KR20090071598A - 수용체 결합 단백질(ｒａｐ)-접합체 투여에 의한 간 질환의 치료 - Google Patents

수용체 결합 단백질(ｒａｐ)-접합체 투여에 의한 간 질환의 치료 Download PDF

Info

Publication number
KR20090071598A
KR20090071598A KR1020097007889A KR20097007889A KR20090071598A KR 20090071598 A KR20090071598 A KR 20090071598A KR 1020097007889 A KR1020097007889 A KR 1020097007889A KR 20097007889 A KR20097007889 A KR 20097007889A KR 20090071598 A KR20090071598 A KR 20090071598A
Authority
KR
South Korea
Prior art keywords
rap
variant
glu
leu
liver
Prior art date
Application number
KR1020097007889A
Other languages
English (en)
Inventor
토드 씨 잔켈
크리스토퍼 엠 스타
Original Assignee
랩터 파마슈티컬 인코포레이티드
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from PCT/US2006/036453 external-priority patent/WO2007035716A2/en
Application filed by 랩터 파마슈티컬 인코포레이티드 filed Critical 랩터 파마슈티컬 인코포레이티드
Publication of KR20090071598A publication Critical patent/KR20090071598A/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K33/00—Medicinal preparations containing inorganic active ingredients
    • A61K33/24—Heavy metals; Compounds thereof
    • A61K33/244—Lanthanides; Compounds thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/70—Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7028—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages
    • A61K31/7034—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin
    • A61K31/704—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin attached to a condensed carbocyclic ring system, e.g. sennosides, thiocolchicosides, escin, daunorubicin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/70—Carbohydrates; Sugars; Derivatives thereof
    • A61K31/715—Polysaccharides, i.e. having more than five saccharide radicals attached to each other by glycosidic linkages; Derivatives thereof, e.g. ethers, esters
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K33/00—Medicinal preparations containing inorganic active ingredients
    • A61K33/24—Heavy metals; Compounds thereof
    • A61K33/243—Platinum; Compounds thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/168—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
    • A61N5/00—Radiation therapy
    • A61N5/10—X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
    • A61N5/1001—X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy using radiation sources introduced into or applied onto the body; brachytherapy
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/10—Antimycotics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00—Antiparasitic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A61P35/04—Antineoplastic agents specific for metastasis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Gastroenterology & Hepatology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Oncology (AREA)
  • Biomedical Technology (AREA)
  • Cell Biology (AREA)
  • Inorganic Chemistry (AREA)
  • Communicable Diseases (AREA)
  • Virology (AREA)
  • Mycology (AREA)
  • Biochemistry (AREA)
  • Radiology & Medical Imaging (AREA)
  • Biophysics (AREA)
  • Botany (AREA)
  • Microbiology (AREA)
  • Toxicology (AREA)
  • Genetics & Genomics (AREA)
  • Pathology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Transplantation (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

본 발명은 간으로의 치료 화합물 전달을 향상시키기 위한 수용체 결합 단백질(RAP) 및 이의 단편 및 변이체의 용도에 관한 것이며 활성제에 접합된 RAP 또는 RAP 변이체를 투여함으로써 간 질환 및 병태, 예컨대 간 암종을 치료하기 위한 방법을 제공한다.

