T cell receptors
  • the CDRs are referred to in terms of both the amino acid sequence and the location within the light or heavy chain.
  • location of the CDRs within the structure of the immunoglobulin variable domain is conserved between species and present in structures called loops, by using numbering systems that align variable domain sequences according to structural features, CDR and framework residues and are readily identified. This information can be used in grafting and replacement of CDR residues from immunoglobulins of one species into an acceptor framework from, typically, a human antibody.
  • An additional numbering system (AHon) has been developed by Honegger and Pluckthun, J. Mol. Biol. 309: 657-670 (2001 ).
  • Hypervariable regions may comprise "extended hypervariable regions” as follows: 24-36 or 24-34 (L1 ), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 or 26-35A (H1 ), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH.
  • constant region refers to a carboxy terminal portion of the light and heavy chain which is not directly involved in binding of the antibody to antigen but exhibits various effector function, such as interaction with the Fc receptor.
  • the terms refer to the portion of an immunoglobulin molecule having a more conserved amino acid sequence relative to the other portion of the immunoglobulin, the variable region, which contains the antigen binding site.
  • the constant region may contain the CH1 , CH2 and CH3 regions of the heavy chain and the CL region of the light chain.
  • FR residues are those variable region residues flanking the CDRs. FR residues are present, for example, in chimeric, humanized, human, domain antibodies, diabodies, linear antibodies, and bispecific antibodies. FR residues are those variable domain residues other than the hypervariable region residues or CDR residues.
  • An "affinity matured" antibody is one with one or more alterations ⁇ e.g., amino acid sequence variations, including changes, additions and/or deletions) in one or more HVRs thereof which result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody which does not possess those alteration(s).
  • Preferred affinity matured antibodies will have nanomolar or even picomolar affinities for the target antigen.
  • Affinity matured antibodies are produced by procedures known in the art. For review, see Hudson and Souriau, Nature Medicine 9 :129-134 (2003); Hoogenboom, Nature Biotechnol. 23 : 1 105-1 1 16 (2005); Quiroz and Sinclair, Revista Ingeneria Biomedia 4 : 39-51 (2010).
  • blocking antibody or an “antagonist” antibody is one which inhibits or reduces biological activity of the antigen it binds.
  • blocking antibodies or antagonist antibodies may substantially or completely inhibit the biological activity of the antigen.
  • An "agonist antibody” is an antibody that triggers a response, e.g., one that mimics at least one of the functional activities of a polypeptide of interest ⁇ e.g., FGF19 or FGF21 ).
  • An agonist antibody includes an antibody that is a ligand mimetic, for example, wherein a ligand binds to a cell surface receptor and the binding induces cell signaling or activities via an intercellular cell signaling pathway and wherein the antibody induces a similar cell signaling or activation.
  • an "agonist" of beta klotho refers to a molecule that is capable of activating or otherwise increasing one or more of the biological activities of beta klotho, such as in a cell expressing beta klotho and a FGF receptor.
  • an agonist of beta klotho ⁇ e.g., an agonistic antibody as described herein
  • the antibodies provided herein are agonistic anti-beta klotho antibodies, including antibodies that induce FGF19-like signaling and/or FGF21 -like signaling.
  • Binding affinity generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule ⁇ e.g., a binding protein such as an antibody) and its binding partner ⁇ e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity” refers to intrinsic binding affinity which reflects a 1 :1 interaction between members of a binding pair ⁇ e.g., antibody and antigen).
  • the affinity of a binding molecule X for its binding partner Y can generally be represented by the dissociation constant (K D ). Affinity can be measured by common methods known in the art, including those described herein.
  • the "KD" or "K D value” may be measured by assays known in the art, for example by a binding assay.
  • the K D may be measured in a radiolabeled antigen binding assay (RIA), for example, performed with the Fab version of an antibody of interest and its antigen (Chen, et al., (1999) J. Mol Biol 293:865-881 ).
  • the K D or K D value may also be measured by using surface plasmon resonance assays by Biacore, using, for example, a
  • An "on-rate” or “rate of association” or “association rate” or “kon” may also be determined with the same surface plasmon resonance or biolayer interferometry techniques described above using, for example, a BIAcoreTM-2000 or a BIAcoreTM-3000 (BIAcore, Inc., Piscataway, NJ), or the OctetQK384 sytem
  • the difference between the two values may be of little or no biological and/or statistical significance within the context of the biological characteristic measured by the values ⁇ e.g., K D values).
  • the difference between the two values may be less than about 50%, less than about 40%, less than about 30%, less than about 20%, less than about 10%, less than about 5%, as a function of the value for the reference antibody.
  • the phrase "substantially reduced,” or “substantially different”, as used herein, denotes a sufficiently high degree of difference between two numeric values ⁇ e.g., one associated with an antibody of the present disclosure and the other associated with a reference antibody) such that one of skill in the art would consider the difference between the two values to be of statistical significance within the context of the biological characteristic measured by the values.
  • the difference between said two values may be preferably greater than about 10%, greater than about 20%, greater than about 30%, greater than about 40%, greater than about 50% as a function of the value for the reference antibody.
  • Antibody effector functions refer to those biological activities attributable to the Fc region ⁇ e.g., a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype. Examples of antibody effector functions include: C1 q binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC);
  • phagocytosis down regulation of cell surface receptors (e.g., B cell receptor); and B cell activation.
  • B cell receptors e.g., B cell receptor
  • Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain, including, for example, native sequence Fc regions, recombinant Fc regions, and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy chain Fc region is often defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof.
  • the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue.
  • a "functional Fc region” possesses an “effector function” of a native sequence Fc region.
  • exemplary "effector functions” include C1 q binding;
  • a "native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature, and not manipulated, modified, and/or changed ⁇ e.g., isolated, purified, selected, including or combining with other sequences such as variable region sequences) by a human.
  • Native sequence human Fc regions include a native sequence human lgG1 Fc region (non- A and A allotypes); native sequence human lgG2 Fc region; native sequence human lgG3 Fc region; and native sequence human lgG4 Fc region as well as naturally occurring variants thereof.
  • a “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification, ⁇ e.g., substituting, addition, or deletion) preferably one or more amino acid
  • the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, for example, from about one to about ten amino acid substitutions, and preferably from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide.
  • the variant Fc region herein will preferably possess at least about 80% homology with a native sequence Fc region and/or with an Fc region of a parent polypeptide, and more preferably at least about 90% homology therewith, for example, at least about 95% homology therewith.
  • a variant with two amino acid changes to alanine at two positions in the human lgG1 Fc sequence are shown bolded in the amino acid sequence provided below:
  • Such a variant sequence may be used in humanized heavy chain constructs such as shown below for a humanized 5H23-vH3 (see, e.g., Example 7) designated
  • 5H23(vH3)-hlgG1 (E233A)(L235A) as provided below; the amino acids that make up the signal sequence are underlined and the variable region sequence is bolded: mdmrvpa llgllllwlrgarcQVQLQQSGAEVKKPGASVKVSCKASGYTFTSYDI WVRQA PGQGLEWIGWIYPGDGSTKYNEKFKGKATITRDTSASTAYMELSSLRSEDTAVYFCARSDYY
  • a "light chain constant region” includes kappa and lambda constant regions.
  • An exemplary kappa constant region is provided below:
  • Such a kappa constant region sequence may be used in humanized light chain constructs such as shown below for a humanized 5H23-vL2 (see, e.g., Example 7) as provided below; the amino acids that make up the signal sequence are underlined and the variable region sequence is bolded:
  • beta klotho or to an anti-beta klotho antibody may refer to a peptide or polypeptide comprising one or more (such as, for example, about 1 to about 25, about 1 to about 20, about 1 to about 15, about 1 to about 10, or about 1 to about 5) amino acid sequence substitutions, deletions, and/or additions as compared to a native or unmodified beta klotho sequence.
  • a beta klotho variant may result from one or more (such as, for example, about 1 to about 25, about 1 to about 20, about 1 to about 15, about 1 to about 10, or about 1 to about 5) changes to an amino acid sequence of a native beta klotho.
  • a variant of an anti-beta klotho antibody may result from one or more (such as, for example, about 1 to about 25, about 1 to about 20, about 1 to about 15, about 1 to about 10, or about 1 to about 5) changes to an amino acid sequence of a native or previously unmodified anti-beta klotho antibody.
  • Variants may be naturally occurring, such as allelic or splice variants, or may be artificially constructed.
  • Polypeptide variants may be prepared from the corresponding nucleic acid molecules encoding the variants.
  • the beta klotho variant or anti-beta klotho antibody variant at least retains beta klotho or anti-beta klotho antibody functional activity, respectively.
  • an anti- beta klotho antibody variant binds beta klotho and/or is antagonistic to beta klotho activity.
  • an anti-beta klotho antibody variant binds beta klotho and/or is agonistic to beta klotho activity.
  • the variant is encoded by a single nucleotide polymorphism (SNP) variant of a nucleic acid molecule that encodes beta klotho or anti-beta klotho antibody VH or VL regions or subregions, such as one or more CDRs.
  • SNP single nucleotide polymorphism
  • vector refers to a substance that is used to carry or include a nucleic acid sequences, including for example, in order to introduce a nucleic acid sequence into a host cell.
  • Vectors applicable for use include, for example, expression vectors, plasmids, phage vectors, viral vectors, episomes and artificial chromosomes, which can include selection sequences or markers operable for stable integration into a host cell's chromosome.
  • the vectors can include one or more selectable marker genes and appropriate expression control sequences. Selectable marker genes that can be included, for example, provide resistance to antibiotics or toxins, complement auxotrophic deficiencies, or supply critical nutrients not in the culture media.
  • Expression control sequences can include constitutive and inducible promoters, transcription enhancers, transcription
  • nucleic acid molecules When two or more nucleic acid molecules are to be co-expressed (e.g. both an antibody heavy and light chain or an antibody VH and VL) both nucleic acid molecules can be inserted, for example, into a single expression vector or in separate expression vectors.
  • the encoding nucleic acids can be operationally linked to one common expression control sequence or linked to different expression control sequences, such as one inducible promoter and one constitutive promoter.
  • the introduction of nucleic acid molecules into a host cell can be confirmed using methods well known in the art. Such methods include, for example, nucleic acid analysis such as
  • nucleic acid molecules are expressed in a sufficient amount to produce a desired product (e.g. an anti-beta klotho antibody as described herein), and it is further understood that expression levels can be optimized to obtain sufficient expression using methods well known in the art.
  • a desired product e.g. an anti-beta klotho antibody as described herein
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • FcRs Fc receptors
  • cytotoxic cells ⁇ e.g., Natural Killer (NK) cells, neutrophils, and macrophages
  • NK Natural Killer
  • the antibodies “arm” the cytotoxic cells and are absolutely required for such killing.
  • ADCC activity of a molecule of interest is assessed in vitro, for example, in a animal model (see, e.g., Clynes et al. (USA) 95:652-656 (1998)). Antibodies with little or no ADCC activity may be selected for use.
  • PBMC peripheral blood mononuclear cells
  • NK Natural Killer
  • Fc receptor or “FcR” describes a receptor that binds to the Fc region of an antibody.
  • the preferred FcR is a native sequence human FcR.
  • a preferred FcR is one that binds an IgG antibody ⁇ e.g., a gamma receptor) and includes receptors of the FcyRI, FcyRII and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
  • FcyRII receptors include FcyRIIA (an “activating receptor") and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof (see, e.g., review Daeron, Annu. Rev. Immunol. 15:203-234 (1997)).
  • FcRs are known (see, e.g., Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991 ); Capel et al., Immunomethods 4:25-34 (1994); and de Haas et al., J. Lab. Clin. Med.
  • FcR neonatal receptor
  • CDC complement dependent cytotoxicity
  • Polypeptide variants with altered Fc region amino acid sequences have been described, (see, e.g., US Patent No. 6,194,551 , WO 1999/51642, Idusogie et al. J. Immunol. 164: 4178-4184 (2000)).
  • Antibodies with little or no CDC activity may be selected for use.
  • a beta klotho polypeptide "extracellular domain” or “ECD” refers to a form of the beta klotho polypeptide that is essentially free of the transmembrane and cytoplasmic domains.
  • a beta klotho polypeptide ECD may have less than 1 % of such transmembrane and/or cytoplasmic domains and preferably, may have less than 0.5% of such domains.
  • identity refers to a relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules, as determined by aligning and comparing the sequences. "Percent identity” means the percent of identical residues between the amino acids or nucleotides in the compared molecules and is calculated based on the size of the smallest of the molecules being compared. For these calculations, gaps in
  • alignments if any must be addressed by a particular mathematical model or computer program (e.g., an "algorithm”).
  • Methods that can be used to calculate the identity of the aligned nucleic acids or polypeptides include those described in Computational Molecular Biology, (Lesk, A. M., ed.), (1988) New York: Oxford University Press; Biocomputing Informatics and Genome Projects, (Smith, D. W., ed.), 1993, New York: Academic Press; Computer Analysis of Sequence Data, Part I, (Griffin, A. M., and Griffin, H.
  • the sequences being compared may be aligned in a way that gives the largest match between the sequences.
  • Computer program may be used to determine percent identity is the GCG program package, which includes GAP (Devereux et al., (1984) Nucl. Acid Res. 12:387; Genetics Computer Group, University of Wisconsin, Madison, Wis.).
  • GAP used to align the two polypeptides or polynucleotides for which the percent sequence identity is to be determined.
  • the sequences may be aligned for optimal matching of their respective amino acid or nucleotide (the "matched span", as determined by the algorithm).
  • a gap opening penalty (which is calculated as 3.times.
  • the average diagonal wherein the "average diagonal” is the average of the diagonal of the comparison matrix being used; the “diagonal” is the score or number assigned to each perfect amino acid match by the particular comparison matrix
  • a gap extension penalty which is usually 1/10 times the gap opening penalty
  • a comparison matrix such as PAM 250 or BLOSUM 62 are used in conjunction with the algorithm.
  • a standard comparison matrix see, Dayhoff et al., (1978) Atlas of Protein Sequence and Structure 5:345-352 for the PAM 250 comparison matrix; Henikoff et al., (1992) Proc. Natl. Acad. Sci. U.S.A. 89:10915- 10919 for the BLOSUM 62 comparison matrix is also used by the algorithm.
  • Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • a "modification" of an amino acid residue/position refers to a change of a primary amino acid sequence as compared to a starting amino acid sequence, wherein the change results from a sequence alteration involving said amino acid residue/positions.
  • typical modifications include substitution of the residue with another amino acid ⁇ e.g., a conservative or non-conservative
  • substitution substitution
  • An "epitope" is the site on the surface of an antigen molecule to which a single antibody molecule binds, such as a localized region on the surface of an antigen, such as a beta klotho polypeptide, a beta klotho polypeptide fragment or a beta klotho epitope, that is capable of being bound to one or more antigen binding regions of an antibody, and that has antigenic or immunogenic activity in an animal, such as a mammal ⁇ e.g., a human), that is capable of eliciting an immune response.
  • An epitope having immunogenic activity is a portion of a polypeptide that elicits an antibody response in an animal.
  • An epitope having antigenic activity is a portion of a polypeptide to which an antibody binds as determined by any method well known in the art, including, for example, by an immunoassay.
  • Antigenic epitopes need not necessarily be immunogenic.