Description

수용체 결합 단백질(ＲＡＰ)-접합체 투여에 의한 간 질환의 치료{TREATMENT OF LIVER DISORDERS BY ADMINISTRATION OF RECEPTOR-ASSOCIATED PROTEIN(RAP)-CONJUGATES}
관련 출원의 상호 참조
본 출원은 이전에 출원된 국제 출원 번호 PCT/US06/36453(2006년 9월 18일 출원)을 우선권으로 주장하며, 본원에 참고인용된다.
기술분야
본 발명은 치료제 또는 활성제에 접합된 RAP 폴리펩티드를 투여하는 단계를 포함하는 간 질환 또는 병태의 치료 방법에서 수용체 결합 단백질(RAP; Receptor-associated protein), RAP 단편 및 RAP 변이체의 용도에 관한 것이다.
LRP1은 저밀도 지질단백질 수용체 "LDLR"의 구성원이다. LRP1은, 퓨린에 의해 분해되어 비공유 결합된 2개의 서브유닛 515-(α) kD 및 85-(β) kDa을 생성하는 4525개의 아미노산(600 kDa)의 거대 단백질이다. LRP는 대부분의 조직 유형에서 발현되지만, 주로 간에서 발견된다. 저밀도 지질단백질(LDL) 수용체 패밀리의 다른 구성원은 LDL-R(132 kDa); LRP2(메갈린, gp330); LRP/LRP1 및 LRP1B(600 kDa); VLDL-R(130 kDa); LRP5; LRP6; apoER-2 (LRP-8, 130 kDa); 모자이크 LDL-R (LR11, 250 KDa); 및 기타 구성원, 예컨대 LRP3, LRP6, 및 LRP-7을 포함한다.
LRP1은 다기능 수용체로 생각되고 있다. LDL 수용체에서 발견되는 것과 유사한 결합 반복부가 종래에 비관련된다고 여겨졌던 각종 리간드와의 결합력에 대한 분자 원리이다. 이들은 리간드 락토페린, 수용체 결합 단백질(RAP), 지질단백질 리파아제, apoE, 제VIII 인자, β-아밀로이드 전구체, α-2-마크로글로불린, 트롬보스폰딘 2 MMP-2(기질성 메탈로프로테아제-2), MPP-9-TIMP-1(기질성 메탈로프로테아제-1의 조직 억제제); uPA (유로키나아제 플라스미노겐 활성제):PAI-l (플라스미노겐 활성제 억제제-1):uPAR (uPA 수용체); 및 tPA (조직 플라스미노겐 활성제):PAI-1: uPAR, 슈도모나스 외독소 A, 및 인간 리노바이러스를 포함한다. [Meilinger et al., FEBS Lett, 360:70-74 (1995)] 참조. LRP1은 GenBank 수탁 번호: X 13916 및 스위스프로트(SwissProt) 등록 번호: Q07954를 갖는다. LRP1 유전자/단백질에 대한 대안 명칭은 저밀도 지질단백질 수용체 관련 단백질 1[전구체], LRP, α-2-마크로글로불린 수용체, A2MR, 아포지질단백질 E 수용체, ApoER, CD91, LRP1 또는 A2MR을 포함한다.
수용체 결합 단백질(RAP)인 내질 망상 샤페론 단백질은 대부분의 LDLR 내의 상보적 반복(CR) 서열과 결합한다. RAP는 분비 경로 내에서 LDLR의 폴딩을 보조하고 모든 다른 기존의 리간드가 LDLR에 결합하는 것을 상쇄시킨다(Bu, (2001) Int Rev Cytol 209, 79-116). RAP에 대한 상세한 구조적 정보 부족에도 불구하고, CR 폴딩과 RAP의 결합은 수용체 결합 검정, 열분석기(calorimetry), 및 돌연변이 유발의 조합에 의해 폭넓게 특성화된 바 있다(Andersen, et al., (2001) Biochemistry 40, 15408-15417; Andersen, et al., (2000) J Biol Chem 275, 21017-21024; Migliorini, et al., (2003) J Biol Chem 278, 17986-17992; Neels, et al., (1999) J Biol Chem 274, 31305-31311; Horn, et al., (1997) J Biol Chem 272, 13608-13613)).
RAP는 3개의 상동성이 불충분한 도메인 배열로 이루어져 있다(Obermoeller, et al., (1997) J Biol Chem 272, 10761-10768). 이러한 도메인 각각(d1, d2 및 d3)은 LDLR 엑토도메인 내 즉각 인접한 CR 서열 쌍에 변화하는 친화도를 갖고 결합하는 것으로 제시되었다. 폴딩의 촉진 및 대부분의 다른 리간드(α-2-마크로글로불린 제외)의 결합 억제를 비롯하여, LDLR 상의 전장 RAP의 각 효과는 RAPd3에 의해서만 반복된다. RAPd3은 성숙 유니프로트 P30533의 아미노산 200∼323 및 전구체 유니프로트 P30533의 아미노산 234∼357을 포함한다.
간세포는 간의 동양혈관(sinusoid)의 상피 세포이다. 상기 세포 유형은 총 간 질량의 약 80%를 구성하여, 장기의 기능에 필요한 거대한 혈액 접촉 표면을 제공한다. 간세포는 지질단백질의 대사, 특히 유미입자 잔존물의 제거(1,2,3), 및 다른 순환성 단백질의 간으로의 흡수(2,4,5)에 참여하는 대량의 저밀도 지질단백질 수용체 결합 단백질(LRP1)을 발현한다. 생리학적 역할과 일치하게, LRP1은 상당히 유능한 리간드 수송(trafficking) 수용체이어서, 신속한 내재화 및 재생률의 구성적 엔도시토시스를 진행한다(6). 내재화 이후, LRP1은 단백질을 신속하게 분해시키는 리소좀에 결합 수송물을 전달한다.
간세포 암종(HCC)은 간세포 또는 이의 전구 세포에서 기인한다. HCC는 전세 계 5번째로 흔한 암이고 암 관련 사망 중 3번째로 흔한 원인이며, 미국에서 발생이 증가 추세이다(7,8,9,10,11,12). 발달 중인 간세포 암종의 가능성은 바이러스 감염(B형 및 C형 간염), 알콜 중독, 흡연 및 비만으로 증가한다. 상기 질병에 대한 예후는, 보고된 5년의 중간 생존율이 5% 미만으로 조악하다. 외과 절제술, 이식 및 물리적 절제술이 치료를 위한 제1 선택이지만, 오직 5∼10%의 환자만이 이러한 접근에 적당한 종양을 제시한다. 종양 크기, 간 내 종양 파종(dissemination), 전이, 감소된 장기의 기능 정도 및 높은 재발 정도는 외과 개입의 효능을 한정한다(13). 동맥교류형 화학색전요법(Transartehal chemoembolism; 종양에 혈액 공급을 차단(폐색)하여 화학요법이 종양에 직접 투여하는 절차) 및 간내 화학요법(간 조직으로 화학요법을 직접 도입)은 일부 경우에 도움이 되는 것으로 제시되었지만, 또한 전체적인 반응 속도는 낮았다(14,15). 전신 화학요법, 예컨대 아드리아마이신(아드리아마이신)은 효과적인 화학요법의 전신 독성 및 동일 요법에 대한 종양 세포 내성으로 인해 15∼20%의 반응률을 얻는다(16,17). 간 기능이 이미 저하된 환자에서 대다수의 HCC 케이스가 발생하기 때문에, 일부 간독성을 초래하는 것 중 대부분인 효과적인 화학요법 투여계획은 종종 불충분한 잔존간기능 및 전격성 간부전으로 인한 금기를 나타낸다. 정맥 투여 후 접합된 치료제, 예컨대 90이트륨의 간으로의 표적 전달은 이러한 약물과 관련된 전신 독성을 유의적으로 감소시켜 HCC 치료 동안 환자의 위험을 감소시킬 것이다. 이러한 표적 전달을 제공하는 하나의 방법은 간 특이적 분자, 또는 고 친화도로 간에서 수용체에 결합하는 리간드, 예컨대 RAP를 사 용할 수 있다.
따라서, 간 암종 또는 기타 간 질병을 치료하기 위해서, 고 친화도 리간드를 이용한 간으로의 치료제의 선택성 종양 표적화, 예컨대 간세포 위치로의 화학치료제 또는 기타 제제의 RAP-의존 혈인성 전달에 의해 환자의 위험을 추가로 완화시키는 것이 당업계에 필요한 실정이다.
발명의 개요
본 발명은 간으로의 수송이 향상된 RAP 접합된 활성제의 투여를 통해 피험체에서 간 질환의 치료를 위한 RAP, RAP 단편 및 RAP 변이체의 용도에 관한 것이다.
일 측면에서, 본 발명은 피험체의 간 질환을 치료하는 방법으로서, (a) 서열 번호 1의 수용체 결합 단백질(RAP), RAP 단편, 및 약 1∼5 nM의 LRP1에 대한 RAP의 결합 친화력을 보유하는 RAP 변이체로 이루어진 군에서 선택된 수용체 결합 부분을, (b) 간 질환 치료용 활성제에 부착시킨 것을 포함하는 접합체의 유효량을 상기 피험체에게 투여하는 단계를 포함하는 방법을 제공한다.
RAP 변이체 분자는 전장 인간 RAP의 일부분을 구성할 것이다. 일 구체예에서, RAP 변이체는 서열 번호 1의 N 말단으로부터 적어도 200개, 최대 243개의 아미노산의 결손이 있다. 관련 구체예에서, RAP 단편 또는 변이체는 서열 번호 1의 N 말단으로부터 243개의 아미노산의 결손이 있다. 또다른 구체예에서, RAP 변이체는 C 말단으로부터 최대 11개의 아미노산의 결손이 있고, 서열 번호 1의 C 말단으로부터 4개 이상의 아미노산의 추가 결손이 있을 수 있다. 추가 구체예에서, RAP 변이체는 (a) 71개 이상의 아미노산 길이이고 (b) 아미노산 256∼270을 포함하는 성숙 RAP(서열 번호 1)의 연속 부위를 포함한다. 관련 구체예에서, RAP 변이체는 (a) 71개 이상의 아미노산 길이이고 (b) 아미노산 256∼270을 포함하는 RAP d3(서열 번호 2)의 연속 부위를 포함한다.
일 구체예에서, RAP 변이체는 RAP의 제3 도메인(d3) 내에 돌연변이를 갖는다. RAP d3은 성숙 RAP의 아미노산 200∼323(유니프로트 P30533) (서열 번호 2) 및 전구체 RAP의 아미노산 234∼357(유니프로트 P30533)을 포함한다. 또다른 구체예에서, 폴리펩티드는 성숙 P30533의 RAP 중 적어도 아미노산 1∼143이 결여된 RAP 변이체를 포함하는 것으로 간주된다. 추가의 구체예에서, RAP 변이체는 성숙 RAP의 적어도 아미노산 1∼143 및 아미노산 320∼323이 결여된다. 또다른 구체예에서, 폴리펩티드는 성숙 P30533의 RAP 중 최대 4개의 C 말단 아미노산이 결여된다.
관련 구체예에서, 본 발명은 수용체 결합 부분이, 서열 번호 4와 70% 이상 동일한 50개의 인접 아미노산을 포함하는 약 85개 미만의 아미노산 길이이고, LRP1에 결합하는 환형 RAP 펩티드인 방법을 포함한다. 관련 구체예에서, 환형 RAP 펩티드는 약 1 x 10-8 M 이하 Kd로 LRP1에 결합한다.
또다른 측면에서, 본 발명은 RAP, RAP 단편 또는 RAP 변이체가 돌연변이를 포함하는 방법을 제공한다. 일 구체예에서, 돌연변이는 서열 번호 1의 천연 RAP에 대해 하나 이상의 보존적 치환을 포함한다. 또다른 구체예에서, 돌연변이는 산성 아미노산의 염기성 아미노산으로의 치환이다. 일 구체예에서, 상기 산성 아미노산은 D 및 E로 이루어진 군에서 선택된다. 관련 구체예에서, 상기 염기성 아미노산은 K 및 R로 이루어진 군에서 선택된다.
관련 측면에서, RAP, RAP 단편 또는 RAP 변이체 내 상기 돌연변이는 염기성 아미노산의 산성 아미노산으로의 치환이다. 일 구체예에서, 상기 염기성 아미노산은 K 및 R로 이루어진 군에서 선택된다. 또다른 구체예에서, 상기 산성 아미노산은 D 및 E로 이루어진 군에서 선택된다.
추가의 구체예에서, 상기 돌연변이는 A, C, D, E, G, I, K, L, M, N, P, Q, R, S, T, 및 V로 이루어진 군에서 선택된 아미노산의 F, Y, W, 및 H로 이루어진 군에서 선택된 아미노산으로의 치환이다. 관련 구체예에서, 본 발명에 사용하기 위해 고려되는 RAP 단편 또는 RAP 변이체는 성숙 RAP의 위치 251, 256, 257, 266, 270, 279, 280, 296 또는 305 중 어느 하나에서 돌연변이를 포함한다.
RAP 변이체 단독 이외에, 본 발명은 RAP 도메인 또는 RAP 도메인의 변이체의 소중합체 조합을 포함한다. RAP 코딩 서열은 이전에 정의된 도메인인 3개로 나눠졌다. 각 도메인은 분자량이 대략 10 kD인 대략 100개의 아미노산을 포함한다. 도메인 1 (또는 d1)은 GenBank 수탁 번호 P30533의 성숙 서열 중 아미노산 1∼94로 이루어지고; 도메인 2 (또는 d2)는 아미노산 95∼198로 이루어지고; 도메인 3 (또는 d3)은 아미노산 199∼319로 이루어지며, C 말단의 4개의 아미노산 보유 신호가 결여된다(서열 번호 9).
따라서, 본 발명은 RAP 도메인의 변이체가 RAP d1의 2 이상의 변이체를 포함하고, RAP d2의 2 이상의 변이체를 포함하고, RAP d3의 2 이상의 변이체를 포함하고, RAP d1의 변이체 및 RAP d3의 변이체를 포함하지만 RAP d2가 결여되고, RAP d2 또는 RAP d3의 2 이상의 변이체와 함께 RAP d1의 2 이상의 변이체를 다양한 조합으로 RAP d1 및 d2의 다중 변이체를 포함하거나 또는 다양한 조합으로 RAP d2 및 d3의 다중 변이체를 포함하는 동일한 서열 또는 대안적인 서열의 보존적 반복부를 비롯하여 다양한 조합(예, d1-d3, d1-d3-d3, d1-d1-d3, d1-d1-d3-d3, d1-d3-d1-d3, d1-d3-d1-d3-d1, d3, d1-d2-d1, d2-d2-d3, d3-d2-d3, d2-d3-d2-d3-d2-d3 등)으로 포함하는 폴리펩티드를 포함한다는 것을 고려한다. 다양한 조합은 동일한 CR 함유 단백질 내 상이한 CR 쌍에 결합하거나 또는 상이한 CR 함유 단백질의 CR 쌍에 결합할 수 있는 도메인 3차원 배열 내 도메인을 표시하는 펩티드 링커에 의해 인접되거나 분리될 수 있다.
따라서, 예시적인 구체예에서, 본 발명은 RAP d3의 2개 이상의 변이체를 포함하는 소중합체 조합을 포함하고, 여기서 RAP d3의 변이체는 상기 기술된 바와 같이 환형 RAP 펩티드이다.
본 발명은 또한 진단제 또는 치료제에 접합된 폴리펩티드 수용체 결합 단백질(RAP), RAP 변이체, RAP 단편 또는 변이체의 조합을 포함하는 접합체의 용도를 포함한다. 일 구체예에서, 폴리펩티드 및 진단제 또는 치료제는 링커를 통해 연결된다. 추가 구체예에서, 상기 링커는 펩티드 링커이다.
관련 측면에서, 본 발명은 약학적으로 허용되는 담체, 희석제 또는 부형제에서 진단제 또는 치료제에 접합된 RAP 변이체를 포함하는 약학 조성물의 용도를 제공한다.
또다른 측면에서, 본 발명은 그러한 RAP 변이체 및 RAP 접합체를 치료적으로 포함하는 조성물을 사용할 수 있는 양으로 RAP 변이체 및 접합체를 생성하는 방법을 제공한다. 본 발명은 또한 본 발명의 방법에 유용한 RAP, RAP 단편 및 RAP 변이체를 포함하는 상기 폴리펩티드 중 어느 하나를 코딩하는 핵산을 제공한다. 그러한 핵산을 포함하는 벡터, 그러한 핵산 또는 벡터를 함유하는 숙주 세포, 및 적당한 배양 배지 중에서 숙주 세포를 배양하는 단계 및 상기 숙주 세포 또는 배양 배지로부터 폴리펩티드를 단리시키는 단계를 포함하는 상기 폴리펩티드의 생성 방법을 또한 제공한다.
일 측면에서, 본 발명은 간 손상과 관련된 질병 또는 병태의 치료 방법을 제공하며, 여기서 간 병태 또는 질병은 간암, 간염, 간경변, 진균, 리케치아 또는 기생충 감염, 알콜, 화학적 독소, 및 약물 독성과 관련된 손상, 대사성 간 질병, 특발성 자가면역 간 질병, 담도 폐쇄, 간 지방증, 담즙정체증, 및 간 절제술 후 병태로 이루어진 군에서 선택된다. 일 구체예에서, 간암은 간세포 암종이다.
관련 구체예에서, 간암은 간세포 암종으로 이루어진 군에서 선택되고 활성제 부분은 세포독성 화학요법제이다.
추가 구체예에서, 상기 질환은 간 종양 또는 간 종양 전이이며, 치료제는 화학요법제이다.
일 측면에서, 본 발명은 활성제가 세포독성제인 치료 방법을 제공한다. 일 구체예에서, 세포독성제는 메클로레타민 히드로클로라이드, 시클로포스파미드, 이포스파미드, 클로람부실, 멜팔란, 부설판, 티오테파, 카르무스틴, 로무스틴, 다카르바진 및 스트렙토조신으로 이루어진 군에서 선택된다.
관련 측면에서, 세포독성 세포는 방사성 동위원소이다. 관련 구체예에서, 방사성 동위원소는 131I, 125I, 111In, 90Y, 67Cu, 127Lu, 212Bi, 213Bi, 255Fm, 149Tb, 223Rd1 213Pb, 212Pb, 211At, 89Sr, 153Sm, 166Ho, 225Ac, 186Re, 67Ga, 68Ga 및 99 mTc로 이루어진 군에서 선택되는 것이다.
여전히 추가의 구체예에서, 본 발명의 발명은 치료될 질환이 바이러스에 의해 야기되는 간염이고, 치료제는 항바이러스제인 것을 제공한다.
발명의 상세한 설명
본 발명은 간 수용체 LRP1에 결합하는 RAP 단백질 접합체를 투여하는 단계를 포함하는 간에 화합물을 전달하는 방법에 관한 것이다. RAP 접합체의 내재화는 간 질병 또는 병태를 치료하기 위해 간으로 치료 화합물 또는 기타 활성제를 전달하는 효과적인 수단이다.
A. 정의
달리 정의하지 않는 한, 본원에 사용되는 모든 기법 및 과학적 용어는 본 발명을 포함하여 당업자에게 공통적으로 이해되는 바와 동일한 의미를 갖는다. 하기 참고문헌은 본 발명에 사용된 다수 용어의 일반적인 정의로서 당업자에게 제공된다: Singleton, et al., DICTIONARY OF MICROBIOLOGY AND MOLECULAR BIOLOGY (2d ed. 1994); THE CAMBRIDGE DICTIONARY OF SCIENCE AND TECHNOLOGY (Walker ed., 1988); THE GLOSSARY OF GENETICS, 5TH ED., R. Rieger, et al. (eds.), Springer Verlag (1991); 및 Hale and Marham, THE HARPER COLLINS DICTIONARY OF BIOLOGY (1991).
본원에 인용된 각 공개, 특허 출원, 특허, 및 기타 참고문헌은 본 명세서와 불일치하는 정도로 그 전문이 참고인용된다.
여기서 본 명세서 및 첨부된 청구범위에 사용된 바와 같이 단수 형태의 단어는 본문에서 명확하게 언급하지 않는 한 복수 의미도 포함한다는 것을 유의한다.
본원에 사용된 바와 같이 하기 용어들은 달리 제시되지 않는 한 이들이 속하는 의미를 갖는다.
본원에 사용된 바와 같이 "간 종양 및 간 내 또는 주변에 다른 종양형성"은간 내에 또는 주변에 발달하는 1차 종양 및/또는 전이 둘다 포함한다. 또한 이것은 체내 어딘가로 이동하지만, 화학요법제와 함께 RAP, RAP 단편 또는 RAP 변이체 펩티드 접합체에 반응을 유지하는 간 종양의 전이를 의미할 수도 있다. 그러한 다수 유형의 종양 및 종양형성이 공지되어 있다. 1차 간 종양은 간세포 암종 및 당업계에 공지된 나머지들을 포함한다. 본원에 사용된 바와 같이, 종양 및 종양형성은 간 및 간 조직과 결합될 수 있다. 그러한 종양은 일반적으로 고체 종양이거나, 또는 이들은 간에 편재된 축적물이 있는 종양을 확산시킨다. 본 발명에 따라 치료하기 위한 종양 또는 종양형성은 음성 또는 양성일 수 있고, 화학요법, 방사선 및/또는 기타 치료로 사전에 치료될 수 있다.
용어 "유효량"은 피험체의 건강 상태, 병상, 및 질병에 바람직한 결과를 생성하거나 또는 진단 목적을 위해 충분한 투여량을 의미한다. 바람직한 결과는 수용자의 투여량에서 주관적 또는 객관적인 향상을 포함할 수 있다. "치료적 유효량"이란 건강 상에 의도된 유리한 효과를 생성하는데 효과적인 제제의 양을 말한다.
"소형 유기 분자"란 제약업에 일반적으로 사용되는 그러한 유기 분자와 유사한 크기의 유기 분자를 말한다. 상기 용어는 유기 생물학적 중합체(예, 단백질, 핵산 등)를 배제힌다. 바람직한 소형 유기 분자는 크기가 최대 약 5,000 Da, 최대 약 2,000 Da, 또는 최대 약 1,000 Da의 범위이다.
진단 또는 치료의 "피험체"는 인간 또는 포유류 또는 영장류를 포함한 비인간 동물이다.
"치료"란 예방적 치료 또는 처치 치료 또는 진단 치료를 말한다.
"예방적" 치료는 질병의 징후가 나타나지 않거나 발달 중인 병상의 위험을 감소시키기 위해 초기 징후만이 나타나는 피험체에게 투여되는 치료이다. 본 발명의 접합체 화합물은 병상이 발달하는 가망성을 감소시키거나 발달하는 경우 병상의 중증도를 최소화시키는 예방적 치료로서 제시될 수 있다.
"처치" 치료는 병상의 징후 또는 증상을 감소 또는 제거하기 위해 그러한 징후 또는 증상이 나타나는 피험자에게 투여되는 치료이다. 징후 또는 증상은 생화학적, 세포적, 조직학적, 기능적, 주관적 또는 객관적일 수 있다. 본 발명의 접합체 화합물은 처치 치료 또는 진단으로 제시될 수 있다.
"진단"이란 병상 상태의 존재 또는 성질을 확인하는 것을 의미한다. 진단 방법은 이의 특이성 및 선택성이 다르다. 특정 진단법은 병태의 명확한 진단을 제공하지 않을 수 있지만, 이 방법이 진단을 돕는 긍적적인 조치를 제공하면 충분하다.
"약학 조성물"이란 인간 및 포유동물을 비롯한 피험체 동물에 약학적 용도에 적당한 조성물을 말한다. 약학 조성물은 활성제에 접합된 RAP, RAP 단편 또는 RAP 변이체 폴리펩티드의 약리학적 유효량을 포함하고, 또한 약학적으로 허용되는 담체를 포함한다. 약학 조성물은 활성 성분(들), 및 담체를 구성하는 불활성 성분(들), 및 임의의 둘 이상의 성분들의 조합, 착화 또는 응집, 또는 하나 이상의 성분들의 해리, 또는 하나 이상의 성분들의 기타 유형의 반응 또는 상호작용으로부터 직접적으로 또는 간접적으로 유도되는 임의의 생성물을 포함하는 조성물을 포함한다. 따라서, 본 발명의 약학 조성물은 본 발명의 접합체 화합물과 약학적으로 허용되는 담체를 혼합하여 제조된 임의의 조성물을 포함한다.
"약학적으로 허용되는 담체"란 표준 약학 담체, 완충제, 및 부형제, 예컨대 인산염 완충된 식염 용액, 덱스트로스의 5% 수용액, 및 유화액, 예컨대 유/수 또는 수/유 유화액, 및 각종 유형의 습윤제 및/또는 보조제 중 어느 하나를 말한다. 적당한 약학 담체 및 제형은 문헌[Remington's Pharmaceutical Sciences, 19th Ed. (Mack Publishing Co., Easton, 1995)]에 기술되어 있다. 바람직한 약학 담체는 활성제의 의도된 투여 방식에 따라 다르다. 전형적인 투여 방식은 장내(예, 경구) 또는 비경구(예, 피하, 근육내, 정맥내 또는 복강내 주사; 또는 국소성, 경피성, 또는 경점막 투여)를 포함한다. "약학적으로 허용되는 염"은, 예를 들어 금속 염(나트륨, 칼륨, 마그네슘, 칼슘 등) 및 암모니아 또는 유기 아민의 염을 포함하는 약학 용도를 위한 화합물로 제형될 수 있는 염이다.
본원에 사용된 바와 같이 용어 "단위 제형"이란 인간 및 동물 피험체에 단일단위 투여량으로서 적당한 물리적으로 분리된 단위를 말하며, 각 단위는 약학적으로 허용되는 희석제, 담체 또는 매개체와 결합되어 목적하는 효과를 생성하는데 충분한 양으로 계산된 본 발명의 화합물의 소정량을 포함한다. 본 발명의 신규 단위 제형에 대한 규격은 사용된 특정 접합체 및 실현될 효과, 및 숙주에서 각 화합물과 결합된 약력학에 따라 다르다.
본원에 사용된 "조절하다"란 증가 또는 감소에 의해 바뀌는 능력(예, 길항제 또는 작용제로서 작용함)을 말한다.
본원에 사용된 "증가하는 상대적 전달"이란 RAP, RAP 단편 또는 RAP 변이체 접합된 활성제의 의도한 전달 부위(예, 간)에서의 축적은 비접합된 활성제의 축적과 비례하여 증가되는 효과를 말한다.
"치료 지수"란 최소 치료량 이상 및 비허용 독성량 이하의 투여 범위(양 및/또는 타이밍)를 말한다.
"등가 용량"이란 활성제의 동량을 포함하는 용량을 말한다.
"폴리뉴클레오티드"란 뉴클레오티드 단위로 이루어진 중합체를 말한다. 폴리뉴클레오티드는 데옥시리보핵산 ("DNA") 및 리보핵산 ("RNA") 및 핵산 유사체와 같은 천연 핵산을 포함한다. 핵산 유사체는 비천연 염기를 포함하는 것, 천연 포스포디에스테르 결합 이외의 다른 뉴클레오티드와의 연결에 맞물리거나 또는 포스포디에스테르 결합 이외의 연결을 통해 결합된 염기를 포함하는 뉴클레오티드를 포함한다. 따라서, 뉴클레오티드 유사체는, 비제한적인 예로서, 포스포로티오에이트, 포스포로디티오에이트, 포스포로트리에스테르, 포스포라미데이트, 보라노포스페이트, 메틸포스포네이트, 키랄-메틸 포스포네이트, 2-O-메틸 리보뉴클레오티드, 펩티드-핵산(PNA) 등을 포함한다. 그러한 폴리뉴클레오티드는, 예를 들어 자동화된 DNA 합성기기를 사용하여 합성될 수 있다. 용어 "핵산"이란 전형적으로 거대한 폴리뉴클레오티드를 말한다. 용어 "올리고뉴클레오티드"란 전형적으로 짧은 폴리뉴클레오티드, 일반적으로 약 50 미만의 뉴클레오티드를 말한다. 뉴클레오티드 서열이 DNA 서열(즉, A, T, G, C)로 표시되는 경우, 이는 또한 RNA 서열(즉, A, U, G, C)을 포함하고, 여기서 "U"는 "T"로 대체된다는 것을 이해할 것이다. 단백질 및 RNA를 코딩하는 뉴클레오티드 서열은 인트론을 포함할 수 있다.
"cDNA"란 단일 가닥 또는 이중 가닥 형태로 mRNA와 상보적이거나 동일한 DNA를 말한다.
통상적인 표시법을 본원에 사용하여 폴리뉴클레오티드 서열을 기술한다: 단일 가닥 폴리뉴클레오티드 서열의 왼편 말단은 5' 말단이고; 이중 가닥 폴리뉴클레오티드 서열의 왼편 방향은 5' 방향으로서 언급된다. 발생기의 RNA 전사산물에 5'에서 3' 방향으로 첨가하는 것은 전사 방향으로서 언급된다. mRNA와 동일한 서열을 갖는 DNA 가닥은 "코딩 가닥"으로 언급되고; DNA로부터 전사된 mRNA와 동일한 서열을 갖고 RNA 전사산물의 5' 말단에 대해 5'에 위치하는 DNA 가닥 상의 서열은 "상류 서열"로 언급되고; RNA와 동일한 서열을 갖고 코딩 RNA 전사산물의 3' 말단에 대해 3'인 DNA 가닥 상의 서열은 "하류 서열"로 언급된다.
"상보적인"이란 위상기하학적 적합성 또는 2개의 폴리뉴클레오티드의 상호작용 표면에 함께 일치되는 것을 말한다. 따라서, 2개의 분자는 상보성으로 기술될 수 있고, 또한 접촉면 특성은 서로 상보적이다. 첫번째 폴리뉴클레오티드의 뉴클레오티드 서열이 두번째 폴리뉴클레오티드의 폴리뉴클레오티드 결합 파트너의 뉴클레오티드 서열과 동일한 경우 첫번째 폴리뉴클레오티드는 두번째 폴리뉴클레오티드와 상보적이다. 따라서, 서열이 5'-TATAC-3'인 폴리뉴클레오티드는 서열이 5'-GTATA-3'인 폴리뉴클레오티드와 상보적이다.
서던 또는 노던 블롯에서 필터 상에 100개 이상의 상보적 잔기를 갖는 상보적 아미노산의 하이브리드화를 위한 엄격한 하이브리드 조건의 예는 42℃에서 해파린 1 mg을 갖는 50% 포르말린이고, 하이브리드는 밤새 수행된다. 매우 엄격한 세척 조건의 예는 약 15분 동안 72℃에서 0.15 M NaCl이다. 엄격한 세척 조건의 예는 15분 동안 65℃에서 0.2 X SSC 세척이다(예, SSC 완충제의 기술에 관한 Sambrook 등 참조).
또한 저밀도 지질단백질 수용체 부류 A 도메인(LDL-A, Pfam)으로 공지된 "상보체-반복부" 또는 "CR"은 다른 특징 중 6개의 시스테인 및 산성 아미노산의 클러스터에 의해 규정된 단백질 도메인 패밀리의 구성원이다. 다수의 상보체-반복부는 LDL 수용체형 모듈을 말하는 규정된 구조로 폴딩되는 것을 발견하였다(Structural Classification of 단백질, SCOP). CR 도메인은 LDLR에 속하는 수용체를 비롯하여 다수의 수용체의 리간드 결합 결정자로 구성된다. 모티프 AxcBxCxD(이때, c는 보존 시스테인이고, x는 임의의 아미노산이며, B 및 D는 아스파라진산염, 글루타민산염 또는 아스파라긴임)를 갖는 각 CR 내 선형 서열의 아미노산은 칼슘 결합 및 리간드의 결합에 참여하는 것을 증명하였다. 곧 특정 CR 도메인의 인접쌍은 RAP에 결합하는 것을 증명하였다. RAP 결합 CR 쌍(A, C, A' 및 C)의 2개의 CR 도메인 둘다에서 위치 A 및 C의 아미노산은 RAP 결합에 참여하는 것을 증명하였다.
"재조합 폴리뉴클레오티드"란 자연적으로 함께 결합하지 않은 서열을 갖는 폴리뉴클레오티드를 말한다. 증폭되거나 조립된 재조합 폴리뉴클레오티드는 적당한 벡터에 포함될 수 있고, 상기 벡터를 사용하여 적당한 숙주 세포를 형질변환시킬 수 있다. 재조합 폴리뉴클레오티드를 포함하는 숙주 세포는 "재조합 숙주 세포"로 언급된다. 상기 유전자는 재조합 숙주 세포 내에 발현되어, 예를 들어 "재조합 폴리펩티드"를 생성한다. 재조합 폴리뉴클레오티드는 비코딩 기능을 제공할 수도 있다(예, 프로모터, 복제 기점, 리보솜 결합 부위 등).
"발현 조절 서열"이란 이에 작동적으로 연결된 뉴클레오티드 서열의 발현(전사 및/또는 번역)을 조절하는 폴리뉴클레오티드 내 뉴클레오티드 서열을 말한다. "작동적으로 연결된"이란 한 부분(예, 전사를 조절하는 능력)의 활성이 다른 나머지 부분(예, 서열의 전사) 상에서의 작용을 초래하는 2개의 쌍 사이의 기능적 관계를 말한다. 발현 조절 서열은, 비제한적인 예로서, 프로모터(예, 유도성 또는 구조적), 인핸서, 전사 종결자, 출발 코돈(즉, ATG), 인트론에 대한 접합 신호, 및 종결 코돈 서열을 포함할 수 있다.
"발현 벡터"란 발현될 뉴클레오티드 서열에 작동적으로 연결된 발현 조절 서열을 포함하는 재조합 폴리뉴클레오티드를 포함하는 벡터를 말한다. 발현 벡터는 발현을 위한 충분한 시스-작용 성분을 포함하고; 발현을 위한 다른 성분은 숙주 세포 또는 생체내 발현 시스템에 의해 공급될 수 있다. 발현 벡터는 당업자에게 공지된 모든 것, 예컨대 재조합 폴리뉴클레오티드를 도입하는 코스미드, 플라스미드(예, 노출된 것 또는 리포솜에 함유된 것) 및 바이러스를 포함한다.
"폴리펩티드"란 아미노산 잔기, 펩티드 결합을 통해 연결된 관련 천연 구조적 변이체, 및 이의 합성 비천연 유사체, 관련 천연 구조적 변이체, 및 이의 합성 비천연 유사체로 이루어진 중합체를 말한다. 합성 폴리펩티드는, 예를 들어 자동화된 폴리펩티드 합성기기를 사용하여 합성될 수 있다. 용어 "단백질"이란 전형적으로 거대 폴리펩티드를 말한다. 용어 "펩티드"란 전형적으로 짧은 폴리펩티드를 말한다.
"RAP 변이체"란 α-2-마크로글로불린/저밀도 지질단백질 수용체-관련 단백질-결합 단백질 1(RAP)의 2개 이상의 다형 중 어느 하나를 말한다(유니프로트 등록번호 P30533, Pfam 등록번호 PF06400 및 PF06401). 변이체는 다른 아미노산에 대해 하나 이상의 아미노산의 치환을 수반하는 하나 이상의 돌연변이를 기준으로 이의 아미노산 서열의 조성물과 상이하다. 치환은 치환될 아미노산 및 치환 중인 아미노산의 물리 화학적 또는 작용적 관련성을 기초로 보존적이거나 비보존적일 수 있다.
2 이상의 폴리뉴클레오티드 또는 폴리펩티드 서열에서 용어 "동일한" 또는 "백분율 동일성"이란 하기 서열 비교 알고리즘 중 하나를 사용하거나 시각적 검사에 의해 측정된 바와 같이 최대 대응값과 비교하고 정렬시킬 경우 동일하거나 동일한 뉴클레오티드 또는 아미노산 잔기의 열거된 백분율을 갖는 2 이상의 서열 또는 하위서열을 말한다.
2개의 핵산 또는 폴리펩티드에서 용어 "실질적으로 상동인" 또는 "실질적으로 동일한"이란 일반적으로 하기 서열 비교 알고리즘 중 하나를 사용하거나 시각적 검사에 의해 측정된 바와 같이 최대 대응값과 비교하고 정렬시킬 경우 40%, 60%, 80%, 90%, 95%, 98% 이상의 뉴클레오티드 또는 아미노산 잔기 동일성을 갖는 2 이상의 서열 또는 하위서열을 말한다. 바람직하게는, 실질적인 동일성은 약 50개 이상의 잔기 길이인 서열 영역, 약 100개 이상의 잔기 영역에 존재하고, 가장 바람직하게는 서열은 약 150개 이상의 잔기와 실질적으로 동일하다. 가장 바람직한 구체예에서, 서열은 비교 생물학적 중합체 중 하나 또는 모두의 전체 길이와 실질적으로 동일하다.
서열 비교의 경우, 전형적으로 하나의 서열은 테스트 서열과 비교되는 기준 서열로서 작용한다. 서열 비교 알고리즘을 사용하는 경우, 테스트 및 기준 서열을 컴퓨터에 입력하고, 하위서열 배위결합을 지정하고, 필요한 경우, 서열 알고리즘 프로그램 변수를 지정한다. 서열 비교 알고리즘은 지정된 프로그램 변수를 기준으로 기준 서열과 비교하여 테스트 서열(들)과 동일한 백분율 서열을 계산한다.
비교를 위한 서열의 최상의 정렬은, 예를 들어 문헌[Smith and Waterman, Adv. Appl. Math. 2:482 (1981)]의 국소적 상동성 알고리즘, 문헌[Needleman and Wunsch, J. Mol. Biol. 48:443 (1970)]의 상동성 정렬 알고리즘, 문헌[Pearson and Lipman, Proc. Natl. Acad. Sci. USA 85:2444 (1988)]의 유사 방법에 대한 조사, 이러한 알고리즘의 컴퓨터화된 실행(미국 위스콘신주 매디슨 사이언스 드라이브 575 소재하는 유전학 컴퓨터 그룹, 위스콘신 유전학 소프트웨어 패키지에서의 GAP, BESTFIT, FASTA, 및 TFASTA), 또는 시각적 검사에 의해 실시될 수 있다. 백분율 서열 동일성 및 서열 유사성에 적당한 알고리즘의 또다른 예는 문헌[Altschul et al., J. Mol. Biol. 215:403-410 (1990)]에 기술된 BLAST 알고리즘이다.
"실질적으로 순수한" 또는 "단리된"은 대상 종이 존재하는 우세한 종(즉, 몰 기준 상으로, 조성물 내에 다른 어떤 개별 고분자 종 보다 더욱 풍부함)이고, 실질적으로 정제된 단편은 대상 종이 존재하는 모든 고분자 종의 약 50% 이상(몰 기준)을 포함하는 조성물을 의미한다. 일반적으로, 실질적으로 순수한 조성물은 조성물 내 존재하는 고분자 종의 약 80%∼90% 이상이 해당 정제된 종인 것을 의미한다. 대상 종은, 조성물이 본질적으로 단일 고분자 종으로 이루어진 경우 필수적인 균일성으로 정제(통상적인 검출 방법으로는 조성물에서 오염 종을 검출할 수 없음)된다. 용매 종, 소분자(< 500 달톤), 안정화제(예, BSA), 및 성분 이온 종은 이러한 정의를 위해 고분자 종을 고려하지 않는다. 일부 구체예에서, 본 발명의 접합체는 실질적으로 순수하거나 단리된다. 일부 구체예에서, 본 발명의 방법에 유용한 접합체는 이의 합성에 사용된 고분자 출발 재료와 관련하여 실질적으로 순수하거나 단리된다. 일부 구체예에서, 본 발명의 약학 조성물은 RAP, RAP 단편 또는 RAP 변이체 폴리펩티드 및 하나 이상의 약학적으로 허용되는 부형제와 혼합된 활성제의 실질적으로 정제되거나 단리된 접합체를 포함한다
대상에 적용되는 바와 같이 "천연"이란 대상이 자연계에서 발견될 수 있는 것을 말한다. 예를 들어, (바이러스를 비롯한) 유기체에 존재하고 자연계에서 공급원에서 단리될 수 있으며 실험실에서 인간에 의해 의도적으로 변형될 수 없는 폴리펩티드 또는 폴리뉴클레오티드 서열을 천연이라고 한다.
"링커"란 공유결합, 또는 이온성, 반데르발스 또는 수소 결합, 예컨대 5' 말단에서 하나의 상보 서열에 그리고 3' 말단에서 또다른 상보 서열에 하이브리드화하여 2개의 비상보 서열을 결합하는 핵산 분자를 통해 2개의 다른 분자를 결합하는 분자를 말한다.
B. LDLR
"LDLR"이란 저밀도 지질단백질 수용체 관련 단백질 1(LRP1), LDL-R (132 kDa); LRP2 (메갈린, gp330); LRP/LRP1 및 LRP1 B (600 kDa); VLDL-R (130 kDa); LRP5; LRP6; apoER-2 (LRP-8, 130 kDa); 모자이크 LDL-R (LR11, 250 KDa); 및 기타 구성원, 예컨대 LRP3, LRP6, 및 LRP-7을 포함하는 저밀도 지질단백질 수용체 패밀리의 구성원을 말한다.
패밀리의 특이적 특징은 세포 표면 발현; 세포외 리간드 결합 도메인 반복부(DxSDE); 리간드 결합을 위한 Ca++의 필요 ; RAP 및 apoE의 결합; EGF 전구체 상동성 도메인 반복부(YWTD); 단일 막 경간 영역; 세포질 도메인 내 내재화 신호(FDNPXY); 및 다양한 리간드의 수용체 매개 엔도시토시스를 포함한다. LRP1을 포함하는 패밀리의 일부 구성원은 신호 전달 경로에 참여한다.
LDLR 리간드란 LDLR에 결합하는 것으로 공지된 분자의 구성원을 말한다. 이러한 분자는, 예를 들어 락토페린, RAP, 지질단백질 리파아제, apoE, 제VIII 인자, β-아밀로이드 전구체, α-2-마크로글로불린, 트롬보스폰딘 2 MMP-2(기질성 메탈로프로테아제-2), MPP-9-TIMP-1(기질성 메탈로프로테아제-1의 조직 억제제); uPA(유로키나아제 플라스미노겐 활성제):PAI-1(플라스미노겐 활성제 억제제-1): uPAR(uPA 수용체); 및 tPA(조직 플라스미노겐 활성제): PAI-1: uPAR을 포함한다.
LDLR은 각 수용체의 N 말단 세포외 도메인, 또는 엑토도메인 내 보존된 단백질 도메인을 통해 각종 세포외 리간드와 결합한다. 이러한 도메인은 상보형 반복부(CR, 또는 저밀도 지질단백질 수용체 도메인 부류 A, Idl-a), EGF형 반복부 및 YWTD, 또는 β-프로펠러, 도메인을 포함한다. CR 도메인은 확인된 대부분의 리간드와의 결합에 원인이 된다. CR 서열은 LDL 수용체형 모듈(SCOP 용어)로 언급되는 보존된 폴딩으로 명기된다. 대략 36개의 각 아미노산 CR은 1-3, 2-5, 4-6 배열에서 3개의 분자내 시스테인을 형성하는 6개의 시스테인 및 이열편 고리부 중 하나의 열편 내에 결합된 칼슘 이온을 함유한다.
LRP1에서, 인간 LRP1의 두번째 리간드 결합 도메인은 8개의 연속 CR 단위로 이루어져 있다. 가능한 7개의 인접 CR 쌍 각각은 개별적으로 발현되고 RAPd3과 결합하는지 검정된다(Andersen, et al., (2000) J Biol Chem 275, 21017-21024). 두번째 CR 내 CR 위치에서 비기호성 잔기를 함유하는 마지막 쌍(CR9 및 CR10)을 제외하고, 모든 쌍은 유사한 친화도(1∼5 nM)를 갖고 RAP에 결합한다.
C. RAP 단편 및 RAP 변이체
RAP의 무작위 및 부위 지정 돌연변이 유발은 CR 쌍과 복합체를 형성하는 리간드의 친화도에 불균형을 초래하는 소수의 잔기가 존재할 수 있음을 나타낸다(Migliorini, et al.,(2003) J Biol Chem 278, 17986-17992). 특히, RAPd3 내 위치 256 및 270에서 리신은 LRP1에 상기 도메인이 결합하는데 중요한 것으로 밝혀졌다. 예를 들어, H249T, E251K, K256A 및 K270D (전장 RAP 서열에 기초함)의 돌연변이를 갖는 Mega RAP1로 언급되는 RAPd3 변이체는 LRP1 CR 도메인에 결합하는 것에 실패한다(도 1, 표 2 참조). 또한 각각 위치 205 및 285에 집중된 2개의 별개의 10개의 아미노산 염기성 영역이 중요하다(Melman, et al., (2001) J Biol Chem 276, 29338-29346). 이러한 관찰은 RAP 및 CR 쌍 사이에 대다수의 결합 에너지에 기여하는 한정된 잔기 세트인 "과열점", 즉 다른 단백질-단백질 계면에서 관찰되는 현상이 존재한다는 것과 일치한다(Li, et al, (2005) Structure (Camb) 13, 297-307; Halperin, et al., (2004) Structure (Camb) 12, 1027-1038; Gao, et al.,(2004) J Mol Model (Online) 10, 44-54; Dwyer, et al., (2001) Biochemistry 40, 13491-13500; DeLano, (2002) Curr Opin Struct Biol 12, 14-20; Bogan, et al., (1998) J Mol Biol 280, 1-9; Clackson, et al., (1995) Science 267, 383-386).
RAP 분자는 323개의 아미노산 펩티드(서열 번호 1)인 성숙 RAP를 형성하기 위해 분해되는 35개의 아미노산 신호 서열을 갖는 357개의 아미노산 단백질(서열 번호 6 및 7)로서 초기에 생성된다. 성숙 RAP는 또한 4개의 아미노산 C 말단 내질 망상 보유 신호를 유지한다.
RAP의 어떤 부분이 LRP 결합 및 조절 활성에 중요하며, 어떤 부분들이 결합 활성의 손실 없이 돌연변이화, 변형, 또는 결실될 수 있는지에 대한 실질적인 지침이 당업계에 존재한다(Nielsen et al. Proc. Nat. Acad. Sci. USA 94:7521 (1997); 및 Rail et al. J. Biol. Chem. 273(37):24152, 1998 참조). 예를 들어, RAP의 LRP 결합 기능은 RAP의 중첩 도메인을 표시하는 융합 단백질 상에서 직접 결합 연구를 실행함으로써 맵핑하였다(Willnow et al., J. Biol. Chem. 267(36):26172-80, 1992 참조). RAP 결합 모티프는 또한 절두되고 부위 지정된 RAP 돌연변이체를 특징으로 하였다(Melman et al. J. Biol. Chem. 276(31): 29338-29346, 2001 참조). 본 발명에 따라 사용하기에 적당한 특정 RAP 폴리펩티드 단편은 단편(RAP N 말단 아미노산에서 RAP C 말단 아미노산 위치로 정의됨) 1∼323(RAP); 1∼319; 1∼250; 1∼110; 91∼210; 191∼323; 221∼323; 1∼190; 1∼200; 및 1∼210을 포함한다. 일 측면에서, 본 발명에 사용되는 RAP 단백질은 신호 펩티드가 결여된 성숙 RAP(서열 번호 1)이다. 관련 측면에서, RAP는 N 말단에서 RAP 신호 펩티드, C 말단에서 HNEL 내질 망상 보유 신호가 결여(서열 번호 8)된다. 바람직한 RAP 폴리펩티드는 단편 1∼323(RAP); 1∼319; 191∼323; 및 1∼210, 아미노산 256∼270을 포함하는 RAP의 71개 이상의 연속 아미노산을 갖는 단편, 및 아미노산 256∼270을 포함하는 RAP의 71개 이상의 연속 아미노산을 갖는 RAP 단편을 포함하고 RAP d3의 연속 부위를 포함한다. 서열 KDEL로 치환된 4개의 아미노산 서열 C 말단을 갖는 변형된 RAP 폴리펩티드가 또한 적당하다. C 말단-4개의 아미노산 서열(HNEL)이 결실된 변형된 RAP 폴리펩티드 또한 적당하다. 또한 아미노산 201∼210의 RAP의 천연 서열을 포함하는 RAP 폴리펩티드 단편이 바람직하다.
RAP 변이체는 또한 특정 아미노산 잔기의 보존적 치환을 포함할 수 있다. "보존적" 아미노산 치환은 관련 잔기의 양극성, 전하, 용해성, 소수성, 친수성, 및/또는 양친매성 성질에서 유사성을 기초로 실시된다. 예를 들어, 무극성(소수성) 아미노산은 알라닌(Ala, A), 류신 (Leu, L), 이소류신(lie, I), 발린(Val, V), 프롤린(Pro, P), 페닐알라닌(Phe, F), 트립토판(Trp, W), 및 메티오닌(Met, M)을 포함하고; 극성 중성 아미노산은 글리신(Gly, G), 세린(Ser, S), 트레오닌(Thr, T), 시스테인(Cys, C), 티로신(Tyr, Y), 아스파라긴(Asn, N), 및 글루타민(Gln, Q)을 포함하고; 양 전하(염기성) 아미노산은 아르기닌(Arg, R), 리신(Lys, K), 및 히스티딘(His, H)을 포함하며; 음 전하(산성) 아미노산은 아스파르트산(Asp, D) 및 글루탐산(Glu, E)을 포함한다. 변형은 재조합 DNA 기법을 사용하여 폴리펩티드 분자 내에서 아미노산을 분류학적으로 치환하고 활성을 위해 생성된 재조합 변이체를 검정함으로써 도입될 수 있다. 핵산 변형은 상이한 종으로부터 유래한 핵산(가변 위치)이 다르거나 또는 고도로 보존된 영역(불변 영역)이 다른 부위에서 이루어질 수 있다. 본 발명에 유용한 폴리펩티드 조성물을 발현시키는 방법은 하기 자세히 기술된다.
다른 바람직한 구체예는 인간 또는 포유동물 RAP 폴리펩티드를 포함하고, 여기서 상기 폴리펩티드는 위치 282∼289, 201∼210, 및 311∼319 상의 RAP의 천연 아미노산 서열을 포함한다. LRP 수용체에 결합한 RAP의 돌연변이되고 N 말단 또는 C 말단이 절두된 변이체는 본원에 그 전문이 참고인용되고 이러한 RAP 돌연변이되고 절두된 변이체에 관련된 Melman 등(J. Biol. Chem. 276(31): 29338-46, 2001)에 개시된다. 다른 바람직한 RAP 폴리펩티드는 아미노산 85∼148과 178∼248 사이의 RAP 천연 서열을 포함한다(Farquhar et al., Proc. Nat. Acad. Sci. USA 91: 3161-3162 (1994) 참조).
따라서, 다수의 문헌들은 LRP 수용체에 RAP 및 RAP 단편이 결합하기 위해 결합 부위 및 구조 활성 관계를 개시한다. 당업자는 LRP 결합 부위를 포함하고 본 발명에 따라 RAP 폴리펩티드로서 사용하기에 적당한 RAP 폴리펩티드를 얻기 위해 당업계에 잘 공지된 각종 기법을 용이하게 응용할 수 있다. RAP의 바람직한 단편은 생리학적 조건 하에 가용성이 있다. 이러한 폴리펩티드의 N 말단 또는 C 말단은, 필요에 따라 짧아질 수 있으나, 단 LRP 입자에 대한 결합력은 변하지 않고 남아있다.
D. 환형 RAP 펩티드
RAP는 기능적으로 두자리인데, 첫번째 및 세번째 도메인(d1 및 d3)은 LDLR 내 상보형 반복부(CR)의 나노몰 친화도가 낮은 특정 직렬 쌍과 결합한다(27). 대략 110개의 아미노산으로 이루어진 도메인 3은 관련 CR 쌍에서 가장 높은 친화도를 가진 것으로 제시되었다. 면역원성을 최소화하기 위해, 생산 효능을 최대화하고 잠재력을 향상시키며, 이는 수용체 결합에 직접적으로 참여하는 그러한 서열에 RAP를 최소화하는 것이 유용하다. 하지만, d3의 안정한 폴딩은 수용체 접촉면을 형성하는데 직접적으로 참여하지 않는 RAP 내 서열을 요구하는 것으로 제시되었다(28). 따라서, d3의 N 말단 영역 및 d2의 C 말단 영역에서 발견되는 이러한 추가 서열은 안정한 폴딩과 높은 친화도의 수용체 결합을 보장하는데 필요하다. 단리된 d3은 전장 RAP 내에 d3가 그러하듯이 수용체에 단단하게 결합하지 않는다. 폴딩 안정화 서열이 결여된 d3의 절두형 또한 수용체에 불량하게 결합한다. RAP d3과 LDLR CR34 사이의 착체로부터 유도된 구조 데이타(29)는 RAP d3의 수용체 결합 서열이 유연한 고리부에 의해 연결된 대략 동일한 길이의 2개의 역평행 α-나선 내에서 발견되는 것을 제시한다. 쌍이 된 나선 앙상블은 명백한 시계 반대 방향 트위스트를 갖고 팽팽하게 트위스트된 "U"와 유사하다.
비천연 이황화물 결합은 RAP d3의 수용체 결합 단위를 구성하는 2개의 역평행 나선의 말단을 접촉시키는 조작을 하였다(공소유의 미국 특허 출원 번호 60/919,238(2007년 3월 21일 출원)(대리인 문서 번호 31075/42620)을 참조하고 이의 전문은 본원에 참고인용됨). 고리화된 펩티드는 대략 75개의 아미노산 길이이지만 비고리화된 펩티드와 비교하였을 때 우수한 결합 친화력을 갖고 110-아미노산 RAP d3에 필적한 친화도를 갖는다. 그러한 최소화된 RAP d3 펩티드에 대해 가능한 하나의 적용은 본 발명의 방법에 따른 치료제를 전달하기 위한 표적제와 같다.
본 발명에 포함된 환형 RAP 펩티드는 성숙 RAP의 아미노산 서열을 기초로 하고, 바람직하게는 도메인 3은 바람직하게는 123개 미만의 아미노산 길이이고 2개의 비연속 아미노산 사이에 공유 결합을 포함한다. 일부 구체예에서, 공유 결합은 RAP 펩티드의 3차원 구조를 안정화시킨다. 일부 구체예에서, 공유 결합은 환형 RAP 펩티드가 약 1 x 10-8 M 이하(더 나은 친화도를 의미하는 것이 약함)인 Kd로 CR 함유 단백질에 결합하도록 결합 친화력에 향상을 제공한다. 그러한 결합 친화력은 표지 면역 검정, ELISA, 표면 플라즈몬 공명(SPR) 기초 기법(예, Biacore) 분석, 또는 운동성 배제 검정(예, KinExA)과 같은 당업계에 공지된 임의의 방법으로 측정될 수 있다. 친화도 데이타는, 예를 들어 문헌[Scatchard et al., Ann N.Y. Acad. Sci., 51:660 (1949)]의 방법으로 분석할 수 있다. 예시적 구체예에서, CR-단백질, 예컨대 LRP1에 대한 결합 친화력은 약 1 x 10-9, 10-10, 10-11, 10-12, 10-13, 10-14 M 이하이다. 본 발명은 길이가 약 103, 약 99, 약 95, 약 90, 약 85, 약 82, 약 80, 약 78, 약 76, 75, 74, 73, 72, 71, 70, 69, 68, 67, 66, 65, 64, 63, 62, 61, 60, 59, 58, 57, 또는 56 아미노산 이하를 비롯한 다양한 크기의 환형 RAP 펩티드를 제공한다. 일부 구체예에서, 공유 결합은 약 76, 75, 74, 73, 72, 71, 70, 69, 68, 67, 66, 65, 64, 63, 62, 61, 60, 59, 58, 57, 또는 56 아미노산에 의해 분리된 아미노산 사이에 형성된다.
일 구체예에서, 본 발명의 방법에 유용한 RAP 펩티드(환형 RAP 펩티드 포함)의 아미노산 서열은 성숙 RAP의 N 말단으로부터 적어도 200개, 최대 243개의 아미노산이 결손된다. 따라서, RAP 펩티드는 성숙 RAP의 아미노산 1∼200개, 1∼220개, 1∼225개, 1∼230개, 1∼235개, 1∼240개, 1∼241개, 1∼242개, 1∼243, 또는 대안적으로 1∼244, 1∼245, 1∼246, 1∼247, 또는 1∼248개가 결손될 수 있다. 관련 구체예에서, RAP 펩티드 아미노산 서열은 성숙 RAP의 C 말단으로부터 적어도 4개, 최대 11개의 아미노산이 추가로 결손된다. 따라서, RAP 펩티드는 성숙 RAP의 아미노산 314∼323 또는 313∼323, 또는 대안적으로 304∼323, 305∼323, 306∼323, 307∼323, 308∼323, 309∼323, 310∼323, 311∼323, 또는 312∼323이 결손될 수 있다. 또다른 구체예에서, RAP 펩티드 아미노산 서열은 (a) 71개 이상의 아미노산 길이이고 (b) 아미노산 256∼270을 포함하는 성숙 RAP의 연속 부위를 포함한다. 관련 구체예에서, RAP 펩티드 아미노산 서열은 (a) 71개 이상의 아미노산 길이이고 (b) 아미노산 256∼270을 포함하는 성숙 RAP 도메인 3의 연속 부위를 포함한다. RAP 펩티드(환형 RAP 펩티드 포함)에 기초를 형성할 수 있는 RAP의 예시적 부분은 성숙 RAP(서열 번호 1)의 아미노산 200∼323, 221∼323, 200∼319, 221∼319, 243∼319, 244∼319, 249∼319, 200∼313, 221∼313, 243∼313, 244∼313, 249∼313, 200∼303, 221∼303, 243∼303, 244∼303, 또는 249∼303을 포함한다.
본원에 기술된 바와 같이, 천연 RAP의 것과 유사(예, 천연 RAP와 비교하였을 때 약 5 배 이하의 차이)한 CR 함유 단백질에 대한 친화도 및 선택성을 제시하는 환형 RAP 펩티드를 제조할 수 있다. 천연 RAP와 비교하였을 때 LRP1에 대한 친화도가 향상된 환형 RAP 펩티드를 또한 제조할 수 있다. 일 구체예에서, 환형 RAP 펩티드는 LRP1(P98157)에 대한 (천연 RAP에 대해) 적어도 1.5배, 2배, 2.5배, 3배, 4배, 5배, 7배, 10배, 또는 20배 향상된 친화도를 제시한다.
본 발명에 고려되는 환형 RAP 펩티드는 천연 RAP 서열을 포함할 수 있거나 천연 서열에 돌연변이를 포함할 수 있다. 예시적 구체예에서, 본 발명의 환형 RAP 펩티드는 서열 번호 3에 제시된 RAP의 아미노산 243∼313 또는 서열 번호 4에 제시된 RAP의 아미노산 249∼303과 적어도 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% 또는 99% 동일한 아미노산 서열을 포함한다. 일부 구체예에서, 환형 RAP 펩티드는, 서열 번호 4와 70% 이상 동일한 50개의 인접 아미노산을 포함하는 약 85개 미만의 아미노산 길이이고, 약 1 x 10-8 M 이하 결합 친화력 Kd로 CR 함유 단백질에 결합한다.
환형 RAP 펩티드는 여전히 LRP1에 대해 결합 친화력을 보유하는 천연 RAP 서열에 대해 보존적 치환(예, 최대 5, 최대 10, 최대 15, 최대 20 또는 최대 25)을 포함할 수 있다. RAP 펩티드 함유 비보존적 치환은 또한 LRP1에 대한 결합 친화력을 보유할 수 있다. 예를 들어, 성숙 RAP의 위치 217, 249, 또는 251 중 어느 하나에서의 비보존적 돌연변이는 결합 친화력에 영향을 줄 수 없는 것으로 제시되었다.
이전의 구체예 중 어느 하나에서, RAP 펩티드는 펩티드의 N 말단에서 또는 부근에서 시스테인 및 펩티드의 C 말단에서 또는 부근에서 시스테인을 포함하여, 펩티드를 고리화시키고 2개의 시스테인 사이에서 이황화물 결합 형성을 통해 α-나선을 안정화시킬 수 있다. 경우에 따라, 글리신 또는 프롤린은 시스테인과 α-나선 사이(예, N 말단에서 Cys-Gly 및 C 말단에서 Gly-Cys)에 삽입될 수 있다. 글리신의 도입은 인접 비천연 고리내 이황화물 결합을 위한 α-나선을 분해시킬 수 있다.
환형 펩티드, Hep1은 추측컨대 펩티드와 LRP1 사이에 착체 형성 하에 엔트로피를 감소시킴으로써 결합 열역학(Kd > 50 nM 내지 Kd < 1 nM)을 향상시키는 비천연 내부 이황화물 결합에 의해 안정화된다. LRP1에 결합하고 간 질병 치료에 유용한 추가의 RAP 변이체는 본원에 그 전문이 참고인용되는 공동소유의 국제 특허 출원 번호 PCT/US2006/36453에 기술된다.
Hep1 서열은 N 말단에 3개의 위치(LEA/XCG) 및 C 말단에 2개의 위치(RI/GC)에서 인간 RAP와 상이하다(서열 번호 9). 환자들은 RAP에서 유도된 펩티드에 면역학적으로 내성이어야 한다. RAP의 도메인 1 및 2 내 에피토프가 쥐에서 실험적 하이만(Heymann) 신장염의 발생에 역할을 하는 반면, Hep1 펩티드는 전적으로 도메인 3으로부터 유도된다. 인간 RAP는 설치류 및 개과의 RAP 서열 모두와 상이한 서열을 갖기 때문에, 이러한 종은 정맥내 투여로 수주 내 유의적인 항약물성 항체 역가가 발달할 것으로 예상된다.
본원에서 환형 RAP 펩티드 중 어느 하나가 본원에 기술된 바와 같이 소중합체 조합으로 다량체화되는 것을 또한 고려한다. 본원에 사용된 "다량체화된 환형 RAP 펩티드"란 RAP d3의 2 이상의 변이체를 포함하는 폴리펩티드를 말하고, 여기서 상기 RAP d3의 변이체는 본원에 기술된 환형 RAP 펩티드이다. 용어 "다량체" 및 "소중합체"는 본원에 상호 혼용된다. 일 구체예에서, 소중합체 또는 다량체는 2 이상, 3 이상, 4 이상, 5 이상, 6 이상, 7 이상 또는 8 이상의 환형 RAP 펩티드를 포함한다. 예시적 일 구체예에서, 환형 RAP 펩티드는 바이오틴 분자와 접합되어 다량체화 또는 소중합을 촉진한다. 이후, 바이오틴 접합 환형 펩티드는 스트렙타비딘에 결합하거나 항 바이오틴 항체에 결합함으로써 다량체화될 수 있다(도 3). 환형 RAP 펩티드 소중합체 또는 다량체는 또한 당업계에 잘 공지되고 하기 기술된 다른 기법에 의해 제조될 수도 있다.
다수의 기법들은 당업계에 공지되어 펩티드의 다량체 또는 소중합체를 생성한다. 예를 들어, 펩티드는 본원에 기술된 링커에 의해 또는 폴리에틸렌 글리콜을 통해 연결될 수 있다. 본원에 전문에 참고인용되는 문헌[Zhang et al., Bioconjug Chem. 14:86-92, 2003](분지형 PEG 상에 펩티드의 6개의 복사본을 배치시켜 10,000배 이상의 친화도를 초래하는 반면, 아밀로이드 원섬유 결합 펩티드는 폴리(에틸렌 글리콜)(PEG) 스페이서 또는 원섬유에 대해 약 100 배 이상의 친화도를 제시하는 단지 2개의 아미노산에 의해 결합됨) 참조. 펩티드는 스트렙타비딘과의 결합을 통해 바이오틴화된 후 용이하게 다량체화될 수 있다. 예를 들어, 본원에 전문이 참고 인용되는 문헌[Guillaume et al., J. Biol. Chem., 278(7): 4500-4509, 2003](펩티드 다량체는 아비딘 또는 아비딘 유도체를 통해 연결됨으로써 제조될 수 있고, 4량체 및 8량체의 균질한 조제물이 가능함) 참조. 수용체 결합능이 있는 펩티드는 항체 또는 면역글로불린 골격의 상이한 CDR 영역에 그래프팅될 수 있다. 본원에 전문이 참고인용되는 문헌[Fredehckson et al., Proc Natl Acad Sci USA. 103(39): 14307-12, 2006. Epub Sep 14, 2006](그래프트된 2개의 mpl 수용체 결합 펩티드를 함유하는 항체 및 단편은 천연 리간드에 동등한 힘을 가지게 하는 것으로 추정되는 방식으로 mpl 수용체를 자극함) 참조. 펩티드는 직렬 또는 분지형 방식으로 링커를 포함 또는 불포함하여 항체 Fc 도메인에 결합할 수 있다. 본원에 전문에 참고인용된 국제 공개 번호 WO 00/24782(2000년 5월 4일 출원) 참조. 펩티드 및 다른 단백질은 다중효소 복합체에서 유도된 고분자 골격으로 제시될 수 있다. 본원에 전문이 참고인용되는 문헌[Domingo et al., J Mol Biol. 305(2):259-67, 2001] 참조. 펩티드를 제시하는데 적당한 단백질 골격의 조사를 하는 경우, 본원에 전문이 참고인용되는 문헌[Hosse et al., Protein Science 15:14-27, 2006(골격, 예컨대 피브로넥틴 III형 도메인, 리포칼린, 크노틴, 시토크롬 b562, 쿠니츠형 프로테아제 억제제, Z-도메인, 및 탄수화물 결합 모듈 CBM4-2 조사됨) 참조.
따라서, 예시적 구체예에서, 2가 소중합체 조합은 환형 RAP 펩티드 및 항체 Fc 영역을 포함하는 폴리펩티드의 동종이량체화(homodimerization)에 의해 제조된다. 4가 소중합체 조합은 4량체 면역글로불린(2개의 중쇄 및 2개의 경쇄 포함)에서 항체 가변 영역이 환형 RAP 펩티드로 치환됨으로써 제조된다. 또다른 예시적 구체예에서, 2가, 3가, 4가, 또는 기타 소중합체 조합은 PEG 분자에 환형 RAP 펩티드가 접합됨으로써 제조된다. 다른 소중합체 조합은 당업자에 의해 구상될 수 있다.
E. RAP , RAP 단편 또는 RAP 변이체 및 활성제의 접합체
"RAP 접합체", "리간드-폴리펩티드 접합체" "활성제에 접합된 RAP, RAP 단편 또는 RAP 변이체를 포함하는 키메라 분자"란 각각 활성제에 결합된 RAP, RAP 단편 또는 RAP 변이체를 포함하는 화합물을 말한다. 본원에 사용된 바와 같이, 용어 "접합된"은 치료제(들) 및 RAP, RAP 단편 또는 RAP 변이체 폴리펩티드가, 예를 들어 공유 화학 결합, 물리력, 반데르발스 또는 소수성 상호작용, 캡슐화, 삽입 또는 이의 조합에 의해 물리적으로 연결된다는 것을 의미한다. 바람직한 구체예에서, 치료제(들) 및 RAP, RAP 단편 또는 RAP 변이체 폴리펩티드는 공유 화학 결합에 의해 물리적으로 연결된다. 따라서, 바람직한 화학요법제는 RAP, RAP 단편 또는 RAP 변이체 또는 이의 단편에 대한 접합에 사용될 작용기, 예컨대 알콜, 산, 카르보닐, 티올 또는 아민 기를 함유한다. 아드리아마이신은 아민 부류 내에 있으며 또한 카르보닐을 통한 연결 가능성도 있다. 파클리탁셀은 알콜 부류 내에 있다. 적당한 접합 기가 없는 화학요법제를 추가로 변형시켜 그러한 기를 첨가할 수 있다. 상기 모든 화합물은 본 발명에 고려된다. 다중 치료제의 경우, 각종 접합의 조합을 사용할 수 있다.
일부 구체예에서, 직접적(개재 원자 없음) 또는 간접적(링커, 예컨대 공유 결합 원자의 쇄를 통함)일 수 있는 공유 화학 결합은 RAP, RAP 단편 또는 RAP 변이체 및 활성제와 결합한다. 바람직한 구체예에서, 접합체의 RAP, RAP 단편 또는 RAP 변이체 및 활성제 부분은 RAP, RAP 단편 또는 RAP 변이체의 원자와 활성제의 원자 사이에 공유 결합에 의해 직접적으로 연결된다. 일부 바람직한 구체예에서, 수용체 결합 부분은 RAP, RAP 단편 또는 RAP 변이체가 활성제에 접촉할 수 있는 사실상 임의의 아미노산 서열 또는 임의의 분자 또는 원자의 공유 결합 또는 펩티드를 포함하는 링커에 의해 본 발명에 따른 화합물의 활성제 부분과 접촉된다.
일부 구체예에서, 링커는 1∼약 60개, 또는 1∼30개 원자 또는 그 이상, 2∼5개 원자, 2∼10개 원자, 5∼10개 원자, 또는 10∼20개 원자 이상의 원자 쇄를 포함한다. 일부 구체예에서, 쇄 원자는 모두 탄소 원자이다. 일부 구체예에서, 쇄 원자는 C, O, N, 및 S로 이루어진 군에서 선택된다. 쇄 원자 및 링커는 더욱 가용성인 접합체를 제공하도록 이의 예상된 용해도(친수성)에 따라 선택될 수 있다. 일부 구체예에서, 링커는 리소좀에서 효소의 공격을 당하는 작용기를 제공한다. 일부 구체예에서, 링커는 표적 조직 또는 장기에서 발견되는 효소에 의해 공격 당하거나 공격 또는 가수분해 하에 활성제와 RAP, RAP 단편 또는 RAP 변이체 사이에서 링커를 절단하는 작용기를 제공한다. 일부 구체예에서, 링커는 표적 부위에서 발견되는 조건(예, 리소좀의 낮은 pH) 하에 가수분해가 실시되는 작용기를 제공한다. 링커는 하나 이상의 그러한 작용기를 포함할 수 있다. 일부 구체예에서, 링커의 길이는 RAP, RAP 단편 또는 RAP 변이체 결합 부위 및 활성제 활성 결합 부위 중 하나 또는 모두의 사이에서 (활성제가 큰 경우) 입체 장애에 대한 잠재성을 감소시키기에 충분히 길다.
링커는 공유 결합 또는 펩티드이고 활성제는 폴리펩티드인 경우, 전체 접합체는 융합 단백질일 수 있다. 그러한 펩티딜 링커는 임의의 길이일 수 있다. 예시적 링커는 약 1∼50개, 5∼50개, 또는 10∼30개의 아미노산 길이이다. 그러한 융합 단백질은 당업계에게 공지된 재조합 유전적 처리 방법에 의해 생성될 수 있다. 일부 구체예에서, 접합체의 RAP, RAP 단편 또는 RAP 변이체 부분은 쉽게 분해되어 활성 화합물을 방출함으로써 조제된다. 다른 구체예에서, 링커는 세포내, 또는 더욱 바람직하게는 리소좀 주변 조건에서 분해되어 RAP, RAP 단편 또는 RAP 변이체 폴리펩티드 부분에서 활성제 부분을 방출하거나 분리시킨다.
접합체는 동일한 RAP, RAP 단편 또는 RAP 변이체에 결합되는 하나 이상의 활성제를 포함할 수 있다. 예를 들어, 접합 반응은 활성제의 1∼5개, 약 5개, 약 1∼10개, 약 5∼10개, 약 10∼20개, 약 20∼30개, 또는 30개 이상의 분자를 RAP, RAP 단편 또는 RAP 변이체 폴리펩티드에 접합시킬 수 있다. 이러한 조제는 혼합물로서 사용될 수 있거나, 특이적 화학량론적 조제물로 정제될 수 있다. 당업자는 구성을 결정할 수 있고 화학량론적비가 바람직하다. 또한, 하나 이상의 활성제 유형은 하나 이상의 제제 유형이 표적 부위 또는 구획으로 전달되는 것이 바람직한 RAP, RAP 단편 또는 RAP 변이체 폴리펩티드에 연결될 수 있다. 복수의 활성제 종은 동일한 RAP, RAP 단편 또는 RAP 변이체 폴리펩티드, 예컨대 아드리아마이신-시스플라티넘 RAP (또는 다른 RAP 변이체) 접합체에 결합될 수 있다. 따라서, 접합체는 일정 범위의 화학량론적 비율로 이루어질 수 있고 하나 이상의 활성제 유형을 도입할 수 있다. 이들은 역시 정제된 혼합물로 분리될 수 있고 응집체로 사용될 수 있다.
본원에 기술되고 당업계에 공지된 방법을 사용하여 접합된 RAP, RAP 단편 또는 RAP 변이체 또는 이의 단편은 이의 안정성 또는 약력학 성질(예, PEG화)을 향상시키는데 바람직하게 변형될 수 있다. RAP 변이체 폴리펩티드 및 활성제에 접합하는데 적당한 링커 및 이의 작용기, 및 그러한 제조에 쉽게 응용가능한 합성 화학적 방법은 본원에 전문이 참고인용된 미국 특허 공개 번호 2003253890에 기술된다.
이러한 접합체의 합성은 효율적이며 편리하여 수성 용해도가 향상된 약물을 고수율로 생성한다.
F. 활성제
본 발명의 활성제는 생물학적 과정에 영향을 줄 수 있는 제제를 포함한다. 본 발명의 화합물 조성물 및 방법에 사용되는 특히 바람직한 활성제는 약물 및 진단제를 비롯한 치료제이다. 용어 "약물" 또는 "치료제"란 치료적 유효량으로 투여되는 경우 약리학적 활성을 갖거나 건강에 유리한 활성제를 말한다. 특히 바람직한 제제는 천연 생물학적 제제(예, 효소, 단백질, 폴리뉴클레오티드, 항체, 폴리펩티드, 나노입자, 글리콘쥬케이트)이다. 일부 구체예에서, RAP, RAP 단편 또는 RAP 변이체에 접합된 활성제는 생존하고 있는 숙주에서 생물학적 과정을 조절할 수 있는 분자, 및 임의의 결합 부분 또는 이의 단편. 약물 또는 치료제의 예는 질병 또는 병태의 예방, 진단, 완화, 처치 또는 치료에 사용되는 물질을 포함한다. 상기 제제는 질병을 야기하는 제제가 아님을 특히 고려한다.
i. 단백질 활성제
활성제는 비단백질 또는 단백질일 수 있다. 활성제는 단백질 또는 효소 또는 단백질 또는 효소의 일부, 실질적으로는 전부의, 또는 모든 치료적 또는 생물학적 활성을 여전히 보유하는 임의의 단편일 수 있다. 일부 구체예에서, 단백질 또는 효소는, 발현되거나 생성되지 않는 경우 또는 발현되거나 생성시 실질적으로 감소되는 경우, 질병이 나타나는 것이다. 바람직하게는, 단백질 또는 효소는 인간 또는 마우스로부터 유도되거나 얻어진다.
본 발명의 바람직한 구체예에서, RAP, RAP 단편 또는 RAP 변이체 폴리펩티드에 접합된 활성제가 단백질 또는 효소, 또는 단백질 또는 효소의 생물학적 활성을 보유하는 이의 단편인 경우, 활성제는 인간 또는 포유동물 단백질 또는 효소의 해당 부분의 아미노산 서열과 동일한 아미노산 서열을 갖는다. 다른 구체예에서, 접합체의 활성제 부분은 인간 또는 포유동물의 종에 고유한 단백질 또는 효소이다. 다른 구체예에서, 단백질 또는 효소, 또는 이의 단편은 해당 인간 또는 포유동물 단백질 또는 효소의 천연 서열에 실질적으로 상동(즉, 활성제의 적어도 10개, 25개, 50개, 100개, 150개, 또는 200개의 아미노산 길이, 또는 전체 길이 상에서 아미노산 서열에 적어도 80%, 85%, 90%, 95%, 더욱 바람직하게는 98%, 또는 가장 바람직하게는 99% 동일함)하다.
RAP, RAP 단편 또는 RAP 변이체-활성제 접합체는 RAP, RAP 단편 또는 RAP 변이체 또는 이의 LRP1 결합 단편에 연결된 하나 이상의 활성제 부분(예, 1∼10 또는 1∼4 또는 20∼3 부분)을 포함할 수 있다. 예를 들어, 접합 반응은 단일 RAP, RAP 단편 또는 RAP 변이체에 1 내지 4개 이상의 분자가 접합될 수 있다. 이러한 조제물은 혼합물로서 사용될 수 있거나, 또는 특이적 RAP, RAP 단편 또는 RAP 변이체 폴리펩티드-제제 화학량론적 조제물로 정제될 수 있다. 당업자는 구성을 결정할 수 있고 화학량론적비가 바람직하다.
제제가 접합된 이러한 RAP, RAP 단편 또는 RAP 변이체는 일정 범위의 화학량론적 비로 이루어질 수 있다. 이들은 역시 정제된 혼합물로 분리될 수 있고 응집체로 사용될 수 있다. 이는 RAP, RAP 단편 또는 RAP 변이체의 순서일 수 있고 융합시 활성제는 LRP1 결합 부분의 능력이 LRP1에 결합하는데 중요하다. 따라서, 바람직한 구체예에서, RAP, RAP 단편 또는 RAP 변이체는 단백질 활성제 코딩 서열에서 N 말단에 위치한다.
ii. 약물 활성제
일반적으로, 약물 활성제는 임의의 크기의 것일 수 있다. 바람직한 약물은 관심 표적에 결합할 수 있는 소형 유기 분자이다. 접합체의 약물 부분은, 소분자인 경우, 일반적으로 분자량이 약 50 D 이상, 통상 약 100 D 이상이고, 여기서 분자량은 500 D 이상일 수 있지만, 통상 약 2000 D을 초과하지 않을 것이다.
약물 부분은 본 발명의 방법을 실행하는 동안 접합체가 투여됨으로써 숙주 내에서 표적과 상호작용할 수 있다.
일부 구체예에서, 활성제 또는 약물은 이소시아네이트 시약과 반응시키기 위한 히드록실 또는 아미노 기를 가지거나 활성제는 이소시아네이트 시약과 반응시키기 위해 화학 변성되어 히드록실 또는 아미노 기를 도입한다.
일부 구체예에서, 활성제 또는 약물은, 바람직하게는 활성제의 목적하는 생물학적 활성의 손실 없이 변형되고/되거나 공유 연결에 참여할 수 있는 영역을 포함한다. 약물 부분은 종종 하나 이상의 상기 작용기로 치환된 환형 탄소 또는 복소환 구조 및/또는 방향족 또는 다환방향족 구조를 포함한다. 또한 약물 부분으로서 관심 부분은생체분자, 단백질, 효소, 다당류, 및 펩티드를 비롯한 폴리핵산, 당류, 지방산, 스테로이드, 퓨린, 피리미딘, 유도체, 구조적 유사체 또는 이의 조합 중에서 발견되는 구조이다.
적당한 활성제는, 비제한적인 예로서, 신경정신약리학제, 예컨대(1) 중추신경계 강하제, 예컨대 일반적인 마취제(바르비투르산염, 벤조디아제핀, 스테로이드, 시클로헥산온 유도체, 및 잡다한 제제들), 진정제-수면제(벤조디아제핀, 바르비투르산염, 피페리딘디온 및 트리온, 퀴나졸린 유도체, 카르바메이트, 알데히드 및 유도체, 아미드, 비환형 우레이드, 벤즈아제핀 및 관련 약물, 페노티아진 등), 주요 수의근 긴장 조절 약물(항경련제, 예컨대 히단토인, 바르비투르산염, 옥사졸리딘디온, 숙신이미드, 아실우레이드, 글루타리미드, 벤조디아제핀, 2차 및 3차 알콜, 디벤즈아제핀 유도체, 벨프로산 및 유도체, GABA 유사체 등), 진통제(몰핀 및 유도체, 오리파빈 유도체, 몰피난 유도체, 페닐피페리딘, 2,6-메탄-3-벤즈아조카인 유도체, 디페닐프로필아민 및 이소스테르, 살리실레이트, p-아미노페놀 유도체, 5-피라졸론 유도체, 아릴아세트산 유도체, 페나메이트 및 이소스테르 등) 및 구토방지제(콜린억제제, 항히스타민, 도파민활성방지제 등), (2) 중추신경계 흥분제, 예컨대 강장제(호흡 흥분제, 경련성 흥분제, 정신운동성 흥분제), 마취제 길항제(몰핀 유도체, 오리파빈 유도체, 2,6-메탄-3-벤족사신 유도체, 몰피난 유도체) 뇌기능강화제, (3) 신경정신약리학제, 예컨대 불안완화 진정제(벤조디아제핀, 프로판디올 카르바메이트) 항정신병제(페노티아진 유도체, 티옥산틴 유도체, 다른 삼환형 화합물, 부티로페논 유도체 및 이소스테르, 디페닐부틸아민 유도체, 치환된 벤즈아미드, 아릴피페라진 유도체, 인돌 유도체 등), 항울제(삼환형 화합물, MAO 억제제 등), (4) 기도 약물, 예컨대 주요 진해제(아편 알칼로이드 및 이의 유도체); 약력학제, 예컨대 (1) 말초신경계 약물, 예컨대 국소 마취제(에스테르 유도체, 아미드 유도체), (2) 시냅스 또는 신경효과기 연접 부위에서 작용하는 약물, 예컨대 콜린효능제, 콜린작동성 차단제, 신경근 차단제, 아드레날린작동제, 항아드레날린작동제, (3) 평활근 활성 약물, 예컨대 진경약(콜린억제제, 이완제 진경제), 혈관확장제, 평활근 흥분제, (4) 히스타민 및 항히스타민, 예컨대 히스타민 및 이의 유도체(베타졸), 항히스타민 (H1-길항제, H2-길항제), 히스타민 대사 약물, (5) 심혈관성 약물, 예컨대 강심제(식물 추출, 부테놀리드, 펜타디에놀리드, 에리스로플레움 종으로부터의 알칼로이드, 이온투과담체, 아드레날린수용체 흥분제 등), 항부정맥 약물, 강압제, 고지혈증치료제(클로피브르산 유도체, 니코틴산 유도체, 호르몬 및 유사체, 항생제, 살리실산 및 유도체), 정맥류성 약물, 지혈제, (6) 혈액 및 조혈모계 약물, 예컨대 항빈혈성 약물, 혈액 응고 약물(지혈제, 항응고제, 항혈전제, 혈전용해제, 혈액 단백질 및 이의 단편), (7) 위장관 약물, 예컨대 소화제 (건위체, 담즙분비촉진제), 항궤양 약물, 지사제, (8) 국소 작용 약물; 화학요법제, 예컨대 (1) 감염 방지제, 예컨대 기생충살충제(염소화된 탄화수소, 피레틴, 황화된 화합물), 구충제, 항원충제, 항말라리아제, 항아메바제, 항리슈마니아(antileishmanial) 약물, 항트리고모나스제, 항트립파노솜제, 설폰아미드, 항미코박테리아 약물, 항바이러스 화학요법제 등, 및 (2) 세포분열억제제, 즉 항종양제 또는 세포사 약물, 예컨대 알킬화제, 예컨대 메클로레타민 히드로클로라이드(니트로겐 머스타드, 머스타르겐, HN2), 시클로포스파미드(시토반, 엔독사나), 이포스파미드(IFEX), 클로람부실(Leukeran), 멜팔란(페닐알라닌 머스타드, L-사르콜리신, 알케란, L-PAM), 부설판(밀레란), 티오테파(트리에틸렌티오포스포아미드), 카르무스틴(BiCNU, BCNU), 로무스틴(CeeNU, CCNU), 스트렙토조신(자노사르) 다카르바진 등; 식물 알칼로이드, 예컨대 빈크리스틴(온코빈), 빈블라스틴(벨반, 벨베), 파클리탁셀(탁솔) 등; 항대사물질, 예컨대 메토트렉세이트(MTX), 머캅토퓨린(퓨린톨, 6-MP), 티오구아닌(6-TG), 플루오로우라실(5-FU), 시타라빈(Cytosar-U, Ara-C), 아자시티딘(Mylosar, 5-AZA) 등; 항생제, 예컨대 닥티노마이신(액티노마이신 D, 코스메겐), 독소루비신(아드리아마이신), 다우노루비신(다우노마이신, 세루비딘), 아이다루비신(아이다마이신), 블레오마이신(블레녹산), 피카마이신(미트라마이신, 미트라신), 미토마이신(뮤타마이신) 등, 및 기타 항세포 증식제, 예컨대 히드록시우레아(Hydrea), 프로카르바진(뮤탈란), 다카르바진(DTIC-Dome), 시스플라틴(플라티놀), 카르보플라틴(파라플라틴), 아스파라기나아제(Elspar), 에토포시드(VePesid, VP-16-213), 암사르크린(AMSA, m-AMSA), 미토탄(리소드렌), 미톡산트론(노바트론), (9) FGFR, PDGFR, VEGFR2, VEGFR, HER2, Ebr-B2 및 나머지와 같은 키나아제를 억제할 수 있는 수용체 티로신 키나아제 억제제(비제한적인 예로서, SU6668(FGFR, PDGFR, VEGFR, VEGFR2), 서니티닙(PDGFR), 베바시주납(VEGFR), 게피티닙, 에릴로티닙, 세툭시맙(EGFR), 라파티닙(Erb-B2), 트라스투주맙(HER2) 및 알렘투주맙(항-CD52), 다사티닙, 이마티닙, 소라페닙, 수니티닙 등을 포함함), (10) 항종양제(비제한적인 예로서, SU6668, 베바시주마, 수니티닙, 반데타닙(VEGFR2), BMS-275291, COL-3, 네오바스탓(MMPs), 비탁신 등을 포함함)를 포함한다. 바람직한 화학요법제는 유리 형태로 목적하는 용량에서 비허용되는 전신 독성을 입증하는 것이다. 그러한 제제의 치료 수준과 관련된 일반적인 전신 독성은 RAP, RAP 단편 또는 RAP 변이체 폴리펩티드와 이들의 연결에 의해 감소될 수 있다. 특히 바람직한 것은 심근독성에 의해 한정되는 용량이지만 유용한 치료제인 심근독성 화합물이다. 전형적인 예는 아드리아마이신(또한 독소루비신으로 공지됨) 및 이의 유사체, 예컨대 다우노루비신이다. RAP, RAP 단편 또는 RAP 변이체 폴리펩티드가 그러한 약물에 연결되는 것은 심장 및 관련 심근독성에 활성제의 축적을 방지할 수 있다.
적당한 활성제는, 비제한적인 예로서, 항생제, 예컨대 아미노글리코시드, 예컨대 아미카신, 아프라마이신, 아르베카신, 밤베르마이신, 부티로신, 디베카신, 디히드로스트렙토마이신, 포르티미신, 겐타미신, 이세파미신, 카나마이신, 미크로놈신, 네오마이신, 네틸미신, 파로마이신, 리보스타마이신, 시소미신, 스펙티노마이신, 스트렙토마이신, 토브라마이신, 트로스펙토마인신; 암페니콜, 예컨대 아지담페니콜, 클로람페니콜, 플로르페니콜, 및 테이마페니콜; 안사마이신, 에컨대 리파미드, 리팜핀, 리파마이신, 리파펜틴, 리팍시민; β-락탐, 예컨대 카르바세펨, 카르바페넴, 세팔로스포린, 세파마이신, 모노박탐, 옥사펨, 페니실린; 린코사미드, 예컨대 클리나마이신, 린코마이신; 마크로리드, 예컨대 클라리트로마이신, 디르트로마이신, 에리스로마이신 등; 폴리펩티드, 예컨대 암포마이신, 바시트라신, 카프레오마이신 등; 테프라사이클린, 예컨대 아피사이클린, 클로르테트라사이클린, 클로모사이클린 등; 합성 항박테리아제, 예컨대 2,4-디아미노피리미딘, 니트로퓨란, 퀴놀론 및 이의 유사체, 설폰아미드, 설폰을 포함한다.
적당한 활성제는, 비제한적인 예로서, 항진균제, 예컨대 폴리엔, 예를 들어 암포테리신 B, 칸디시딘, 데르모스타틴, 필리핀, 펀지크로민, 하키마이신, 하마이신, 루센소마이신, 메파르트리신, 나타마이신, 니스타틴, 페실로신, 페리마이신; 합성 항진균제, 예컨대 알릴아민, 예를 들어 부텐아핀, 나프티핀, 테르비나핀; 이미다졸, 예컨대 비포나졸, 부토코나졸, 콜로르단토인, 클로르미다졸 등, 티오카르바메이트, 예컨대 톨시클레이트, 트리아졸, 예컨대 프루코나졸, 이트라코나졸, 테르코나졸을 포함한다.
적당한 활성제는, 비제한적인 예로서, 구충제, 예컨대 아레콜린, 아스피딘, 아스피딘올, 디클로로펜, 엠벨린, 코신, 나프탈렌, 니클로사미드, 펠레티에린, 퀴나크린, 알란톨락톤, 아모카르진, 아모스카네이트, 아스카리돌, 베페늄, 비토스카네이트, 탄소 테트라클로라이드, 카르바크롤, 시클로벤다졸, 디에틸카르바마진 등을 포함한다.
적당한 활성제는, 비제한적인 예로서, 항말라리아제, 예컨대 아세답손, 아모디아퀸, 아르테에테르, 아르테메테르, 아르테미시닌, 아르테수네이트, 아토바쿠온, 베베에린, 베르베린, 키라타, 클로르구아니드, 클로로퀸, 클로르프로가우닐, 신초나, 신초니딘, 신초닌, 시클로구아닐, 겐티오피크린, 할로판트린, 히드록시클로로퀸, 메플로퀸 히드로클로라이드, 3-메틸아르사세틴, 파마퀸, 플라스모시드, 프리마퀸, 프리메타민, 퀴나크린, 퀴니딘, 퀴닌, 퀴노시드, 퀴놀린, 2염기성 나트륨 아르세네이트를 포함한다.
적당한 활성제는, 비제한적인 예로서, 항원충제, 예컨대 아크라닐, 티니다졸, 이프로니다졸, 에틸스티바민, 펜타미딘, 아세타르손, 아미니트로졸, 아니소마이신, 니푸라텔, 티니다졸, 벤지다졸, 수라민 등을 포함한다.
활성제로서 사용하기 적당한 약물은, 또한 문헌[Goodman and Gilman's, The Pharmacological Basis of Therapeutics (9th Ed) (Goodman et al. eds)(McGraw-Hill)(1996)]; 및 [1999 Physician's Desk Reference (1998)]에 열거된다.
적당한 약물은, 비제한적인 예로서, 미국 특허 번호 5,880,161, 5,877,206, 5,786,344, 5,760,041, 5,753,668, 5,698,529, 5,684,004, 5,665,715, 5,654,484, 5,624,924, 5,618,813, 5,610,292, 5,597,831, 5,530,026, 5,525,633, 5,525,606, 5,512,678, 5,508,277, 5,463,181, 5,409,893, 5,358,952, 5,318,965, 5,223,503, 5,214,068, 5,196,424, 5,109,024, 5,106,996, 5,101,072, 5,077,404, 5,071,848, 5,066,493, 5,019,390, 4,996,229, 4,996,206, 4,970,318, 4,968,800, 4,962,114, 4,927,828, 4,892,887, 4,889,859, 4,886,790, 4,882,334, 4,882,333, 4,871,746, 4,863,955, 4,849,563, 4,845,216, 4,833,145, 4,824,955, 4,785,085, 4,684,747, 4,618,685, 4,611,066, 4,550,187, 4,550,186, 4,544,501, 4,541,956, 4,532,327, 4,490,540, 4,399,283, 4,391,982, 4,383,994, 4,294,763, 4,283,394, 4,246,411, 4,214,089, 4,150,231, 4,147,798, 4,056,673, 4,029,661, 4,012,448에 개시된 항종양제;
미국 특허 번호 5,192,799, 5,036,070, 4,778,800, 4,753,951, 4,590,180, 4,690,930, 4,645,773, 4,427,694, 4,424,202, 4,440,781, 5,686,482, 5,478,828, 5,461,062, 5,387,593, 5,387,586, 5,256,664, 5,192,799, 5,120,733, 5,036,070, 4,977,167, 4,904,663, 4,788,188, 4,778,800, 4,753,951, 4,690,930, 4,645,773, 4,631,285, 4,617,314, 4,613,600, 4,590,180, 4,560,684, 4,548,938, 4,529,727, 4,459,306, 4,443,451, 4,440,781, 4,427,694, 4,424,202, 4,397,853, 4,358,451, 4,324,787, 4,314,081, 4,313,896, 4,294,828, 4,277,476, 4,267,328, 4,264,499, 4,231,930, 4,194,009, 4,188,388, 4,148,796, 4,128,717, 4,062,858, 4,031,226, 4,020,072, 4,018,895, 4,018,779, 4,013,672, 3,994,898, 3,968,125, 3,939,152, 3,928,356, 3,880,834, 3,668,210에 개시된 신경정신약리학/항정신제;
미국 특허 번호 4,966,967, 5,661,129, 5,552,411, 5,332,737, 5,389,675, 5,198,449, 5,079,247, 4,966,967, 4,874,760, 4,954,526, 5,051,423, 4,888,335, 4,853,391, 4,906,634, 4,775,757, 4,727,072, 4,542,160, 4,522,949, 4,524,151, 4,525,479, 4,474,804, 4,520,026, 4,520,026, 5,869,478, 5,859,239, 5,837,702, 5,807,889, 5,731,322, 5,726,171, 5,723,457, 5,705,523, 5,696,111, 5,691,332, 5,679,672, 5,661,129, 5,654,294, 5,646,276, 5,637,586, 5,631,251, 5,612,370, 5,612,323, 5,574,037, 5,563,170, 5,552,411, 5,552,397, 5,547,966, 5,482,925, 5,457,118, 5,414,017, 5,414,013, 5,401,758, 5,393,771, 5,362,902, 5,332,737, 5,310,731, 5,260,444, 5,223,516, 5,217,958, 5,208,245, 5,202,330, 5,198,449, 5,189,036, 5,185,362, 5,140,031, 5,128,349, 5,116,861, 5,079,247, 5,070,099, 5,061,813, 5,055,466, 5,051,423, 5,036,065, 5,026,712, 5,011,931, 5,006,542, 4,981,843, 4,977,144, 4,971,984, 4,966,967, 4,959,383, 4,954,526, 4,952,692, 4,939,137, 4,906,634, 4,889,866, 4,888,335, 4,883,872, 4,883,811, 4,847,379, 4,835,157, 4,824,831, 4,780,538, 4,775,757, 4,774,239, 4,771,047, 4,769,371, 4,767,756, 4,762,837, 4,753,946, 4,752,616, 4,749,715, 4,738,978, 4,735,962, 4,734,426, 4,734,425, 4,734,424, 4,730,052, 4,727,072, 4,721,796, 4,707,550, 4,704,382, 4,703,120, 4,681,970, 4,681,882, 4,670,560, 4,670,453, 4,668,787, 4,663,337, 4,663,336, 4,661,506, 4,656,267, 4,656,185, 4,654,357, 4,654,356, 4,654,355, 4,654,335, 4,652,578, 4,652,576, 4,650,874, 4,650,797, 4,649,139, 4,647,585, 4,647,573, 4,647,565, 4,647,561, 4,645,836, 4,639,461, 4,638,012, 4,638,011, 4,632,931, 4,631,283, 4,628,095, 4,626,548, 4,614,825, 4,611,007, 4,611,006, 4,611,005, 4,609,671, 4,608,386, 4,607,049, 4,607,048, 4,595,692, 4,593,042, 4,593,029, 4,591,603, 4,588,743, 4,588,742, 4,588,741, 4,582,854, 4,575,512, 4,568,762, 4,560,698, 4,556,739, 4,556,675, 4,555,571, 4,555,570, 4,555,523, 4,550,120, 4,542,160, 4,542,157, 4,542,156, 4,542,155, 4,542,151, 4,537,981, 4,537,904, 4,536,514, 4,536,513, 4,533,673, 4,526,901, 4,526,900, 4,525,479, 4,524,151, 4,522,949, 4,521,539, 4,520,026, 4,517,188, 4,482,562, 4,474,804, 4,474,803, 4,472,411, 4,466,979, 4,463,015, 4,456,617, 4,456,616, 4,456,615, 4,418,076, 4,416,896, 4,252,815, 4,220,594, 4,190,587, 4,177,280, 4,164,586, 4,151,297, 4,145,443, 4,143,054, 4,123,550, 4,083,968, 4,076,834, 4,064,259, 4,064,258, 4,064,257, 4,058,620, 4,001,421, 3,993,639, 3,991,057, 3,982,010, 3,980,652, 3,968,117, 3,959,296, 3,951,950, 3,933,834, 3,925,369, 3,923,818, 3,898,210, 3,897,442, 3,897,441, 3,886,157, 3,883,540, 3,873,715, 3,867,383, 3,873,715, 3,867,383, 3,691,216, 3,624,126에 개시된 심혈관제;
미국 특허 번호 5,902,594, 5,874,476, 5,874,436, 5,859,027, 5,856,320, 5,854,242, 5,811,091, 5,786,350, 5,783,177, 5,773,469, 5,762,919, 5,753,715, 5,741,526, 5,709,870, 5,707,990, 5,696,117, 5,684,042, 5,683,709, 5,656,591, 5,643,971, 5,643,950, 5,610,196, 5,608,056, 5,604,262, 5,595,742, 5,576,341, 5,554,373, 5,541,233, 5,534,546, 5,534,508, 5,514,715, 5,508,417, 5,464,832, 5,428,073, 5,428,016, 5,424,396, 5,399,553, 5,391,544, 5,385,902, 5,359,066, 5,356,803, 5,354,862, 5,346,913, 5,302,592, 5,288,693, 5,266,567, 5,254,685, 5,252,745, 5,209,930, 5,196,441, 5,190,961, 5,175,160, 5,157,051, 5,096,700, 5,093,342, 5,089,251, 5,073,570, 5,061,702, 5,037,809, 5,036,077, 5,010,109, 4,970,226, 4,916,156, 4,888,434, 4,870,093, 4,855,318, 4,784,991, 4,746,504, 4,686,221, 4,599,228, 4,552,882, 4,492,700, 4,489,098, 4,489,085, 4,487,776, 4,479,953, 4,477,448, 4,474,807, 4,470,994, 4,370,484, 4,337,199, 4,311,709, 4,308,283, 4,304,910, 4,260,634, 4,233,311, 4,215,131, 4,166,122, 4,141,981, 4,130,664, 4,089,977, 4,089,900, 4,069,341, 4,055,655, 4,049,665, 4,044,139, 4,002,775, 3,991,201, 3,966,968, 3,954,868, 3,936,393, 3,917,476, 3,915,889, 3,867,548, 3,865,748, 3,867,548, 3,865,748, 3,783,160, 3,764,676, 3,764,677에 개시된 항균제;
미국 특허 번호 5,872,109, 5,837,735, 5,827,837, 5,821,250, 5,814,648, 5,780,026, 5,776,946, 5,760,002, 5,750,543, 5,741,798, 5,739,279, 5,733,939, 5,723,481, 5,716,967, 5,688,949, 5,686,488, 5,686,471, 5,686,434, 5,684,204, 5,684,041, 5,684,031, 5,684,002, 5,677,318, 5,674,891, 5,672,620, 5,665,752, 5,656,661, 5,635,516, 5,631,283, 5,622,948, 5,618,835, 5,607,959, 5,593,980, 5,593,960, 5,580,888, 5,552,424, 5,552,422, 5,516,764, 5,510,361, 5,508,026, 5,500,417, 5,498,405, 5,494,927, 5,476,876, 5,472,973, 5,470,885, 5,470,842, 5,464,856, 5,464,849, 5,462,952, 5,459,151, 5,451,686, 5,444,043, 5,436,265, 5,432,181, RE034918, 5,393,756, 5,380,738, 5,376,670, 5,360,811, 5,354,768, 5,348,957, 5,347,029, 5,340,815, 5,338,753, 5,324,648, 5,319,099, 5,318,971, 5,312,821, 5,302,597, 5,298,633, 5,298,522, 5,298,498, 5,290,800, 5,290,788, 5,284,949, 5,280,045, 5,270,319, 5,266,562, 5,256,680, 5,250,700, 5,250,552, 5,248,682, 5,244,917, 5,240,929, 5,234,939, 5,234,937, 5,232,939, 5,225,571, 5,225,418, 5,220,025, 5,212,189, 5,212,172, 5,208,250, 5,204,365, 5,202,350, 5,196,431, 5,191,084, 5,187,175, 5,185,326, 5,183,906, 5,177,079, 5,171,864, 5,169,963, 5,155,122, 5,143,929, 5,143,928, 5,143,927, 5,124,455, 5,124,347, 5,114,958, 5,112,846, 5,104,656, 5,098,613, 5,095,037, 5,095,019, 5,086,064, 5,081,261, 5,081,147, 5,081,126, 5,075,330, 5,066,668, 5,059,602, 5,043,457, 5,037,835, 5,037,811, 5,036,088, 5,013,850, 5,013,751, 5,013,736, 5,006,542, 4,992,448, 4,992,447, 4,988,733, 4,988,728, 4,981,865, 4,962,119, 4,959,378, 4,954,519, 4,945,099, 4,942,236, 4,931,457, 4,927,835, 4,912,248, 4,910,192, 4,904,786, 4,904,685, 4,904,674, 4,904,671, 4,897,397, 4,895,953, 4,891,370, 4,870,210, 4,859,686, 4,857,644, 4,853,392, 4,851,412, 4,847,303, 4,847,290, 4,845,242, 4,835,166, 4,826,990, 4,803,216, 4,801,598, 4,791,129, 4,788,205, 4,778,818, 4,775,679, 4,772,703, 4,767,776, 4,764,525, 4,760,051, 4,748,153, 4,725,616, 4,721,712, 4,713,393, 4,708,966, 4,695,571, 4,686,235, 4,686,224, 4,680,298, 4,678,802, 4,652,564, 4,644,005, 4,632,923, 4,629,793, 4,614,741, 4,599,360, 4,596,828, 4,595,694, 4,595,686, 4,594,357, 4,585,755, 4,579,866, 4,578,390, 4,569,942, 4,567,201, 4,563,476, 4,559,348, 4,558,067, 4,556,672, 4,556,669, 4,539,326, 4,537,903, 4,536,503, 4,518,608, 4,514,415, 4,512,990, 4,501,755, 4,495,197, 4,493,839, 4,465,687, 4,440,779, 4,440,763, 4,435,420, 4,412,995, 4,400,534, 4,355,034, 4,335,141, 4,322,420, 4,275,064, 4,244,963, 4,235,908, 4,234,593, 4,226,887, 4,201,778, 4,181,720, 4,173,650, 4,173,634, 4,145,444, 4,128,664, 4,125,612, 4,124,726, 4,124,707, 4,117,135, 4,027,031, 4,024,284, 4,021,553, 4,021,550, 4,018,923, 4,012,527, 4,011,326, 3,998,970, 3,998,954, 3,993,763, 3,991,212, 3,984,405, 3,978,227, 3,978,219, 3,978,202, 3,975,543, 3,968,224, 3,959,368, 3,949,082, 3,949,081, 3,947,475, 3,936,450, 3,934,018, 3,930,005, 3,857,955, 3,856,962, 3,821,377, 3,821,401, 3,789,121, 3,789,123, 3,726,978, 3,694,471, 3,691,214, 3,678,169, 3,624,216에 개시된 항염증제;