  • Epitopes often consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and have specific three dimensional structural characteristics as well as specific charge characteristics.
  • the term, "epitope" specifically includes linear epitopes and conformational epitopes.
  • a region of a polypeptide contributing to an epitope may be contiguous amino acids of the polypeptide or the epitope may come together from two or more noncontiguous regions of the polypeptide.
  • the epitope may or may not be a three- dimensional surface feature of the antigen.
  • a beta klotho epitope is a three-dimensional surface feature of a beta klotho polypeptide.
  • a beta klotho epitope is linear feature of a beta klotho polypeptide.
  • an antigen has several or many different epitopes and may react with many different antibodies.
  • An antibody binds "an epitope” or “essentially the same epitope” or “the same epitope” as a reference antibody, when the two antibodies recognize identical, overlapping or adjacent epitopes in a three-dimensional space.
  • the most widely used and rapid methods for determining whether two antibodies bind to identical, overlapping or adjacent epitopes in a three-dimensional space are competition assays, which can be configured in a number of different formats, for example, using either labeled antigen or labeled antibody. In some assays, the antigen is
  • Epitope mapping is the process of identifying the binding sites, or epitopes, of antibodies on their target antigens.
  • Antibody epitopes may be linear epitopes or conformational epitopes.
  • Linear epitopes are formed by a continuous sequence of amino acids in a protein.
  • Conformational epitopes are formed of amino acids that are discontinuous in the protein sequence, but which are brought together upon folding of the protein into its three-dimensional structure. Induced epitopes are formed when the three dimensional structure of the protein is in an altered
  • epitope binning is the process of grouping antibodies based on the epitopes they recognize. More particularly, epitope binning comprises methods and systems for discriminating the epitope recognition properties of different antibodies, using competition assays combined with computational processes for clustering antibodies based on their epitope recognition properties and identifying antibodies having distinct binding specificities.
  • a "beta klotho-mediated disease” and "beta klotho-mediated disorder” and “beta klotho-mediated condition” are used interchangeably and refer to any disease, disorder or condition that is completely or partially caused by or is the result of beta klotho or the interaction of a beta klotho with an FGF receptor such as FGFRI c, FGFR2c, FGFR3c, or FGFR4 and/or alternatively any disease, disorder, or condition in which it is desirable to mimic or augment the in vivo effects of FGF19 and/or FGF21 .
  • terapéuticaally effective amount refers to the amount of an agent ⁇ e.g., an antibody described herein or any other agent described herein) that is sufficient to reduce and/or ameliorate the severity and/or duration of a given disease, disorder or condition, and/or a symptom related thereto.
  • therapeutically effective amount of a agent can be an amount necessary for (i) reduction or amelioration of the advancement or
  • a "therapeutically effective amount" of a substance/molecule/agent of the present disclosure may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the substance/molecule/agent, to elicit a desired response in the individual.
  • a therapeutically effective amount encompasses an amount in which any toxic or detrimental effects of the substance/molecule/agent are outweighed by the
  • the term “therapeutically effective amount” refers to an amount of an antibody or other agent (e.g., or drug) effective to "treat” a disease, disorder, or condition, in a subject or mammal.
  • an "effective amount” is generally an amount sufficient to reduce the severity and/or frequency of symptoms, eliminate the symptoms and/or underlying cause, prevent the occurrence of symptoms and/or their underlying cause, and/or improve or remediate the damage that results from or is associated with a disease, disorder, or condition, including, for example, diabetes, obesity, dyslipidemia, cardiovascular disease, metabolic syndrome or broadly any disease, disorder, or condition in which it is desirable to mimic or augment the in vivo effects of FGF19 and/or FGF21 .
  • the effective amount is a therapeutically effective amount or a prophylactically effective amount.
  • a “therapeutically effective amount” is an amount sufficient to remedy a disease, disorder, or condition [e.g., Type 2 diabetes, obesity, dyslipidemia, NASH, cardiovascular disease, metabolic syndrome or broadly any disease, disorder, or condition in which it is desirable to mimic or augment the in vivo effects of FGF19 and/or FGF21 ) or symptoms, particularly a disease, disorder, or condition, or symptoms associated with such a disease, disorder, or condition, or otherwise prevent, hinder, retard or reverse the progression of the disease, disorder, or condition, or any other undesirable symptom associated with such a disease, disorder, or condition, in any way whatsoever.
  • a “prophylactically effective amount” is an amount of a pharmaceutical composition that, when administered to a subject, will have the intended prophylactic effect, e.g., preventing or delaying the onset (or reoccurrence) of diabetes, obesity or
  • dyslipidemia or reducing the likelihood of the onset (or reoccurrence) of a disease, disorder, or condition or associated symptom(s), including, for example, diabetes, obesity, dyslipidemia, cardiovascular disease, metabolic syndrome or broadly any disease, disorder, or condition in which it is desirable to mimic or augment the in vivo effects of FGF19 and/or FGF21 ) or associated symptoms.
  • the full therapeutic or prophylactic effect does not necessarily occur by administration of one dose, and may occur only after administration of a series of doses.
  • a therapeutically or prophylactically effective amount may be administered in one or more
  • a prophylactically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of a disease, disorder, or condition, a prophylactically effective amount may be less than a therapeutically effective amount.
  • Chronic administration refers to administration of the agent(s) in a continuous mode ⁇ e.g., for a period of time such as days, weeks, months or years) as opposed to an acute mode, so as to maintain the initial therapeutic effect (activity) for an extended period of time.
  • Intermittent administration is treatment that is not consecutively done without interruption, but rather is cyclic in nature.
  • Administration "in combination with” one or more further therapeutic agents includes simultaneous ⁇ e.g., concurrent) and consecutive administration in any order.
  • the term "in combination” in the context of the administration of other therapies ⁇ e.g., other agents) includes the use of more than one therapy ⁇ e.g., one agent).
  • the use of the term “in combination” does not restrict the order in which therapies are administered to a subject.
  • a first therapy ⁇ e.g., agent can be administered before ⁇ e.g., 1 minute, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, 8 weeks, 9 weeks, 10 weeks, 1 1 weeks, or 12 weeks), concurrently, or after ⁇ e.g., 1 minute, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 1 1 weeks, or 12 weeks) the administration of a second therapy ⁇ e.g., agent) to a subject which had, has, or is susceptible to a beta klotho-mediated disease
  • any additional therapy ⁇ e.g., agent can be administered in any order with the other additional therapies ⁇ e.g., agents).
  • the antibodies can be administered in combination with one or more therapies such as agents ⁇ e.g., therapies, including agents, that are not the antibodies that are currently
  • therapies ⁇ e.g., agents
  • agents useful in combination therapy include, but are not limited to, the following: non-steroidal antiinflammatory drug (NSAID) such as aspirin, ibuprofen, and other propionic acid derivatives (alminoprofen, benoxaprofen, bucloxic acid, carprofen, fenbufen, fenoprofen, fluprofen, flurbiprofen, indoprofen, ketoprofen, miroprofen, naproxen, oxaprozin, pirprofen, pranoprofen, suprofen, tiaprofenic acid, and tioxaprofen), acetic acid derivatives (indomethacin, acemetacin, alclofenac, clidanac, diclofenac, fenclofenac, fenclozic acid, fentiazac, fuirofenac, ibufenac, isoxepac, oxe
  • cyclooxygenase-2 (COX-2) inhibitors include cyclooxygenase-2 (COX-2) inhibitors.
  • agents for combination include steroids such as prednisolone, prednisone, methylprednisolone, betamethasone,
  • dexamethasone or hydrocortisone.
  • Such a combination may be especially advantageous, since one or more side-effects of the steroid can be reduced or even eliminated by tapering the steroid dose required when treating patients in
  • agents for combinations include cytokine suppressive anti-inflammatory drug(s) (CSAIDs); antibodies to or antagonists of other human cytokines or growth factors, for example, TNF, LT, ⁇ _-1 ⁇ , IL-2, IL-6, IL-7, IL-8, IL-15, IL-16, IL-18, EMAP-II, GM-CSF, FGF, or PDGF.
  • CSAIDs cytokine suppressive anti-inflammatory drug
  • Combinations of agents may include TNF antagonists like chimeric, humanized or human TNF antibodies, REMICADE, anti-TNF antibody fragments (e.g., CDP870), and soluble p55 or p75 TNF receptors, derivatives thereof, p75TNFRIgG (ENBREL ® ) or p55TNFR1 gG (LENERCEPT ® ), soluble IL-13 receptor (slL-13), and also TNFa converting enzyme (TACE) inhibitors; similarly IL-1 inhibitors [e.g., lnterleukin-1 -converting enzyme inhibitors) may be effective.
  • TNF antagonists like chimeric, humanized or human TNF antibodies, REMICADE, anti-TNF antibody fragments (e.g., CDP870), and soluble p55 or p75 TNF receptors, derivatives thereof, p75TNFRIgG (ENBREL ® ) or p55TNFR1 gG (LENERCEPT ® ), soluble IL
  • Interleukin 1 1 Interleukin 1 1 , anti-P7s and p-selectin glycoprotein ligand (PSGL).
  • agents useful in combination therapy include interferon- 1 a (AVONEX); interferon- 1 b (BETASERON ® ); Copaxone; hyperbaric oxygen; intravenous immunoglobulin; clabribine; and antibodies to or antagonists of other human cytokines or growth factors ⁇ e.g., antibodies to CD40 ligand and CD80).
  • Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed.
  • physiologically acceptable carrier is an aqueous pH buffered solution.
  • physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight ⁇ e.g., less than about 10 amino acid residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt- forming counterions such as sodium; and/or nonionic surfactants such as TWEENTM, polyethylene glycol (PEG), and PLURONICSTM.
  • buffers such as phosphate, citrate, and other organic acids
  • antioxidants including ascorbic
  • carrier can also refer to a diluent, adjuvant ⁇ e.g., Freund's adjuvant (complete or incomplete)), excipient, or vehicle with which the therapeutic is administered.
  • Such carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a exemplary carrier when a composition ⁇ e.g., a pharmaceutical composition) is administered intravenously.
  • Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
  • Suitable excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
  • the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
  • Compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like.
  • Oral compositions, including formulations can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc.
  • compositions including pharmaceutical compounds, may contain a prophylactically or
  • an anti-beta klotho antibody for example, in isolated or purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the subject ⁇ e.g., patient).
  • the formulation should suit the mode of administration.
  • pharmaceutically acceptable means being approved by a regulatory agency of the Federal or a state government, or listed in the U.S. Pharmacopeia, European Pharmacopeia or other generally recognized Pharmacopeia for use in animals, and more particularly in humans.
  • composition refers to a preparation which is in such form as to permit the biological activity of the active ingredient ⁇ e.g., an anti- beta klotho antibody) to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
  • Such formulation may be sterile.
  • a "sterile" formulation is aseptic or free from all living microorganisms and their spores.
  • Polyclonal antibodies refers to an antibody population generated in an immunogenic response to a protein having many epitopes and thus includes a variety of different antibodies directed to the same and to different epitopes within the protein. Methods for producing polyclonal antibodies are known in the art (See, e.g., Chapter 1 1 in: Short Protocols in Molecular Biology. (2002) 5th Ed., Ausubel et al., eds., John Wiley and Sons, New York).
  • an "isolated nucleic acid” is a nucleic acid, for example, an RNA, DNA, or a mixed polymer, which is substantially separated from other genome DNA sequences as well as proteins or complexes such as ribosomes and polymerases, which naturally accompany a native sequence.
  • An "isolated" nucleic acid molecule is one which is separated from other nucleic acid molecules which are present in the natural source of the nucleic acid molecule.
  • an "isolated" nucleic acid molecule, such as a cDNA molecule can be substantially free of other cellular material, or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized.
  • nucleic acid molecules encoding an antibody as described herein are isolated or purified.
  • the term embraces nucleic acid sequences that have been removed from their naturally occurring environment, and includes recombinant or cloned DNA isolates and chemically synthesized analogues or analogues biologically synthesized by heterologous systems.
  • a substantially pure molecule may include isolated forms of the molecule.
  • Polynucleotide or “nucleic acid,” as used interchangeably herein, refer to polymers of nucleotides of any length, and include DNA and RNA.
  • the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase or by a synthetic reaction.
  • a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs.
  • Oligonucleotide generally refers to short, generally single- stranded, generally synthetic polynucleotides that are generally, but not necessarily, less than about 200 nucleotides in length.
  • oligonucleotide and
  • polynucleotide are not mutually exclusive. The description above for
  • a cell that produces an anti-beta klotho antibody of the present disclosure may include a parent hybridoma cell, as well as bacterial and eukaryotic host cells into which nucleic acid encoding the antibodies have been introduced. Suitable host cells are disclosed below.
  • the left-hand end of any single-stranded polynucleotide sequence disclosed herein is the 5' end; the left-hand direction of double-stranded polynucleotide sequences is referred to as the 5' direction.
  • the direction of 5' to 3' addition of nascent RNA transcripts is referred to as the transcription direction; sequence regions on the DNA strand having the same sequence as the RNA transcript that are 5' to the 5' end of the RNA transcript are referred to as "upstream sequences;" sequence regions on the DNA strand having the same sequence as the RNA transcript that are 3' to the 3' end of the RNA transcript are referred to as "downstream sequences.”
  • the term "package insert” is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, contraindications and/or warnings concerning the use of such therapeutic products.
  • the terms "prevent,” “preventing,” and “prevention” refer to the total or partial inhibition of the development, recurrence, onset or spread of a beta klotho- mediated disease and/or symptom related thereto, resulting from the administration of a therapy or combination of therapies provided herein ⁇ e.g., a combination of prophylactic or therapeutic agents, such as an antibody provided herein).
  • prophylactic agent refers to any agent that can totally or partially inhibit the development, recurrence, onset or spread of a beta klotho- mediated disease and/or symptom related thereto in a subject.
  • the term “prophylactic agent” refers to an anti-beta klotho antibody as described herein. In certain other embodiments, the term “prophylactic agent” refers to an agent other than an anti-beta klotho antibody as described herein.
  • a prophylactic agent is an agent which is known to be useful to or has been or is currently being used to prevent a beta klotho-mediated disease, disorder, or condition, and/or a symptom related thereto or impede the onset, development, progression and/or severity of a beta klotho-mediated disease, disorder, or condition, and/or a symptom related thereto.
  • the prophylactic agent is a humanized anti-beta klotho antibody, such as a humanized anti-beta klotho monoclonal antibody.
  • a "prophylactically effective serum titer” is the serum titer in a subject, preferably a human, that totally or partially inhibits the development, recurrence, onset or spread of a beta klotho-mediated disease, disorder, or condition, and/or symptom related thereto in the subject.
  • a "therapeutically effective serum titer” is the serum titer in a subject, preferably a human, that reduces the severity, the duration and/or the symptoms associated with a beta klotho-mediated disease, disorder, or condition, in the subject.
  • recombinant antibody refers to an antibody that is prepared, expressed, created or isolated by recombinant means.
  • Recombinant antibodies can be antibodies expressed using a recombinant expression vector transfected into a host cell, antibodies isolated from a recombinant, combinatorial antibody library, antibodies isolated from an animal ⁇ e.g., a mouse or cow) that is transgenic and/or transchromosomal for human immunoglobulin genes (see, e.g., Taylor, L. D. et al. (1992) Nucl. Acids Res. 20:6287-6295) or antibodies prepared, expressed, created or isolated by any other means that involves splicing of immunoglobulin gene sequences to other DNA sequences.
  • Such recombinant antibodies can have variable and constant regions, including those derived from human germline immunoglobulin sequences (See Kabat, E. A. et al. (1991 ) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human
  • such recombinant antibodies may be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