미국 특허 번호 4,450,159, 4,450,159, 5,905,085, 5,883,119, 5,880,280, 5,877,184, 5,874,594, 5,843,452, 5,817,672, 5,817,661, 5,817,660, 5,801,193, 5,776,974, 5,763,478, 5,739,169, 5,723,466, 5,719,176, 5,696,156, 5,695,753, 5,693,648, 5,693,645, 5,691,346, 5,686,469, 5,686,424, 5,679,705, 5,679,640, 5,670,504, 5,665,774, 5,665,772, 5,648,376, 5,639,455, 5,633,277, 5,624,930, 5,622,970, 5,605,903, 5,604,229, 5,574,041, 5,565,560, 5,550,233, 5,545,734, 5,540,931, 5,532,248, 5,527,820, 5,516,797, 5,514,688, 5,512,687, 5,506,233, 5,506,228, 5,494,895, 5,484,788, 5,470,857, 5,464,615, 5,432,183, 5,431,896, 5,385,918, 5,349,061, 5,344,925, 5,330,993, 5,308,837, 5,290,783, 5,290,772, 5,284,877, 5,284,840, 5,273,979, 5,262,533, 5,260,300, 5,252,732, 5,250,678, 5,247,076, 5,244,896, 5,238,689, 5,219,884, 5,208,241, 5,208,228, 5,202,332, 5,192,773, 5,189,042, 5,169,851, 5,162,334, 5,151,413, 5,149,701, 5,147,877, 5,143,918, 5,138,051, 5,093,338, 5,091,389, 5,068,323, 5,068,247, 5,064,835, 5,061,728, 5,055,290, 4,981,792, 4,810,692, 4,410,696, 4,346,096, 4,342,769, 4,317,825, 4,256,766, 4,180,588, 4,000,275, 3,759,921에 개시된 면역억제제;
미국 특허 번호 4,446,128, 4,524,147, 4,720,484, 4,722,899, 4,748,018, 4,877,619, 4,998,931, 5,049,387, 5,118,509, 5,152,980, 5,256,416, 5,468,729, 5,583,139, 5,604,234, 5,612,060, 5,612,350, 5,658,564, 5,672,605, 5,681,571, 5,708,002, 5,723,718, 5,736,143, 5,744,495, 5,753,687, 5,770,201, 5,869,057, 5,891,653, 5,939,455, 5,948,407, 6,006,752, 6,024,957, 6,030,624, 6,037,372, 6,037,373, 6,043,247, 6,060,049, 6,087,096, 6,096,315, 6,099,838, 6,103,235, 6,124,495, 6,153,203, 6,169,087, 6,255,278, 6,262,044, 6,290,950, 6,306,651, 6,322,796, 6,329,153, 6,344,476, 6,352,698, 6,365,163, 6,379,668, 6,391,303, 6,395,767, 6,403,555, 6,410,556, 6,412,492, 6,468,537, 6,489,330, 6,521,232, 6,525,035, 6,525,242, 6,558,663, 6,572,860에 개시된 면역조절제;
미국 특허 번호 5,292,736, 5,688,825, 5,554,789, 5,455,230, 5,292,736, 5,298,522, 5,216,165, 5,438,064, 5,204,365, 5,017,578, 4,906,655, 4,906,655, 4,994,450, 4,749,792, 4,980,365, 4,794,110, 4,670,541, 4,737,493, 4,622,326, 4,536,512, 4,719,231, 4,533,671, 4,552,866, 4,539,312, 4,569,942, 4,681,879, 4,511,724, 4,556,672, 4,721,712, 4,474,806, 4,595,686, 4,440,779, 4,434,175, 4,608,374, 4,395,402, 4,400,534, 4,374,139, 4,361,583, 4,252,816, 4,251,530, 5,874,459, 5,688,825, 5,554,789, 5,455,230, 5,438,064, 5,298,522, 5,216,165, 5,204,365, 5,030,639, 5,017,578, 5,008,264, 4,994,450, 4,980,365, 4,906,655, 4,847,290, 4,844,907, 4,794,110, 4,791,129, 4,774,256, 4,749,792, 4,737,493, 4,721,712, 4,719,231, 4,681,879, 4,670,541, 4,667,039, 4,658,037, 4,634,708, 4,623,648, 4,622,326, 4,608,374, 4,595,686, 4,594,188, 4,569,942, 4,556,672, 4,552,866, 4,539,312, 4,536,512, 4,533,671, 4,511,724, 4,440,779, 4,434,175, 4,400,534, 4,395,402, 4,391,827, 4,374,139, 4,361,583, 4,322,420, 4,306,097, 4,252,816, 4,251,530, 4,244,955, 4,232,018, 4,209,520, 4,164,514, 4,147,872, 4,133,819, 4,124,713, 4,117,012, 4,064,272, 4,022,836, 3,966,944에 개시된 진통제;
미국 특허 번호 5,219,872, 5,219,873, 5,073,560, 5,073,560, 5,346,911, 5,424,301, 5,073,560, 5,219,872, 4,900,748, 4,786,648, 4,798,841, 4,782,071, 4,710,508, 5,482,938, 5,464,842, 5,378,723, 5,346,911, 5,318,978, 5,219,873, 5,219,872, 5,084,281, 5,073,560, 5,002,955, 4,988,710, 4,900,748, 4,798,841, 4,786,648, 4,782,071, 4,745,123, 4,710,508에 개시된 콜린효능제;
미국 특허 번호 5,091,528, 5,091,528, 4,835,157, 5,708,015, 5,594,027, 5,580,892, 5,576,332, 5,510,376, 5,482,961, 5,334,601, 5,202,347, 5,135,926, 5,116,867, 5,091,528, 5,017,618, 4,835,157, 4,829,086, 4,579,867, 4,568,679, 4,469,690, 4,395,559, 4,381,309, 4,363,808, 4,343,800, 4,329,289, 4,314,943, 4,311,708, 4,304,721, 4,296,117, 4,285,873, 4,281,189, 4,278,608, 4,247,710, 4,145,550, 4,145,425, 4,139,535, 4,082,843, 4,011,321, 4,001,421, 3,982,010, 3,940,407, 3,852,468, 3,832,470에 개시된 아드레날린작동제;
미국 특허 번호 5,874,479, 5,863,938, 5,856,364, 5,770,612, 5,702,688, 5,674,912, 5,663,208, 5,658,957, 5,652,274, 5,648,380, 5,646,190, 5,641,814, 5,633,285, 5,614,561, 5,602,183, 4,923,892, 4,782,058, 4,393,210, 4,180,583, 3,965,257, 3,946,022, 3,931,197에 개시된 항히스타민제;
미국 특허 번호 5,863,538, 5,855,907, 5,855,866, 5,780,592, 5,776,427, 5,651,987, 5,346,887, 5,256,408, 5,252,319, 5,209,926, 4,996,335, 4,927,807, 4,910,192, 4,710,495, 4,049,805, 4,004,005, 3,670,079, 3,608,076, 5,892,028, 5,888,995, 5,883,087, 5,880,115, 5,869,475, 5,866,558, 5,861,390, 5,861,388, 5,854,235, 5,837,698, 5,834,452, 5,830,886, 5,792,758, 5,792,757, 5,763,361, 5,744,462, 5,741,787, 5,741,786, 5,733,899, 5,731,345, 5,723,638, 5,721,226, 5,712,264, 5,712,263, 5,710,144, 5,707,984, 5,705,494, 5,700,793, 5,698,720, 5,698,545, 5,696,106, 5,677,293, 5,674,861, 5,661,141, 5,656,621, 5,646,136, 5,637,691, 5,616,574, 5,614,514, 5,604,215, 5,604,213, 5,599,807, 5,585,482, 5,565,588, 5,563,259, 5,563,131, 5,561,124, 5,556,845, 5,547,949, 5,536,714, 5,527,806, 5,506,354, 5,506,221, 5,494,907, 5,491,136, 5,478,956, 5,426,179, 5,422,262, 5,391,776, 5,382,661, 5,380,841, 5,380,840, 5,380,839, 5,373,095, 5,371,078, 5,352,809, 5,344,827, 5,344,826, 5,338,837, 5,336,686, 5,292,906, 5,292,878, 5,281,587, 5,272,140, 5,244,886, 5,236,912, 5,232,915, 5,219,879, 5,218,109, 5,215,972, 5,212,166, 5,206,415, 5,194,602, 5,166,201, 5,166,055, 5,126,488, 5,116,829, 5,108,996, 5,099,037, 5,096,892, 5,093,502, 5,086,047, 5,084,450, 5,082,835, 5,081,114, 5,053,404, 5,041,433, 5,041,432, 5,034,548, 5,032,586, 5,026,882, 4,996,335, 4,975,537, 4,970,205, 4,954,446, 4,950,428, 4,946,834, 4,937,237, 4,921 ,846, 4,920,099, 4,910,226, 4,900,725, 4,892,867, 4,888,336, 4,885,280, 4,882,322, 4,882,319, 4,882,315, 4,874,855, 4,868,167, 4,865,767, 4,861,875, 4,861,765, 4,861,763, 4,847,014, 4,774,236, 4,753,932, 4,711,856, 4,710,495, 4,701,450, 4,701,449, 4,689,410, 4,680,290, 4,670,551, 4,664,850, 4,659,516, 4,647,410, 4,634,695, 4,634,693, 4,588,530, 4,567,000, 4,560,557, 4,558,041, 4,552,871, 4,552,868, 4,541,956, 4,519,946, 4,515,787, 4,512,986, 4,502,989, 4,495,102에 개시된 스테로이드제
를 포함하고, 상기 문헌들의 모든 개시물은 본원에 참고인용된다.
접합체의 약물 부분은 벡터 단백질 리간드 또는 링커에 공유 결합하기 위한 연결 부위를 갖는 반면 관심 표적에 이의 친화도 및 특이성을 보유하는 모든 약물 또는 이의 결합 단편 또는 부분일 수 있다. 그러한 약물의 접합체는 약물 자체로서 동일한 질환, 질병, 및 징후에 사용될 수 있다.
G. 암 화학요법 활성제
본 발명의 방법에 유용한 접합체를 기초로 하는 RAP, RAP 단편 또는 RAP 변이체에 사용하기 위한 바람직한 암 화학요법제는 유리 형태로, 또는 유리 형태로 그러한 종양에 그렇게 유용하지 않은 경우, RAP, RAP 단편 또는 RAP 변이체 또는 이의 LRP1 결합 단편에 연결시 유용하게, 간 내 또는 주변의 간 종양 또는 다른 종양형성을 치료하는데 유용할 수 있는 모든 약물을 포함한다. 그러한 화학요법제는 바람직하게는 비제한적인 예로서 아드리아마이신(또한 독소루비신으로 공지됨), 시스플라틴, 파클리탁셀, 이의 유사체를 포함하는 세포독성 화학요법제이고, 다른 화학요법제는 생체외 및 생체내에서 종양에 대한 활성을 입증한다. 그러한 화학요법제는 또한 알킬화제, 대사길항물질, 천연 생성물(예, 빈카 알칼로이드, 에피도필로톡신, 항생제, 효소 및 생물학적 반응 변형제), 토포이소머라제 억제제, 미소관 억제제, 스핀들 독(spindle poison), 호르몬 및 길항제, 및 잡제, 예컨대 백금 배위결합 착체, 안트라센디온, 치환된 우레아 등을 포함한다. 당업자는 다른 화학요법제를 알 것이다.
비제한적인 예로서 131I (요오드), 125I, 111In (인듐), 90Y(이트륨), 67Cu(구리), 127Lu(루테튬), 212Bi(비스무스), 213Bi, 255Fm(패르뮴), 149Tb(테르븀), 223Rd(라듐), 213Pb(납), 212Pb, 211At(아스타틴), 89Sr(스트론튬), 153Sm(사마륨), 166Ho(홀뮴), 225Ac(엑티늄), 186Re(레늄), 67Ga(갈륨), 68Ga 및 99 mTc(테크네튬)과 같은 방사성 동위원소를 포함하는 암 또는 종양형성의 치료에 유용한 세포독성 화학요법제는 본 발명에 유용한 RAP, RAP 단편 또는 RAP 변이체와 접합될 수 있다. 방사성 동위원소는 그러한 목적을 위해, 비제한적인 예로서 1,4,7,10-테트라아자시클로-11 도데칸-N,N,N,N-테트라아세트산(DOTA), 1,4,8,11-테트라아자시클로테트라데칸 N,N',N",N"'-테트라아세트산(TETA), 디에틸렌 트리아민 펜타-아세테이트(DTPA), 디머캅토숙신산(DMSA), 테트라아자시클로트리데칸-N,N',N",N"'-테트라아세트산(TRITA), 및 1,5,9,13-테트라아자시클로헥사데칸-N,N',N",N'"-테트라아세트산(HETA), 히드록시에틸리덴 디포스포네이트(HEDP), HEXA, 및 에틸렌디아민테트라아세트산(EDTA)을 포함하는 당업계에 일반적인 금속 킬레이트화제를 사용하여 폴리펩티드에 연결될 수 있고, 폴리펩티드 상에 방사성 동위원소를 "적재"할 수 있다.
바람직한 화학요법제는 유리 형태로 목적하는 용량에서 비허용되는 전신 독성을 입증하는 것이다. 그러한 제제의 치료적 수준과 관련된 일반적인 전신 독성은 RAP, RAP 단편 또는 RAP 변이체에의 연결에 의해 감소된다. 특히 바람직한 것은 심근독성으로 한정되는 용량이지만 치료적으로 유용한 심근독성 화합물이다. 전형적인 예는 아드리아마이신(또한 독소루비신으로 공지됨) 및 이의 유사체, 예컨대 다우노루비신이다. 그러한 약물에 RAP, RAP 단편 또는 RAP 변이체의 연결은 심장에서 축적 및 관련된 심근독성을 감소시킨다.
H. 나노입자
나노입자는 생분해성이 있고 생분해성이 없는 중합체 또는 지질과 같은 다른 재료로부터 구성된 고분자 조립체이다. 그러한 조립체는 입자 내 공동에서 치료 분자를 함유하도록 조작될 수 있다. 이러한 수단을 통해, 나노입자는 약물의 생물학적분포, 약력학, 면역원성 및 잠재력을 바꾸는 수단을 제공한다. 이어서, 적당한 RAP, RAP 단편 또는 RAP 변이체의 결합은 이러한 분자들의 조직 분포의 특이성을 증가시키는 수단을 제공할 것이다.
I. RAP 접합체의 제조 방법
i. 숙주 세포
키메라 단백질을 제조하는데 사용되는 숙주 세포는 박테리아, 효모, 곤충, 비포유동물 척추동물, 또는 포유동물 세포이고; 포유동물 세포는, 비제한적인 예로서 햄스터, 원숭이, 침팬지, 개, 고양이, 소, 돼지, 마우스, 쥐, 토끼, 양 및 인간 세포를 포함한다. 숙주 세포는 불멸화된 세포(세포주)이거나 비불멸화된(1차 또는 2차) 세포일 수 있고, 광범위한 각종 세포 유형, 비제한적인 예로서 섬유아세포, 캡틴생성세포, 상피 세포(예, 유선 상피 세포, 위장 상피 세포), 난소 세포(예, 중국 햄스터 난소 또는 CHO 세포), 내피 세포, 신경로 세포, 신경 세포, 혈액의 형성된 성분(예, 림프구, 골수 세포), 근육 세포, 간세포 및 이러한 체세포 유형의 전구체 중 어느 하나일 수 있다. 숙주 세포는 LRP 예컨대 CHO13-5-1을 발현하지 않는 CHO 세포의 돌연변이체를 포함할 수 있다(FitzGerald et al., J. Biol. Chem., 129(6):1533-41, 1995).
키메라 단백질을 코딩하는 DNA 또는 RAN를 함유하고 발현하는 세포는 본원에서 유전적으로 변형된 세포로서 언급된다. 키메라 단백질을 코딩하는 DNA 또는 RNA를 함유하고 발현하는 포유동물 세포는 유전적으로 변형된 포유동물 세포로서 언급된다. 공지된 형질감염 방법, 예컨대 전기천공법, 현미주사, 현미발사체 충격, 인산칼슘 침전, 변형된 인산칼슘 침전, 양이온성 지질 치료, 포토포레이션, 융합 방법, 수용체 매개 전이, 또는 폴리브렌 침전에 의해 DNA 또는 RNA가 세포로 도입된다. 대안적으로, DNA 또는 RNA는 바이러스 벡터를 이용한 감염에 의해 도입될 수 있다. 키메라 단백질을 코딩하는 DNA 또는 RNA를 발현하는 포유동물 세포를 비롯한 세포의 제조 방법은 미국 특허 번호 6,048,729, 5,994,129, 및 6,063,630에 기술된다. 이러한 응용의 각 교시는 특별히 본원에 그 전문이 참고인용된다.
ii. 핵산 구성체
키메라 단백질을 발현시키는데 사용되는 핵산 구성체는 형질감염된 포유동물 세포 또는 수용자 세포의 게놈으로 상동성 재조합을 통해 무작위로 또는 미리 선택된 표적 부위에서 통합되는 것에서 염색체 외적으로 발현(유전자 부체)되는 것일 수 있다. 염색체 외적으로 발현된 구성체는, 키메라 단백질 코딩 서열 외에, 세포에서 단백질을 발현시키고, 경우에 따라 구성체를 복제하기에 충분한 서열을 포함한다. 이는 통상적으로 프로모터, 키메라 단백질 코딩 DNA 및 폴리아데닐화 부위를 포함한다. 키메라 단백질을 코딩하는 DNA는 이의 발현이 프로모터의 제어 하에 있는 방식으로 구성체에 위치한다. 경우에 따라, 구성체는 추가 성분, 예컨대 스플라이스 부위, 인핸서 서열, 적당한 프로모터의 제저 하에 선택가능한 마커 유전자, 및 적당한 프로모터의 제어 하에 증폭가능한 마커 유전자 중 하나 이상을 포함할 수 있다.
DNA 구성체가 세포의 게놈으로 통합되는 구체예에서, 키메라 단백질 코딩 핵산 서열만이 포함되는 것이 필요하다. 경우에 따라, 이는 프로모터 및 인핸서 서열, 폴리아데닐화 부위 또는 부위들, 스플라이스 부위 또는 부위들, 선택가능한 마커 또는 마커들을 코딩하는 핵산 서열, 증폭가능한 마커를 코딩하는 핵산 서열 및/또는 게놈 내 선택된 부위로의 DNA의 표적 통합으로 수용자 세포 내 게놈 DNA에 상동성인 DNA(표적 DNA 또는 DNA 서열)를 포함할 수 있다.
iii. 세포 배양법
키메라 단백질 코딩 DNA 또는 RNA를 포함하는 포유동물 세포는 세포 성장 및 DNA 또는 RNA의 발현에 적당한 조건 하에서 배양된다. 키메라 단백질을 발현하는 그러한 세포는 공지된 방법 및 본원에 기술된 방법을 사용하여 동정될 수 있고, 공지된 방법 및 또한 본원에 기술된 방법을 사용하여 키메라 단백질 제조의 증폭 하에 또는 증폭 없이 키메라 단백질을 단리시키고 정제한다. 동정은, 예를 들어 키메라 단백질을 코딩하는 DNA 또는 RNA의 존재를 가리키는 표현형을 제시하는 유전적으로 변형된 포유동물 세포의 스크리닝, 예컨대 PCR 스크리닝, 서던 블롯 분석에 의해 스크리닝, 또는 키메라 단백질 발현에 대한 스크리닝을 통해 수행될 수 있다. 키메라 단백질 코딩 DNA를 통합시킨 세포의 선택은 DNA 구성체 내 선택가능한 마커를 포함하고 선택가능한 마커 유전자를 포함하는 형질감염되거나 감염된 세포를 선택가능한 마커 유전자를 발현하는 그러한 세포만의 생존에 적당한 조건 하에서 배양함으로써 실현될 수 있다. 도입된 DNA 구성체는 증폭에 적당한 조건(예, 증폭가능한 마커 유전자의 다중 사본을 포함하는 세포만이 생존할 수 있는 약물 농축의 존재 하에 증폭가능한 마커 유전자를 포함하는 유전적으로 변형된 포유동물 세포를 배양함) 하에 유전적으로 변형된 포유동물 세포를 배양함으로써 추가 증폭될 수 있다.
키메라 단백질을 발현하는 유전적으로 변형된 포유동물 세포는, 본원에 기술된 바와 같이, 발현 생성물의 검출을 통해 동정될 수 있다. 예를 들어, 담체가 RAP, RAP 단편 또는 RAP 변이체인 키메라 단백질을 발현하는 포유동물 세포는 샌드위치 효소 면역검정에 의해 동정될 수 있다. 항체는 LRP1 결합 위치 또는 접합체의 활성제 위치에 대해 작용할 수 있다.
iv. RAP 단편 또는 RAP 변이체 폴리펩티드의 제조
본 발명에 따라 사용하기 위한 RAP 단편 또는 RAP 변이체 폴리펩티드는 본 발명의 화합물 및 조성물에 사용하기 위한 펩티드 및 생성물을 개시하기 위한 목적으로 본원에 전문이 참고인용되는 미국 특허 번호 5,474,766 및 국제 특허 출원 번호 PCT/US2006/36453에 개시된 것을 포함한다. RAP 단편 및 RAP 변이체 폴리펩티드는 당업자에게 공지되어 있는 임의의 단백질 조제법 및 정제법을 사용하여 제조된다.
리간드는 단백질의 천연 기원에서 정제되고, 리간드를 발현하는 재조합 숙주로부터 단리되거나 단백질 합성으로 잘 공지된 기법을 사용하여 합성될 수 있다. 당업자는 수용체-결합 부위를 포함하는 RAP 단편 또는 RAP 변이체를 얻기 위해 각종 그러한 기법을 쉽게 응용한다(Melman et al., J. Biol. Chem. 276 (31): 29338-29346 (2001); Savonen et al., J Biol Chem. 274(36): 25877-25882 (1999); Nielsen et al. Proc. Natl. Acad. Sci. USA 94:7521-7525 (1997); Medved et al., J. Biol. Chem. 274(2): 717-727 (1999); Rail et al., J. Biol. Chem. 273(37): 24152-24157 (1998); Orlando et al., Proc. Natl. Acad. Sci. USA 3161-3163 (1994)).
천연 RAP 단백질의 단리는 종래에 기술되었다(Ashcom et al., J. Cell. Biol. 110:1041-1048 (1990) 및 Jensen et al., FEBS Lett. 255:275-280 (1989)). RAP 변이체 및 단편은 효소 및/또는 키메라 분해에 의해 전환되어 모든 단백질의 단편을 생성하는 천연 단백질을 단리시킴으로써 생성된다. 미국 특허 번호 6,447,775는 RAP 변이체 폴리펩티드를 얻는 방법에 대한 특정 문헌으로써 본원에 참고인용된다. 또한, RAP 단편 또는 RAP 변이체는 재조합 박테리아에서 발현된다(Williams et al., J. Biol. Chem. 267:9035-9040 (1992); Wurshawsky et al., J. Biol. Chem. 269:3325-3330 (1994)). 재조합 이. 콜리 균주로부터 39 kDa RAP 단백질을 정제시키는 절차는 종래에 기술되었다(Herz et al., J. Biol. Chem. 266, 21232-21238 (1991); 미국 특허 번호 5,474,766).
플라스미드 pGEX-39 kDa을 발현하는 이. 콜리 균주 DH5알파의 배양물은 37℃에서 암피실린 100 μg/㎖가 있는 LB 배지에서 중간 대수기로 성장한다. 배양물을 30℃로 냉각시키고 0.01% 이소프로필티오-β-D-갈락토시드를 보충하여 글루타티온-S-전이효소-39 kDa 융합 단백질의 발현을 유도한다. 30℃에서 4∼6시간 유도 후, 배양물을 얼음으로 냉각하고 원심분리로 회수한다. 추가 단계는 4℃에서 실시한다. 세포 펠렛을 1% 트리톤 X-100, 1 μM 펩스타틴, 2.5 μg/㎖ 류펩틴, 0.2 mM 페닐메틸설포닐 플루오리드(PMSF), 및 1 μM 에틸렌디아민테트라아세테이트(EDTA)가 함유된 PBS에서 용해시킨다. Branson Model 450 Sonifier를 이용하여 용해물을 초음파처리하고 생성된 막 및 기타 세포 좌멸물을 15분 동안 15,000 g에서 원심분리시켜 분리한다. 회수된 상청액을 PBS 및 0.1% 아지드나트륨 중 아가로스 고정된 글루타티온 비드(Sigma Chemical Co.)와 함께 밤새 항온처리한다. 비드를 세척하고, 융합 단백질을 5 mM 감소된 글루타티온(Sigma Chemical Co.)과 경쟁시킴으로써 용출한다. 투석 후, 융합 단백질은 융합 단백질 50 μg 당 활성화된 인간 트롬빈 100 ng과 함께 밤새 항온처리됨으로써 분해된다. 글루타티온-S-전이효소 에피토프는 이후 아가로스 고정된 글루타티온 비드와 함께 추가 항온처리되어 제거된다.
상기 제시된 바와 같이, 상기 방법이 RAP의 제조 및 정제에 대해 기술하고 있지만, 다른 RAP 단편 또는 RAP 변이체도 또한 유사한 기법을 사용하여 제조될 수 있다. 그러한 리간드의 평가는 Christensen 및 Birn에서 찾을 수 있다(Am. J. Physiol. Renal Physiol., 280:F562-F573, 2001, 특히 표 2 및 이에 인용된 참고문헌 참조). 상기 리간드의 제조 및 정제 기법은 당업자에게 잘 공지되어 있다.
J. RAP 접합체의 특징
i. 표지
일부 구체예에서, RAP, RAP 단편 및 RAP 변이체를 기초로 한 활성제 접합체는 이의 검출을 용이하게 하기 위해 표지된다. "표지" 또는 "검출가능한 부분"은 분광적, 광화학적, 생화학적, 면역화학적, 화학적, 또는 다른 물리적 수단에 의해 검출가능한 조성물이다. 예를 들어, 본 발명에 사용하기에 적당한 표지는, 예를 들어 방사성 표지(예, 32P), 형광물질(예, 플루오레세인), 전자 밀집 시약, 효소(예, ELISA에 흔히 사용되는 것), 바이오틴, 디곡시게닌, 또는 합텐 및, 예를 들어 합텐 또는 펩티드에 식별용 방사선 동위원소를 도입에 의해 검출할 수 있거나, 합텐 또는 펩티드와 특이적으로 반응성인 항체를 검출하는데 사용되는 단백질을 포함한다.
상기 언급된 바와 같이, 사용된 스크리닝 검정에 따라, 접합체의 활성제, 링커 또는 RAP, RAP 단편 또는 RAP 변이체 폴리펩티드 부분이 표지될 수 있다. 접합체의 생물학적 활성이 유의적으로 방해되지 않는 한, 사용된 특정 표지 또는 검출가능한 기는 본 발명의 중요한 측면이 아니다. 검출가능한 기는 검출가능한 물리적 또는 화학적 성질을 갖는 임의의 재료일 수 있다. 따라서, 표지는 분광적, 광화학적, 생화학적, 면역화학적, 전기적, 광학적 또는 화학적 수단에 의해 검출가능한 임의의 조성물이다.
본 발명에 사용하기에 적당한 표지의 예는, 비제한적인 예로서, 형광 염료(예, 플루오레세인 이소티오시아네이트, 텍사스 레드, 로다민 등), 식별용 방사성 동위원소(예, 3H, 125I, 35S, 14C, 또는 32P), 효소(예, 호스 라디쉬 퍼옥시다제, 알칼리 포스파타아제 및 ELISA에 흔히 사용되는 기타 물질), 및 색체계적 표지, 예컨대 콜로이드 골드 또는 착색 유리 또는 플라스틱 비드(예, 폴리스티렌, 폴리프로필렌, 라텍스 등)를 포함한다.
표지는 당업계에 잘 공지된 방법에 따른 검정법의 목적하는 성분과 직접적으로 또는 간접적으로 연결될 수 있다. 바람직하게는, 일 구체예에서 표지는 본 발명에 따른 활성제를 접합시키기 위한 이소시아네이트 시약을 사용하여 생물학적 중합체와 공유결합한다. 본 발명의 일 측면에서, 본 발명의 이작용성 이소시아네이트 시약을 사용하여 생물학적 중합체에 표지를 접합시켜 이에 결합된 활성제 없이 표지 생물학적 중합체 접합체를 형성할 수 있다. 표지 생물학적 중합체 접합체는 본 발명에 따른 표지된 접합체의 합성을 위한 중간체로 사용될 수 있거나 생물학적 중합체 접합체를 검출하는데 사용될 수 있다. 상기 제시된 바와 같이, 광범위한 각종 표지는 필요한 감광성, 검정의 목적한 성분과의 접합의 용이성, 안정성 필요성, 이용가능한 기구, 및 처분 설비에 따른 표지의 선택과 함께 사용될 수 있다. 비방사성 표지는 종종 간접적 수단에 의해 결합된다. 일반적으로, 리간드 분자(예, 바이오틴)는 분자에 공유결합된다. 리간드는 또다른 분자(예, 스트렙타비딘 분자)에 결합하고, 이는 신호계, 예컨대 검출가능한 효소, 형광 화합물 또는 화학발광 화합물에 고유하게 검출가능하게 되거나 공유결합된다.
접합체는 또한 예를 들어 효소 또는 형광물질과 접합됨으로써 신호 생성 화합물에 직접적으로 접합될 수 있다. 표지로 사용하기에 적당한 효소는, 비제한적인 예로서 가수분해효소, 특히 포스파타제, 에스테라제 및 글리코시다제, 또는 옥시도타제, 특히 퍼옥시다제를 포함한다. 표지로 사용하기에 적당한 형광 화합물, 즉 형광물질은, 비제한적인 예로서 플루오레세인 및 이의 유도체, 로다민 및 이의 유도체, 단실, 움벨리페론 등을 포함한다. 적당한 형광물질의 추가예는, 비제한적인 예로서 에오신, TRITC-아민, 퀴닌, 플루오레세인 W, 아크리딘 옐로우, 리사민 로다민, B 설포닐 클로라이드 에리스로세인, 루테늄(트리스, 비피리디늄), 텍사스 레드, 니코틴아미드 아데닌 디뉴클레오티드, 플라빈 아데닌 디뉴클레오티드 등을 포함한다. 표지로 사용하기에 적당한 화학발광 화합물은, 비제한적인 예로서 루시페린 및 2,3-디히드로프탈라진디온, 예컨대 루미놀을 포함한다. 본 발명의 방법에 사용될 수 있는 각종 표지 또는 신호 생성 시스템의 평가의 경우, 미국 특허 번호 4,391,904 참조.
표지의 검출 수단은 당업자에게 잘 공지되어 있다. 따라서, 예를 들어 표지가 방사성 표지일 경우, 검출을 위한 수단은 방사능 사진촬영으로서 신틸레이션 카운터 또는 사진 필름을 포함한다. 표지가 형광 표지인 경우, 광의 적당한 파장으로 형광색소를 여기시키고 생성된 형광을 검출함으로써 검출할 수 있다. 형광은 전자 검출자, 예컨대 전하 커플링 소자(CCD) 또는 광전자 배증관 등의 사용에 의해 시각적으로 검출될 수 있다. 유사하게, 효소 표지는 효소에 대한 적당한 기질을 제공하고 생성된 반응 생성물을 검출함으로써 검출될 수 있다. 색체계적 또는 화학발광 표지는 표지와 관련된 색체를 관찰함으로써 간단하게 검출할 수 있다. 본 발명의 방법에 사용하기에 적당한 기타 표지 및 검출 시스템은 당업자라면 쉽게 알 것이다. 질병 또는 건강 상태의 진단에 상기 표지된 조절인자 및 리간드를 사용할 수 있다.
K. 약학 조성물의 사용법 및 약학 조성물의 투여 방법
접합체는 수성 또는 비수성 용액, 예컨대 식물유 또는 다른 유사한 오일, 합성 지방족 산 글리세리드, 프로필렌 글리콜 또는 고급 지방족 산의 에스테르 중에, 필요하다면 통상적인 첨가제, 예컨대 가용화제, 등장성 제제, 현탁제, 유화제, 안정화제 및 보존제와 함께 용해, 현탁 또는 유화시킴으로써 주사용 조제물로 제형될 수 있다.
접합체를 에어로졸 제형으로 사용하여 흡입을 통해 투여될 수 있다. 본 발명의 화합물은 가압된 허용가능한 추진체, 예컨대 디클로로디플루오로메탄, 프로판, 질소 등으로 제형될 수 있다.
주사 또는 정맥내 투여를 위한 단위 제형은 멸균수, 정상적 식염수 또는 또다른 약학적으로 허용되는 담체 중에 용액으로서 조성물 내에 접합체를 포함할 수 있다.
실제 사용시, 본원에 기술된 RAP, RAP 단편 또는 RAP 변이체 접합체는 통상적인 약학적 화합물화 기법에 따른 약학적 담체와 혼합시키는 결합체 내 활성 성분으로서 배합될 수 있다. 담체는, 예컨대 경구 또는 비경구(정맥내 포함) 투여에 바람직한 제제의 형태에 따라 각종 광범위한 형태를 취할 수 있다.
투여의 경피성 경로와 관련하여, 약물의 경피성 투여 방법은 문헌[Remington's Pharmaceutical Sciences, 17th Edition, (Gennaro et al. Eds. Mack Publishing Co., 1985)]에 개시된다. 진피 또는 피부 패치는 본 발명의 방법에 유용한 접합체의 경피성 전달에 바람직한 수단이다. 패치는 바람직하게는 화합물의 흡수를 증가시키기 위해 DMSO와 같은 흡수성 인핸서를 제공한다. 경피성 약물 전달을 위한 다른 방법은 미국 특허 번호 5,962,012, 6,261,595, 및 6,261,595에 개시된다. 이의 각각은 본원에 전문이 참고인용된다.
약학적으로 허용되는 부형제, 예컨대 매개체, 보조제, 담체 또는 희석제는 구입 가능하다. 또한, 약학적으로 허용되는 보조제 물질, 예컨대 pH 조절제 및 완충제, 강장조절제, 안정화제, 습윤제 등이 구입 가능하다.
당업자는 투여량 수준이 특이적 화합물의 기능, 증상의 중증도 및 부작용에 대한 피험체의 민감성에 따라 달라질 수 있음을 쉽게 알 것이다. 제시된 화합물에 대한 바람직한 사용량은, 비제한적인 예로서 환자, 실험실 동물, 및 생체내에서 수행된 투여량 반응 및 약력학적 평가를 비롯하여 각종 수단에 의해 당업자에 의해 쉽게 측정가능하다.
상기 각 측면에서, 임의의 제시된 경우에서 가장 적당한 경로는 부분적으로 치료될 병태의 성질 및 중증도 및 활성 성분의 성질에 따라 달라지겠지만, 조성물은, 비제한적인 예로서, 경구, 직장, 국소, 비경구(피하, 근육내, 및 정맥내 포함), 폐(비내 또는 협측 흡입), 또는 비내 투여에 적당한 조성물을 포함한다. 투여의 예시적 경로는 경구 및 정맥내 경로이다. 조성물은 편리하게 단위 제형에 존재할 수 있고 약학 분야에 잘 공지된 방법 중 어느 하나에 의해 제조될 수 있다.
본 발명의 조성물은 바이러스 엔벨롭 또는 소포 내에 캡슐화되거나 이에 접합되어 투여되거나, 또는 세포 내에 도입될 수 있다. 소포는 통상 구형이고 종종 지질인 교질세포 입자이다. 리포솜은 이중층 막으로부터 형성된 소포이다. 적당한 소포는, 비제한적인 예로서, 단층판(unilamellar) 매개체 및 다층판(multilamellar) 지질 소포 또는 리포솜을 포함한다. 그러한 소포 및 리포솜은 표준 기법, 예컨대 미국 특허 번호 4,394,448에 기술된 것을 사용하여 광범위한 지질 또는 인지질 화합물, 예컨대 포스파티딜콜린, 포스파티드산, 포스파티딜세린, 포스파티딜에탄올아민, 스핑고미엘린, 당지질, 강글리오시드 등에서 제조될 수 있다. 그러한 소포 또는 리포솜은 세포내로 화합물을 투여하고 표적 장기로 화합물을 전달하는데 사용될 수 있다. 관심 p97 조성물의 제어된 방출은 또한 캡슐화를 사용하여 실현될 수 있다(예, 미국 특허 번호 5,186,941 참조).
RAP계, RAP 단편계 또는 RAP 변이체계 활성제 접합체를 혈류에 전달하는데 임의의 투여 경로를 사용할 수 있다. 바람직하게는, 조성물은 말초적으로, 가장 바람직하게는 정맥내 또는 심장 도관에 의해 투여된다. 경정맥내 및 경동맥내 주사 또한 유용하다. 조성물은 국소적으로 또는 부위별로, 예컨대 복강내 또는 근육 위 피하에 투여될 수 있다. 일 측면에서, 조성물은 적당한 약학적 희석제 또는 담체로 투여된다.
투여될 투여량은 개인의 필요, 목적하는 효과, 사용되는 활성제, 생물학적 중합체 및 선택된 투여 경로에 따라 달라질 것이다. 바람직한 접합체 투여량은 약 0.2 pmol/kg∼약 25 nmol/kg의 범위이고, 특히 바람직한 투여량은 2∼250 pmol/kg 범위이며; 대안적으로, 바람직한 접합체 투여량은 0.02∼2000 mg/kg 범위일 수 있다. 이러한 투여량은 생물학적 중합체와 결합된 활성제 또는 약물 부분의 수에 영향을 미칠 것이다. 대안적으로, 투여량은 투여된 활성제를 기초로 계산될 수 있다.
바람직한 구체예에서, 접합체는 RAP 변이체를 포함한다. 예를 들어, 아드리아마이신 0.005∼100 mg/kg을 포함하는 RAP, RAP 단편 또는 RAP 변이체-아드리아마이신의 용량은 또한 생체내에 유용하다. 아드리아마이신 0.05 mg/kg∼20 mg/kg을 포함하는 RAP, RAP 단편 또는 RAP 변이체-아드리아마이신의 용량이 특히 바람직하다. 당업자는 화합물의 유리 형태로 사용되는 권장량을 부분 기초로 RAP 변이체에 연결된 화합물에 적당한 용량을 측정할 수 있다. 활성제와 RAP 변이체의 접합은 일반적으로 동일한 효과를 얻기에 필요한 약물 양을 감소시킨다.
본 발명의 접합체 및 조절인자는 동물, 및 특히 인간에서 치료, 예방 및 진단성 개재에 유용하다. RAP, RAP 단편 또는 RAP 변이체 화합물은 특정 조직에 우선적인 축적이 제시할 수 있다. 진단 용도를 위한 바람직한 의학적 징후는, 예를 들어 관심 표적 장기(예, 폐, 간, 신장, 비장)과 관련된 임의의 병태를 포함한다.
본 발명의 방법은 각종 상이한 병태의 치료에의 용도를 발견한다. 특정 구체예에서, 목적하는 활성을 갖는 활성제 또는 약물이 종래에 확인되었지만, 상기 활성제 또는 약물이 표적 부위, 부분 또는 구획으로 적절하게 전달되지 않아서 완전히 만족하는 치료 결과를 생성하지 않는 질병 상태에서의 본 발명의 방법의 용도가 특히 관심의 대상이다. 그러한 활성제 또는 약물과 함께, 활성제를 RAP, RAP 단편 또는 RAP 변이체에 접합시키는 본 발명의 방법은 활성제 또는 약물의 치료적 효능 및 치료 지수를 향상시키는데 사용될 수 있다.
본 발명의 접합체를 이용함으로써 치료가능한 특이적 질병 상태는 접합체에 존재할 수 있는 각종 유형의 약물 부분이다. 따라서, 간에 영향을 미치고 본 발명의 방법에 의해 치료가능한 질병 상태는 세포 증식 질병, 예컨대 신생물 질병, 자가면역 질병, 호르몬 이상 질병, 퇴행성 질병, 노화 질병 등을 포함한다.
치료는 질병 획득의 가망성 감소, 질병의 예방, 질병의 서행, 정지 또는 역전, 진행 또는 숙주를 괴롭히는 병태와 관련된 증상의 개선(여기서, 개선 또는 이득은, 광의의 의미로는, 변수, 예컨대 치료될 병리학적 병태, 예컨대 염증 및 이와 관련된 통증과 관련된 증상의 규모에서 적어도 감소가 언급됨)을 비롯하여 접합체의 투여와 관련하여 피험체로의 임의의 이로운 결과를 포함하는 것을 의미한다. 따라서, 치료는 또한 병리학적 병태, 또는 적어도 이와 관련된 증상이 완전하게 억제, 예컨대 발생이 방지되거나, 또는 숙주가 더이상 병리학적 병태, 또는 적어도 병리학적 병태를 특징으로 하는 증상으로 곤란을 겪지 않도록 정지, 예컨대 종료되는 상황을 포함한다.
L. RAP 접합체의 간으로의 전달
대부분의 간은 문맥에 의해 주로 관류된다. 초회 통과 포획의 효능과 결부시켜, 동맥 혈액에 대한 종양의 의존도는 RAP 접합된 화학요법제의 정맥내 투여 후 비암성(non-cancerous) 간 조직의 상당 부분을 살릴 수 있을 것이다.
간 맥관구조에 의해 갖게 되는 잠재적인 이점 이외에, HCC 종양 세포 및 주변 조직 상의 LRP1의 상대 발현 수준은 RAP 접합체의 효능을 추가로 촉진할 수 있다. 연구들은 신생물 형질전환 후 간세포 상의 LRP1 발현의 10배 이상의 향상을 입증하였다(23). 현저하게 대조적으로, 다른 문헌들은 비암성이지만 간경변인 간 조직에서 상당히 저발현되는 것으로 제시되었다(24). 병에 걸린 간의 어디에서든 발현이 감소되는 종양 세포 상에서 향상된 LRP1의 발현은, 제1 우회 포획을 이용한 동맥 전달과 같이, 종양 조직을 선호하는 RAP 접합체의 불균일한 전달을 초래할 것이다. 화학요법제에 대해 신속하게 급증하는 종양 세포의 민감도가 통상 향상되는 것과 함께, 불균일한 전달은 대부분의 HCC 환자에서 감소된 간 여력에 제시되는 치료로 장벽을 우회할 수 있다.
간세포 암종을 치료하는 효과적인 방법은 이트륨-90(90Y)의 투여이다. 90Y는 각종 종양에 대해 항생제 효능이 높은 암 화학요법제이다. 90Y의 부식은 높은 에너지의 베타 입자를 생성하여, HCC에 일반적인 것과 같은 거대한 고체 종양에 대해 특히 양호한 선택이 되게 한다. 이트륨은 부식에 안정한 성분인 지르코늄이 된다. 간세포 종양으로의 90Y의 전달은 최근 동맥교류형 카테터화에 의해 투여된 핵종 함유 불용성 유리 비드(THERASPHERETM)의 사용으로 실현된다. 이러한 방법은 거대하고 잘 규정된 종양의 치료에 효과적이지만 복수의 작은 종양과 관련된 경우 또는 전이와 관련된 경우에는 덜 유용하다. 또다른 접근은 90Y 또는 다른 화학요법제가 선택적으로 종양 세포를 표적하는 제제에 접합되는 것이다. 이러한 접근의 예는 주사 후 90Y가 적재된 금속 킬레이트화제를 갖는 비호지킨성 임파종 치료제 ZEVALIN®(이브리투모맙 티우세탄), 항-CD-22 단일클론 항체에서 발견될 수 있다.
RAP는 투여 후 간으로 신속한 확산을 입증한다. 단백질 30 피코몰의 정맥내 환약 주사 후, 70% 이상의 외인성 RAP가 10분 내에 간에 축적된다(20). 주사된 RAP의 순환성 반감기는 1분 미만이다. 이러한 약력학은 또한 쥐에서 정맥내 주사로 최대 2.5 mg/kg (60 nmol/kg)가 관찰된다(20). 유사한 약력학은 또다른 높은 친화성 LRP1 리간드, 프로테아제-활성 α-2-마크로글로불린, 725 kD 사량체 혈청 당단백질에 대해 보고되었다(21). 소량의 RAP(주사된 투여량의 < 1%)만이 심장, 뇌, 근육 또는 신장에 축적되며, 이러한 조직에서 RAP 결합 LDLR의 조직과 혈관 발현 둘다는 상기 분야에 경미하다고 제시된다. 정맥내 투여된 RAP는 쥐과 및 고양이과 종에서 측정가능한 독성이 없었음을 제시되었다. 간에 의한 RAP의 포획 효능은 간세포 상에 풍부한 세포 표면 헤파린 설페이트 프로테오글리칸과 초기에 낮은 친화도로 결합하는 단계 후 LRP1에 의해 고 친화도 결합과 엔도시토시스(1,22)를 이용하여 향상된다. 본 발명에 따라, 정맥내 투여 후 간으로의 RAP-접합된 화학요법제, RAP 단편-접합된 화학요법제 또는 RAP 변이체-접합된 화학요법제, 예컨대 90Y의 거의 정량 전달은 이러한 약물과 관련된 전신 독성을 유의적으로 감소시켜, HCC의 치료 동안 환자에의 위험을 감소시킬 것이다. 90Y 또는 기타 활성제와 접합된 RAP 또는 RAP 단편 또는 변이체는 활성제를 간으로 전달하는 효과적인 방법을 제공한다.
다수의 인자들이 RAP 접합체에 의한 선택성 간 종양 표적화를 선호하지만, 이는 또한 그러한 제제가 전이된 HCC에 효과적일 것임을 시사한다. 전이된 종양 세포는 이소성 부위에 이주됨으로써 이의 특성을 그대로 유지시키려는 경향이 있어서, 간외성 전이된 인간 HCC에서 LRP1의 줄지않은 발현을 입증한다(25). 이러한 요인은 RAP, RAP 단편 및 RAP 변이체 및 적당한 화학요법제 또는 다른 활성제의 정맥내 투여 접합체에 민감성이 유사한 HCC가 전이되게 할 수 있다.
M. 간 질환
본 발명의 일 측면은 간 질병의 치료를 위해 RAP, RAP 단편 또는 RAP 단편 또는 변이체에 화학요법 약물 또는 기타 제제를 접합시켜 간으로 치료 화합물을 전달하는 것을 포함한다. 간 질병을 치료하기 위해 RAP 접합체의 투여는 간에 의한 제제의 제거율, 또는 혈장 막에서의 내약물성 기작(MDR, P-당단백질)과 같은 간 질병의 치료와 관련된 여러가지 과제들이 제기될 것이다.
본 발명에 의해 고려된 간 질병은, 비제한적인 예로서, 하기 논의된 질환을 포함한다. 간세포 암종, 또는 간암(hepatoma)은 세계에서 5번째로 가장 흔한 암이며 발생률은 계속 증가하고 있다. 발암성 간세포는 높은 수준의 LRP1 발현을 유지한다. 간세포 암종은 화학요법에 잘 반응하지 않는데, 그 이유는 종양 세포가 높은 비율의 내약물성을 보이고 사용된 화학요법이 전신(정맥내) 투여로 인해 특히 심장 및 신장에 심각한 독성을 갖기 때문이다.
간염은 간의 염증에 대한 총칭이다. 간염은 급성 또는 만성일 수 있고, 예를 들어 바이러스(예, 간염 A, B, C, D 또는 E 또는 ABCDE외, CMV, 엡스테인바), 진균, 리케치아 또는 기생충 감염, 알콜, 화학적 독소, 약물(예, 아세타미노펜, 아미오다론, 이소니아지드, 할로탄, 클로르프로마진, 에리스로마이신), 대사성 간 질병(예, 윌슨 질병, 알파1-항트립신 결핍), 암, 특발성 자가면역 간 질병, 간경변(예, 1차 담즙 간경변), 담도 폐쇄로 인한 급성 또는 만성 간부전을 포함한다. 간염 A, B 및/또는 C 바이러스에 의한 간 감염은 간 부전을 일으키는 서행성 간 질병을 초래할 수 있다. 급성 간염 감염은 간염 A에 의해 가장 흔하게 야기된다. 간염 B 및 간염 C 감염은 둘다 체내에 잔존할 수 있고 다년간의 감염(만성)이 될 수 있다. 간염 C는 간경변 및 암을 비롯한 치명적인 병태를 야기할 수 있다.
RAP 또는 RAP 단편 또는 변이체와 접합된 조성물을 사용하여 치료가능하게 간주되는 추가의 간 질환 또는 병태는 간 지방증(미국 특허 6,596,762), 담즙정체증(미국 특허 번호 6,069,167), 간경변, 독성 간 손상, 간절제술 후 병태, 및 담도 폐쇄를 포함한다.
간 질병의 치료를 위한 RAP 또는 RAP 단편 또는 변이체에의 접합을 위한 후보자 약물은, 비제한적인 예로서, 5-플루오로우라실, 독소루비신(아드리아마이신), 미토마이신 C, 시스플라틴, 에피루비신, 다우노루비신, 에토포시드, 및 표 1에 제시된 기타 화학요법제, 아데포비르, 라미부딘, 엔테카비르, 리바비린, 인터페론 알파, 페길화된 인터페론 알파-2a, 인터페론 알파-2b 및 기타 항바이러스, 비타민 E, 우르소데옥시콜산, 및 간 질환을 치료하는데 사용된 기타 제제를 포함한다.
Figure 112009023293844-PCT00001
Figure 112009023293844-PCT00002
Figure 112009023293844-PCT00003
본 발명의 추가 측면 및 상세한 설명은 한정하려고 하는 것보다는 예시적으로 간주되는 하기 실시예에서 분명해질 것이다.
도 1A-B는 RAP d3, MegaRAP1 d3 (RAPv2A d3) 및 중간 서열 변이체가 LRP2 CR89 및 LRP1 CR3-5에 결합한 것을 도시한다. 도 1A는 RAP d3 돌연변이체 및 RAPv2A d3 복귀 돌연변이체가 LRP2 CR89에 결합한 것을 도시한다. 도 1B는 RAP d3 돌연변이체 및 RAPv2A d3 복귀 돌연변이체가 LRP1 CR3-5에 결합한 것을 도시한다. 데이타를 플로팅하고 단일 결합 부위를 추정하여 비선형 회귀법으로 대입(GraphPad Prism)하였다. Kd값 표준 편차는 회귀 분석으로부터 유도되었다.