  • serum titer refers to an average serum titer in a subject from multiple samples ⁇ e.g., at one time present or multiple time points) or in a population of least 10, such as at least 20, or at least 40 subjects, up to about 100, 1000 or more.
  • side effects encompasses unwanted and/or adverse effects of a therapy ⁇ e.g., a prophylactic or therapeutic agent). Unwanted effects are not necessarily adverse. An adverse effect from a therapy ⁇ e.g., a prophylactic or therapeutic agent) might be harmful or uncomfortable or risky. Examples of side effects include, diarrhea, cough, gastroenteritis, wheezing, nausea, vomiting, anorexia, abdominal cramping, fever, pain, loss of body weight, dehydration, alopecia, dyspenea, insomnia, dizziness, mucositis, nerve and muscle effects, fatigue, dry mouth, and loss of appetite, rashes or swellings at the site of
  • a subject is a mammal, such as a non-primate ⁇ e.g., cows, pigs, horses, cats, dogs, rats, etc.) or a primate ⁇ e.g., monkey and human).
  • the subject is a human.
  • the subject is a mammal (e.g., a human) having a beta klotho-mediated disease, disorder or condition.
  • the subject is a mammal ⁇ e.g., a human) at risk of developing a beta klotho-mediated disease, disorder, or condition.
  • substantially all refers to refers to at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or about 100%.
  • a therapeutic agent refers to any agent that can be used in treating, preventing or alleviating a disease, disorder or condition, including in the treatment, prevention or alleviation of one or more symptoms of a beta klotho- mediated disease, disorder, or condition and/or a symptom related thereto.
  • a therapeutic agent refers to an anti-beta klotho antibody as described herein.
  • a therapeutic agent refers to an agent other than an antibody provided herein.
  • a therapeutic agent is an agent which is known to be useful for, or has been or is currently being used for the treatment, prevention or alleviation of one or more symptoms of a beta klotho-mediated disease, disorder, or condition, or a symptom related thereto.
  • the combination of therapies ⁇ e.g., use of agents, including therapeutic agents
  • a synergetic effect is unexpected and can not be predicted.
  • a synergistic effect of a combination of therapeutic agents permits the use of lower dosages of one or more of the agents and/or less frequent administration of the agents to a subject with a beta klotho-mediated disease.
  • a synergistic effect can result in improved efficacy of therapies in the prevention, treatment or alleviation of one or more symptom of a beta klotho-mediated disease.
  • synergistic effect of a combination of therapies ⁇ e.g., therapeutic agents) may avoid or reduce adverse or unwanted side effects associated with the use of any single therapy.
  • the term "therapy” refers to any protocol, method and/or agent that can be used in the prevention, management, treatment and/or amelioration of a beta klotho- mediated disease, disorder, or conditions.
  • the terms “therapies” and “therapy” refer to a biological therapy, supportive therapy, and/or other therapies useful in the prevention, management, treatment and/or amelioration of a beta klotho-mediated disease, disorder or condition, known to one of skill in the art such as medical personnel.
  • detectable probe refers to a composition that provides a detectable signal.
  • the term includes, without limitation, any fluorophore,
  • chromophore chromophore, radiolabel, enzyme, antibody or antibody fragment, and the like, that provide a detectable signal via its activity.
  • a diagnostic agent refers to a substance administered to a subject that aids in the diagnosis of a disease, disorder, or conditions. Such substances can be used to reveal, pinpoint, and/or define the localization of a disease causing process.
  • a diagnostic agent includes a substance that is conjugated to an anti-beta klotho antibody as described herein, that when administered to a subject or contacted to a sample from a subject aids in the diagnosis a beta klotho-mediated disease.
  • detectable agent refers to a substance that can be used to ascertain the existence or presence of a desired molecule, such as an anti-beta klotho antibody as described herein, in a sample or subject.
  • a detectable agent can be a substance that is capable of being visualized or a substance that is otherwise able to be determined and/or measured (e.g., by quantitation).
  • encode or grammatical equivalents thereof as it is used in reference to nucleic acid molecule refers to a nucleic acid molecule in its native state or when manipulated by methods well known to those skilled in the art that can be transcribed to produce mRNA, which is then translated into a polypeptide and/or a fragment thereof.
  • the antisense strand is the complement of such a nucleic acid molecule, and the encoding sequence can be deduced therefrom.
  • excipient refers to an inert substance which is commonly used as a diluent, vehicle, preservative, binder, or stabilizing agent, and includes, but not limited to, proteins (e.g., serum albumin, etc.), amino acids (e.g., aspartic acid, glutamic acid, lysine, arginine, glycine, histidine, etc.), fatty acids and phospholipids (e.g., alkyl sulfonates, caprylate, etc.), surfactants (e.g., SDS, polysorbate, nonionic surfactant, etc.), saccharides (e.g., sucrose, maltose, trehalose, etc.) and polyols (e.g., mannitol, sorbitol, etc.). See, also, Remington's Pharmaceutical Sciences
  • fragment refers to a peptide or polypeptide that comprises less than the full length amino acid sequence. Such a fragment may arise, for example, from a truncation at the amino terminus, a truncation at the carboxy terminus, and/or an internal deletion of a residue(s) from the amino acid sequence. Fragments may, for example, result from alternative RNA splicing or from in vivo protease activity. In certain
  • beta klotho fragments include polypeptides comprising an amino acid sequence of at least 5 contiguous amino acid residues, at least 10 contiguous amino acid residues, at least 15 contiguous amino acid residues, at least 20 contiguous amino acid residues, at least 25 contiguous amino acid residues, at least 40 contiguous amino acid residues, at least 50 contiguous amino acid residues, at least 60 contiguous amino residues, at least 70 contiguous amino acid residues, at least 80 contiguous amino acid residues, at least 90 contiguous amino acid residues, at least contiguous 100 amino acid residues, at least 125 contiguous amino acid residues, at least 150 contiguous amino acid residues, at least 175 contiguous amino acid residues, at least 200 contiguous amino acid residues, at least 250, at least 300, at least 350, at least 400, at least 450, at least 500, at least 550, at least 600, at least 650, at least 700, at least 750, at least 800, at least at least
  • a fragment of a beta klotho polypeptide or an antibody that binds to a beta klotho antigen retains at least 1 , at least 2, or at least 3 or more functions of the polypeptide or antibody.
  • a subject derives from a therapy (e.g., a prophylactic or therapeutic agent), which does not result in a cure of the disease.
  • a subject is administered one or more therapies (e.g., prophylactic or therapeutic agents, such as an antibody provided herein) to "manage” a beta klotho- mediated disease, one or more symptoms thereof, so as to prevent the progression or worsening of the disease.
  • therapies e.g., prophylactic or therapeutic agents, such as an antibody provided herein
  • administering refers to the act of injecting or otherwise physically delivering a substance as it exists outside the body ⁇ e.g., an anti-beta klotho antibody as described herein) into a patient, such as by mucosal, intradermal, intravenous, intramuscular delivery and/or any other method of physical delivery described herein or known in the art.
  • administration of the substance typically occurs after the onset of the disease, disorder, or condition, or symptoms thereof.
  • a disease, disorder, or condition or symptoms thereof are being prevented,
  • administration of the substance typically occurs before the onset of the disease, disorder, or condition, or symptoms thereof.
  • analog refers to a polypeptide that possesses a similar or identical function as a beta klotho
  • polypeptide, a fragment of a beta klotho polypeptide, or an anti-beta klotho antibody does not necessarily comprise a similar or identical amino acid sequence of a beta klotho polypeptide, a fragment of a beta klotho polypeptide, or an anti-beta klotho antibody, or possess a similar or identical structure of a beta klotho
  • a polypeptide that has a similar amino acid sequence refers to a polypeptide that satisfies at least one of the following: (a) a polypeptide having an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of a beta klotho polypeptide (e.g., SEQ ID NO:297, a fragment of a beta klotho polypeptide, or an anti-beta klotho antibody described herein; (b) a beta klotho polypeptide (e.g., SEQ ID NO:297, a fragment of a beta klotho polypeptide, or an anti-beta klotho antibody described herein; (b) a beta klotho
  • a polypeptide with similar structure to a beta klotho polypeptide, a fragment of a beta klotho polypeptide, or an anti-beta klotho antibody described herein refers to a polypeptide that has a similar secondary, tertiary or quaternary structure of a beta klotho polypeptide, a fragment of a beta klotho, or a beta klotho antibody described herein.
  • the structure of a polypeptide can determined by methods known to those skilled in the art, including but not limited to, X-ray crystallography, nuclear magnetic resonance, and crystallographic electron microscopy.
  • composition is intended to encompass a product containing the specified ingredients ⁇ e.g., an antibody provided herein) in, optionally, the specified amounts, as well as any product which results, directly or indirectly, from combination of the specified ingredients in, optionally, the specified amounts.
  • derivative refers to a polypeptide that comprises an amino acid sequence of a beta klotho
  • polypeptide a fragment of a beta klotho polypeptide, or an antibody that binds to a beta klotho polypeptide which has been altered by the introduction of amino acid residue substitutions, deletions or additions.
  • derivative as used herein also refers to a beta klotho polypeptide, a fragment of a beta klotho polypeptide, or an antibody that binds to a beta klotho polypeptide which has been chemically modified, e.g., by the covalent attachment of any type of molecule to the polypeptide.
  • a beta klotho polypeptide, a fragment of a beta klotho polypeptide, or a beta klotho antibody may be chemically modified, e.g., by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular Iigand or other protein, etc.
  • the derivatives are modified in a manner that is different from naturally occurring or starting peptide or polypeptides, either in the type or location of the molecules attached. Derivatives further include deletion of one or more chemical groups which are naturally present on the peptide or polypeptide.
  • a derivative of a beta klotho polypeptide, a fragment of a beta klotho polypeptide, or a beta klotho antibody may be chemically modified by chemical modifications using techniques known to those of skill in the art, including, but not limited to specific chemical cleavage, acetylation, formulation, metabolic synthesis of tunicamycin, etc. Further, a derivative of a beta klotho polypeptide, a fragment of a beta klotho polypeptide, or a beta klotho antibody may contain one or more non-classical amino acids.
  • a polypeptide derivative possesses a similar or identical function as a beta klotho polypeptide, a fragment of a beta klotho polypeptide, or a beta klotho antibody described herein.
  • Binding proteins such as antibodies that bind to beta klotho ⁇ e.g., human and/or cyno beta klotho) are provided.
  • Antibodies of the present disclosure are useful, for example, for the diagnosis or treatment of diseases, disorders, or conditions associated with expression, of beta klotho.
  • antibodies of the present disclosure are useful for the diagnosis or treatment of a diseases, disorder, or condition, such as Type 2 diabetes, obesity, dyslipidemia, NASH, cardiovascular disease, metabolic syndrome or broadly any disease, disorder, or condition in which it is desirable to mimic or augment the in vivo effects of FGF19 and/or FGF21 .
  • antibodies that bind to a beta klotho polypeptide, a beta klotho polypeptide fragment, beta klotho peptide, or a beta klotho epitope.
  • the anti-beta klotho antibodies bind to the extracellular domain (ECD) of beta klotho.
  • the anti-beta klotho antibodies provided herein can also be conjugated or recombinantly fused to a diagnostic agent, detectable agent or therapeutic agent. Further provided are compositions comprising an beta klotho antibody.
  • isolated nucleic acid molecules encoding an immunoglobulin heavy chain, light chain, VH region, VL region, VH CDR1 , VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and/or VL CDR3 of anti-beta klotho antibodies that bind to a beta klotho polypeptide, a beta klotho polypeptide fragment, a beta klotho peptide or a beta klotho epitope.
  • vectors and host cells comprising nucleic acid molecules encoding anti-beta klotho antibodies that bind to a beta klotho polypeptide, a beta klotho polypeptide fragment, a beta klotho peptide or a beta klotho epitope. Also provided are methods of making antibodies that bind to a beta klotho polypeptide, a beta klotho polypeptide fragment, a beta klotho peptide or a beta klotho epitope.
  • Methods of using the anti-beta klotho antibodies include treating, preventing or alleviating a disease, disorder or condition, including treating, preventing or alleviating one or more symptoms of a disease, disorder or condition in a subject.
  • Non limiting examples of diseases, disorders, or conditions include glucose utilization disorders and the sequelae associated therewith, including diabetes mellitus (Type I and Type-2), gestational diabetes, hyperglycemia, insulin resistance, abnormal glucose metabolism, "pre-diabetes" (Impaired Fasting Glucose (IFG) or Impaired Glucose Tolerance (IGT)), or other physiological disorders associated with, or that result from, the hyperglycemic condition, including, for example, histopathological changes such as pancreatic ⁇ - cell destruction.
  • IGF Impaired Fasting Glucose
  • ITT Impaired Glucose Tolerance
  • subjects with a diseases, disorders, or condition, in need of treatment may have a fasting plasma glucose (FPG) level greater than about 100 mg/dl.
  • FPG fasting plasma glucose
  • hyperglycemic-related disorders include kidney damage ⁇ e.g., tubule damage or nephropathy), liver degeneration, eye damage (e.g., diabetic retinopathy or cataracts), and diabetic foot disorders.
  • Other of diseases, disorders, or conditions include dyslipidemias and their sequelae such as, for example, atherosclerosis, coronary artery disease, cerebrovascular disorders and the like or other of diseases, disorders, or conditions which may be associated with the metabolic syndrome, such as obesity and elevated body mass (including the co- morbid conditions thereof such as, but not limited to, nonalcoholic fatty liver disease (NAFLD), nonalcoholic steatohepatitis (NASH), and polycystic ovarian syndrome (PCOS)), or thromboses, hypercoagulable and prothrombotic states (arterial and venous), hypertension, cardiovascular disease, stroke and heart failure.
  • NAFLD nonalcoholic fatty liver disease
  • NASH nonalcoholic steatohepatitis
  • PCOS polycystic ova
  • diseases, disorders, or conditions include atherosclerosis, chronic inflammatory bowel diseases (e.g., Crohn's disease and ulcerative colitis), asthma, lupus erythematosus, arthritis, or other inflammatory rheumatic disorders.
  • diseases, disorders, or conditions include adipose cell tumors, lipomatous carcinomas including, for example, liposarcomas, solid tumors, and neoplasms.
  • Other diseases, disorders, or conditions include neurodegenerative diseases and/or demyelinating disorders of the central and peripheral nervous systems and/or neurological diseases involving neuroinflammatory processes and/or other peripheral
  • diseases, disorders, or conditions include skin and dermatological disorders and/or disorders of wound healing processes, including erythemato-squamous dermatoses.
  • diseases, disorders, or conditions include syndrome X, osteoarthritis, and acute respiratory distress syndrome.
  • hypoglycemic or “hyperglycemia,” when used in reference to a disease, disorder, or condition of a subject refers to a transient or chronic abnormally high level of glucose present in the blood of a subject.
  • the disease, disorder, or condition may be caused by a delay in glucose metabolism or absorption such that the subject exhibits glucose intolerance or a state of elevated glucose not typically found in normal subjects ⁇ e.g., in glucose- intolerant pre-diabetic subjects at risk of developing diabetes, or in diabetic subjects).
  • fasting plasma glucose (FPG) levels for normoglycemia may be less than about 100 mg/dl, for impaired glucose metabolism, between about 100 and 126 mg/dl, and for diabetics greater than about 126 mg/dl.
  • Methods of preventing ⁇ e.g., in subjects predisposed to having a particular disorder(s) relate to delaying, slowing or inhibiting progression of, the onset of, or treating ⁇ e.g., ameliorating) obesity or an undesirable body mass ⁇ e.g., a greater than normal body mass index, or "BMI" relative to an appropriate matched subject of comparable age, gender, race, etc.).
  • BMI normal body mass index
  • Methods of treating obesity or an undesirable body mass include contacting or administering a binding protein such as an anti-beta klotho antibody as described herein in an amount effective to treat obesity or an undesirable body mass.
  • a binding protein such as an anti-beta klotho antibody as described herein in an amount effective to treat obesity or an undesirable body mass.
  • a subject may have a body mass index greater than 25, for example, 25- 30, 30-35, 35-40, or greater than 40.
  • Methods of preventing relate to delaying, slowing or inhibiting the progression of, the onset of, or treating undesirable levels or