도 2는 RAP 펩티드-독소 접합체를 LRP1 수용체 발현 세포에 투여 후 세포 사망의 백분율을 도시한다.
도 3은 환형 RAP의 구조 및 다량체 환형 RAP 펩티드를 도시한다.
도 4는 생체내 조직에서 mRAPc 소중합된 펩티드의 흡수 및 생물학적분포(bio-distribution)를 도시한다.
표 2는 RAP d3 및 RAP v2 (RAP v2A) 변이체가 LRP1 CR3-5 및 LRP2 CR89에 결합하는 데이타를 제시한다. NF는 결합을 측정할 수 없거나 단일 결합 부위를 추정하여 비선형 회귀법으로 신뢰성 있게 데이타를 대입할 수 없는 것을 가리킨다. 최대 결합의 백분율은 각 리간드에 대해 테스트된 최고 농도에서의 OD 비율 및 상기 농도에서 모든 그러한 리간드에 대해 측정한 OD 최고값이다.
실시예 1 : LRP1 경로를 통한 RAP 접합체의 세포로의 독소 전달
세포독성제에 접합된 RAP 펩티드가 세포로 독성을 효과적으로 전달하여 세포 사멸을 시작하는지 여부를 측정하기 위해, 시험관내 검정을 사용하여 RAP-LRP1 결합을 통한 독소 전달 및 내재화 경로를 평가하였다.
야생형 및 LRP1-결핍 CHO-K1 세포는 5% 우태 혈청이 보충된 BioWhittaker Ultra-CHO에서 성장시켰다. 실험 이전에 48시간 동안 12 웰 플레이트에 세포를 접종하였다. RAP d3의 일부(미니-RAPc, Hep1 : 바이오틴-GGSGGCGFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGGC)(서열 번호 9)와 상응한 내적으로 이황화물이 연결된 바이오틴화 절두 펩티드는 스트렙타비딘과 박테리아 독소 사포린(ZAP; 샌디에고 소재하는 Advanced Targeting Systems) 사이에서 동몰량의 접합체로 조합되었다. 성장 배지로 혼합물 을 100 nM로 희석시키고 두 세트로 만들어 웰에 첨가하였다. 대조군으로서, 100 nM 농도에서 RAP d3 펩티드 단독(미니-RAPc), 스트렙타비딘-사포린 접합체 단독(ZAP)과 함께, 그리고 1 μM에서 사포린 단독(SAP)과 함께 복제물 웰을 항온처리하였다. 가습된 챔버 내 37℃, 5% CO2에서 48시간 동안 세포를 항온처리하였다. MTT 검정 키트(Invitrogen; 샌디에고 소재)를 이용하여 각 처리 조건에 대한 세포 생존력을 측정하였다.
도 2는 펩티드만으로는 세포 생존에 유의적 효과가 없는 것을 제시하고 있다. 스트렙타비딘-사포린 접합체만으로는, LRP-결핍형 세포에서 효과 없이, 야생형 CHO-K1에 대해 생존가능한 세포수가 대략 10% 감소되었다. 펩티드 및 세포독성 접합체의 조합은 LRP-결핍형 CHO K1에서 5%의 손실만 가지고 야생형 CHO-K1에 대해 생존가능한 세포수가 거의 40% 감소되었다. 사포린 단독(1 μM)은 약 55%(야생형) 및 35%(LRP-결핍형)의 손실을 초래한다.
이러한 데이타는 RAP d3 펩티드가 LRP1 세포내 경로를 통해 결합 독성의 내재화를 효과적으로 조정할 수 있고, 화합물 및 치료제를 전달하는 유용한 시스템을 제공한다.
실시예 2: 생체내 RAP 및 RAP 펩티드 접합체 투여
B형 간염 바이러스의 감염은 자각증상이 없는 감염, 급성 간염, 전격성(빠르고 중증인 개시) 간염, 또는 만성의 낮은 수준의 잔류성 감염의 발달까지의 각종 결과를 유발할 수 있다. 감염된 성인의 5∼10%는 만성 보균자가 될 것이다. 만성 보균자의 상태로 있는 성인 중, 25∼35%는 간경변 또는 간세포 암종(HCC)의 감염 합병증으로 결국 사망할 것이다. 발달 중인 간세포 암종의 가능성 또한 알콜 중독, 흡연 및 비만으로 증가한다. 상기 질병에 대한 예후는, 보고된 5년 중간 생존율이 5% 미만으로 조악하다.
HCC는 5번째로 가장 흔하게 진단되는 악성 종양이며, 세계적으로 매년 거의 500,000명의 사망이 보고된다. 종양 조직의 외과적 제거, 이식 및 물리적 파괴가 치료를 위한 첫번째 선택이지만, 5∼10%의 환자만이 이러한 접근에 적당한 종양을 제시하고 있는 실정이다(13-15). 또한, 전신 화학요법은, 화학요법제의 독성과 종양 세포의 내성으로 인해 15∼20%의 낮은 반응률을 얻는다.
예를 들어, 독소루비신은 광범위하게 다양한 종양에 대해 효율이 높은 암 화학요법제이며, 특히 종양 세포를 비롯한 급성장하는 세포에 대해 유독하다. 하지만, 간세포 암종의 치료에서 독소루비신의 사용은 간과 심장에의 유의적 독성 및 혈액 세포 생산의 억제로 인해 한정된다(34). 또한, 간세포 암종 세포는 빠른 속도로 내약물성 유형으로 전환됨을 보여준다(35).
치료에 대한 대안적 접근은 방사선을 이용한다. 예를 들어, 최근 치료될 간 암에 대한 새로운 치료는 종양 조직을 관류시키는 작은 혈관으로 통과시키는 주요 간 동맥으로 방사성 재료(90Y)로 표지한 현미경 유리 비드를 주사하는 것을 병용한다. 이후 방사선은 종양 조직을 파괴한다. 하지만, 간 동맥에서 폐까지의 혈액의 중요한 문합은 다수의 환자에서 유리 비드의 사용을 방해한다. 위장관을 공급하는 동맥으로 유의적인 비드의 환류는 또한 심각한 부작용을 야기할 수 있다. 따라서 종양 조직에의 효과적인 방사선 치료 전달은 혈관에서 포집될 거대한 재료에 의존하지 않는 보다 직접적인 접근을 요구한다.
생물학적분포 및 치료제의 효능을 테스트하기 위한 간세포 암종(HCC)에 대한 관련 동물 모델은 우드척 간염 바이러스(WHV)에 감염된 이스턴 우드척다람쥐이다(33). 신생아기에 바이러스 감염된 거의 모든 우드척은 24개월의 중간 간격 내에서 HCC를 발달시킨다. 중간 평균 여명은 30개월이지만, WHV에 감염된 우드척은 HCC 환자 대다수가 제시하는 증상인 간경변이 발달하지 않는다. 우드척 간염 바이러스 및 인간 B형 간염 바이러스는 구조, 유전적 특징, 매개(transmission) 방법, 감염 과정 및 간세포 암종으로의 진행이 유사하다. 상기 모델의 중요성을 강조하는 유의적인 유사성이 존재한다. 인간과 유사하게, 출생 후 단시간에 간염 바이러스에 노출된 모든 우드척의 절반 이상이 만성 감염을 발달시키고 거의 모든 만성 감염된 우드척은 노출 후 대략 20∼28개월 간 간세포 암종을 발달시킨다. 나머지 접종된 신생아기 우드척은 종종 급성 간염이 발달하지만, 바이러스에 대한 항체가 발달되거나 회복될 것이다. 이러한 "회복된" 동물의 17∼25%는 노출 후 29∼56개월에 HCC를 발달시킨다. 간염 감염에서 분명히 회복된 후 HCC의 발달은 또한 인간에서도 제시된다.
간으로 제제의 전달 하에 RAP 및 RAP 펩티드의 효과를 측정하기 위해, 우드척 HCC 모델에서 대조군과 RAP 펩티드 접합 치료제의 흡수와 독성을 연구한다. 6마리의 만성 감염된 우드척과 4마리의 미감염된 우드척(대략 1.5∼2살)을 이용한다.
약력학의 초기 테스트로서, RAP 펩티드를 90Y(GE Healthcare)에 접합시키고, 이를 마취된 HCC 보유 우드척에 정맥내 투여한다. RAP 펩티드는 N 말단에서 DOTA 킬레이트화 부분을 포함하여 방사성 동위원소, 예컨대 90Y를 적재할 수 있다. 따라서, RAP 펩티드의 변성은 이트륨-90으로 변성된 RAP 펩티드의 항온처리를 통해 RAP 펩티드-90Y를 생성할 수 있다. 일반적인 전달 화합물은 다음과 같은 특징을 통상 제시할 것이다: 1) 이미 저하된 간 기능에 악영향을 미치지 않음, 2) 간 및 악성 간 조직에 의해 측정가능한 흡수, 및 3) 흡수 하에, 종양 세포에 유독하고 종양 퇴화를 야기함.
대조군으로서, 추가의 종양 보유 우드척은 동몰량의 자유 90Y 또는 말레이미도-DOTA에 접합된 C 말단 시스테인을 포함하는 박테리아 발현된 전장 RAP를 주사하여 RAP-90Y를 생성한다.
90Y는 잘 규정된 독성 및 발암성 프로파일을 갖는다. RAP 펩티드-DOTA-90Y 접합체의 약력학 프로파일이 신속하고 거의 정량적인 간 축적으로 RAP와 상당하게 상이하지는 않을 것으로 예상된다. RAP 펩티드 약력학은 LRP1 기능, 서열 및 발현이 아문 내에 강하게 보존되기 때문에 모든 포유동물 종에서 매우 유사할 것이다. 유사하게, RAP 서열은 인간 서열이 다른 영장류의 서열과 동일하지만, 포유동물 종 중에서는 상동하다.
동물 비교의 기선 수준을 측정하기 위해, 혈청은 다음과 같은 분자의 기선 수준 및 바이러스 적재를 분석한다: 알칼리 포스파타제(ALP)-담관암과 관련된 효소; 이들이 차단되는 경우 종종 증가됨; 아스파르테이트 아미노전이효소(AST)-AST는 손상된 세포로부터 방출되는 간 내 세포질 효소이며, 바이러스 간염 및 AST보다는 간에 더욱 특이적인 간 독성 알라닌 아미노전이효소(ALT)에서 가장 높은 상승이 발생하지만, 또한 신장 및 근육에도 존재함. AST의 상승이 간에서 기원(예, AST 및 ALT의 상승)하는 것을 확인한다는 것은 간세포의 상해를 강하게 시사한다; 빌리루빈, 접합된 빌리루빈의 불균형한 상승이 담즙정체증 및 만성 간 질병의 후기 과정에서 제시되고 혈청 빌리루빈이 간세포 손상으로 증가함; 알부민, 이것은 간이 충분한 양의 단백질을 제조하는지 여부와 무관하게 간에 의해 제조된 주요 단백질을 측정함; 감마-글루타밀 전이효소(GGT), 이것은 간세포에서 발견되는 효소이며 간 손상 및 수복에 매우 민감함; 간 세포에서 발견되는 락트산 탈수소효소(LDH), 세포 사멸 및/또는 상해로 인한 세포로부터의 누출물에서 통상 증가가 발견됨; 프로트롬빈 타임(PT), PT는 비타민 K 의존 인자 II, VII, IX 및 X의 간 합성(PT 내 상승은 간 기능부전의 징후일 수 있음), 및 감염과 싸우는 것을 돕는 항체를 비롯한 혈액 내 알부민 및 모든 기타 단백질들을 측정하기 위한 총 단백질 수준에 의존함.
치료 전에 간의 기본 상태를 측정하면 동물을 마취시키고 양 뒷다리를 면도하고 세정한다. 다리 내 주요(발목뼈) 정맥을 노출시켜 카테터를 한쪽 다리에 꽂아넣는다. 이후 우드척을 자기 공명 화상화기(MRI), 7T MRI에 배치한다. 간의 정찰 화상을 획득하여 간의 위치 및 크기를 측정한다. 우드척의 기계적 호흡을 제어하는 다중절편, 다중에코 T2-무게 화상은 간 전체와 임의의 종양의 위치를 고품질의 화상으로 형성하기 위해 획득된다. 카테터를 통해 명암대비제(가돌리늄)를 주사하여 T2 화상의 화질을 향상시키고 종양의 위치를 찾는다. 간은 또한 2D-CSI(2차원 화학적 이동 화상화) 인 분광기를 이용하여 화상화된다. 화상화가 종료되면, MRI에서 마취된 우드척을 꺼내고 테스트 제제의 투여를 준비한다.
2마리의 감염된 우드척에서, 카테터가 꽂혀있는 쪽이 아닌 다리의 정맥에 RAP 펩티드-90Y를 주사한다. 감염된 우드척의 두번째 쌍에서, RAP 펩티드-90Y를 주사한다. 감염된 우드척의 세번째 쌍은 DOTA-90Y를 주사할 것이다. 이러한 상태는, 90Y가 표적 부분에 결합하지 않기 때문에 음성 대조군으로서 작용한다. 4마리의 대조군 우드척은 식염수에 용해된 RAP 펩티드-90Y 또는 RAP-90Y로 주사되어 병든 생존군과 건강한 생존군을 이용한 동물에서 2개의 테스트 화합물의 상대 분포의 비교를 제공할 것이다.
약물 주입 시점에서 출발하여 매 5분 마다 대측성 카테터에서 별도의 멸균 용기로 혈액을 수집한다. 약물을 주사한 지 30분 후, 우드척을 안락사시키고 시체 전부를 동결시킨다. 모든 우드척으로부터 실험 동안 수집된 모든 혈액 샘플을 분석하여 혈액 내 순환 중인 90Y-표지된 약물의 양을 측정한다.
펩티드의 STD10(처리된 동물의 10%에서 중증의 독성을 초래하는 것) 측정이 확립된 후 비설치류에서 1/10 등가 용량을 테스트한다. 조직병리학과 함께, 간 효 소의 상승은 간 독성의 믿을만한 척도이어야 한다. 비설치류 종에서 중증의 독성 부재는 쥐 STD10 인간-등가 용량의 1/10에서 제 I상 연구를 위한 인간 출발 용량을 직접적으로 계산을 할 수 있다. 대략의 효과적인 용량 계산은 이전의 데이타를 기초로 할 수 있다. 효과적인 용량 100 피코몰/kg (3 nmol/m2)은 500 MBq 용량, 90Y가 있는 RAP 펩티드-DOTA의 정량 적재 및 몰 당 74 페타벡퀘렐의 YCI3에 대한 특이적 활성으로 간주함으로써 유도된다.
HCC 세포를 일정하게 선호하는 RAP 및 RAP 펩티드 및 기타 화합물의 간으로의 1차 전달은 다른 조직 부위와 비교하였을 때 RAP를 통한 간으로의 제제의 효과적인 바람직한 전달을 시사한다. 정상 조직을 선호하는 유의적인 간 외 전달 또는 간 전달은 전달 경로가 간 및 HCC 세포에 특이적이지 않음을 제시한다.
또한, RAP 단백질 및 RAP 펩티드의 투여 및 약력학 프로파일의 분석은 RAP 펩티드 및 전장 RAP 단백질이 간으로 활성제를 수송하는데 효과적인 분자들이며, RAP-접합체 및 RAP 펩티드-접합체가 생체내 비접합된 전장 RAP의 LRP-1 표적 양상을 모방하는 것을 측정하는 방법을 제공한다.
따라서, 전장 RAP LRP-1 특이적 결합을 모방하는 전장 RAP와 보다 짧은 RAP 단편 모두가 건강한 조직에서 독성의 유도 없이 치료 화합물을 간으로 전달하는데 효과적인 수단이다.
실시예 3: 생체내 투여 후 RAP 분포 분석
RAP, RAP 단편 또는 RAP 변이체가 다른 조직보다 간에 더욱 특이적으로 표적 화되는지 여부를 측정하기 위해, 90Y에 접합된 단편 및 RAP 단백질의 위치 측정 및 분포를 수행한다. 동물은 또한 조절 약물 및 종양 세포의 위치 측정 및 분포가 모니터링된다.
90Y 표지된 펩티드 또는 단백질 치료제의 단일 투약 후 수컷 우드척(마르모타 모낙스; Marmota monax)의 조직 내 잔류 방사능의 상대 수준을 측정하기 위해, 처리된 동물의 동결 절편을 분석한다. 간의 종양 및 비 종양 부분을 구별하는 것은 특별한 노력이 든다.
분석된 조직 절편은 지방 조직, 위장관, 피부, 신장, 척수, 간, 비장, 부신, 종양 조직, 비종양 조직, 흉선, 골(척추), 폐, 갑상선/부갑상선, 골수, 림프절, 뇌, 심근, 췌장, 위벽, 침샘(귀밑샘), 및 소장과 대장을 포함할 수 있다.
희생 후 즉시, 각 동물 견본은 CO2/헥산에서 급속 냉동시킨다. 당업계의 동물 관리 프로토콜 표준법에 따라 2% 카르복시메틸셀룰로스(CMC)에 박히게 되는 동결절편에 적당한 동물 견본을 제공하는데 적당한 단계를 취한다. 견본 블록은 Leica CM-3600 동결절편기 내에서 30 ㎛로 절편된다.
절편은 16시간 이상 동안 절편기 동결캐비넷 또는 대략 30분 동안 ThermoSavant 동결건조기에서 동결건조된다. 각 절편의 대표물을 30분, 1, 2, 6, 12, 24, 48 및 72시간 동안 (약 4℃에서 냉장된 납 상자 안에서 배경 방사선 인위구조를 최소화한) 14C 화상판에 노출시켜 시간의 손실 없이 최상의 공명을 제공한 다. 노출 후, Fuji BAS-2500 스캐너 및 Fuji Image Reader 소프트웨어 버전 1.1로 화상판을 판독한다.
RAP 접합체는 주로 피험체 동물의 간, 특히 간세포 암종 또는 기타 간 손상을 갖는 것에서 발견될 것으로 예상된다.
실시예 4: 최소화된 RAP 펩티드의 발생 및 LRP1 에 대한 결합 친화력의 상승
추가의 최소화된 RAP 펩티드를 본원에 기술된 바와 같이 발생시켰다.
mRAP-8c 및 mRAP-14c로 고안된 2개의 추가의 펩티드를 발생시켰다. mRAP-8c(서열 번호 10)는 단편의 N 말단에 아미노산 치환 E246C, L247Gi 및 C 말단에 치환 L311G, S312C를 포함한다. mRAP-14c(서열 번호 11)는 아미노산 치환 F250C 및 L308G, Q309C를 포함한다. 서열 바이오틴-GGSGG(서열 번호 12)를 각 펩티드의 N 말에 첨가하였다.
고상 결합 검정법으로 LRP1 클러스터 II에 대한 mRAP-8c 및 MRAP-14c 펩티드의 친화도를 측정하였다. 간단히 말해서, 재조합 인간 LRP1 클러스터 II(R&D Systems, C 말단 Fc 태그를 갖는 아미노산 786-1165, 1 μg)를 사용하여 4℃에서 밤새 5 mM CaCl2로 보충된 TBS pH 8(TBSC)로 Nunc MAXISORPTM 96웰 플레이트를 코팅하였다. TBSC로 웰을 세척하고 2% BSA 함유 TBSC로 블로킹한다.
스트렙타비딘과 바이오틴화된 펩티드 간의 복합체를 수반하는 검정에서, 억제제의 존재 또는 부재 하에 실온에서 0.05% Tween-20이 보충된 상기 블로킹 완충제 중에서 2시간 동안 고정된 수용체와 함께 LRP1 리간드를 항온처리하였다. 항바 이오틴 항체 및 바이오틴화된 펩티드의 복합체를 수반하는 검정에서, 모든 억제제 용액을 RAP d3 리간드의 직접 첨가 전에 1시간 동안 고정된 LRP1-C2와 미리 항온처리하였다. CR 쌍의 리간드 결합능은 칼슘을 요구하기 때문에, 50 mM EDTA의 존재 하에 동일한 결합 반응을 실시하여 비특이적 결합의 척도를 제공하였다. 5 mM CaCl2 및 0.05% Tween-20이 보충된 TBS로 웰을 세척하였다.항-S-펩티드-HRP 접합체(Abeam) 또는 항-α-2-마크로글로불린-HRP 접합체(Abeam)를 이용하여 결합된 리간드를 검출하였다. 과잉 HRP 접합체를 제거하고 웰을 세척하였다. TMB 시약(BioRad; 캘리포니아주 헤르큘러스 소재)을 사용하여 색조를 현상시켰다. 마이크로평판 분광광도계(Molecular Devices, Palo Alto)를 이용하여 450 nm에서의 흡광을 측정하였다.
결합 검정의 결과는 mRAP-14c가 대략 21 nM의 친화도를 입증하는 반면, mRAP-8c는 대략 4 nM의 LRP1 클러스터 II에 대한 친화도를 제시한다는 것을 보여주었다.
이러한 결과는 전장 RAP d3의 크기를 대략 절반으로 할 수 있는 최소화된 RAP 단편이 RAP 수용체 LRP1에 효율적으로 결합하고 LRP1 엔도시토시스를 통해 간으로 제제를 전달하는데 유용하다는 것을 확인해주고 있다.
실시예 5: 환형 RAP 펩티드 소중합체 조합물의 평가
최소화된 RAP 환형 펩티드는 단리된 RAP d3로서 적절한 CR 쌍에 대한 유사한 친화도를 보유하지만, 다수의 CR 쌍을 갖는 수용체에 결합하는 전장 RAP에 의해 부 여된 원자가 이득을 제시하지는 않는다. 이러한 원자가 이득을 재구성하기 위해, 스트렙타비딘 또는 항바이오틴 항체 상에 바이오틴화된 RAP d3 펩티드를 발생시켰다(도 3).
RAP d3에서 유도되고 분자내 이황화물 결합으로 환형화된 절두된 펩티드(mRAPc)를 사용하여 LRP1의 두번째 리간드 결합 도메인(LRP1-C2)의 결합 하에 다량체화의 효과를 테스트할 수 있다. 검출을 단순화시키고 스트렙타비딘 또는 항바이오틴 항체와 펩티드의 다량체화시키기 위해, 상기 펩티드를 펜타펩티드 링커에 의해 RAP 서열에서 분리된 N 말단 바이오틴 잔기로 일치시켰다(GGSGG)(서열 번호 12). 단량체 mRAPc 펩티드는 상기 LRP1-C2에 고 친화도를 갖고 결합하도록 제시되었다. LRP1-C2 내 7개의 CR 쌍 중 6개는 RAP 결합을 위해 필요한 모티프를 공유하고 친화도가 유사(1∼5 nM)한 RAP d3에 독립적으로 결합하는 것을 입증하였다(Obermoeller et al.,J Biol Chem 272:10761-10768, 1997; Andersen et al., J Biol Chem 275:21017-21024, 2000).
스트렙타비딘 또는 항바이오틴 항체의 존재 및 부재 하에 재조합 RAP d3의 LRP1-C2에 대한 결합을 억제하는 mRAPc의 능력은 상기 기술된 바와 같이 고상 결합 검정에 의해 측정되었다.
결과는 단량체 펩티드에 대한 억제 정도(EC50)가 29 ±7 nM임을 제시하고 있다(표 3). mRAPc에 대한 EC50은 1/2 몰 당량의 스트렙타비딘과 배합되지만, 동일한 조건 하에서가 아닌 한, 6 ±1 nM, 즉 펩티드 단독에서 거의 5배 향상된다. 성숙 RAP는 EC50이 0.8 ±3 nM이며, 단량체 mRAPc 펩티드보다 36배 우수하고 스트렙타비 딘 상에 조립된 펩티드보다 여전히 약 10배 우수하다. 스트렙타비딘 단독은 억제 효과가 전혀 없다. 스트렙타비딘의 존재 하에 제시된 억제력의 수배 향상은 최소화된 RAP 도메인의 다량체화 하에서 결합력의 향상과 일치한다.
mRAPc mRAPc + 스트렙타비딘 RAP
EC50(2 nM RAP d3) 29 ± 7 8 ± 2 0.8 ± 3
최대 결합값 0.34 0.26 0.29
r2 0.82 0.97 0.93
단량체와의 비례값 1x 3.6x 36x
바이오틴에 대한 항바이오틴 항체의 비교적 약한 1가 친화도(낮은 나노몰 KD)가 제시된 경우, 적당하게 근접한 2개의 수용체 결합 펩티드 및 단일 항체로 이루어진 다가 복합체의 예비조립체가 펩티드-항체 복합체를 안정화시킨다고 가정하였다. 따라서, 1∼3의 몰 비율에서 항체 및 펩티드를 세척 전에 고정된 수용체와 항온처리한 후 RAP d3 리간드를 첨가하였다. 대조군과 동일한 절차를 수행하였다:펩티드 단독, 항체 단독 및 전장 RAP. 이러한 방법을 사용하여 단량체 mRAPc 펩티드에 대한 EC50이 20 ± 1 nM로 측정되었다(표 4).
mRAPc mRAPc + 항바이오틴 Ab RAP
EC50(2 nM RAP d3) 20 ± 1 3 ± 1 0.5 ± 5
최대 결합값 0.62 0.52 0.74
r2 0.99 0.99 0.89
단량체와의 비례값 1x 6.7x 40x
항바이오틴 항체와 mRAPc의 조합은 EC50 3 ± 1 nM을 얻었다. 전장 RAP는 EC50 0.5 ± 5 nM을 얻었다. 항체 단독을 RAP d3과 수용체의 결합에 영향을 미치지 않았다. 항체의 예비조립체는 스트렙타비딘보다 더욱 효과적으로 mRAPc 억제 잠재력이 약 7배로 분명하게 향상되었다. 항체의 존재 하에 mRAPc에 대한 EC50은 전장 RAP의 EC50보다 6배 높게 남는다. 따라서, 4가 스트렙타비딘에서와 같이, 2가 항체의 첨가는 펩티드의 능력을 유의적으로 향상시켜 RAP d3과 LRP1-C2의 결합을 억제하였다.
다른 LRP1-리간드의 결합을 억제하기 위해 다량체화된 mRAPc의 능력이 mRAPc 단량체 및 전장 RAP에 의한 억제와 비교되었다. 트립신 활성화된 α-2-마크로글로불린 및 uPA/PAI-1 복합체를 단일 리간드 농도에서 mRAPc 펩티드의 존재 하에 항온처리하였다. 두 경우 모두에서, 스트렙타비딘과 mRAPc의 복합체는 RAP와 mRAPc 단량체 사이의 대략 중도에서 EC50을 갖는 결합을 억제하였다.
실시예 6: 환형 RAP 펩티드 소중합체 조합물의 간으로의 진입 평가
다량체 펩티드가 생체내 전장 RAP의 생물학적분배 양상을 복제한 후 정맥 주사되는지 여부를 측정하기 위해, 간 내 mRAPc 펩티드 축적물의 수준을 측정하였다. 바이오틴화된 RAP 펩티드, 바이오틴화된 RAP 단백질 또는 완충제를 35S-SLR-스트렙타비딘(0.7 mCi/mL, 300 Ci/mmol, GE Healthcare)과 배합하고 D-TUBETM 투석 카세트(14 kD MWCO, EMD Biosciences)를 이용하여 포스페이트-완충된 식염수(PBS)에 투석시켰다. 수컷 Sprague-Dawley 쥐(6∼8주)에 꼬리 정맥을 통해 테스트 재료(2 μL/g; ∼20 μCi/쥐)를 주사하였다. 펜토박테리아(200 mg/kg)로 주사 후 30분에 동물을 희생시켰다. 실험실 동물의 인도적 처치를 위한 캐나다 동물 보호 협회에서 제정한 지침에 따라 모든 피험체를 처리하였다. 시체를 냉동시키고, 카르복시메티셀룰로스에 박고 Fuji BAS-2500 포스포이미저를 이용하여 준정량적 전체 시체의 방사능 발광 사진 촬영(QWBA)에 의한 분석을 위해 절편하였다. 발광 분석(Fuji Image Reader v1.1 및 Fuji Image Gauge v3.12)을 위해 각 동물에 대해 검정된 장기 내에 명확하게 묘사된 부분을 선택하였다. 단위 면적 당 광자극된 발광의 단위(PSL/mm2)로 값을 표시한다.
35S 표지된 스트렙타비딘의 조제물은 20∼1의 몰비로 바이오틴화된 mRAPc 펩티드, 또는 5∼1의 몰비로 생체내 바이오틴화된 RAP와 조합하여, 쥐에 정맥내 주사하였다. 대조군으로서 표지된 스트렙타비딘을 단독으로 사용하였다.
스트렙타비딘은 정맥내 주사 후 간 내에 유의적은 아니지만, 간에 축적되는 것으로 보고되었다(Wilbur, et al., Bioconjug Chem 9:100-107, 1998; Rosebrough,et al., J Nucl Med 37:1380-1384, 1996). 이 실험에서, 바이오틴화된 RAP의 조제물은 스트렙타비딘 단독의 값보다 2.7배 높은 수준에서, 처리된 다른 모든 조직에서 유사하거나 낮은 수준에서 간에 분포되었다(도 3). 표지된 스트렙타비딘 상에 미리 모아진 mRAPc 펩티드는 스트렙타비딘 단독의 값보다 7배 높은 수준에서, 처리된 다른 모든 조직에서 대조군과 비교하였을 때 유사하거나 낮은 수준으로 간에 분포되었다(도 3). 혈액 내에서 경쟁하는 LRP1 리간드의 높은 농도는 펩티드 복합체의 간 흡수를 분명히 차단할 수 없었고 이전에 정맥내 투여된 전장 RAP를 관찰되는 것이 주목할 만하다(Warshawsky,et al., J Clin Invest 92:937-944, 1993).
쥐에서 생물학적분포 연구 이외에, 간세포 암종과 같은 간 질환을 연구하는데 유용한 우드척에서 mRAPc 다량체화된 펩티드의 분포를 평가하였다(실시예 2 참조). 대조군으로서 스트렙타비딘 단독 및 mRAPc-스트렙타비딘을 사용하여 상기 기술된 바와 같이 본질적으로 생물학적분포 연구를 수행하였다. 연구 결과는 우드척 간에서 mRAPc-스트렙타비딘의 흡수(1979의 평균 PSL/mm2)는 스트렙타비딘 단독의 흡수보다 대략 4.5배(평균 435 PSL/mm2) 이상임을 제시하고 있다.
이러한 결과는 다량체화된 mRAPc가 간에 의해 생체내 효율적으로 흡수되는 것을 제시하고, 다량체화된 RAPc가 간 질환 치료를 위해 간에 치료제를 투여하는데 효과적인 매개체임을 나타낸다.
상기 예시적 실시예에 제시된 바와 같이 본 발명에서 다수의 변형 및 변화가 당업자에게 일어날 것으로 예상된다. 따라서, 첨부된 청구범위에 제시된 바와 같은 그러한 한정만은 본 발명에서 취해야 할 것이다.
Figure 112009023293844-PCT00004
Figure 112009023293844-PCT00005
Figure 112009023293844-PCT00006
Figure 112009023293844-PCT00007
SEQUENCE LISTING <110> Raptor Pharmaceuticals, Inc. Zankel, et al. <120> Treatment of Liver Disorders by Administration of Receptor-Associated Protein(RAP)-Conjugates <130> 31075/42619A <140> PCT/US2007/078792 <141> 2007-09-18 <150> PCT/US06/036453 <151> 2006-09-18 <160> 12 <170> PatentIn version 3.5 <210> 1 <211> 323 <212> PRT <213> Homo sapiens <400> 1 Tyr Ser Arg Glu Lys Asn Gln Pro Lys Pro Ser Pro Lys Arg Glu Ser 1 5 10 15 Gly Glu Glu Phe Arg Met Glu Lys Leu Asn Gln Leu Trp Glu Lys Ala 20 25 30 Gln Arg Leu His Leu Pro Pro Val Arg Leu Ala Glu Leu His Ala Asp 35 40 45 Leu Lys Ile Gln Glu Arg Asp Glu Leu Ala Trp Lys Lys Leu Lys Leu 50 55 60 Asp Gly Leu Asp Glu Asp Gly Glu Lys Glu Ala Arg Leu Ile Arg Asn 65 70 75 80 Leu Asn Val Ile Leu Ala Lys Tyr Gly Leu Asp Gly Lys Lys Asp Ala 85 90 95 Arg Gln Val Thr Ser Asn Ser Leu Ser Gly Thr Gln Glu Asp Gly Leu 100 105 110 Asp Asp Pro Arg Leu Glu Lys Leu Trp His Lys Ala Lys Thr Ser Gly 115 120 125 Lys Phe Ser Gly Glu Glu Leu Asp Lys Leu Trp Arg Glu Phe Leu His 130 135 140 His Lys Glu Lys Val His Glu Tyr Asn Val Leu Leu Glu Thr Leu Ser 145 150 155 160 Arg Thr Glu Glu Ile His Glu Asn Val Ile Ser Pro Ser Asp Leu Ser 165 170 175 Asp Ile Lys Gly Ser Val Leu His Ser Arg His Thr Glu Leu Lys Glu 180 185 190 Lys Leu Arg Ser Ile Asn Gln Gly Leu Asp Arg Leu Arg Arg Val Ser 195 200 205 His Gln Gly Tyr Ser Thr Glu Ala Glu Phe Glu Glu Pro Arg Val Ile 210 215 220 Asp Leu Trp Asp Leu Ala Gln Ser Ala Asn Leu Thr Asp Lys Glu Leu 225 230 235 240 Glu Ala Phe Arg Glu Glu Leu Lys His Phe Glu Ala Lys Ile Glu Lys 245 250 255 His Asn His Tyr Gln Lys Gln Leu Glu Ile Ala His Glu Lys Leu Arg 260 265 270 His Ala Glu Ser Val Gly Asp Gly Glu Arg Val Ser Arg Ser Arg Glu 275 280 285 Lys His Ala Leu Leu Glu Gly Arg Thr Lys Glu Leu Gly Tyr Thr Val 290 295 300 Lys Lys His Leu Gln Asp Leu Ser Gly Arg Ile Ser Arg Ala Arg His 305 310 315 320 Asn Glu Leu <210> 2 <211> 123 <212> PRT <213> Homo sapiens <400> 2 Leu Asp Arg Leu Arg Arg Val Ser His Gln Gly Tyr Ser Thr Glu Ala 1 5 10 15 Glu Phe Glu Glu Pro Arg Val Ile Asp Leu Trp Asp Leu Ala Gln Ser 20 25 30 Ala Asn Leu Thr Asp Lys Glu Leu Glu Ala Phe Arg Glu Glu Leu Lys 35 40 45 His Phe Glu Ala Lys Ile Glu Lys His Asn His Tyr Gln Lys Gln Leu 50 55 60 Glu Ile Ala His Glu Lys Leu Arg His Ala Glu Ser Val Gly Asp Gly 65 70 75 80 Glu Arg Val Ser Arg Ser Arg Glu Lys His Ala Leu Leu Glu Gly Arg 85 90 95 Thr Lys Glu Leu Gly Tyr Thr Val Lys Lys His Leu Gln Asp Leu Ser 100 105 110 Gly Arg Ile Ser Arg Ala Arg His Asn Glu Leu 115 120 <210> 3 <211> 71 <212> PRT <213> Homo sapiens <400> 3 Phe Arg Glu Glu Leu Lys His Phe Glu Ala Lys Ile Glu Lys His Asn 1 5 10 15 His Tyr Gln Lys Gln Leu Glu Ile Ala His Glu Lys Leu Arg His Ala 20 25 30 Glu Ser Val Gly Asp Gly Glu Arg Val Ser Arg Ser Arg Glu Lys His 35 40 45 Ala Leu Leu Glu Gly Arg Thr Lys Glu Leu Gly Tyr Thr Val Lys Lys 50 55 60 His Leu Gln Asp Leu Ser Gly 65 70 <210> 4 <211> 55 <212> PRT <213> Homo sapiens <400> 4 His Phe Glu Ala Lys Ile Glu Lys His Asn His Tyr Gln Lys Gln Leu 1 5 10 15 Glu Ile Ala His Glu Lys Leu Arg His Ala Glu Ser Val Gly Asp Gly 20 25 30 Glu Arg Val Ser Arg Ser Arg Glu Lys His Ala Leu Leu Glu Gly Arg 35 40 45 Thr Lys Glu Leu Gly Tyr Thr 50 55 <210> 5 <211> 119 <212> PRT <213> Homo sapiens <400> 5 Leu Asp Arg Leu Arg Arg Val Ser His Gln Gly Tyr Ser Thr Glu Ala 1 5 10 15 Glu Phe Glu Glu Pro Arg Val Ile Asp Leu Trp Asp Leu Ala Gln Ser 20 25 30 Ala Asn Leu Thr Asp Lys Glu Leu Glu Ala Phe Arg Glu Glu Leu Lys 35 40 45 His Phe Glu Ala Lys Ile Glu Lys His Asn His Tyr Gln Lys Gln Leu 50 55 60 Glu Ile Ala His Glu Lys Leu Arg His Ala Glu Ser Val Gly Asp Gly 65 70 75 80 Glu Arg Val Ser Arg Ser Arg Glu Lys His Ala Leu Leu Glu Gly Arg 85 90 95 Thr Lys Glu Leu Gly Tyr Thr Val Lys Lys His Leu Gln Asp Leu Ser 100 105 110 Gly Arg Ile Ser Arg Ala Arg 115 <210> 6 <211> 1493 <212> DNA <213> Homo sapiens <400> 6 tgagcggggg atgatggcgc cgcggagggt caggtcgttt ctgcgcgggc tcccggcgct 60 gctactgctg ctgctcttcc tcgggccctg gcccgctgcg agccacggcg gcaagtactc 120 gcgggagaag aaccagccca agccgtcccc gaaacgcgag tccggagagg agttccgcat 180 ggagaagttg aaccagctgt gggagaaggc ccagcgactg catcttcctc ccgtgaggct 240 ggccgagctc cacgctgatc tgaagataca ggagagggac gaactcgcct ggaagaaact 300 aaagcttgac ggcttggacg aagatgggga gaaggaagcg agactcatac gcaacctcaa 360 tgtcatcttg gccaagtatg gtctggacgg aaagaaggac gctcggcagg tgaccagcaa 420 ctccctcagt ggcacccagg aagacgggct ggatgacccc aggctggaaa agctgtggca 480 caaggcgaag acctctggga aattctccgg cgaagaactg gacaagctct ggcgggagtt 540 cctgcatcac aaagagaaag ttcacgagta caacgtcctg ctggagaccc tgagcaggac 600 cgaagaaatc cacgagaacg tcattagccc ctcggacctg agcgacatca agggcagcgt 660 cctgcacagc aggcacacgg agctgaagga gaagctgcgc agcatcaacc agggcctgga 720 ccgcctgcgc agggtcagcc accagggcta cagcactgag gctgagttcg aggagcccag 780 ggtgattgac ctgtgggacc tggcgcagtc cgccaacctc acggacaagg agctggaggc 840 gttccgggag gagctcaagc acttcgaagc caaaatcgag aagcacaacc actaccagaa 900 gcagctggag attgcgcacg agaagctgag gcacgcagag agcgtgggcg acggcgagcg 960 tgtgagccgc agccgcgaga agcacgccct gctggagggg cggaccaagg agctgggcta 1020 cacggtgaag aagcatctgc aggacctgtc cggcaggatc tccagagctc ggcacaacga 1080 actctgaagg cactggggag cccagcccgg cagggaagag gccagcgtga aggacctggg 1140 ctcttggccg tggcatttcc gtggacagcc cgccgtcagg gtggctgggg ctggcacggg 1200 tgtcgaggca ggaaggattg tttctggtga ctgcagccgc tgccgtcgcg acacagggct 1260 tggtggtggt agcatttggg tctgagatcg gcccagctct gactgaaggg gcttggcttc 1320 cactcagcat cagcgtggca gtcaccaccc cagtgaggac ctcgatgtcc agctgctgtc 1380 aggtctgata gtcctctgct aaaacaacac gatttacata aaaaatctta cacatctgcc 1440 accggaaata ccatgcacag agtccttaaa aaatagagtg cagtatttaa acc 1493 <210> 7 <211> 357 <212> PRT <213> Homo sapiens <400> 7 Met Ala Pro Arg Arg Val Arg Ser Phe Leu Arg Gly Leu Pro Ala Leu 1 5 10 15 Leu Leu Leu Leu Leu Phe Leu Gly Pro Trp Pro Ala Ala Ser His Gly 20 25 30 Gly Lys Tyr Ser Arg Glu Lys Asn Gln Pro Lys Pro Ser Pro Lys Arg 35 40 45 Glu Ser Gly Glu Glu Phe Arg Met Glu Lys Leu Asn Gln Leu Trp Glu 50 55 60 Lys Ala Gln Arg Leu His Leu Pro Pro Val Arg Leu Ala Glu Leu His 65 70 75 80 Ala Asp Leu Lys Ile Gln Glu Arg Asp Glu Leu Ala Trp Lys Lys Leu 85 90 95 Lys Leu Asp Gly Leu Asp Glu Asp Gly Glu Lys Glu Ala Arg Leu Ile 100 105 110 Arg Asn Leu Asn Val Ile Leu Ala Lys Tyr Gly Leu Asp Gly Lys Lys 115 120 125 Asp Ala Arg Gln Val Thr Ser Asn Ser Leu Ser Gly Thr Gln Glu Asp 130 135 140 Gly Leu Asp Asp Pro Arg Leu Glu Lys Leu Trp His Lys Ala Lys Thr 145 150 155 160 Ser Gly Lys Phe Ser Gly Glu Glu Leu Asp Lys Leu Trp Arg Glu Phe 165 170 175 Leu His His Lys Glu Lys Val His Glu Tyr Asn Val Leu Leu Glu Thr 180 185 190 Leu Ser Arg Thr Glu Glu Ile His Glu Asn Val Ile Ser Pro Ser Asp 195 200 205 Leu Ser Asp Ile Lys Gly Ser Val Leu His Ser Arg His Thr Glu Leu 210 215 220 Lys Glu Lys Leu Arg Ser Ile Asn Gln Gly Leu Asp Arg Leu Arg Arg 225 230 235 240 Val Ser His Gln Gly Tyr Ser Thr Glu Ala Glu Phe Glu Glu Pro Arg 245 250 255 Val Ile Asp Leu Trp Asp Leu Ala Gln Ser Ala Asn Leu Thr Asp Lys 260 265 270 Glu Leu Glu Ala Phe Arg Glu Glu Leu Lys His Phe Glu Ala Lys Ile 275 280 285 Glu Lys His Asn His Tyr Gln Lys Gln Leu Glu Ile Ala His Glu Lys 290 295 300 Leu Arg His Ala Glu Ser Val Gly Asp Gly Glu Arg Val Ser Arg Ser 305 310 315 320 Arg Glu Lys His Ala Leu Leu Glu Gly Arg Thr Lys Glu Leu Gly Tyr 325 330 335 Thr Val Lys Lys His Leu Gln Asp Leu Ser Gly Arg Ile Ser Arg Ala 340 345 350 Arg His Asn Glu Leu 355 <210> 8 <211> 319 <212> PRT <213> Homo sapiens <400> 8 Tyr Ser Arg Glu Lys Asn Gln Pro Lys Pro Ser Pro Lys Arg Glu Ser 1 5 10 15 Gly Glu Glu Phe Arg Met Glu Lys Leu Asn Gln Leu Trp Glu Lys Ala 20 25 30 Gln Arg Leu His Leu Pro Pro Val Arg Leu Ala Glu Leu His Ala Asp 35 40 45 Leu Lys Ile Gln Glu Arg Asp Glu Leu Ala Trp Lys Lys Leu Lys Leu 50 55 60 Asp Gly Leu Asp Glu Asp Gly Glu Lys Glu Ala Arg Leu Ile Arg Asn 65 70 75 80 Leu Asn Val Ile Leu Ala Lys Tyr Gly Leu Asp Gly Lys Lys Asp Ala 85 90 95 Arg Gln Val Thr Ser Asn Ser Leu Ser Gly Thr Gln Glu Asp Gly Leu 100 105 110 Asp Asp Pro Arg Leu Glu Lys Leu Trp His Lys Ala Lys Thr Ser Gly 115 120 125 Lys Phe Ser Gly Glu Glu Leu Asp Lys Leu Trp Arg Glu Phe Leu His 130 135 140 His Lys Glu Lys Val His Glu Tyr Asn Val Leu Leu Glu Thr Leu Ser 145 150 155 160 Arg Thr Glu Glu Ile His Glu Asn Val Ile Ser Pro Ser Asp Leu Ser 165 170 175 Asp Ile Lys Gly Ser Val Leu His Ser Arg His Thr Glu Leu Lys Glu 180 185 190 Lys Leu Arg Ser Ile Asn Gln Gly Leu Asp Arg Leu Arg Arg Val Ser 195 200 205 His Gln Gly Tyr Ser Thr Glu Ala Glu Phe Glu Glu Pro Arg Val Ile 210 215 220 Asp Leu Trp Asp Leu Ala Gln Ser Ala Asn Leu Thr Asp Lys Glu Leu 225 230 235 240 Glu Ala Phe Arg Glu Glu Leu Lys His Phe Glu Ala Lys Ile Glu Lys 245 250 255 His Asn His Tyr Gln Lys Gln Leu Glu Ile Ala His Glu Lys Leu Arg 260 265 270 His Ala Glu Ser Val Gly Asp Gly Glu Arg Val Ser Arg Ser Arg Glu 275 280 285 Lys His Ala Leu Leu Glu Gly Arg Thr Lys Glu Leu Gly Tyr Thr Val 290 295 300 Lys Lys His Leu Gln Asp Leu Ser Gly Arg Ile Ser Arg Ala Arg 305 310 315 <210> 9 <211> 80 <212> PRT <213> Artificial sequence <220> <223> Synthetic peptide <400> 9 Gly Gly Ser Gly Gly Cys Gly Phe Arg Glu Glu Leu Lys His Phe Glu 1 5 10 15 Ala Lys Ile Glu Lys His Asn His Tyr Gln Lys Gln Leu Glu Ile Ala 20 25 30 His Glu Lys Leu Arg His Ala Glu Ser Val Gly Asp Gly Glu Arg Val 35 40 45 Ser Arg Ser Arg Glu Lys His Ala Leu Leu Glu Gly Arg Thr Lys Glu 50 55 60 Leu Gly Tyr Thr Val Lys Lys His Leu Gln Asp Leu Ser Gly Gly Cys 65 70 75 80 <210> 10 <211> 67 <212> PRT <213> Artificial sequence <220> <223> Synthetic peptide <400> 10 Cys Gly Lys His Phe Glu Ala Lys Ile Glu Lys His Asn His Tyr Gln 1 5 10 15 Lys Gln Leu Glu Ile Ala His Glu Lys Leu Arg His Ala Glu Ser Val 20 25 30 Gly Asp Gly Glu Arg Val Ser Arg Ser Arg Glu Lys His Ala Leu Leu 35 40 45 Glu Gly Arg Thr Lys Glu Leu Gly Tyr Thr Val Lys Lys His Leu Gln 50 55 60 Asp Gly Cys 65 <210> 11 <211> 60 <212> PRT <213> Artificial sequence <220> <223> Synthetic peptide <400> 11 Cys Glu Ala Lys Ile Glu Lys His Asn His Tyr Gln Lys Gln Leu Glu 1 5 10 15 Ile Ala His Glu Lys Leu Arg His Ala Glu Ser Val Gly Asp Gly Glu 20 25 30 Arg Val Ser Arg Ser Arg Glu Lys His Ala Leu Leu Glu Gly Arg Thr 35 40 45 Lys Glu Leu Gly Tyr Thr Val Lys Lys His Gly Cys 50 55 60 <210> 12 <211> 5 <212> PRT <213> Artificial sequence <220> <223> Synthetic peptide <400> 12 Gly Gly Ser Gly Gly 1 5

Claims (31)

  1. 피험체의 간 질환을 치료하는 방법으로서, (a) 서열 번호 1의 수용체 결합 단백질(RAP), RAP 단편, 및 약 1∼5 nM의 LRP1에 대한 RAP의 결합 친화력을 보유하는 RAP 변이체로 이루어진 군에서 선택된 수용체 결합 부분을, (b) 간 질환 치료용 활성제에 부착시킨 것을 포함하는 접합체의 유효량을 상기 피험체에게 투여하는 단계를 포함하는 방법.
  2. 제1항에 있어서, 상기 접합체의 수용체 결합 부분은 서열 번호 1의 N 말단으로부터 적어도 200개, 최대 243개의 아미노산이 결손된 RAP 단편 또는 변이체인 방법.
  3. 제1항에 있어서, 상기 접합체의 수용체 결합 부분은 서열 번호 1의 N 말단으로부터 적어도 200개, 최대 243개의 아미노산이 결손된 RAP 단편인 방법.
  4. 제2항 또는 제3항에 있어서, 상기 RAP 단편 또는 변이체는 서열 번호 1의 N 말단으로부터 243개의 아미노산이 결손된 것인 방법.
  5. 제2항 내지 제4항 중 어느 하나의 항에 있어서, 상기 RAP 단편 또는 변이체는 서열 번호 1의 C 말단으로부터 적어도 4개, 최대 11개의 아미노산이 추가로 결 손된 것인 방법.
  6. 제2항 내지 제4항 중 어느 하나의 항에 있어서, 상기 RAP 단편 또는 변이체는 서열 번호 1의 C 말단으로부터 11개의 아미노산이 추가로 결손된 것인 방법.
  7. 제1항에 있어서, 상기 RAP 단편 또는 변이체는 서열 번호 1의 성숙 RAP의 아미노산 1∼143 및 320∼323이 결여된 것인 방법.
  8. 제2항 내지 제7항 중 어느 하나의 항에 있어서, 상기 RAP 단편 또는 변이체는 (a) 71개 이상의 아미노산 길이이고 (b) 아미노산 256∼270을 포함하는 RAP d3(서열 번호 2)의 연속 부위를 포함하는 방법.
  9. 제1항에 있어서, 상기 수용체 결합 부분은, 서열 번호 4와 70% 이상 동일한 50개의 인접 아미노산을 포함하는 약 85개 미만의 아미노산 길이이고, 약 1 x 10-8 M 이하의 Kd로 LRP1에 결합하는 환형 RAP 펩티드인 방법.
  10. 제1항 내지 제9항 중 어느 하나의 항에 있어서, 상기 수용체 결합 부분은 서열 번호 1의 천연 RAP에 대해 하나 이상의 보존적 치환을 포함하는 RAP 변이체인 방법.
  11. 제1항 내지 제9항 중 어느 하나의 항에 있어서, 상기 수용체 결합 부분은 성숙 RAP의 위치 217, 249, 또는 251 중 어느 하나에 돌연변이를 포함하는 RAP 변이체인 방법.
  12. 제2항 내지 제11항 중 어느 하나의 항에 있어서, 상기 RAP 변이체는 산성 아미노산의 염기성 아미노산으로의 치환인 돌연변이를 포함하는 방법.
  13. 제12항에 있어서, 상기 산성 아미노산은 D 및 E로 이루어진 군에서 선택되는 방법.
  14. 제12항에 있어서, 상기 염기성 아미노산은 K 및 R로 이루어진 군에서 선택되는 방법.
  15. 제2항 내지 제11항 중 어느 하나의 항에 있어서, 상기 RAP 변이체는 염기성 아미노산의 산성 아미노산으로의 치환인 돌연변이를 포함하는 방법.
  16. 제15항에 있어서, 상기 염기성 아미노산은 K 및 R로 이루어진 군에서 선택되는 방법.
  17. 제15항에 있어서, 상기 산성 아미노산은 D 및 E로 이루어진 군에서 선택되는 방법.
  18. 제2항 내지 제11항 중 어느 하나의 항에 있어서, 상기 RAP 변이체는 A, C, D, E, G, I, K, L, M, N, P, Q, R, S, T, 및 V로 이루어진 군에서 선택된 아미노산의 F, Y, W, 및 H로 이루어진 군에서 선택된 아미노산으로의 치환인 돌연변이를 포함하는 방법.
  19. 제1항에 있어서, 상기 접합체의 수용체 결합 부분은 서열 번호 9에 제시된 RAP 단편 또는 변이체인 방법.
  20. 제1항 내지 제19항 중 어느 하나의 항에 있어서, RAP, RAP 단편 또는 RAP 변이체와 진단제 또는 치료제는 링커를 통해 연결되는 방법.
  21. 제20항에 있어서, 상기 링커는 펩티드 링커인 방법.
  22. 제1항 내지 제21항 중 어느 하나의 항에 있어서, 수용체 결합 부분은 RAP 단편 또는 RAP 변이체의 소중합체 조합인 방법.
  23. 제1항 내지 제22항 중 어느 하나의 항에 있어서, 접합체는 약학적으로 허용 되는 담체, 희석제 또는 부형제를 포함하는 약학 조성물 내에 존재하는 방법.
  24. 제1항 내지 제23항 중 어느 하나의 항에 있어서, 간 질환은 간암, 간염, 간경변, 진균, 리케치아 또는 기생충 감염, 알콜, 화학적 독소, 약물 독성으로 인한 손상, 대사성 간 질병, 특발성 자가면역 간 질병, 담도 폐쇄, 간 지방증, 담즙정체증, 및 간 절제술 후 병태로 이루어진 군에서 선택되는 방법.
  25. 제24항에 있어서, 간암은 간세포 암종으로 이루어진 군에서 선택되고 활성제 부분은 세포독성 화학요법제인 방법.
  26. 제24항에 있어서, 질환은 간 종양 또는 간 종양 전이이고, 치료제는 화학요법제인 방법.
  27. 제1항 내지 제26항 중 어느 하나의 항에 있어서, 활성제는 세포독성제인 방법.
  28. 제27항에 있어서, 세포독성제는 메클로레타민 히드로클로라이드, 시클로포스파미드, 이포스파미드, 클로람부실, 멜팔란, 부설판, 티오테파, 카르무스틴, 로무스틴, 다카르바진 및 스트렙토조신으로 이루어진 군에서 선택되는 방법.
  29. 제1항 내지 제26항 중 어느 하나의 항에 있어서, 활성제는 방사성 동위원소인 방법.
  30. 제29항에 있어서, 방사성 동위원소는 131I, 125I, 111In, 90Y, 67Cu, 127Lu, 212Bi, 213Bi, 255Fm, 149Tb, 223Rd, 213Pb, 212Pb, 211At, 89Sr, 153Sm, 166Ho, 225Ac, 186Re, 67Ga, 68Ga 및 99 mTc로 이루어진 군에서 선택되는 방법.
  31. 제24항에 있어서, 질환은 바이러스에 의해 야기되는 간염이고, 치료제는 항바이러스제인 방법.
KR1020097007889A 2006-09-18 2007-09-18 수용체 결합 단백질(ｒａｐ)-접합체 투여에 의한 간 질환의 치료 KR20090071598A (ko)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
PCT/US2006/036453 WO2007035716A2 (en) 2005-09-16 2006-09-18 Compositions comprising receptor-associated protein (rap) variants specific for cr-containing proteins and uses thereof
WOPCT/US06/36453 2006-09-18
US91929507P 2007-03-21 2007-03-21
US60/919,295 2007-03-21