  • abnormally elevated serum/plasma LDL, VLDL, triglycerides or cholesterol can lead to, for example, plaque formation, narrowing or blockage of blood vessels, and increased risk of hypertension, stroke and coronary artery disease.
  • diseases, disorders, or conditions may be due to, for example, genetic predisposition or diet.
  • the present disclosure provides anti-beta klotho antibodies that may find use herein as therapeutic agents.
  • exemplary antibodies include polyclonal, monoclonal, humanized, human, bispecific, and heteroconjugate antibodies, as well as variants thereof having improved affinity or other properties.
  • antibodies that bind to beta klotho including a beta klotho polypeptide, a beta klotho polypeptide fragment, a beta klotho peptide or a beta klotho epitope.
  • the anti-beta klotho antibodies are humanized antibodies ⁇ e.g., comprising human constant regions) that bind beta klotho, including beta klotho polypeptide, a beta klotho polypeptide fragment, a beta klotho peptide or a beta klotho epitope.
  • the anti-beta klotho antibody comprises a VH region, VL region, VH CDR1 , VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and/or VL CDR3 of any one of the murine monoclonal antibodies described herein, such as an amino acid sequence depicted in Tables 1 -10.
  • the isolated antibody or functional fragment thereof provided herein comprises one, two, and/or three heavy chain CDRs and/or one, two, and/or three light chain CDRs from: (a) the antibody designated 5H23; (b) the antibody designated 1 C17; (c) the antibody designated 1 D19; (d) the antibody designated 2L12; (e) the antibody designated 3L3; (f) the antibody designated 3N20; (g) the antibody designated 4P5; (h) the antibody designated 5C23; (i) the antibody designated 5F7; (j) the antibody designated 1 G19, as shown in Tables 1 -10.
  • the antibody designated 5H23 comprises a VH sequence that is SEQ ID NO:25 and a VL sequence that is SEQ ID NO:26.
  • the antibody designated 1 C17 comprises a VH sequence that is SEQ ID NO:51 and a VL sequence that is SEQ ID NO:52.
  • the antibody designated 1 D19 comprises a VH sequence that is SEQ ID NO:77 and a VL sequence that is SEQ ID NO:78.
  • the antibody designated 2L12 comprises a VH sequence that is SEQ ID NO:103 and a VL sequence that is SEQ ID NO:104.
  • the antibody designated 3L3 comprises a VH sequence that is SEQ ID NO:129 and a VL sequence that is SEQ ID NO:130.
  • the antibody designated 3N20 comprises a VH sequence that is SEQ ID NO:155 and a VL sequence that is SEQ ID NO:156.
  • the antibody designated 4P5 comprises a VH sequence that is SEQ ID NO:181 and a VL sequence that is SEQ ID NO:182.
  • the antibody designated 5C23 comprises a VH sequence that is SEQ ID NO:207 and a VL sequence that is SEQ ID NO:208.
  • the antibody designated 5F7 comprises a VH sequence that is SEQ ID NO:233 and a VL sequence that is SEQ ID NO:234.
  • the antibody designated IG19 comprises a VH sequence that is SEQ ID NO:259 and a VL sequence that is SEQ ID NO:260.
  • the antibodies provided herein comprise a VH region or VH domain In other embodiments, the antibodies provided herein comprise a VL region or VL chain. In some embodiments, the antibodies provided herein have a combination of (i) a VH domain or VH region; and/or (ii) a VL domain or VL region.
  • an antibody provided herein comprises or consists of six CDRs, for example, VH CDR1 , VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and/or VL CDR3 identified in Tables 1 -10.
  • an antibody provided herein can comprise less than six CDRs.
  • the antibody comprises or consists of one, two, three, four, or five CDRs selected from the group consisting of VH CDR1 , VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and/or VL CDR3 identified in tables 1 -10.
  • the antibody comprises or consists of one, two, three, four, or five CDRs selected from the group consisting of VH CDR1 , VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and/or VL CDR3 of the murine monoclonal antibody selected from the group consisting of: (a) the antibody designated 5H23; (b) the antibody designated 1 C17; (c) the antibody designated 1 D19; (d) the antibody designated 2L12; (e) the antibody designated 3L3; (f) the antibody designated 3N20; (g) the antibody designated 4P5; (h) the antibody designated 5C23; (i) the antibody designated 5F7; (j) the antibody designated 1 G19; described herein.
  • the antibody comprises or consists of one, two, three four or five CDRs of anyone of the VH CDR1 , VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and/or VL CDR3 identified in Tables 1 -10.
  • the antibodies provided herein comprise one or more ⁇ e.g., one, two or three) VH CDRs listed in Tables 1 -10. In other embodiments, the antibodies provided herein comprise one or more ⁇ e.g., one, two or three) VL CDRs listed in Tables 1 -10. In yet other embodiments, the antibodies provided herein comprise one or more ⁇ e.g., one, two or three) VH CDRs listed in Tables 1 -10 and one or more VL CDRs listed in Tables 1 -10. Accordingly, in some
  • the antibodies comprise a VH CDR1 having the amino acid sequence of any one of SEQ ID NOS: 1 , 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, 70, 79, 85, 90, 91 , 96, 105, 1 1 1 , 1 16, 1 17, 122, 131 , 137, 142, 143, 148, 157, 163, 168, 169, 174, 183, 189, 194, 195, 200, 209, 215, 220, 221 , 226, 235, 241 , 246, 247, and 252.
  • the antibodies comprise a VH CDR2 having the amino acid sequence of any one of SEQ ID NOS: 2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71 , 76, 80, 86, 92, 97, 102, 106, 1 12, 1 18, 123, 128, 132, 138, 144, 149, 154, 158, 164, 170, 175, 180, 184, 190, 196, 201 , 206, 210, 216, 222, 227, 232, 236, 242, 248, 253, and 258.
  • the antibodies comprise a VH CDR3 having the amino acid sequence of any one of SEQ ID NOS: 3, 9, 15, 20, 29, 35, 41 , 46, 55, 61 , 67, 72, 81 , 87, 93, 98, 107, 1 13, 1 19, 124, 133, 139, 145, 150, 159, 165, 171 , 176, 185, 191 , 197, 202, 21 1 , 217, 223, 228, 237, 243, 249, and 254.
  • the antibodies comprise a VH CDR1 and/or a VH CDR2 and/or a VH CDR3 independently selected from a VH CDR1 , VH CDR2, VH CDR3 as depicted in any one of the amino acid sequences depicted in Table 1 -10.
  • the antibodies comprise a VL CDR1 having the amino acid sequence of any one of SEQ ID NOS: 4, 10, 16, 21 , 30, 36, 42, 47, 56, 62, 68, 73, 82, 88, 94, 99, 108, 1 14, 120, 125, 134, 140, 146, 151 , 160, 166, 172, 177, 186, 192, 198, 203, 212, 218, 224, 229, 238, 244, 250, and 255.
  • the antibodies comprise a VL CDR2 having the amino acid sequence of any one of SEQ ID NOS: 5, 1 1 , 22, 31 , 37, 48, 57, 63, 74, 83, 89, 100, 109, 1 15, 126, 135, 141 , 152, 161 , 167, 178, 187, 193, 204, 213, 219, 230, 239, 245, and 256.
  • the antibodies comprise a VL CDR3 having the amino acid sequence of any one of SEQ ID NOS: 6, 17, 23, 32, 43, 49, 58, 69, 75, 84, 95, 101 , 1 10, 121 , 127, 136, 147, 153, 162, 173, 179, 188, 199, 205, 214, 225, 231 , 240, 251 , and 257.
  • VL CDR3 having the amino acid sequence of any one of SEQ ID NOS: 6, 17, 23, 32, 43, 49, 58, 69, 75, 84, 95, 101 , 1 10, 121 , 127, 136, 147, 153, 162, 173, 179, 188, 199, 205, 214, 225, 231 , 240, 251 , and 257.
  • the antibodies comprise a VL CDR1 and/or a VL CDR2 and/or a VL CDR3 independently selected from a VL CDR1 , VL CDR2, VL CDR3 as depicted in any one of the amino acid sequences depicted in Tables 1 -10.
  • the antibodies provided herein comprise a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence of selectedselected from the group consisting of: (i) SEQ ID NO:1 , 27, 53,
  • the antibodies provided herein comprise a heavy chain variable (VH) region comprising: (1 ) a VH CDR1 having an amino acid sequence of selectedselected from the group consisting of: (i) SEQ ID NO:1 , 27, 53,
  • the antibodies provided herein comprise a light chain variable (VL) region comprising: (1 ) a VL CDR1 having an amino acid sequence of selectedselected from the group consisting of: (i) SEQ ID NO:4, 30, 56, 82, 108, 134, 160, 186, 212, and or 238, (ii) SEQ ID NO:10, 36, 52, 88, 1 14, 140, 166, 192, 218 or 244, (iii) SEQ ID NO:16, 42, 68, 94, 120, 146, 172, 198, 224 or 250, and (iv) SEQ ID NO:21 , 47, 73, 99, 125, 151 , 177, 203, 229 or 255; (2) a VL CDR2 having an amino acid sequence of selectedselected from the group consisting of: (i) SEQ ID NO:5, 31 , 57, 83, 109, 135, 161 , 187, 213, and or 2
  • antibodies comprising one or more VH CDRs and one or more ⁇ e.g., one, two or three) VL CDRs listed in Tables 1 -10.
  • an antibody comprising a VH CDR1 (SEQ ID NOS: 1 , 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, 70, 79, 85, 90, 91 , 96, 105, 1 1 1 , 1 16, 1 17, 122, 131 , 137, 142, 143, 148, 157, 163, 168, 169, 174, 183, 189, 194, 195, 200, 209, 215, 220, 221 , 226, 235, 241 , 246, 247, and 252.) and a VL CDR1 (SEQ ID NOS: 4, 10, 16, 21 , 30, 36, 42, 47, 56, 62, 68, 73, 82, 88, 94, 99,
  • VL CDR2 SEQ ID NOS: 5, 1 1 , 22, 31 , 37, 48, 57, 63, 74, 83, 89,
  • VH CDR1 SEQ ID NOS 1 , 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, 70, 79, 85, 90, 91 , 96, 105, 1 1 1 , 1 16, 1 17, 122, 131 , 137, 142, 143, 148, 157, 163, 168, 169, 174, 183, 189, 194, 195, 200, 209, 215, 220, 221 , 226, 235, 241 ,
  • VL CDR3 (SEQ ID NOS: 6, 17, 23, 32, 43, 49, 58, 69, 75, 84, 95,
  • VH CDR2 SEQ ID NOS: 2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71, 76, 80, 86, 92, 97, 102, 106, 112, 118, 123, 128, 132, 138, 144, 149, 154,
  • VL CDR1 SEQ ID NOS: 4, 10, 16, 21 , 30, 36, 42, 47, 56, 62, 68, 73, 82, 88, 94, 99, 108, 114, 120, 125, 134, 140, 146, 151 , 160, 166, 172, 177, 186, 192, 198, 203, 212, 218, 224, 229, 238, 244, 250, and 255) and a VH CDR2 (SEQ ID NOS: 2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71, 76, 80, 86, 92, 97, 102, 106, 112, 118, 123, 128, 132, 138, 144, 149, 154,
  • VL CDR3 SEQ ID NOS: 6, 17, 23, 32, 43, 49, 58, 69, 75, 84, 95, 101 , 110, 121, 127, 136, 147, 153, 162, 173, 179, 188, 199, 205, 214, 225, 231, 240, 251, and 257); a VH CDR1 (SEQ ID NOS: 1 , 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65,
  • VL CDR1 SEQ ID NOS: 4, 10, 16, 21 , 30, 36, 42, 47, 56, 62,
  • VH CDR1 SEQ ID NOS: 1, 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, 70, 79, 85, 90, 91, 96, 105, 111, 116, 117, 122, 131, 137, 142, 143, 148, 157, 163, 168, 169, 174, 183, 189, 194, 195, 200, 209, 215, 220, 221, 226, 235, 241, 246, 247, and 252), a VH CDR2 (SEQ ID NOS: 2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71, 76, 80, 86, 92, 97, 102, 106, 112, 118, 123, 128, 132, 138, 144, 149, 154, 158,
  • VH CDR2 SEQ ID NOS: 2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71 , 76, 80,
  • VL CDR3 SEQ ID NOS: 6, 17, 23, 32, 43, 49, 58, 69, 75, 84, 95, 101, 110, 121, 127, 136, 147, 153, 162, 173, 179, 188, 199, 205, 214, 225, 231, 240, 251, and 257); a VH CDR2 (SEQ ID NOS: 2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71, 76, 80, 86, 92, 97, 102, 106, 112, 118, 123, 128, 132, 138, 144, 149, 154, 158, 164, 170, 175, 180, 184, 190, 196, 201, 206, 210, 216, 222, 227
  • VH CDR2 SEQ ID NOS: 2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71, 76, 80, 86, 92, 97, 102, 106, 112, 118, 123, 128, 132, 138, 144, 149, 154, 158, 164, 170, 175, 180, 184, 190, 196, 201, 206, 210, 216, 222, 227, 232, 236, 242, 248, 253, and 258), a VH CDR3 (SEQ ID NOS: 3, 9, 15, 20, 29, 35, 41 , 46, 55, 61, 67, 72, 81, 87, 93, 98, 107, 113, 119, 124, 133
  • VL CDR2 SEQ ID NOS: 5, 11 , 22, 31 , 37, 48, 57, 63, 74, 83, 89, 100, 109, 115, 126,
  • VH CDR2 (SEQ ID NOS: 2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71, 76, 80,
  • VH CDR3 SEQ ID NOS: 3, 9, 15, 20, 29, 35, 41 , 46, 55, 61 , 67, 72, 81 , 87,
  • VL CDR3 (SEQ ID NOS: 6,
  • VH CDR1 SEQ ID NOS: 1 ,
  • VL CDR1 (SEQ ID NOS:
  • VL CDR2 SEQ ID NOS: 5, 11 , 22, 31 , 37, 48, 57, 63, 74, 83,
  • VH CDR1 SEQ ID NOS:1, 7, 12, 13, 18, 27, 33, 38, 39, 44,
  • VL CDR1 SEQ ID NOS: 4, 10, 16,21, 30, 36, 42, 47, 56,
  • CDR3 (SEQ ID NOS: 6, 17, 23, 32, 43, 49, 58, 69, 75, 84, 95, 101 , 110, 121 , 127,
  • VH CDR1 (SEQ ID NOS: 1 , 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, 70, 79,
  • VL CDR2 SEQ ID NOS: 5, 11, 22, 31 , 37, 48, 57, 63, 74, 83, 89, 100, 109, 115,
  • VL CDR3 SEQ ID NOS: 6, 17, 23, 32, 43, 49, 58, 69, 75, 84, 95, 101 , 110,
  • VH CDR2 SEQ ID NOS: 2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71,
  • VL CDR1 SEQ ID NOS: 4, 10, 16,21,30, 36,42, 47, 56, 62,68, 73, 82,
  • VL CDR2 SEQ ID NOS: 5, 11, 22, 31 , 37, 48, 57, 63, 74, 83, 89, 100, 109, 115, 126, 135, 141 , 152,
  • VH CDR2 SEQ ID NOS: 2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71, 76, 80, 86, 92, 97, 102, 106, 112, 118, 123, 128, 132, 138, 144, 149, 154, 158, 164, 170, 175, 180, 184, 190, 196, 201 , 206, 210,216, 222, 227, 232, 236, 242, 248, 253, and 258), a VL CDR1 (SEQ ID NOS: 4, 10, 16, 21, 30, 36, 42, 47, 56, 62, 68, 73, 82, 88, 94, 99, 108, 114, 120, 125, 134, 140, 146, 151, 160, 166, 172, 177, 186
  • VL CDR1 SEQ ID NOS: 4, 10, 16,21,30, 36,42, 47, 56, 62,68, 73, 82, 88, 94, 99, 108, 114, 120, 125, 134, 140, 146, 151, 160, 166, 172, 177, 186, 192, 198, 203, 212, 218, 224, 229, 238, 244, 250, and 255) and a VL CDR3 (SEQ ID NOS: 6, 17, 23, 32,43, 49, 58, 69, 75, 84, 95
  • VL CDR2 SEQ ID NOS:5, 11 , 22, 31 , 37, 48, 57, 63, 74, 83, 89, 100, 109, 115, 126, 135, 141, 152, 161, 167, 178, 187, 193, 204, 213, 219, 230, 239, 245, and 256
  • VL CDR3 SEQ ID NOS:6, 17, 23, 32, 43, 49, 58, 69, 75, 84, 95, 101, 110, 121, 127, 136, 147, 153, 162, 173, 179, 188, 199, 205, 214, 225, 231 , 240, 251 , and 257);
  • VH CDR1 SEQ ID NOS: 1 , 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, 70, 79, 85, 90, 91 , 96,
  • VH CDR2 SEQ ID NOS: 2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71 , 76, 80, 86, 92, 97, 102, 106, 112, 118, 123, 128, 132, 138,
  • VH CDR3 SEQ ID NOS: 3, 9, 15, 20, 29, 35, 41,46, 55,61,67, 72, 81,87, 93, 98, 107, 113, 119, 124, 133, 139, 145, 150, 159,
  • VL CDR1 SEQ ID NOS: 4, 10, 16,21,30, 36,42,47, 56, 62, 68, 73, 82,88, 94,
  • VH CDR1 SEQ ID NOS:1 , 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, 70, 79, 85, 90, 91 , 96, 105, 111 , 116, 117, 122, 131, 137, 142, 143, 148, 157, 163, 168, 169, 174, 183, 189, 194, 195, 200, 209, 215, 220, 221 , 226, 235, 241 , 246, 247, and 252), a VH CDR2 (SEQ ID NOS: 2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71 , 76, 80,
  • VL CDR2 SEQ ID NOS: 5, 11 , 22, 31 , 37, 48, 57, 63, 74, 83, 89
  • VH CDR1 SEQ ID NOS:1, 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, 70, 79, 85, 90, 91, 96, 105, 111, 116, 117, 122, 131, 137, 142, 143, 148, 157, 163, 168, 169, 174, 183, 189, 194, 195, 200, 209, 215, 220, 221, 226, 235, 241, 246,
  • VH CDR2 SEQ ID NOS: 2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60,
  • VH CDR3 (SEQ ID NOS:3, 9, 15, 20, 29, 35, 41, 46, 55, 61,
  • VL CDR3 SEQ ID NOS:6, 17, 23, 32, 43, 49, 58, 69, 75, 84, 95, 101 , 1 10, 121 , 127, 136, 147, 153, 162, 173, 179, 188, 199, 205, 214, 225, 231 , 240, 251 , and 257); a VH CDR1 (SEQ ID NOS:1 , 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, 70, 79, 85, 90, 91 , 96, 105, 1 1 1 , 1 16, 1 17, 122, 131 , 137, 142, 143, 148, 157, 163, 168, 169, 174, 183, 189, 194, 195, 200, 209, 215, 220, 221
  • VL CDR2 SEQ ID NOS:5, 1 1 , 22, 31 , 37, 48, 57, 63, 74, 83, 89, 100, 109, 1 15, 126, 135, 141 , 152, 161 , 167, 178, 187, 193, 204, 213, 219, 230, 239, 245, and 256; a VH CDR1 (SEQ ID NOS:1 , 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, 70, 79, 85, 90, 91 , 96, 105, 1 1 1 , 1 16,
  • VH CDR2 SEQ ID NOS:2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71 , 76, 80, 86, 92, 97, 102, 106, 1 12,
  • VL CDR1 SEQ ID NOS:4, 10, 16, 21 , 30, 36, 42, 47, 56, 62, 68, 73, 82, 88, 94, 99, 108, 1 14, 120, 125, 134, 140, 146, 151 , 160, 166, 172, 177, 186, 192, 198, 203, 212, 218, 224, 229, 238, 244, 250, and 255) and a VL CDR3 (SEQ ID NOS:6, 17, 23, 32, 43, 49, 58, 69, 75, 84, 95, 101 , 1 10, 121 , 127, 136, 147, 153, 162, 173,
  • VH CDR1 SEQ ID NOS:1 , 7, 12, 13, 18, 27, 33, 38, 39,
  • VL CDR2 (SEQ ID NOS:5, 1 1 , 22, 31 , 37, 48, 57, 63, 74, 83, 89, 100, 109, 1 15, 126, 135, 141 , 152, 161 , 167, 178, 187, 193, 204,
  • VL CDR3 (SEQ ID NOS:6, 17, 23, 32, 43,
  • VH CDR1 SEQ ID NOS:1 , 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, 70, 79, 85, 90, 91 , 96, 105, 1 1 1 , 1 16, 1 17, 122, 131 , 137, 142, 143, 148, 157, 163, 168, 169, 174, 183, 189, 194, 195, 200, 209, 215, 220, 221 , 226, 235, 241 , 246, 247, and 252), a VH CDR3 (SEQ ID NOS:3, 9, 15, 20, 29, 35, 41 , 46, 55, 61 , 67, 72, 81 , 87, 93, 98, 107, 1 13, 1 19, 124, 133, 139, 145, 150, 159, 165, 171 , 176, 185, 19
  • VH CDR3 SEQ ID NOS:3, 9, 15, 20, 29, 35, 41 , 46, 55
  • VL CDR1 SEQ ID NOS:4, 10, 16, 21 , 30, 36, 42, 47, 56, 62, 68, 73, 82, 88, 94, 99, 108, 1 14, 120, 125, 134, 140, 146, 151 , 160, 166, 172, 177, 186, 192, 198, 203, 212, 218, 224, 229, 238, 244, 250, and 255) and a VL CDR2 (SEQ ID NOS:5, 1 1 , 22, 31 , 37, 48, 57, 63, 74, 83
  • VH CDR2 SEQ ID NOS:2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71 , 76, 80, 86, 92, 97, 102, 106, 1 12, 1 18, 123, 128, 132, 138, 144, 149, 154, 158, 164, 170, 175, 180, 184, 190, 196, 201 , 206, 210, 216, 222, 227, 232, 236, 242, 248, 253, and 258), a VH CDR3 (SEQ ID NOS:3, 9, 15, 20, 29, 35, 41 , 46, 55, 61 , 67, 72, 81 ,
  • VL CDR3 SEQ ID NOS:6, 17, 23, 32, 43, 49, 58, 69, 75, 84, 95, 101 , 1 10, 121 , 127, 136, 147, 153, 162, 173, 179, 188, 199, 205, 214, 225,
  • VH CDR1 SEQ ID NOS:1 , 7, 12, 13, 18, 27, 33, 38, 39,
  • VH CDR3 (SEQ ID NOS:3, 9, 15, 20, 29, 35,
  • VL CDR1 (SEQ ID NOS:4, 10, 16, 21 , 30, 36, 42, 47, 56, 62, 68, 73, 82, 88, 94, 99,
  • VL CDR2 SEQ ID NOS:5, 1 1 , 22, 31 , 37, 48, 57, 63, 74, 83, 89, 100, 109, 1 15, 126, 135, 141 , 152, 161 , 167, 178, 187,
  • VH CDR1 SEQ ID NOS:1 , 7, 12, 13, 18, 27, 33, 38, 39, 44, 53, 59, 64, 65, 70, 79, 85, 90, 91 , 96, 105, 1 1 1 , 1 16, 1 17, 122, 131 , 137, 142, 143, 148, 157, 163, 168, 169, 174, 183, 189, 194, 195, 200, 209, 215, 220, 221 , 226, 235, 241 , 246, 247, and 252), a VH CDR2 (SEQ ID NOS:2, 8, 14, 19, 24, 28, 34, 40, 45, 50, 54, 60, 66, 71 , 76, 80, 86, 92, 97, 102, 106, 1 12, 1 18, 123, 128, 132, 138, 144, 149, 154, 158, 164, 1
  • VH CDR2 SEQ ID NOS:2, 8, 14, 19, 24, 28, 34, 40, 45
  • VL CDR1 SEQ ID NOS:4, 10, 16, 21 , 30, 36, 42, 47, 56, 62, 68, 73, 82, 88, 94, 99, 108, 1 14, 120, 125, 134, 140, 146, 151 , 160, 166, 172, 177, 186, 192, 198, 203, 212, 218, 224, 229, 238, 244, 250, and 255) and a VL CDR3 (SEQ ID NOS:6, 17, 23, 32, 43, 49, 58, 69, 75, 84, 95
  • VL CDR2 (SEQ ID NOS:5, 1 1 , 22, 31 , 37, 48,