Publications (1)

Publication Number Publication Date
KR20090071598A true KR20090071598A (ko) 2009-07-01

Family

ID=40590008

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020097007889A KR20090071598A (ko) 2006-09-18 2007-09-18 수용체 결합 단백질(ｒａｐ)-접합체 투여에 의한 간 질환의 치료

Country Status (9)

Country Link
US (1) US8795627B2 (ko)
EP (1) EP2063905B1 (ko)
JP (1) JP2010503710A (ko)
KR (1) KR20090071598A (ko)
CN (1) CN101594878A (ko)
CA (1) CA2663377A1 (ko)
HK (1) HK1132930A1 (ko)
MX (1) MX2009002893A (ko)
WO (1) WO2008036682A2 (ko)

Families Citing this family (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1583562B1 (en) 2003-01-06 2011-06-15 Angiochem Inc. Angiopep-1, related compounds, and uses thereof
ES2424242T3 (es) 2005-07-15 2013-09-30 Angiochem Inc. Uso de polipéptidos de aprotinina como portadores en conjugados farmacéuticos
EP2132224B1 (en) * 2007-03-21 2011-12-28 Raptor Pharmaceutical Inc Cyclic receptor-associated protein (rap) peptides
US9365634B2 (en) 2007-05-29 2016-06-14 Angiochem Inc. Aprotinin-like polypeptides for delivering agents conjugated thereto to tissues
CA2721019C (en) 2008-04-18 2015-09-15 Angiochem Inc. Pharmaceutical compositions of paclitaxel, paclitaxel analogs or paclitaxel conjugates and related methods of preparation and use
US8759010B2 (en) * 2008-09-26 2014-06-24 Inserm (Institut National De La Sante Et De La Recherche Medicale) Host cell kinases as targets for antiviral therapies against HCV infection
US8921314B2 (en) 2008-10-15 2014-12-30 Angiochem, Inc. Conjugates of GLP-1 agonists and uses thereof
MX2011004019A (es) 2008-10-15 2011-06-24 Angiochem Inc Conjugados de etoposido y doxorubicina para entrega de farmacos.
BRPI0922689A2 (pt) 2008-12-05 2018-11-06 Angiochem Inc. conjugados de neurotensina ou análogos de neurotensina e usos dos mesmos
EP2373789A4 (en) 2008-12-17 2012-08-29 Angiochem Inc MEMBRANTYP-1 MATRIX METALLOPROTEINASE INHIBITORS AND THEIR USE
US8623348B2 (en) * 2009-03-27 2014-01-07 Jw Pharmaceutical Corporation Interferon-α (IFN-α) fused proteins comprising IFN-α and a cytoplasmic transduction peptide (CTP)
CN102510759A (zh) 2009-04-20 2012-06-20 安吉奥开米公司 利用与血管肽-2类似物结合的抗癌剂治疗卵巢癌
US9161988B2 (en) 2009-07-02 2015-10-20 Angiochem Inc. Multimeric peptide conjugates and uses thereof
ES2555555T3 (es) * 2010-01-28 2016-01-04 Raptor Pharmaceuticals Inc. Conjugados de péptido de proteína asociada al receptor inhibidor de fucosidasa y su uso en el tratamiento de tumores hepáticos
WO2011103465A2 (en) * 2010-02-20 2011-08-25 Alexey Gennadievich Zdanovsky Botulinum neurotoxin antigenic compositions and methods
US8956859B1 (en) 2010-08-13 2015-02-17 Aviex Technologies Llc Compositions and methods for determining successful immunization by one or more vaccines
GB201220474D0 (en) * 2012-11-14 2012-12-26 Sagetis Biotech Sl Polypeptides
KR101650364B1 (ko) * 2012-12-05 2016-08-23 더백스 제네틱스 백신 코포레이션, 엘티디. 항원-특이적인 t 세포 반응을 유도하는 면역 강화제로서 사용을 위한 융합 단백질
WO2014160088A2 (en) * 2013-03-14 2014-10-02 Rhode Island Hospital, A Lifespan-Partner Treating hepatitis b virus infections
ITMI20130513A1 (it) * 2013-04-05 2014-10-06 Euroclone S P A Metodo diagnostico per patologie autoimmuni del fegato
JP2018507860A (ja) * 2015-02-26 2018-03-22 ザヴァックス ジェネティクス ワクチン カンパニー リミテッドＴｈｅｖａｘ Ｇｅｎｅｔｉｃｓ Ｖａｃｃｉｎｅ Ｃｏ．， Ｌｔｄ． 抗原特異的ｔ細胞反応を誘発するための、免疫原性タンパク質及びアジュバントの組み合わせを含むワクチン組成物
US10849992B1 (en) 2015-04-07 2020-12-01 Alector Llc Methods of screening for sortilin binding antagonists
RS62546B1 (sr) 2015-04-07 2021-12-31 Alector Llc Antitela protiv sortilina i postupci za njihovu upotrebu
WO2016205367A1 (en) 2015-06-15 2016-12-22 Angiochem Inc. Methods for the treatment of leptomeningeal carcinomatosis
CN110536705A (zh) * 2017-01-30 2019-12-03 维克塔-霍洛斯公司 用于癌症成像和放疗的组合物和方法
HUE061841T2 (hu) 2018-07-13 2023-08-28 Alector Llc Anti-sortilin antitestek és felhasználásuk módszerei