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Obesity (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Oncology (AREA)
  • Endocrinology (AREA)
  • General Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Biotechnology (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Pathology (AREA)
  • Emergency Medicine (AREA)
  • Cardiology (AREA)
PCT/US2015/012731 2014-01-24 2015-01-23 Binding proteins and methods of use thereof Ceased WO2015112886A2 (en)

Priority Applications (25)

Application Number Priority Date Filing Date Title
BR112016017248-5A BR112016017248B1 (pt) 2014-01-24 2015-01-23 Anticorpo, célula hospedeira, composição farmacêutica e uso do anticorpo
CA2937898A CA2937898C (en) 2014-01-24 2015-01-23 Antibodies that bind to beta-klotho and their uses
ES15740600T ES2808340T3 (es) 2014-01-24 2015-01-23 Anticuerpos que se unen al dominio de beta klotho 2 y procedimientos de uso de los mismos
EP20170906.0A EP3738981A1 (en) 2014-01-24 2015-01-23 Antibodies binding beta klotho domain 2 and methods of use thereof
KR1020167022746A KR102489475B1 (ko) 2014-01-24 2015-01-23 결합 단백질 및 그의 사용 방법
CN201580016315.8A CN106662577B (zh) 2014-01-24 2015-01-23 结合蛋白及其使用方法
LTEP15740600.0T LT3097122T (lt) 2014-01-24 2015-01-23 Antikūnai, surišantys beta kloto domeną 2, ir jų panaudojimo būdai
UAA201608576A UA119863C2 (uk) 2014-01-24 2015-01-23 Антитіло або його фрагмент, що зв'язується з бета-клото
RS20200912A RS60593B1 (sr) 2014-01-24 2015-01-23 Antitela koja vezuju domen 2 beta-kloto i postupci za njihovu upotrebu
JP2016548190A JP6837840B2 (ja) 2014-01-24 2015-01-23 結合タンパク質及びその使用方法
HRP20200881TT HRP20200881T1 (hr) 2014-01-24 2015-01-23 Antitijela koja vežu beta-klotho domenu 2 i postupci njihove uporabe
AU2015209131A AU2015209131B2 (en) 2014-01-24 2015-01-23 Binding proteins and methods of use thereof
MYPI2016001386A MY191944A (en) 2014-01-24 2015-01-23 Binding proteins and methods of use thereof
DK15740600.0T DK3097122T3 (da) 2014-01-24 2015-01-23 Antistoffer, der binder beta-klotho-domæne 2, og fremgangsmåder til anvendelse deraf
RU2016130128A RU2701434C2 (ru) 2014-01-24 2015-01-23 Связывающие белки и способы их применения
EP15740600.0A EP3097122B9 (en) 2014-01-24 2015-01-23 Antibodies binding beta klotho domain 2 and methods of use thereof
MX2016009555A MX375032B (es) 2014-01-24 2015-01-23 Proteínas de unión y métodos para utilizarlas.
NZ722377A NZ722377A (en) 2014-01-24 2015-01-23 Binding proteins and methods of use thereof
SG11201606018UA SG11201606018UA (en) 2014-01-24 2015-01-23 Binding proteins and methods of use thereof
SI201531230T SI3097122T1 (sl) 2014-01-24 2015-01-23 Protitelesa, ki se vežejo v domeni beta klotho 2, in metode za njihovo uporabo
PL15740600T PL3097122T3 (pl) 2014-01-24 2015-01-23 Przeciwciała wiążące domenę 2 beta klotho oraz sposoby ich stosowania
ZA2016/05151A ZA201605151B (en) 2014-01-24 2016-07-22 Binding proteins and methods of use thereof
IL246921A IL246921B (en) 2014-01-24 2016-07-24 Binding proteins and methods of use thereof
PH12016501644A PH12016501644B1 (en) 2014-01-24 2016-08-17 Binding proteins and methods of use thereof
CY20201100699T CY1123163T1 (el) 2014-01-24 2020-07-29 Αντισωματα που δεσμευουν beta klotho επικρατεια 2 και μεθοδοι χρησης αυτων

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201461931531P 2014-01-24 2014-01-24
US61/931,531 2014-01-24

Publications (2)

Publication Number Publication Date
WO2015112886A2 true WO2015112886A2 (en) 2015-07-30
WO2015112886A3 WO2015112886A3 (en) 2015-10-01

Family

ID=53678415

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/012731 Ceased WO2015112886A2 (en) 2014-01-24 2015-01-23 Binding proteins and methods of use thereof

Country Status (29)

Country Link
US (5) US9738716B2 (https=)
EP (2) EP3738981A1 (https=)
JP (3) JP6837840B2 (https=)
KR (1) KR102489475B1 (https=)
CN (1) CN106662577B (https=)
AU (1) AU2015209131B2 (https=)
CA (1) CA2937898C (https=)
CL (1) CL2016001868A1 (https=)
CY (1) CY1123163T1 (https=)
DK (1) DK3097122T3 (https=)
ES (1) ES2808340T3 (https=)
HR (1) HRP20200881T1 (https=)
HU (1) HUE050279T2 (https=)
IL (1) IL246921B (https=)
LT (1) LT3097122T (https=)
MX (1) MX375032B (https=)
MY (1) MY191944A (https=)
NZ (1) NZ722377A (https=)
PE (1) PE20170256A1 (https=)
PH (1) PH12016501644B1 (https=)
PL (1) PL3097122T3 (https=)
PT (1) PT3097122T (https=)
RS (1) RS60593B1 (https=)
RU (1) RU2701434C2 (https=)
SG (2) SG10201806108TA (https=)
SI (1) SI3097122T1 (https=)
UA (1) UA119863C2 (https=)
WO (1) WO2015112886A2 (https=)
ZA (1) ZA201605151B (https=)

Cited By (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9273107B2 (en) 2012-12-27 2016-03-01 Ngm Biopharmaceuticals, Inc. Uses and methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US9290557B2 (en) 2012-11-28 2016-03-22 Ngm Biopharmaceuticals, Inc. Compositions comprising variants and fusions of FGF19 polypeptides
US9580483B2 (en) 2011-07-01 2017-02-28 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of diabetes
US9925242B2 (en) 2012-12-27 2018-03-27 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of nonalcoholic steatohepatitis
US9963494B2 (en) 2012-11-28 2018-05-08 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject
EP3331914A1 (en) * 2015-08-03 2018-06-13 Novartis AG Methods of treating fgf21-associated disorders
WO2018146594A1 (en) * 2017-02-08 2018-08-16 Novartis Ag Fgf21 mimetic antibodies and uses thereof
US10093735B2 (en) 2014-01-24 2018-10-09 Ngm Biopharmaceuticals, Inc. Beta-klotho binding proteins
WO2019057820A1 (en) * 2017-09-20 2019-03-28 Therachon Sas ABNORMAL VISCERAL GREASE DEPOSITION TREATMENT USING SOLUBLE FIBROBLAST GROWTH FACTOR RECEPTOR 3 (SFGFR3) POLYPEPTIDES
US10294289B2 (en) 2016-07-07 2019-05-21 Therachon Sas Soluble fibroblast growth factor receptor 3 (SFGFR3) polypeptides and uses thereof
US10369199B2 (en) 2013-10-28 2019-08-06 Ngm Biopharmaceuticals, Inc. Methods of using variants of FGF19 polypeptides for the treatment of cancer
US10398758B2 (en) 2014-05-28 2019-09-03 Ngm Biopharmaceuticals, Inc. Compositions comprising variants of FGF19 polypeptides and uses thereof for the treatment of hyperglycemic conditions
US10434144B2 (en) 2014-11-07 2019-10-08 Ngm Biopharmaceuticals, Inc. Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders
US10456449B2 (en) 2014-06-16 2019-10-29 Ngm Biopharmaceuticals, Inc. Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US10517929B2 (en) 2014-10-23 2019-12-31 Ngm Biopharmaceuticals, Inc. Pharmaceutical compositions comprising FGF19 variants
WO2020055768A1 (en) 2018-09-10 2020-03-19 Cold Spring Harbor Laboratory Methods for treating pancreatitis
US10724014B2 (en) 2013-01-16 2020-07-28 Institut National De La Sante Et De La Recherche Medicale Soluble fibroblast growth factor receptor 3 (FGR3) polypeptide for use in the prevention or treatment of skeletal growth retardation disorders
US10744185B2 (en) 2015-11-09 2020-08-18 Ngm Biopharmaceuticals, Inc. Methods of using variants of FGF19 polypeptides for the treatment of pruritus
US10800843B2 (en) 2015-07-29 2020-10-13 Ngm Biopharmaceuticals, Inc. Beta klotho-binding proteins
US10870695B2 (en) 2015-08-24 2020-12-22 Glaxosmithkline Intellectual Property (No. 2) Limited Biopharmaceutical compositions comprising interleukin-5 antibody
WO2022003169A1 (en) * 2020-07-02 2022-01-06 Sanofi Fgfr1/klb targeting agonistic antigen-binding proteins and conjugates thereof with glp-1r agonistic peptides
US11370841B2 (en) 2016-08-26 2022-06-28 Ngm Biopharmaceuticals, Inc. Methods of treating fibroblast growth factor 19-mediated cancers and tumors
US20220372168A1 (en) * 2021-05-04 2022-11-24 Regeneron Pharmaceuticals, Inc. Multispecific fgf21 receptor agonists and their uses
WO2023046071A1 (zh) 2021-09-23 2023-03-30 江苏恒瑞医药股份有限公司 抗klb抗体及用途

Families Citing this family (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TWI728373B (zh) 2013-12-23 2021-05-21 美商建南德克公司 抗體及使用方法
JP6308699B2 (ja) 2014-09-08 2018-04-11 国立大学法人大阪大学 脱髄疾患の予防又は治療剤
KR20180056657A (ko) 2015-09-24 2018-05-29 제넨테크, 인크. 뇌전증의 치료를 위한 방법
CN109608544B (zh) * 2015-11-17 2022-09-16 苏州盛迪亚生物医药有限公司 Pd-l1抗体、其抗原结合片段及其医药用途
US12534502B2 (en) * 2016-10-04 2026-01-27 Svar Life Science Ab FGF21 responsive reporter gene cell line
KR20200123754A (ko) * 2019-04-22 2020-10-30 연세대학교 산학협력단 클로토 단백질 또는 이를 암호화하는 유전자를 유효성분으로 포함하는 조성물
CN110616195B (zh) * 2019-10-11 2021-05-04 江南大学 一株二甲双胍单克隆抗体杂交瘤细胞株及其应用
US11891615B2 (en) 2020-06-10 2024-02-06 Gail Marion Humble Process to produce Klotho protein in vitro
US20230346966A1 (en) * 2020-07-23 2023-11-02 Dyne Therapeutics, Inc. Muscle-targeting complexes and uses thereof in treating muscle atrophy
KR20230044242A (ko) * 2020-07-23 2023-04-03 다인 세라퓨틱스, 인크. 근육 표적화 복합체 및 디스트로핀병증을 치료하기 위한 그의 용도
CN113444730A (zh) * 2021-03-17 2021-09-28 昆明市延安医院 一种原发性肝细胞klotho基因转导干细胞筛选构建方法
EP4363454A4 (en) * 2021-06-30 2026-01-07 Univ Texas POLYPEPTIDES TARGETING CD70 POSITIVE CANCERS
EP4458852A4 (en) * 2021-12-30 2026-04-15 Shanghai Jmt Bio Tech Co Ltd ANTI-KLOTHO ANTIBODY AND ITS USE
CN115197300B (zh) * 2022-05-17 2023-05-05 四川大学华西第二医院 一种对rna具有非序列特异性且高度亲和力的蛋白及其应用
CN118406147B (zh) * 2022-08-02 2025-04-08 东莞市朋志生物科技有限公司 抗b型尿钠肽抗体或其功能性片段、检测b型尿钠肽的试剂和试剂盒
CN116120442B (zh) * 2023-01-30 2025-10-17 深圳市第三人民医院 一种广谱中和SARS-CoV-2的中和抗体P2-1B1及其应用

Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5739277A (en) 1995-04-14 1998-04-14 Genentech Inc. Altered polypeptides with increased half-life
US5827690A (en) 1993-12-20 1998-10-27 Genzyme Transgenics Corporatiion Transgenic production of antibodies in milk
US20040005709A1 (en) 2001-10-24 2004-01-08 Hoogenboom Henricus Renerus Jacobus Mattheus Hybridization control of sequence variation
WO2005044853A2 (en) 2003-11-01 2005-05-19 Genentech, Inc. Anti-vegf antibodies
US6989250B2 (en) 1997-01-24 2006-01-24 Bioinvent International Ab Method for in vitro molecular evolution of protein function
US20110135657A1 (en) 2009-12-07 2011-06-09 Amgen Inc. Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof
US7985840B2 (en) 2002-06-03 2011-07-26 Genentech, Inc Synthetic antibody phage libraries
US20120328616A1 (en) 2011-06-06 2012-12-27 Amgen Inc. Human antigen binding proteins that bind to a complex comprising beta-klotho and an fgf receptor

Family Cites Families (240)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3720760A (en) 1968-09-06 1973-03-13 Pharmacia Ab Method for determining the presence of reagin-immunoglobulins(reagin-ig)directed against certain allergens,in aqueous samples
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
JPS6023084B2 (ja) 1979-07-11 1985-06-05 味の素株式会社 代用血液
US4640835A (en) 1981-10-30 1987-02-03 Nippon Chemiphar Company, Ltd. Plasminogen activator derivatives
ATE37983T1 (de) 1982-04-22 1988-11-15 Ici Plc Mittel mit verzoegerter freigabe.
NZ207394A (en) 1983-03-08 1987-03-06 Commw Serum Lab Commission Detecting or determining sequence of amino acids
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4496689A (en) 1983-12-27 1985-01-29 Miles Laboratories, Inc. Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer
US5128326A (en) 1984-12-06 1992-07-07 Biomatrix, Inc. Drug delivery systems based on hyaluronans derivatives thereof and their salts and methods of producing same
US4737456A (en) 1985-05-09 1988-04-12 Syntex (U.S.A.) Inc. Reducing interference in ligand-receptor binding assays
DE3675588D1 (de) 1985-06-19 1990-12-20 Ajinomoto Kk Haemoglobin, das an ein poly(alkenylenoxid) gebunden ist.
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US4791192A (en) 1986-06-26 1988-12-13 Takeda Chemical Industries, Ltd. Chemically modified protein with polyethyleneglycol
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
IL85035A0 (en) 1987-01-08 1988-06-30 Int Genetic Eng Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same
WO1988007089A1 (en) 1987-03-18 1988-09-22 Medical Research Council Altered antibodies
ATE243754T1 (de) 1987-05-21 2003-07-15 Micromet Ag Multifunktionelle proteine mit vorbestimmter zielsetzung
US5258498A (en) 1987-05-21 1993-11-02 Creative Biomolecules, Inc. Polypeptide linkers for production of biosynthetic proteins
US5336603A (en) 1987-10-02 1994-08-09 Genentech, Inc. CD4 adheson variants
KR900005995A (ko) 1988-10-31 1990-05-07 우메모또 요시마사 변형 인터류킨-2 및 그의 제조방법
EP0394827A1 (en) 1989-04-26 1990-10-31 F. Hoffmann-La Roche Ag Chimaeric CD4-immunoglobulin polypeptides
US5112946A (en) 1989-07-06 1992-05-12 Repligen Corporation Modified pf4 compositions and methods of use
WO1991005548A1 (en) 1989-10-10 1991-05-02 Pitman-Moore, Inc. Sustained release composition for macromolecular proteins
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
WO1991006570A1 (en) 1989-10-25 1991-05-16 The University Of Melbourne HYBRID Fc RECEPTOR MOLECULES
WO1991006287A1 (en) 1989-11-06 1991-05-16 Enzytech, Inc. Protein microspheres and methods of using them
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5349053A (en) 1990-06-01 1994-09-20 Protein Design Labs, Inc. Chimeric ligand/immunoglobulin molecules and their uses
CA2405246A1 (en) 1990-12-03 1992-06-11 Genentech, Inc. Enrichment method for variant proteins with alterred binding properties
DE69123241T2 (de) 1990-12-14 1997-04-17 Cell Genesys Inc Chimärische ketten zur transduktion von rezeptorverbundenen signalwegen
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
EP1400536A1 (en) 1991-06-14 2004-03-24 Genentech Inc. Method for making humanized antibodies
US6800738B1 (en) 1991-06-14 2004-10-05 Genentech, Inc. Method for making humanized antibodies
WO1994004679A1 (en) 1991-06-14 1994-03-03 Genentech, Inc. Method for making humanized antibodies
US5844095A (en) 1991-06-27 1998-12-01 Bristol-Myers Squibb Company CTLA4 Ig fusion proteins
AU665025B2 (en) 1991-09-23 1995-12-14 Cambridge Antibody Technology Limited Production of chimeric antibodies - a combinatorial approach
FI941572L (fi) 1991-10-07 1994-05-27 Oncologix Inc Anti-erbB-2-monoklonaalisten vasta-aineiden yhdistelmä ja käyttömenetelmä
NL9101953A (nl) 1991-11-21 1993-06-16 Seed Capital Investments Testinrichting omvattende een plaat met een veelvoud van putjes met een bijbehorende doseerinrichting, alsmede een kit die deze inrichtingen omvat en toepassing van de inrichtingen.
DE69232137T2 (de) 1991-11-25 2002-05-29 Enzon Inc Multivalente antigen-bindende proteine
US5869619A (en) 1991-12-13 1999-02-09 Xoma Corporation Modified antibody variable domains
EP1291360A1 (en) 1991-12-13 2003-03-12 Xoma Corporation Methods and materials for preparation of modified antibody variable domains and therapeutic uses thereof
US5622929A (en) 1992-01-23 1997-04-22 Bristol-Myers Squibb Company Thioether conjugates
AU675929B2 (en) 1992-02-06 1997-02-27 Curis, Inc. Biosynthetic binding protein for cancer marker
US5912015A (en) 1992-03-12 1999-06-15 Alkermes Controlled Therapeutics, Inc. Modulated release from biocompatible polymers
US5447851B1 (en) 1992-04-02 1999-07-06 Univ Texas System Board Of Dna encoding a chimeric polypeptide comprising the extracellular domain of tnf receptor fused to igg vectors and host cells
GB9225453D0 (en) 1992-12-04 1993-01-27 Medical Res Council Binding proteins
ATE199392T1 (de) 1992-12-04 2001-03-15 Medical Res Council Multivalente und multispezifische bindungsproteine, deren herstellung und verwendung
US5605793A (en) 1994-02-17 1997-02-25 Affymax Technologies N.V. Methods for in vitro recombination
US5834252A (en) 1995-04-18 1998-11-10 Glaxo Group Limited End-complementary polymerase reaction
US5837458A (en) 1994-02-17 1998-11-17 Maxygen, Inc. Methods and compositions for cellular and metabolic engineering
GB9415379D0 (en) 1994-07-29 1994-09-21 Smithkline Beecham Plc Novel compounds
JPH10503371A (ja) 1994-07-29 1998-03-31 スミスクライン・ビーチャム・パブリック・リミテッド・カンパニー 新規化合物
EP0805678B1 (en) 1995-01-05 2003-10-29 THE BOARD OF REGENTS acting for and on behalf of THE UNIVERSITY OF MICHIGAN Surface-modified nanoparticles and method of making and using same
EP1323346B1 (en) 1995-01-17 2006-06-28 The Brigham And Women's Hospital, Inc. Receptor specific transepithelial transport of immunogens
US6030613A (en) 1995-01-17 2000-02-29 The Brigham And Women's Hospital, Inc. Receptor specific transepithelial transport of therapeutics
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
EP0850051A2 (en) 1995-08-31 1998-07-01 Alkermes Controlled Therapeutics, Inc. Composition for sustained release of an agent
US5723125A (en) 1995-12-28 1998-03-03 Tanox Biosystems, Inc. Hybrid with interferon-alpha and an immunoglobulin Fc linked through a non-immunogenic peptide
AU5711196A (en) 1996-03-14 1997-10-01 Human Genome Sciences, Inc. Apoptosis inducing molecule i
JP4046354B2 (ja) 1996-03-18 2008-02-13 ボード オブ リージェンツ,ザ ユニバーシティ オブ テキサス システム 増大した半減期を有する免疫グロブリン様ドメイン
WO1997034911A1 (en) 1996-03-22 1997-09-25 Human Genome Sciences, Inc. Apoptosis inducing molecule ii
WO1998029544A1 (en) 1996-12-26 1998-07-09 Kyowa Hakko Kogyo Co., Ltd. Novel peptide, novel dna, and novel antibody
US20060246540A1 (en) 1997-08-26 2006-11-02 Ashkenazi Avi J Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20020012961A1 (en) 1999-04-15 2002-01-31 Genentech, Inc. Fibroblast growth factor- 19
US20020042367A1 (en) 1997-11-25 2002-04-11 Genentech, Inc. Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity and related disorders
US20030054400A1 (en) 1997-09-17 2003-03-20 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030113718A1 (en) 1997-09-17 2003-06-19 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
NZ503343A (en) 1997-09-17 2002-09-27 Genentech Inc Secreted and transmembrane polypeptides and use to induce apoptosis of tumour cells
US6806352B2 (en) 1997-09-17 2004-10-19 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US5989463A (en) 1997-09-24 1999-11-23 Alkermes Controlled Therapeutics, Inc. Methods for fabricating polymer-based controlled release devices
SE512663C2 (sv) 1997-10-23 2000-04-17 Biogram Ab Inkapslingsförfarande för aktiv substans i en bionedbrytbar polymer
AU753157B2 (en) 1997-11-03 2002-10-10 Georgetown University Medical Center VEGI, an inhibitor of angiogenesis and tumor growth
US20040126852A1 (en) 1997-11-25 2004-07-01 Genentech, Inc. Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity
US20050026832A1 (en) 1997-11-25 2005-02-03 Genentech, Inc. Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity and related disorders
US20020155543A1 (en) 1997-11-25 2002-10-24 Genentech, Inc. Fibroblast growth factor-19 (FGF-19) nucleic acids and polypeptides and methods of use for the treatment of obesity and related disorders
ES2292236T3 (es) 1998-04-02 2008-03-01 Genentech, Inc. Variantes de anticuerpos y sus fragmentos.
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
US7183387B1 (en) 1999-01-15 2007-02-27 Genentech, Inc. Polypeptide variants with altered effector function
HU230769B1 (hu) 1999-01-15 2018-03-28 Genentech Inc. Módosított effektor-funkciójú polipeptid-változatok
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
AU3924300A (en) 1999-04-02 2000-10-23 Millennium Pharmaceuticals, Inc. Fibroblast growth factor-20
US7390879B2 (en) 1999-06-15 2008-06-24 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US7129072B1 (en) 1999-08-30 2006-10-31 New York University Crystal of fibroblast growth factor receptor 1 in complex with fibroblast growth factor
JP2001072607A (ja) 1999-09-03 2001-03-21 Kyowa Hakko Kogyo Co Ltd 新規血管内皮機能改善法
US7459540B1 (en) 1999-09-07 2008-12-02 Amgen Inc. Fibroblast growth factor-like polypeptides
WO2001018209A1 (en) 1999-09-10 2001-03-15 Curagen Corporation Fibroblast growth factor polypeptide and nucleic acids encoding same
US6797695B1 (en) 1999-10-22 2004-09-28 Kyoto University Human FGF-20 gene and gene expression products
WO2001036640A2 (en) 1999-11-18 2001-05-25 Chiron Corporation Human fgf-21 gene and gene expression products
US6716626B1 (en) 1999-11-18 2004-04-06 Chiron Corporation Human FGF-21 nucleic acids
AU1415501A (en) 1999-11-19 2001-06-04 Kyowa Hakko Kogyo Co. Ltd. Novel polypeptide, novel dna, novel anitbody and novel transgenic animal
DE10160151A1 (de) 2001-01-09 2003-06-26 Ribopharma Ag Verfahren zur Hemmung der Expression eines vorgegebenen Zielgens
US20010044525A1 (en) 2000-01-05 2001-11-22 Conklin Darrell C. Novel FGF Homolog zFGF12
WO2001049740A1 (en) 2000-01-05 2001-07-12 Zymogenetics, Inc. Novel fgf homolog zfgf12
AU2631001A (en) 2000-01-05 2001-07-16 Zymogenetics Inc. Novel fgf homolog zfgf11
US20020081663A1 (en) 2000-01-05 2002-06-27 Conklin Darrell C. Novel FGF homolog ZFGF11
US20060160181A1 (en) 2000-02-15 2006-07-20 Amgen Inc. Fibroblast Growth Factor-23 molecules and uses thereof
CA2398603A1 (en) 2000-02-15 2001-08-23 Amgen, Inc. Fibroblast growth factor-23 molecules and uses thereof
US20030180312A1 (en) 2000-02-22 2003-09-25 Genentech, Inc. Secreted and transmembrane polypeptides and nucleic acids encoding the same
US20030105302A1 (en) 2000-03-08 2003-06-05 Nobuyuki Itoh Human FGF-23 gene and gene expression products
AU2001249125A1 (en) 2000-03-08 2001-09-17 Chiron Corporation Human fgf-23 gene and gene expression products
AU5056501A (en) 2000-03-31 2001-10-08 Nobuyuki Itoh Fibroblast growth factor-like molecules and uses thereof
US20030065140A1 (en) 2000-04-03 2003-04-03 Vernet Corine A.M. Novel proteins and nucleic acids encoding same
JP2002112772A (ja) 2000-07-10 2002-04-16 Takeda Chem Ind Ltd 新規ポリペプチドおよびそのdna
ES2340662T3 (es) 2000-07-19 2010-06-08 Advanced Research And Technology Institute Factor de crecimiento de fibroblastos (fgf23) nuevo procedimiento para el uso.
CA2416538A1 (en) 2000-07-20 2002-01-31 Genentech, Inc. Compositions and methods for the diagnosis and treatment of disorders involving angiogenesis
US6812339B1 (en) 2000-09-08 2004-11-02 Applera Corporation Polymorphisms in known genes associated with human disease, methods of detection and uses thereof
US20070037165A1 (en) 2000-09-08 2007-02-15 Applera Corporation Polymorphisms in known genes associated with human disease, methods of detection and uses thereof
US7265210B2 (en) 2000-09-15 2007-09-04 Genentech, Inc. Anti-PRO9821 antibodies
EP1197755A1 (en) 2000-10-11 2002-04-17 Pepscan Systems B.V. Identification of protein binding sites
US7537902B2 (en) 2000-10-24 2009-05-26 Emory University Methods and kits using a molecular interaction between a Smurf-1 WW domain and LIM mineralization protein isoforms
IL139380A0 (en) 2000-10-31 2001-11-25 Prochon Biotech Ltd Active variants of fibroblast growth factor
US20030045489A1 (en) 2000-11-22 2003-03-06 Murphy John E. Methods for modulating angiogenesis
US20020151496A1 (en) 2000-12-08 2002-10-17 Bringmann Peter W. Novel fibroblast growth factors
DE10100587C1 (de) 2001-01-09 2002-11-21 Ribopharma Ag Verfahren zur Hemmung der Expression eines Zielgens
DE10100588A1 (de) 2001-01-09 2002-07-18 Ribopharma Ag Verfahren zur Hemmung der Expression eines Zielgens
US7164007B2 (en) 2001-06-20 2007-01-16 Genentech, Inc. Anti-PR020044 antibodies
DK1438400T3 (da) 2001-10-01 2009-10-05 Dyax Corp Flerkædede eukaryote display-vektorer og anvendelser deraf
US20050107475A1 (en) 2002-03-21 2005-05-19 Jones Stacey A. Methods of using farnesoid x receptor (frx) agonists
US6987121B2 (en) 2002-04-25 2006-01-17 Smithkline Beecham Corporation Compositions and methods for hepatoprotection and treatment of cholestasis
JP2003334088A (ja) 2002-05-22 2003-11-25 Pharma Design Inc ヒト由来の新規Klotho様タンパク質及びその遺伝子
MXPA04012243A (es) 2002-06-07 2005-02-25 Genentech Inc Composiciones y metodos para l diagnostico y tratamiento de tumores.
EP1545584A4 (en) 2002-09-18 2007-04-04 Lilly Co Eli METHOD FOR REDUCING MORBIDITY AND MORTALITY OF CRITICAL SICK PATIENTS
WO2004063355A2 (en) 2003-01-10 2004-07-29 Protein Design Labs, Inc. Novel methods of diagnosis of metastatic cancer, compositions and methods of screening for modulators of matastatic cancer
JP2006240990A (ja) * 2003-05-15 2006-09-14 Kirin Brewery Co Ltd klothoタンパク質および抗klothoタンパク質抗体ならびにそれらの用途
US20070253966A1 (en) 2003-06-12 2007-11-01 Eli Lilly And Company Fusion Proteins
CN1890371A (zh) 2003-12-10 2007-01-03 伊莱利利公司 成纤维细胞生长因子的21突变蛋白
SI1751184T1 (sl) 2004-05-13 2010-01-29 Lilly Co Eli Fgf-21 fuzijski proteini
JP2006016323A (ja) 2004-06-30 2006-01-19 Hiroshima Industrial Promotion Organization 生理活性バイオマテリアル
EA011390B1 (ru) 2004-09-02 2009-02-27 Эли Лилли Энд Компани Мутантные белки (мутеины) фактора роста фибробластов 21
WO2006028714A1 (en) 2004-09-02 2006-03-16 Eli Lilly And Company Muteins of fibroblast growth factor 21
CA2584297A1 (en) 2004-10-29 2006-05-11 Genentech, Inc. Disruptions of genes encoding secreted proteins, compositions and methods relating thereto
EP1815021A2 (en) 2004-11-03 2007-08-08 Almac Diagnostics Limited Transcriptome microarray technology and methods of using the same
JP2006158339A (ja) 2004-12-09 2006-06-22 Kyoto Univ βKlotho遺伝子、Cyp7a1遺伝子、及びそれらの利用
US7655627B2 (en) 2004-12-14 2010-02-02 Eli Lilly And Company Muteins of fibroblast growth factor 21
US20060275794A1 (en) 2005-03-07 2006-12-07 Invitrogen Corporation Collections of matched biological reagents and methods for identifying matched reagents
EP1910542B1 (en) 2005-07-22 2009-12-02 Five Prime Therapeutics, Inc. Compositions and methods of treating disease with fgfr fusion proteins
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
EP1929043A4 (en) 2005-08-24 2009-10-28 Genizon Biosciences Inc GENETIC CARD OF HUMAN GENES ASSOCIATED WITH CROHN'S DISEASE
US20090312265A1 (en) 2006-02-10 2009-12-17 Dermagen Ab Novel antimicrobial peptides and use thereof
US8168169B2 (en) 2006-08-09 2012-05-01 Mclean Hospital Corporation Methods and compositions for the treatment of medical disorders
CA2661332A1 (en) 2006-09-01 2008-03-13 American Type Culture Collection Compositions and methods for diagnosis and treatment of type 2 diabetes
WO2008052796A1 (en) 2006-11-03 2008-05-08 U3 Pharma Gmbh Fgfr4 antibodies
EP2115125B1 (en) 2007-01-03 2016-09-07 NeoStem Oncology, LLC Stem cell growth media and methods of making and using same
CA2682147C (en) 2007-03-30 2017-08-08 Ambrx, Inc. Modified fgf-21 polypeptides and their uses
SI2550972T1 (en) 2007-04-02 2018-05-31 Genentech, Inc. A Klotho-beta agonist antibody for use in the treatment of diabetes mellitus or insulin resistance
WO2008123625A1 (ja) 2007-04-06 2008-10-16 National Institute Of Advanced Industrial Science And Technology 補助因子による受容体の活性化方法並びにリガンド活性の利用方法
US7537903B2 (en) * 2007-04-23 2009-05-26 Board Of Regents, The University Of Texas System FGF21 upregulates expression of GLUT-1 in a βklotho-dependent manner
US10555963B2 (en) 2007-05-08 2020-02-11 Tel Hashomer Medical Research Infrastructure And Services Ltd. Klotho protein and related compounds for the treatment and diagnosis of cancer
US20100330062A1 (en) 2007-05-08 2010-12-30 Koeffler H Phillip Klotho protein and related compounds for the treatment and diagnosis of cancer
EP2036539A1 (en) 2007-09-11 2009-03-18 Novo Nordisk A/S Stable formulations of amylin and its analogues
US20120142546A1 (en) 2007-12-10 2012-06-07 The Johns Hopkins University Hypomethylated genes in cancer
EP2080812A1 (en) 2008-01-18 2009-07-22 Transmedi SA Compositions and methods of detecting post-stop peptides
US8420088B2 (en) 2008-01-28 2013-04-16 Novartis Ag Methods and compositions using FGF23 fusion polypeptides
TW200936156A (en) 2008-01-28 2009-09-01 Novartis Ag Methods and compositions using Klotho-FGF fusion polypeptides
US20090226459A1 (en) 2008-01-29 2009-09-10 Cold Spring Harbor Laboratory Role of fgf-19 in cancer diagnosis and treatment
NZ602702A (en) 2008-03-19 2014-03-28 Ambrx Inc Modified fgf-21 polypeptides and their uses
US20110015345A1 (en) 2008-03-19 2011-01-20 Ambrx, Inc. Modified FGF-23 Polypeptides and Their Uses
EP2257814B1 (en) 2008-03-21 2012-08-29 Podiceps B.v. Diagnostic of pre-symptomatic metabolic syndrome
EP2296690B1 (en) 2008-06-04 2016-11-30 Amgen, Inc Fgf21 mutants and uses thereof
FR2933702A1 (fr) 2008-07-08 2010-01-15 Sanofi Aventis Antagonistes specifiques du recepteur fgf-r4
WO2010006214A1 (en) 2008-07-09 2010-01-14 Ambrx, Inc. Fgf-21 neutralizing antibodies and their uses
CN102171343B (zh) 2008-08-04 2017-07-14 戊瑞治疗有限公司 Fgfr细胞外结构域酸性区突变蛋白
JP5878757B2 (ja) 2008-10-10 2016-03-08 アムジエン・インコーポレーテツド Fgf21変異体およびその使用
WO2010065439A1 (en) 2008-12-05 2010-06-10 Eli Lilly And Company Variants of fibroblast growth factor 21
WO2010080976A1 (en) 2009-01-09 2010-07-15 Sdg, Inc. (An Ohio Corporation) Insulin therapies for the treatment of diabetes, diabetes related ailments, and/or diseases or conditions other than diabetes or diabetes related ailments
US20100274362A1 (en) 2009-01-15 2010-10-28 Avner Yayon Cartilage particle tissue mixtures optionally combined with a cancellous construct
CA2748314C (en) 2009-02-03 2018-10-02 Amunix Operating Inc. Extended recombinant polypeptides and compositions comprising same
HRP20240135T1 (hr) 2009-05-05 2024-04-12 Amgen Inc. Fgf21 mutanti i njihove upotrebe
EP2427207B1 (en) 2009-05-05 2017-08-16 Amgen, Inc Fgf21 mutants and uses thereof
US8461111B2 (en) 2009-05-20 2013-06-11 Florida State University Research Foundation Fibroblast growth factor mutants having improved functional half-life and methods of their use
US20120076729A1 (en) 2009-06-04 2012-03-29 Novartis Ag Methods of treating cancers
EP2440235A1 (en) 2009-06-11 2012-04-18 Novo Nordisk A/S Glp-1 and fgf21 combinations for treatment of diabetes type 2
WO2011154349A2 (en) 2010-06-08 2011-12-15 Novo Nordisk A/S Fgf21 analogues and derivatives
US8324160B2 (en) 2009-06-17 2012-12-04 Amgen Inc. Chimeric polypeptides and uses thereof
CN101993485B (zh) 2009-08-20 2013-04-17 重庆富进生物医药有限公司 促胰岛素分泌肽类似物同源二聚体及其用途
MX368790B (es) 2009-10-15 2019-10-16 Genentech Inc Factores de crecimiento de fibroblasto quimericos con especificidad de receptor alterada.
US8889621B2 (en) 2009-10-30 2014-11-18 New York University Inhibiting binding of FGF23 to the binary FGFR-Klotho complex for the treatment of hypophosphatemia
SG177025A1 (en) * 2010-06-21 2012-01-30 Agency Science Tech & Res Hepatitis b virus specific antibody and uses thereof
EP2679234A3 (en) 2009-12-02 2014-04-23 Amgen Inc. Binding proteins that bind to human FGFR1C, human beta-klotho and both human FGFR1C and human beta-klotho
US20110312881A1 (en) 2009-12-21 2011-12-22 Amunix, Inc. Bifunctional polypeptide compositions and methods for treatment of metabolic and cardiovascular diseases
EP2460527A1 (en) 2010-01-21 2012-06-06 Sanofi Pharmaceutical composition for treating a metabolic syndrome
US20110195077A1 (en) 2010-01-29 2011-08-11 Novartis Ag Methods and compositions using fgf23 fusion ppolypeptides
CA2796055A1 (en) 2010-04-15 2011-10-20 Amgen Inc. Human fgf receptor and .beta.-klotho binding proteins
CA2796459C (en) 2010-04-16 2016-05-24 Salk Institute For Biological Studies Methods for treating metabolic disorders using fgf-1
EP2595647A1 (en) 2010-07-20 2013-05-29 Novo Nordisk A/S N-terminal modified fgf21 compounds
WO2012031603A2 (en) 2010-09-09 2012-03-15 Danish Medical Consults Aps Airway administration of angiogenesis inhibitors
WO2012040518A2 (en) 2010-09-22 2012-03-29 Amgen Inc. Carrier immunoglobulins and uses thereof
CN102464712A (zh) 2010-11-11 2012-05-23 重庆富进生物医药有限公司 缺失型人成纤维细胞生长因子21变异体及其偶联物
US9023791B2 (en) 2010-11-19 2015-05-05 Novartis Ag Fibroblast growth factor 21 mutations
SG191252A1 (en) 2010-12-22 2013-07-31 Marcadia Biotech Inc Methods for treating metabolic disorders and obesity with gip and glp-1 receptor-active glucagon-based peptides
JP5850435B2 (ja) 2010-12-24 2016-02-03 国立研究開発法人産業技術総合研究所 ヒトfgf19活性の正確で高感度な測定方法ならびにヒトfgf19活性の制御剤
CN103533951B (zh) 2011-04-08 2017-04-19 安姆根有限公司 使用生长分化因子15(gdf‑15)治疗或改善代谢障碍的方法
WO2012140650A2 (en) 2011-04-12 2012-10-18 Hepacore Ltd. Conjugates of carboxy polysaccharides with fibroblast growth factors and variants thereof
MX2013013044A (es) 2011-05-10 2014-02-20 Amgen Inc METODO PARA IDENTIFICAR COMPUESTOS QUE ESPECIFICAMENTE MODULAN LA INTERACCION DE FGFR1 Y ß-KLOTHO.
SI2710035T1 (sl) 2011-05-16 2017-07-31 F. Hoffmann-La Roche Ag Agonisti FGFR1 in tehnike njihove uporabe
KR20140039278A (ko) 2011-06-08 2014-04-01 드노보 바이오파마 (항주) 리미티드 코포레이션 레티노이드 x 수용체 모듈레이터 활성 예측 방법 및 조성물
WO2012177481A2 (en) 2011-06-24 2012-12-27 University Of Miami Fibroblast growth factor receptor inhibition for the treatment of disease
WO2013006486A2 (en) 2011-07-01 2013-01-10 Ngm Biopharmaceuticals, Inc. Compositions, uses and methods for treatment of metabolic disorders and diseases
EP2548570A1 (en) 2011-07-19 2013-01-23 Sanofi Pharmaceutical composition for treating a metabolic syndrome
WO2013027191A1 (en) 2011-08-25 2013-02-28 Novartis Ag Methods and compositions using fgf23 fusion polypeptides
MX2014002260A (es) 2011-08-31 2014-08-18 Amgen Inc Factor de crecimiento de fibroblasto 21 para usar en el tratamiento de diabetes tipo 1.
UY34346A (es) 2011-09-26 2013-04-30 Novartis Ag Proteínas de fusión para tratar trastornos metabólicos
TW201315742A (zh) 2011-09-26 2013-04-16 Novartis Ag 治療代謝病症之雙功能蛋白質
AR087973A1 (es) 2011-10-04 2014-04-30 Lilly Co Eli Variantes del factor 21 del crecimiento de fibroblastos
AU2012335205A1 (en) * 2011-11-11 2014-05-29 Rinat Neuroscience Corp. Antibodies specific for Trop-2 and their uses
US20130183294A1 (en) 2012-01-18 2013-07-18 Genentech, Inc. Methods of using fgf19 modulators
US9475856B2 (en) 2012-03-02 2016-10-25 New York University Chimeric FGF21 proteins with enhanced binding affinity for β-klotho for the treatment of type II diabetes, obesity, and related metabolic disorders
JP2013194049A (ja) 2012-03-23 2013-09-30 Kazuo Todokoro ヒト造血幹細胞を増幅させるための組成物及び方法
AU2013243948A1 (en) 2012-04-02 2014-10-30 Moderna Therapeutics, Inc. Modified polynucleotides for the production of proteins associated with human disease
WO2013156920A1 (en) 2012-04-16 2013-10-24 Tel Hashomer Medical Research Infrastructure And Services Ltd. Klotho variant polypeptides and uses thereof in therapy
KR20150002801A (ko) 2012-05-15 2015-01-07 일라이 릴리 앤드 캄파니 섬유모세포 성장 인자 21 단백질의 치료 용도
US9474785B2 (en) 2012-06-07 2016-10-25 New York University Chimeric fibroblast growth factor 19 proteins and methods of use
US9464126B2 (en) 2012-06-07 2016-10-11 New York University Chimeric fibroblast growth factor 21 proteins and methods of use
US9657075B2 (en) 2012-06-07 2017-05-23 New York University Chimeric fibroblast growth factor 23 proteins and methods of use
TWI513705B (zh) 2012-06-11 2015-12-21 Lilly Co Eli 纖維母細胞生長因子21蛋白質
CA2871656A1 (en) 2012-06-11 2013-12-19 Eli Lilly And Company Fibroblast growth factor 21 variants
SMT202100451T1 (it) 2012-07-11 2021-09-14 Blueprint Medicines Corp Inibitori del recettore di crescita dei fibroblasti
TW201420606A (zh) 2012-08-22 2014-06-01 Lilly Co Eli 同源二聚體蛋白
WO2014037373A1 (en) 2012-09-07 2014-03-13 Sanofi Fusion proteins for treating a metabolic syndrome
HK1214832A1 (zh) 2012-11-28 2016-08-05 恩格姆生物制药公司 用於代謝病症和疾病治療的組合物和方法
US9290557B2 (en) 2012-11-28 2016-03-22 Ngm Biopharmaceuticals, Inc. Compositions comprising variants and fusions of FGF19 polypeptides
MX383664B (es) 2012-12-27 2025-03-14 Ngm Biopharmaceuticals Inc Uso de un péptido para modular la homeostasis de los ácidos biliares o tratamiento de una enfermedad relacionada con los ácidos biliares.
US9273107B2 (en) 2012-12-27 2016-03-01 Ngm Biopharmaceuticals, Inc. Uses and methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US9550820B2 (en) 2013-02-22 2017-01-24 New York University Chimeric fibroblast growth factor 23/fibroblast growth factor 19 proteins and methods of use
WO2014152090A1 (en) 2013-03-14 2014-09-25 Georgetown University Compositions and treatments of metabolic disorders using fgf binding protein 3 and fgf 19
WO2014149699A1 (en) 2013-03-15 2014-09-25 Eli Lilly And Company Bifunctional protein
AU2014340241B2 (en) 2013-10-21 2018-11-01 Salk Institute For Biological Studies Mutated fibroblast growth factor (FGF) 1 and methods of use
WO2015065897A1 (en) 2013-10-28 2015-05-07 Ngm Biopharmaceuticals, Inc. Cancer models and associated methods
TWI728373B (zh) 2013-12-23 2021-05-21 美商建南德克公司 抗體及使用方法
PT3097122T (pt) 2014-01-24 2020-07-21 Ngm Biopharmaceuticals Inc Anticorpos de ligação de domínio 2 de beta klotho e métodos de utilização dos mesmos
US10398758B2 (en) 2014-05-28 2019-09-03 Ngm Biopharmaceuticals, Inc. Compositions comprising variants of FGF19 polypeptides and uses thereof for the treatment of hyperglycemic conditions
WO2015195509A2 (en) 2014-06-16 2015-12-23 Ngm Biopharmaceuticals, Inc. Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
CN114129709A (zh) 2014-10-23 2022-03-04 恩格姆生物制药公司 包含肽变异体的药物组合物及其使用方法
US10434144B2 (en) 2014-11-07 2019-10-08 Ngm Biopharmaceuticals, Inc. Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders
WO2017019957A2 (en) 2015-07-29 2017-02-02 Ngm Biopharmaceuticals, Inc. Binding proteins and methods of use thereof
JP6728352B2 (ja) 2015-11-09 2020-07-22 エヌジーエム バイオファーマシューティカルス,インコーポレーテッド 胆汁酸に関係した障害の治療方法
EP3503882A4 (en) 2016-08-26 2020-07-29 NGM Biopharmaceuticals, Inc. METHOD FOR TREATING FIBROBLAST GROWTH FACTOR-19-MEDIATED CARCINOMAS AND TUMORS
WO2018044778A1 (en) 2016-08-29 2018-03-08 NGM Biopharmaceuticals, Inc Methods for treatment of bile acid-related disorders

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5827690A (en) 1993-12-20 1998-10-27 Genzyme Transgenics Corporatiion Transgenic production of antibodies in milk
US5739277A (en) 1995-04-14 1998-04-14 Genentech Inc. Altered polypeptides with increased half-life
US6989250B2 (en) 1997-01-24 2006-01-24 Bioinvent International Ab Method for in vitro molecular evolution of protein function
US20040005709A1 (en) 2001-10-24 2004-01-08 Hoogenboom Henricus Renerus Jacobus Mattheus Hybridization control of sequence variation
US7985840B2 (en) 2002-06-03 2011-07-26 Genentech, Inc Synthetic antibody phage libraries
WO2005044853A2 (en) 2003-11-01 2005-05-19 Genentech, Inc. Anti-vegf antibodies
US20110135657A1 (en) 2009-12-07 2011-06-09 Amgen Inc. Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof
US20120328616A1 (en) 2011-06-06 2012-12-27 Amgen Inc. Human antigen binding proteins that bind to a complex comprising beta-klotho and an fgf receptor

Non-Patent Citations (45)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Molecular Biology", vol. I, 1989, GREEN PUBLISHING ASSOCIATES, INC. AND JOHN WILEY & SONS, INC, pages: 6.3.1 - 6.3.6,2.10.3
"Physician's Desk Reference", 2014
A. L. LEHNINGER: "Biochemistry", 1975, WORTH PUBLISHERS, pages: 73 - 75
ARMOUR ET AL., EUR. J. IMMUNOL., vol. 29, no. 8, 1999, pages 2613 - 24
BODER ET AL., NAT. BIOTECH., vol. 15, 1997, pages 553 - 57
BOND ET AL., J. MOL. BIOL., vol. 348, 2005, pages 699 - 709
BRADBURYMARKS, J. IMMUNO. METHODS, vol. 290, 2004, pages 29 - 49
CHAO ET AL., NAT. PROTOCOLS, vol. 1, 2006, pages 755 - 768
CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546 - 552
EBERSBACH ET AL., J. MOL. BIOL., vol. 372, 2007, pages 172 - 185
FIEDLER ET AL., BIOCONJUGATE CHEMISTRY, vol. 9, no. 2, 1998, pages 236 - 234
FLANAGAN, N., GENETIC ENGINEERING AND BIOTECHNOLOGY NEWS, vol. 3, no. 2, 2010, pages 25 - 28
GEBAUERSKERRA, CURR. OPIN. CHEM. BIOL., vol. 13, 2009, pages 245 - 255
GRABULOVSKI ET AL., J. BIOL. CHEM., vol. 282, 2007, pages 3196 - 3204
GRIFFITHS ET AL., EMBO J, vol. 12, 1993, pages 725 - 734
HAWKINS ET AL., J. MOL. BIOL., vol. 226, 1992, pages 889 - 896
HO ET AL., J. BIOL. CHEM., vol. 280, 2005, pages 607 - 617
HOOGENBOOM, METHODS. MOL. BIOL., vol. 178, 2002, pages 1 - 37
HOOGENBOOM, NATURE BIOTECHNOL., vol. 23, 2005, pages 1105 - 1116
HUDSONSOURIAU, NATURE MEDICINE, vol. 9, 2003, pages 129 - 134
JONES ET AL., METHODS IN MOLECULAR BIOLOGY, vol. 525, 2009, pages 405 - 423
KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614 - 3619
KOIDEKOIDE, METHODS MOL. BIOL., vol. 352, 2007, pages 95 - 109
KREHENBRINK ET AL., J. MOL. BIOL., vol. 383, 2008, pages 1058 - 1068
KWONG, K.RADER, C., E. ET AL.: "Current protocols in protein science", 2009, article "coli expression and purification of Fab antibody fragments"
LU ET AL., J. BIOL. CHEM., vol. 278, 2003, pages 43496 - 43507
MERRIFIELD, J. AM. CHEM. SOC., vol. 85, 1963, pages 2149 - 2154
MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77 - 82
MOREL ET AL., MOLEC. IMMUNOL., vol. 25, 1988, pages 7 - 15
NATURE BIOTECHNOLOGY, vol. 23, 2005, pages 1105 - 1116
NIXONWOOD, CURR. OPIN. DRUG. DISCOV. DEV., vol. 9, 2006, pages 261 - 268
NYGREN ET AL., FEBS J., vol. 275, 2008, pages 2684 - 2690
PLUCKTHUN ET AL.: "Antibody Engineering: Producing antibodies in Escherichia coli: From PCR to fermentation", 1996, IRL PRESS, pages: 203 - 252
QUIROZSINCLAIR, REVISTA INGENERIA BIOMEDIA, vol. 1 and 2, 2010, pages 39 - 51
SHIELDS ET AL., J. BIOL..CHEM., vol. 276, no. 9, 2001, pages 6591 - 604
SILVERMAN ET AL., BIOTECHNOL., vol. 23, 2005, pages 1556 - 1561
STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 9, 1983, pages 242 - 253
STEWART ET AL.: "Therapeutic Monoclonal Antibodies: From Bench to Clinic", 1969, JOHN WILEY & SONS, INC.
STUMPP ET AL., DRUG. DISCOV. TODAY, vol. 13, 2008, pages 695 - 701
SUCKAU ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 9848 - 9852
TACHIBANATAKEKOSHI: "Antibody Expression and Production", 2011, SPRINGER, article "Production of Antibody Fab Fragments in Escherischia coli"
VAN DE WATER ET AL., CLIN. IMMUNOL. IMMUNOPATHOL., vol. 85, no. 3, 1997, pages 229 - 235
WINTER ET AL., ANN. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455
ZINN-JUSTIN ET AL., BIOCHEMISTRY, vol. 31, 1992, pages 11335 - 11347
ZINN-JUSTIN ET AL., BIOCHEMISTRY, vol. 32, 1993, pages 6884 - 6891

Cited By (68)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9580483B2 (en) 2011-07-01 2017-02-28 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of diabetes
US9670260B2 (en) 2011-07-01 2017-06-06 Ngm Biopharmaceuticals, Inc. Compositions comprising fusion variants of FGF19 polypeptides
US9751924B2 (en) 2011-07-01 2017-09-05 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising fusion variants of FGF19 polypeptides for reducing glucose levels in a subject
US11065302B2 (en) 2011-07-01 2021-07-20 Ngm Biopharmaceuticals, Inc. Compositions comprising fusion variants of FGF19 polypeptides
US10413590B2 (en) 2011-07-01 2019-09-17 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants of FGF19 polypeptides for reducing body mass in a subject
US9963494B2 (en) 2012-11-28 2018-05-08 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject
US9290557B2 (en) 2012-11-28 2016-03-22 Ngm Biopharmaceuticals, Inc. Compositions comprising variants and fusions of FGF19 polypeptides
US11066454B2 (en) 2012-11-28 2021-07-20 Ngm Biopharmaceuticals, Inc. Compositions comprising variants and fusions of FGF19 polypeptides
US10758590B2 (en) 2012-11-28 2020-09-01 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF 19 polypeptides for treating diabetes
US11564972B2 (en) 2012-12-27 2023-01-31 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants of FGF19 polypeptides for treating primary biliary cirrhosis in a subject
US9878009B2 (en) 2012-12-27 2018-01-30 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having error of bile acid synthesis
US9895416B2 (en) 2012-12-27 2018-02-20 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having cholestasis
US9974833B2 (en) 2012-12-27 2018-05-22 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having pregnancy intrahepatic cholestasis
US9925242B2 (en) 2012-12-27 2018-03-27 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of nonalcoholic steatohepatitis
US9889178B2 (en) 2012-12-27 2018-02-13 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having nonalcoholic steatohepatitis
US9878008B2 (en) 2012-12-27 2018-01-30 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having bile acid diarrhea or bile acid malabsorption
US11103554B2 (en) 2012-12-27 2021-08-31 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants of FGF19 polypeptides for reducing bile acid synthesis in a subject having cirrhosis
US9273107B2 (en) 2012-12-27 2016-03-01 Ngm Biopharmaceuticals, Inc. Uses and methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US9889177B2 (en) 2012-12-27 2018-02-13 Ngm Biopharmaceuticals, Inc. Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having primary sclerosing cholangitis
US11702642B2 (en) 2013-01-16 2023-07-18 INSERM (Institut National de la Santé et de la Recherche Médicale) Soluble fibroblast growth factor receptor 3 (FGR3) polypeptide for use in the prevention or treatment of skeletal growth retardation disorders
US10724014B2 (en) 2013-01-16 2020-07-28 Institut National De La Sante Et De La Recherche Medicale Soluble fibroblast growth factor receptor 3 (FGR3) polypeptide for use in the prevention or treatment of skeletal growth retardation disorders
US11814654B2 (en) 2013-01-16 2023-11-14 Institut National De La Sante Et De La Recherche Medicale Soluble fibroblast growth factor receptor 3 (FGR3) polypeptide for use in the prevention or treatment of skeletal growth retardation disorders
US10369199B2 (en) 2013-10-28 2019-08-06 Ngm Biopharmaceuticals, Inc. Methods of using variants of FGF19 polypeptides for the treatment of cancer
US11596676B2 (en) 2014-01-24 2023-03-07 Ngm Biopharmaceuticals, Inc. Methods of treating nonalcoholic steatohepatitis comprising administering an anti-human beta klotho antibody or binding fragment thereof
US12378312B2 (en) 2014-01-24 2025-08-05 Ngm Biopharmaceuticals, Inc. Polynucleotides encoding human beta klotho antibodies or binding fragments thereof and methods of use thereof
US10093735B2 (en) 2014-01-24 2018-10-09 Ngm Biopharmaceuticals, Inc. Beta-klotho binding proteins
US10744191B2 (en) 2014-01-24 2020-08-18 Ngm Biopharmaceuticals, Inc. Beta klotho-binding proteins and methods of use thereof
US10398758B2 (en) 2014-05-28 2019-09-03 Ngm Biopharmaceuticals, Inc. Compositions comprising variants of FGF19 polypeptides and uses thereof for the treatment of hyperglycemic conditions
US10456449B2 (en) 2014-06-16 2019-10-29 Ngm Biopharmaceuticals, Inc. Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US11241481B2 (en) 2014-06-16 2022-02-08 Ngm Biopharmaceuticals, Inc. Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases
US10517929B2 (en) 2014-10-23 2019-12-31 Ngm Biopharmaceuticals, Inc. Pharmaceutical compositions comprising FGF19 variants
US10434144B2 (en) 2014-11-07 2019-10-08 Ngm Biopharmaceuticals, Inc. Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders
US11141460B2 (en) 2014-11-07 2021-10-12 Ngm Biopharmaceuticals, Inc. Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders
US10800843B2 (en) 2015-07-29 2020-10-13 Ngm Biopharmaceuticals, Inc. Beta klotho-binding proteins
US11667708B2 (en) 2015-07-29 2023-06-06 Ngm Biopharmaceuticals, Inc. Anti-human beta klotho antibody or binding fragment thereof and methods of their use
EP3331914A1 (en) * 2015-08-03 2018-06-13 Novartis AG Methods of treating fgf21-associated disorders
US11236159B2 (en) 2015-08-03 2022-02-01 Novartis Ag Methods of treating FGF21-associated disorders
US11802152B2 (en) 2015-08-03 2023-10-31 Novartis Ag Methods of treating FGF21-associated disorders
US12187791B2 (en) 2015-08-24 2025-01-07 Glaxosmithkline Intellectual Property (No.2) Limited Biopharmaceutical compositions
US11459384B2 (en) 2015-08-24 2022-10-04 Glaxosmithkline Intellectual Property (No. 2) Limited Biopharmaceutical compositions
US12187790B2 (en) 2015-08-24 2025-01-07 Glaxosmithkline Intellectual Property (No. 2) Limited Biopharmaceutical compositions
US12187789B2 (en) 2015-08-24 2025-01-07 Glaxosmithkline Intellectual Property (No.2) Limited Biopharmaceutical compositions
US12454571B2 (en) 2015-08-24 2025-10-28 Glaxosmithline Intellectual Property (No. 2) Limited Biopharmaceutical compositions
US10870695B2 (en) 2015-08-24 2020-12-22 Glaxosmithkline Intellectual Property (No. 2) Limited Biopharmaceutical compositions comprising interleukin-5 antibody
US11274148B2 (en) 2015-08-24 2022-03-15 Glaxosmithkline Intellectual Property (No.2) Limited Biopharmaceutical compositions
US11286298B2 (en) 2015-08-24 2022-03-29 Glaxosmithkline Intellectual Property (No. 2) Limited Biopharmaceutical compositions
US11299541B2 (en) 2015-08-24 2022-04-12 Glaxosmithkline Intellectual Property (No.2) Limited Biopharmaceutical compositions
US10744185B2 (en) 2015-11-09 2020-08-18 Ngm Biopharmaceuticals, Inc. Methods of using variants of FGF19 polypeptides for the treatment of pruritus
US10294289B2 (en) 2016-07-07 2019-05-21 Therachon Sas Soluble fibroblast growth factor receptor 3 (SFGFR3) polypeptides and uses thereof
US11697678B2 (en) 2016-07-07 2023-07-11 Pfizer Inc. Soluble fibroblast growth factor receptor 3 (SFGFR3) polypeptides and uses thereof
US11021528B2 (en) 2016-07-07 2021-06-01 INSERM (Institut National de la Santé et de la Recherche Médicale Soluble fibroblast growth factor receptor 3 (SFGFR3) polypeptides and uses thereof
US11370841B2 (en) 2016-08-26 2022-06-28 Ngm Biopharmaceuticals, Inc. Methods of treating fibroblast growth factor 19-mediated cancers and tumors
CN110520443B (zh) * 2017-02-08 2023-07-25 诺华股份有限公司 Fgf21模拟抗体及其用途
CN110520443A (zh) * 2017-02-08 2019-11-29 诺华股份有限公司 Fgf21模拟抗体及其用途
AU2018218557B9 (en) * 2017-02-08 2021-06-24 Novartis Ag FGF21 mimetic antibodies and uses thereof
US11692046B2 (en) 2017-02-08 2023-07-04 Novartis Ag FGF21 mimetic antibodies and uses thereof
JP6991246B2 (ja) 2017-02-08 2022-02-03 ノバルティス アーゲー Fgf21模倣抗体及びその使用
JP2020506728A (ja) * 2017-02-08 2020-03-05 ノバルティス アーゲー Fgf21模倣抗体及びその使用
AU2018218557B2 (en) * 2017-02-08 2021-05-27 Novartis Ag FGF21 mimetic antibodies and uses thereof
US10899844B2 (en) 2017-02-08 2021-01-26 Novartis Ag FGF21 mimetic antibodies and uses thereof
WO2018146594A1 (en) * 2017-02-08 2018-08-16 Novartis Ag Fgf21 mimetic antibodies and uses thereof
WO2019057820A1 (en) * 2017-09-20 2019-03-28 Therachon Sas ABNORMAL VISCERAL GREASE DEPOSITION TREATMENT USING SOLUBLE FIBROBLAST GROWTH FACTOR RECEPTOR 3 (SFGFR3) POLYPEPTIDES
WO2020055768A1 (en) 2018-09-10 2020-03-19 Cold Spring Harbor Laboratory Methods for treating pancreatitis
US12054551B2 (en) 2020-07-02 2024-08-06 Sanofi FGFR1/KLB targeting agonistic antigen-binding proteins and conjugates thereof with GLP-1R agonistic peptides
WO2022003169A1 (en) * 2020-07-02 2022-01-06 Sanofi Fgfr1/klb targeting agonistic antigen-binding proteins and conjugates thereof with glp-1r agonistic peptides
US20220372168A1 (en) * 2021-05-04 2022-11-24 Regeneron Pharmaceuticals, Inc. Multispecific fgf21 receptor agonists and their uses
WO2023046071A1 (zh) 2021-09-23 2023-03-30 江苏恒瑞医药股份有限公司 抗klb抗体及用途
EP4406968A4 (en) * 2021-09-23 2025-03-12 Jiangsu Hengrui Pharmaceuticals Co., Ltd. ANTI-KLB ANTIBODIES AND USES

Also Published As

Publication number Publication date
MX375032B (es) 2025-03-06
CY1123163T1 (el) 2021-10-29
PH12016501644B1 (en) 2021-10-06
CN106662577A (zh) 2017-05-10
LT3097122T (lt) 2020-07-27
HRP20200881T1 (hr) 2020-09-04
JP6837840B2 (ja) 2021-03-10
US11596676B2 (en) 2023-03-07
EP3097122B1 (en) 2020-05-06
JP2017507652A (ja) 2017-03-23
BR112016017248A2 (pt) 2017-10-03
RS60593B1 (sr) 2020-08-31
US20230256070A1 (en) 2023-08-17
EP3097122B9 (en) 2020-11-11
US20150210764A1 (en) 2015-07-30
AU2015209131A1 (en) 2016-08-11
RU2016130128A3 (https=) 2018-09-04
HUE050279T2 (hu) 2020-11-30
ES2808340T9 (es) 2021-03-05
JP2020169173A (ja) 2020-10-15
MY191944A (en) 2022-07-20
IL246921A0 (en) 2016-09-29
RU2701434C2 (ru) 2019-09-26
CA2937898A1 (en) 2015-07-30
ES2808340T3 (es) 2021-02-26
IL246921B (en) 2019-09-26
CL2016001868A1 (es) 2017-07-21
ZA201605151B (en) 2020-12-23
PL3097122T3 (pl) 2020-10-19
PT3097122T (pt) 2020-07-21
MX2016009555A (es) 2016-12-08
SG10201806108TA (en) 2018-08-30
SG11201606018UA (en) 2016-08-30
JP7436571B2 (ja) 2024-02-21
WO2015112886A3 (en) 2015-10-01
NZ722377A (en) 2022-09-30
US10744191B2 (en) 2020-08-18
US20190106490A1 (en) 2019-04-11
CA2937898C (en) 2025-05-06
CN106662577B (zh) 2020-07-21
PH12016501644A1 (en) 2016-11-07
UA119863C2 (uk) 2019-08-27
JP2022153375A (ja) 2022-10-12
US20210030857A1 (en) 2021-02-04
EP3097122A4 (en) 2017-09-20
BR112016017248A8 (pt) 2018-04-17
EP3097122A2 (en) 2016-11-30
AU2015209131B2 (en) 2020-06-25
US12378312B2 (en) 2025-08-05
RU2016130128A (ru) 2018-02-27
SI3097122T1 (sl) 2020-07-31
US9738716B2 (en) 2017-08-22
KR102489475B1 (ko) 2023-01-20
PE20170256A1 (es) 2017-04-22
US10093735B2 (en) 2018-10-09
EP3738981A1 (en) 2020-11-18
KR20160125381A (ko) 2016-10-31
DK3097122T3 (da) 2020-08-10
US20180100014A1 (en) 2018-04-12

Similar Documents

Publication Publication Date Title
US12378312B2 (en) Polynucleotides encoding human beta klotho antibodies or binding fragments thereof and methods of use thereof
US12180289B2 (en) Binding proteins and methods of use thereof
US11667708B2 (en) Anti-human beta klotho antibody or binding fragment thereof and methods of their use
HK40036377A (en) Antibodies binding beta klotho domain 2 and methods of use thereof
HK1229825A1 (en) Antibodies binding beta klotho domain 2 and methods of use thereof
HK1229825B (en) Antibodies binding beta klotho domain 2 and methods of use thereof
BR112016017248B1 (pt) Anticorpo, célula hospedeira, composição farmacêutica e uso do anticorpo

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15740600

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2937898

Country of ref document: CA

Ref document number: 2016548190

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2016/009555

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 246921

Country of ref document: IL

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 001275-2016

Country of ref document: PE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112016017248

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2015209131

Country of ref document: AU

Date of ref document: 20150123

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2015740600

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 12016501644

Country of ref document: PH

Ref document number: 2015740600

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20167022746

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: A201608576

Country of ref document: UA

ENP Entry into the national phase

Ref document number: 2016130128

Country of ref document: RU

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: NC2016/0000995

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 112016017248

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20160725