Family Cites Families (935)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3069322A (en) 1958-05-28 1962-12-18 Bergstrom Sune Pge and pgf
US3852468A (en) 1967-02-27 1974-12-03 Ici Ltd Alkanolamine derivatives as {62 -adrenergic blocking agents
US4089900A (en) 1967-09-13 1978-05-16 Pfizer Inc. Antimicrobial agents
US3928356A (en) 1967-10-06 1975-12-23 Fujisawa Pharmaceutical Co 10-{8 4-({107 -Hydroxy alkyl)-1-piperazimyl{9 -dibenzo (h,f) oxofins and thiepins and acetyl esters thereof
US3726978A (en) 1967-11-02 1973-04-10 Sandoz Ag Tetrahydropyridazines and pyridazinones as anti-inflammatory agents
US3832470A (en) 1968-01-29 1974-08-27 H Russek Treatment of angina pectoris with a long-acting vasodilating agent and a beta adrenergic receptor blocking agent
US3668210A (en) 1968-02-07 1972-06-06 Yoshitomi Pharmaceutical 3-chloro dihydrodibenzazepine derivatives
US3789123A (en) 1968-03-27 1974-01-29 Ciba Geigy Corp Tertiary aminoacids as anti-inflammatory agents
US3993763A (en) 1969-03-18 1976-11-23 Ciba-Geigy Corporation Tertiary aminoacids as anti-inflammatory agents
US3951950A (en) 1968-08-21 1976-04-20 E. R. Squibb & Sons, Inc. 4-Azatricyclo[4.3.1.13,8 ]undecane and related compounds
US3898210A (en) 1968-08-21 1975-08-05 Squibb & Sons Inc 4-Azatricyclo {8 4.3.1.1{hu 3,8{b {9 undecane and related compounds
US3538104A (en) 1969-02-28 1970-11-03 Geigy Chem Corp Pyridyl-2-imidazolones
US3624126A (en) 1969-09-02 1971-11-30 Squibb & Sons Inc {66 {11 , {60 -adamantane acetic acid
US3759921A (en) 1969-10-16 1973-09-18 Lilly Co Eli Method of suppressing immuneresponse with 1 substituted-3-(2 pyrimidyl)ureas
US4000275A (en) 1969-11-24 1976-12-28 Eli Lilly And Company Immunosuppressants
US3694471A (en) 1970-06-08 1972-09-26 Warner Lambert Pharmaceutical 17-valerate ester of 6{60 ,9{60 -difluorohydrocortisone, its compositions and use as an anti-inflammatory agent
US3691214A (en) 1970-06-08 1972-09-12 Warner Lambert Pharmaceutical 17-valerate ester of 6alpha,9alpha-difluoroprednisolone,its compositions and use as an anti-inflammatory agent
US3624216A (en) 1970-06-25 1971-11-30 Abbott Lab 8-substituted theophyllines as anti-inflammatory agents
US3934018A (en) 1970-09-03 1976-01-20 Abbott Laboratories 4,6-Dihydro-1,3-dimethyl-8-phenylpyrazolo[4,3-e] [1,4]diazepin-5-(1H)-one and derivatives as anti-inflammatory agents
US3865748A (en) 1970-09-22 1975-02-11 Us Agriculture Cinnamyl phenol antimicrobial agents
US3936393A (en) 1970-09-22 1976-02-03 The United States Of America As Represented By The Secretary Of Agriculture Antimicrobial agents and use thereof
US3764676A (en) 1970-10-28 1973-10-09 Gates Rubber Co Diethyl cyanomethyl phosphonate as an antimicrobial agent
US3783160A (en) 1970-10-28 1974-01-01 Gates Rubber Co Diethyl allyl phosphonate as an anti-microbial agent
US3917476A (en) 1970-10-28 1975-11-04 Gates Rubber Co Diethyl alpha phosphonate as an (antimicrobial agent) algaecide
GB1368948A (en) 1970-11-11 1974-10-02 Manuf Prod Pharma Pyridine derivatives
US3980652A (en) 1970-11-11 1976-09-14 A. Christiaens Societe Anonyme 2-(4-Methyl-piperazino)-3 or 5 cyano pyridine
US3998954A (en) 1971-02-05 1976-12-21 Pfizer Inc. 1,3(2H,4H)-Dioxoisoquinoline-4-carboxamides used as anti-inflammatory agents
US4148796A (en) 1971-03-15 1979-04-10 Sumitomo Chemical Company, Limited γ-Piperidinobutyrophenones
US3857955A (en) 1971-03-29 1974-12-31 Lilly Co Eli Anti-inflammatory agents
US3886157A (en) 1971-03-29 1975-05-27 Ciba Geigy Corp 5,6,8,8B,9-Pentaazanaphth{8 3,2,1-d,e{9 anthracene derivatives
US3867383A (en) 1971-03-29 1975-02-18 Ciba Geigy Corp Monoanthranilatoanilino-s-triazines
US3764677A (en) 1971-06-25 1973-10-09 Gates Rubber Co Diethyl betaaminoethylphosphonate as an antimicrobial agent
US3984405A (en) 1971-06-28 1976-10-05 E. R. Squibb & Sons, Inc. Anti-inflammatory agents
JPS4834870A (ko) 1971-09-10 1973-05-22
US3821401A (en) 1971-09-13 1974-06-28 Lilly Co Eli Other publications
US4029661A (en) 1971-10-04 1977-06-14 Pcr, Inc. Process for producing 5-fluorouracil and derivatives thereof in acid and/or alcohol solvents
US3897441A (en) 1971-10-27 1975-07-29 Syntex Inc Certain thiazole-carboxamides and acylamino-thiazoles
US4001421A (en) 1971-10-27 1977-01-04 Syntex (U.S.A.) Inc. Thiazole cardiovascular agents
US3982010A (en) 1971-10-27 1976-09-21 Syntex (U.S.A.) Inc. Thiazole cardiovascular agents
US3789121A (en) 1971-11-26 1974-01-29 Warner Lambert Co 17{60 ,21-orthobutyrates of 6{60 , 9{60 -difluoro-hydrocortisone and 6{60 , 9{60 -difluoroprednisolone, compositions containing same and the use thereof as anti-inflammatory agents
BE794589A (fr) 1972-02-08 1973-05-16 Cerm Cent Europ Rech Mauvernay Nouveaux derives du 1,1-diphenyl-ethylene, leur procede de preparation et leurs applications
US3821377A (en) 1972-02-22 1974-06-28 Squibb & Sons Inc Anti-inflammatory agents
US4044139A (en) 1974-02-08 1977-08-23 Uniroyal, Inc. Bis(diphenylaminomethane) antimicrobial agents
US3954868A (en) 1972-03-02 1976-05-04 Uniroyal, Inc. Bis(diphenylaminomethane) antimicrobial agents
US3933834A (en) 1972-03-06 1976-01-20 Bayer Aktiengesellschaft Unsymmetrical esters of N-substituted 1,4-dihydropyridine 3,5-dicarboxylic acid
DE2210672C3 (de) 1972-03-06 1980-03-20 Bayer Ag, 5090 Leverkusen N-substituierte unsymmetrische 1 ^-Dihydropyridin-S^-dicarbonsäureester, Verfahren zu ihrer Herstellung sowie ihre Verwendung als Arzneimittel
US3915889A (en) 1972-05-25 1975-10-28 Us Agriculture Dihydrocinnamyl phenol antimicrobial agents
US3867548A (en) 1972-05-25 1975-02-18 Us Agriculture Dihydrocinnamyl phenols useful as antimicrobial agents
DE2228363A1 (de) 1972-06-10 1974-01-03 Bayer Ag 1,4-dihydropyridine, verfahren zu ihrer herstellung sowie ihre verwendung als arzneimittel
US3959296A (en) 1972-06-10 1976-05-25 Bayer Aktiengesellschaft 1,4-Dihydropyridines
US3968117A (en) 1972-06-10 1976-07-06 Bayer Aktiengesellschaft 1,4-Dihydropyridines
GB1399539A (en) 1972-11-03 1975-07-02 Science Union & Cie Tricyclic ureas processes for preparing them and pharma ceutical compositions containing them
US4164514A (en) 1972-12-06 1979-08-14 Pfizer Inc. 2-Aminomethyleneindanone analgesic agents
US4022836A (en) 1972-12-06 1977-05-10 Pfizer Inc. 2-Aminomethyleneindanone analgesic agents
US4117012A (en) 1972-12-06 1978-09-26 Pfizer Inc. 2-aminomethyleneindanone analgesic agents
DE2303761A1 (de) 1973-01-26 1974-08-01 Henkel & Cie Gmbh Neue n,n'-disubstituierte thioharnstoffe, deren herstellung sowie verwendung als antimikrobielle substanzen
GB1391862A (en) 1973-04-04 1975-04-23 Yeda Res & Dev Benzodiazepines
US3873715A (en) 1973-04-06 1975-03-25 Univ Miami Therapeutic agent for improving cardiovascular function
US3930005A (en) 1973-06-15 1975-12-30 Squibb & Sons Inc Antiinflammatory agents and their use
US4002775A (en) 1973-07-09 1977-01-11 Kabara Jon J Fatty acids and derivatives of antimicrobial agents
US3856962A (en) 1973-07-10 1974-12-24 R Alphin Anti-inflammatory agents
US4190587A (en) 1973-08-06 1980-02-26 Hoffmann-La Roche Inc. 4-(3-Oxo-4-trifluoromethyl-1-octenyl)-2-oxo-2H-cyclopenta[b]furans
US3968125A (en) 1973-11-05 1976-07-06 Eli Lilly And Company Dihydroxyhexahydrodibenzo[b,d]pyrans
US4011321A (en) 1973-12-19 1977-03-08 Smith Kline & French Laboratories Limited Pharmaceutical compositions and methods of inhibiting β-adrenergic receptors
US3991212A (en) 1973-12-26 1976-11-09 Eli Lilly And Company Anti-inflammatory agents
US4314081A (en) 1974-01-10 1982-02-02 Eli Lilly And Company Arloxyphenylpropylamines
US4313896A (en) 1974-01-10 1982-02-02 Eli Lilly And Company Aryloxyphenylpropylamines
US4018895A (en) 1974-01-10 1977-04-19 Eli Lilly And Company Aryloxyphenylpropylamines in treating depression
US4194009A (en) 1974-01-10 1980-03-18 Eli Lilly And Company Aryloxyphenylpropylamines for obtaining a psychotropic effect
FR2260331B1 (ko) 1974-02-08 1978-01-13 Mauvernay Centre Europ Rech
US3949082A (en) 1974-07-24 1976-04-06 Merck & Co., Inc. Thiadiazoles as anti-inflammatory agents
US3896139A (en) 1974-03-14 1975-07-22 Syntex Inc Process for preparing 3-(4-or-5-azidocarbonylthiazol-2-oxy)-propanediol-1,2-acetonides
US3949081A (en) 1974-04-08 1976-04-06 Ciba-Geigy Corporation 4-Carbamoyl-1-benzazepines as antiinflammatory agents
US3991201A (en) 1974-06-27 1976-11-09 Janssen Pharmaceutica N.V. 1-(β-Aryl-β-R-ethyl)imidazoles as antimicrobial agents
US3975543A (en) 1974-07-05 1976-08-17 Eli Lilly And Company Ethyl- and vinylbenzenes as anti-inflammatory agents
US4083968A (en) 1974-07-19 1978-04-11 Hoffmann-La Roche Therapeutic agent for improving cardiovascular function
US4058620A (en) 1974-07-19 1977-11-15 Hoffmann-La Roche Inc. Therapeutic agents for improving cardiovascular function
US4164586A (en) 1974-07-19 1979-08-14 Hoffmann-La Roche Inc. Therapeutic agent for improving cardiovascular function
US4076834A (en) 1974-07-19 1978-02-28 Hoffmann-La Roche Inc. Therapeutic agents for improving cardiovascular function
US3940407A (en) 1974-09-16 1976-02-24 Syntex (U.S.A.) Inc. β-Adrenergic blocking agents in the 1,2,3-thiadiazole series
DE2449030A1 (de) 1974-10-11 1976-05-20 Schering Ag Neue pyridin-derivate
US4000282A (en) 1974-12-16 1976-12-28 Merck & Co., Inc. 2-(3-tert. butyl or isopropylamino-2-hydroxypropoxy)-3-cyanopyridines
US4048058A (en) 1975-08-13 1977-09-13 Standard Oil Company (Indiana) Methods to be used in reforming processes employing multi-metallic catalysts
US4027031A (en) 1975-04-28 1977-05-31 Stauffer Chemical Company 2-Cyclopropanecarboxamido-S-halothiazole as anti-inflammatory agents
US3959368A (en) 1975-04-28 1976-05-25 Stauffer Chemical Company N,N-dimethyl-N'-phenylthiocarbamyl formamidine and its use as an anti-inflammatory agent
US3998970A (en) 1975-04-28 1976-12-21 Stauffer Chemical Company N,N-dimethyl-N'-phenylthiocarbamyl formamidine and its use as an anti-inflammatory agent
US3968224A (en) 1975-04-28 1976-07-06 Stauffer Chemical Company 3-(4'-Chlorophenyl)-5-methyl-4,5-dihydro-1,2,4-oxadiazole, its use as an anti-inflammatory agent
US3978227A (en) 1975-04-28 1976-08-31 Stauffer Chemical Company 5-furoyl-2,2,4-trimethyl-1,4-dihydro-1h-1,5-benzodiazepine as an anti-inflammatory agent
US3947475A (en) 1975-04-28 1976-03-30 Stauffer Chemical Company 5-Furoyl-2,2,4-trimethyl-1,4-dihydro-1H-1,5-benzodiazepine as an anti-inflammatory agent
US3966944A (en) 1975-05-19 1976-06-29 Abbott Laboratories 10 (N-methyl-4-piperidylidene)-10H[1]-benzopyrano[3,2-b]-pyridine as an analgesic, anti-inflammatory and agent against type III hypersensitivity disease
US4024284A (en) 1975-06-09 1977-05-17 Eli Lilly And Company Ethyl- and vinylbenzenes as anti-inflammatory agents
GB1495778A (en) 1975-06-18 1977-12-21 Wyeth John & Brother Ltd Hexahydroazepines
US4055655A (en) 1975-07-21 1977-10-25 National Research Laboratories Complexes of heavy metal ions and polyfunctional organic ligands used as antimicrobial agents
US3978219A (en) 1975-07-25 1976-08-31 Stauffer Chemical Company Nicotinamidoxime as an anti-inflammatory agent
US3978202A (en) 1975-07-25 1976-08-31 Stauffer Chemical Company ο-Chlorobenzamidoxime as an anti-inflammatory agent
US4011326A (en) 1975-07-29 1977-03-08 Merck & Co., Inc. 2-Substituted oxazolo[4,5-b]pyridine anti-inflammatory agents
AT361486B (de) 1975-08-07 1981-03-10 Hoffmann La Roche Verfahren zur herstellung von neuen imidazo(1,5 -a) (1,4)diazepinverbindungen, ihren salzen und optisch aktiven formen
US4025640A (en) 1975-08-26 1977-05-24 American Hoechst Corporation Oxothienobenzoxepin-acetic acids, precursors and derivatives thereof
US4012527A (en) 1975-09-15 1977-03-15 Stauffer Chemical Company N,N-Dimethyl-N'-phenylthiocarbamyl formamidine hydrochloride and its use as an anti-inflammatory agent
US3994898A (en) 1975-10-16 1976-11-30 E. R. Squibb & Sons, Inc. 1,2,4-Triazolo (4,3-b) pyridazin-3-ones
FR2330383A1 (fr) 1975-11-06 1977-06-03 Synthelabo Nouveaux ethers de phenols substitues, leurs sels, leur preparation et les medicaments qui les renferment
US4082843A (en) 1975-11-26 1978-04-04 Smith Kline & French Laboratories Limited 3-(3-(3-Substituted amino-2-hydroxypropoxy)phenyl)-6-hydrazino pyridazines and their use as vasodilators and β-adrenergic blocking agents
US4049665A (en) 1975-12-24 1977-09-20 Colgate-Palmolive Company Unsymmetrical disulfides as antimicrobial agents
JPS5946205B2 (ja) 1976-01-01 1984-11-10 科研製薬株式会社 ベンゾイル誘導体を有効成分とする消炎鎮痛剤
US4145444A (en) 1976-01-01 1979-03-20 Kaken Chemical Co., Ltd. Anti-inflammatory agent of benzoyl derivative
US4012448A (en) 1976-01-15 1977-03-15 Stanford Research Institute Synthesis of adriamycin and 7,9-epiadriamycin
US4275064A (en) 1976-02-06 1981-06-23 Interx Research Corporation Transient pro-drug forms of xanthine derivatives and their use as topical anti-inflammatory agents
US4130664A (en) 1976-02-13 1978-12-19 Uniroyal, Inc. (Bis(diphenylaminomethane) antimicrobial agents
US4018923A (en) 1976-03-10 1977-04-19 Eli Lilly And Company 5,6-Diaryl-1,2,4-triazines as topically-active anti-inflammatory agents
US4021553A (en) 1976-03-10 1977-05-03 Eli Lilly And Company 5,6-Diaryl-1,2,4-triazines as topically-active anti-inflammatory agents
US4013672A (en) 1976-03-15 1977-03-22 E. R. Squibb & Sons, Inc. 2,5,7,8-Tetrahydro-1,2,4,5,6-pentaazabenzo[6,7]-cyclohepta[1,2,3-cd]-as-indacenes
US4018779A (en) 1976-03-25 1977-04-19 E. R. Squibb & Sons, Inc. Derivatives of 10,11-dihydrobenzo[4,5]cyclohepta[1,2-b]-pyrazolo[4,3-e]pyridine-5(1H)ones
PL101032B1 (pl) 1976-04-06 1978-11-30 Sposob otrzymywania 1-nitro-9-dwualkilo-aminoizoalkiloamiroakrydyn lub ich soli
US4020072A (en) 1976-05-04 1977-04-26 E. R. Squibb & Sons, Inc. 5-Aminomethyl-1H-pyrazolo[3,4-b]pyridines
US4064258A (en) 1976-07-19 1977-12-20 Syntex (U.S.A.) Inc. Thiazole cardiovascular agents
US4092419A (en) 1976-06-15 1978-05-30 Merck & Co., Inc. Substituted (3-loweralkylamino-2-R1 O-propoxy)pyridines, their preparation and use
IL52448A (en) 1976-07-06 1981-09-13 Bayer Ag Antimycotic and sporicidal pharmaceutical compositions comprising imidazol-1-yl-(4-phenoxy-phenyl)-(pyridin-2-yl)phenyl methane
US4056673A (en) 1976-07-16 1977-11-01 Hoffmann-La Roche Inc. Phosphonoacetic acid derivatives of nucleosides
US4064257A (en) 1976-07-19 1977-12-20 Syntex (U.S.A.) Inc. Thiazole cardiovascular agents
US4064259A (en) 1976-07-19 1977-12-20 Syntex (U.S.A.) Inc. Thiazole cardiovascular agents
DE2635665A1 (de) 1976-08-07 1978-02-09 Bayer Ag Antimikrobielle mittel
DE2644833A1 (de) 1976-10-05 1978-04-20 Boehringer Sohn Ingelheim Neue 1-aryloxy-2-hydroxy-3-alkylenaminopropane und verfahren zu ihrer herstellung
US4069341A (en) 1976-10-18 1978-01-17 The Dow Chemical Company Oxybis(4,1-phenylene(2-oxo-2,1-ethanediyl)) thiocyanate and its use as an antimicrobial agent
US4304910A (en) 1978-05-04 1981-12-08 Kewanee Industries, Inc. Quarnary ammonium polymeric anti-microbial agent
US4089977A (en) 1976-11-24 1978-05-16 Kewanee Industries Polymeric anti-microbial agent
US4124707A (en) 1976-12-22 1978-11-07 Schering Corporation 7α-Halogeno-3,20-dioxo-1,4-pregnadienes, methods for their manufacture, their use as anti-inflammatory agents, and pharmaceutical formulations useful therefor
US4062858A (en) 1976-12-22 1977-12-13 E. R. Squibb & Sons, Inc. Derivatives of 5,6-dihydrobenzo[5,6]cyclohepta[1,2-b]pyrazolo[4,3-e]pyridin-11(1H)-ones and 11(1H)-imines
JPS53113032A (en) 1977-03-09 1978-10-03 Mitsubishi Chem Ind Ltd Immune depresants
US4246411A (en) 1977-03-14 1981-01-20 Pcr Incorporated 5,5-Difluorouracil
DE2711106A1 (de) 1977-03-15 1978-09-21 Bayer Ag Bis-(5,5'-dimethyl-1,3-oxazolidin- 3-yl)methan
US4252815A (en) 1977-04-21 1981-02-24 Mead Johnson & Company Methods of treating cardiovascular diseases with phenyltetrazolyloxy propanolamines
FR2388799A1 (fr) 1977-04-28 1978-11-24 Rolland Sa A Derives de pyridazinone, leur procede de preparation et leur application comme medicaments
DE2720868A1 (de) 1977-05-10 1978-11-23 Bayer Ag Antimikrobielle mittel
US4128664A (en) 1977-05-16 1978-12-05 Riker Laboratories, Inc. Substituted benzamides as anti-inflammatory agents
US4133819A (en) 1977-06-17 1979-01-09 Pfizer Inc. Hexahydro-1-hydroxy-9-hydroxymethyl-3-substituted-6H-dibenzo[b,d]pyrans as analgesic agents
US4209520A (en) 1977-06-17 1980-06-24 Pfizer Inc. Hexahydro-1-hydroxy-9-hydroxymethyl-3-substituted-6H-dibenzo[b,d]pyrans as analgesic agents
US4125612A (en) 1977-06-20 1978-11-14 Schering Corporation N-1-(p-Biphenylalkyl)piperazines and their use as anti-inflammatory agents
US4314943A (en) 1977-07-13 1982-02-09 Mead Johnson & Company Heterocyclic substituted aryloxy 3-indolyl-tertiary butylaminopropanols
US4147798A (en) 1977-08-02 1979-04-03 W. R. Grace & Co. Antineoplastic agent
US4306097A (en) 1977-09-13 1981-12-15 Pfizer Inc. 3-[2-Hydroxy-4-(substituted)phenyl]-cycloalkanol analgesic agents
US4147872A (en) 1977-09-13 1979-04-03 Pfizer Inc. 3-[2-Hydroxy-4-(substituted)-phenyl]azacycloalkanes and derivatives thereof as analgesic agents and intermediates therefor
US4145443A (en) 1977-10-31 1979-03-20 Syntex (U.S.A.) Inc. Bicyclo 3.1.0!hexylethylaminocarbonyl-substituted naphthyloxy cardiovascular agents
US4151297A (en) 1977-10-31 1979-04-24 Syntex (U.S.A.) Inc. Bicyclo [3.1.0] hexyl-substituted ethylamino carbonyl phenoxy cardiovascular agents
US4123550A (en) 1977-10-31 1978-10-31 Syntex (U.S.A.) Inc. Bicyclo[3.1.0]hexylethylaminocarbonyl-substituted heteroaryl cardiovascular agents
US4220594A (en) 1977-11-04 1980-09-02 E. R. Squibb & Sons, Inc. Hexa- and octahydro-4,7-epoxyisobenzofuran-1-ol and hexa- and octahydro-5,8-epoxy-1H-2-benzopyran-3-ol
US4143054A (en) 1977-11-04 1979-03-06 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane- and 7-oxabicycloheptene compounds
US4201778A (en) 1977-11-08 1980-05-06 Schering Corporation 6-Acyloxy-1,4,6-pregnatrienes, their use as anti-inflammatory agents, methods for their manufacture, and 6-oxo-1,4-pregnadiene intermediates
DE2757680A1 (de) 1977-12-23 1979-06-28 Troponwerke Gmbh & Co Kg Neue 2-oxo-1-pyrrolidinessigsaeurederivate, verfahren zu ihrer herstellung und ihre verwendung als arzneimittel
FR2415099A1 (fr) 1978-01-20 1979-08-17 Ile De France Nouveaux derives de 4-amino-5-alkylsulfonyl ortho-anisamides, leurs procedes de preparation et leur application comme psychotropes
US4329289A (en) 1978-02-08 1982-05-11 Hoffmann-La Roche Inc. Adrenergic blocking agents
US4247710A (en) 1978-02-08 1981-01-27 Hoffmann-La Roche Inc. Intermediate in the production of adrenergic blocking agents
US4394448A (en) 1978-02-24 1983-07-19 Szoka Jr Francis C Method of inserting DNA into living cells
US4397844A (en) 1978-02-24 1983-08-09 Ciba-Geigy Corporation Antigen derivatives and processes for their preparation
JPS54119499A (en) 1978-03-09 1979-09-17 Shionogi & Co Ltd Triazolobenzodiazepin derivative
US4181720A (en) 1978-04-05 1980-01-01 Syntex (U.S.A.) Inc. Corticosteroid antiinflammatory agents
GB1573599A (en) 1978-05-24 1980-08-28 Wyeth John & Brother Ltd 4-aminoquinoline derivatives
US4177280A (en) 1978-07-03 1979-12-04 Syntex (U.S.A.) Inc. Bicyclo[3.1.0]hexyl-substituted carbonylaminophenoxy cardiovascular agents
US4214089A (en) 1978-07-18 1980-07-22 American Home Products Corporation Thiazolo[3,2-a]benzimidazoles, imidazo [2,1-b]thiazoles, and related compounds as antineoplastic agents, and enhancers of the immune response
DE2960689D1 (en) 1978-07-28 1981-11-19 Synthelabo Fluorene and fluoranthene derivatives, process for their preparation and their therapeutic application
US4267328A (en) 1978-08-01 1981-05-12 Synthelabo 1-Phenylpiperazines
JPS5538325A (en) 1978-09-11 1980-03-17 Sankyo Co Ltd 4-anilinoquinazoline derivative and its preparation
US4342769A (en) 1978-10-02 1982-08-03 Schering Corporation 2-[(Methylsulfinyl)acetyl]-3-heterocyclicindoles and derivatives thereof as immunosuppressants
DE2965394D1 (en) 1978-11-01 1983-06-16 Sanraku Ocean Co Process for producing antibiotic beta-lactam compounds
US4173650A (en) 1978-11-03 1979-11-06 American Cyanamid Company Cis-2-benzoyl-3-hydroxy-2-alkenonitriles as anti-inflammatory agents
US5066493A (en) 1978-11-03 1991-11-19 American Home Products Corporation Rapamycin in treatment of tumors
US4355034A (en) 1979-02-07 1982-10-19 Merck & Co., Inc. Ethenyl derivatives of mercaptoalkylpyridines as anti-inflammatory agents
FI800381A (fi) 1979-02-16 1980-08-17 Sandoz Ag Nya kefalosporinderivat deras framstaellning och anvaendning som antimikrobiella aemnen
US4173634A (en) 1979-02-23 1979-11-06 E. R. Squibb & Sons, Inc. Basically-substituted tricyclic pyrazoles useful as antiinflammatory agents
US4234593A (en) 1979-03-20 1980-11-18 Stauffer Chemical Company 3-(N-Alkylcarbamyl)-5-(carboalkoxy)-1,3,4-oxadiazole-2-thiones and their use as anti-inflammatory agents
US4226887A (en) 1979-04-16 1980-10-07 Eli Lilly And Company Anti-inflammatory agents
FR2455039A1 (fr) 1979-04-26 1980-11-21 Synthelabo Pyrimido et imidazo-pyrido-indole-diones et leur application en therapeutique
US4244955A (en) 1979-04-30 1981-01-13 Richardson-Merrell Inc. 2,4a-Ethanobenz[g]isoquinolin-5(1H)-ones and their use as anti-fertility and analgesic agents
US4260634A (en) 1979-06-18 1981-04-07 International Minerals & Chemical Corp. Antimicrobial agents
US4308283A (en) 1979-06-18 1981-12-29 International Minerals & Chemical Corp. Antimicrobial agents
DE2931778A1 (de) 1979-08-04 1981-02-19 Bayer Ag Antimikrobielle mittel
US4283394A (en) 1979-08-06 1981-08-11 Research Corporation Cytotoxic nucleoside-corticosteroid phosphodiesters
US4450159A (en) 1979-08-08 1984-05-22 The Upjohn Company Carbamic acid derivatives as selective immunosuppresive agents
CA1151651A (en) 1979-08-08 1983-08-09 Takao Kiyohara Antitumor and immunosuppressive 4-carbamoyl imidazolium-5-olate derivatives, pharmaceutical composition and production thereof
JPS5645460A (en) 1979-09-20 1981-04-25 Sumitomo Chem Co Ltd Novel imidazolyl sulfonate derivative
US4278608A (en) 1979-09-06 1981-07-14 Hoffmann-La Roche Inc. Adrenergic blocking agents
US4281189A (en) 1979-09-06 1981-07-28 Hoffmann-La Roche Inc. Sulfonamide intermediates for adrenergic blocking agents
US4285873A (en) 1979-09-06 1981-08-25 Hoffmann-La Roche Inc. Adrenergic blocking agents
US4304721A (en) 1979-09-06 1981-12-08 Hoffmann-La Roche Inc. Adrenergic blocking agents
HU185926B (en) 1979-09-27 1985-04-28 Agostne Kahan Process for preparing water soluble derivatives of non-steroid antiinflammatory compositions and pharmaceutical compositins containing such derivatives
US4244963A (en) 1979-09-27 1981-01-13 Merck & Co., Inc. 1-[2-(Alkyl and arylsulfonyl)-2-propenyl and propyl] substituted piperidines useful as antimicrobial and antiinflammatory agents
JPS6043064B2 (ja) 1979-11-28 1985-09-26 ウェルファイド株式会社 新規イソオキサゾ−ル誘導体
US4252816A (en) 1979-12-03 1981-02-24 Merck & Co., Inc. Tetrahydro-1H-1,4-diazepino(1,7-a)benzimidazoles useful as analgesic agents
MC1357A1 (fr) 1979-12-07 1981-08-10 Hoffmann La Roche Derives de 2,3-indoledione
US4335141A (en) 1979-12-26 1982-06-15 Merck & Co., Inc. 2-Substituted-aminopropene-and propanenitrile antimicrobial and anti-inflammatory agents
US4391904A (en) 1979-12-26 1983-07-05 Syva Company Test strip kits in immunoassays and compositions therein
US4311709A (en) 1979-12-26 1982-01-19 Merck & Co., Inc. Loweralkyl substituted diphenyl polyamine as an antimicrobial agent
IE810250L (en) 1980-02-11 1981-08-11 Berlex Lab N-(3-phenoxy-2-hydroxypropyl) benzimidazole -1-¹alkanamines.
JPS56113748A (en) 1980-02-13 1981-09-07 Kowa Co Aminoethanol derivative and its preparation
US4251530A (en) 1980-02-19 1981-02-17 Merck & Co., Inc. 2-{[4-(6-Substituted-2-pyrazinyl)-1-piperazinyl]alkyl}-5-substituted-1,2,4-triazolo[4,3-a]pyridin-3(2H)-one analgesic agents
US4391982A (en) 1980-03-05 1983-07-05 The University Of Rochester Intermediates for the production of picropodophyllin and related compounds and processes for the preparation and use thereof
US4294763A (en) 1980-03-05 1981-10-13 University Of Rochester Intermediates for the production of picropodophyllin and related compounds and processes for the preparation and use thereof
US4399283A (en) 1980-03-11 1983-08-16 Warner Lambert Company Pharmaceutical salts of 4'-(9-acridinylamino)-methanesulfon-m-anisidide
FR2480283A1 (fr) 1980-04-10 1981-10-16 Science Union & Cie Nouveaux derives tricycliques, leurs procedes de preparation et leur utilisation comme medicament
JPS56145222A (en) 1980-04-28 1981-11-11 Toshiyuki Hamaoka Improved antibody and its preparation
DE3018865A1 (de) 1980-05-16 1981-11-26 Bayer Ag, 5090 Leverkusen Antimikrobielle mittel
DE3019322A1 (de) 1980-05-21 1981-12-03 Merck Patent Gmbh, 6100 Darmstadt Psychopharmakon sowie verwendung von adenosinderivaten
US4361583A (en) 1980-08-19 1982-11-30 Synthelabo Analgesic agent
US4391827A (en) 1980-09-08 1983-07-05 Pfizer Inc. 3-(2-Hydroxy-4-(substituted)phenyl)-cycloalkanone and cycloalkanol analgesic agents and intermediates therefor
JPS5767516A (en) 1980-09-24 1982-04-24 Microbial Chem Res Found Novel analgesic agent
JPS57106617A (en) 1980-12-23 1982-07-02 Sankyo Co Ltd Analgesic and anti-inflammatory agent
US4568679A (en) 1980-12-23 1986-02-04 Merck & Co., Inc. Aralkylaminoethanol heterocyclic compounds
US4599228A (en) 1981-01-19 1986-07-08 Vipont Laboratories, Inc. Antimicrobial agent
US4520026A (en) 1981-02-06 1985-05-28 S. A. Labaz N.V. Indolizine derivatives and use as cardiovascular agents
DE3104380A1 (de) 1981-02-07 1982-08-19 Bayer Ag, 5090 Leverkusen Antimikrobielle mittel
US4412995A (en) 1981-02-19 1983-11-01 Sterling Drug Inc. Pentacyclic phenylpyrazole compounds as anti-inflammatory agents
US4370484A (en) 1981-03-12 1983-01-25 The Regents Of The University Of California Sceptrin an antimicrobial agent from Agelas sceptrum
US4443451A (en) 1981-07-15 1984-04-17 Janssen Pharmaceutica N.V. Bicyclic pyrimidin-5-one derivatives
US4440763A (en) 1981-03-18 1984-04-03 Block Drug Company, Inc. Use of 4-aminosalicyclic acid as an anti-inflammatory agent
JPS57156466A (en) 1981-03-24 1982-09-27 Mitsui Toatsu Chem Inc Uracil derivative and medicinal composition containing the same
JPS57169490A (en) 1981-04-10 1982-10-19 Kumiai Chem Ind Co Ltd 2,3-disubstituted-5,6-dihydro-imidazo(2,1-b)thiazole, its salt and their preparation
US4501755A (en) 1981-05-01 1985-02-26 Pennwalt Corporation Isoflavones useful as anti-inflammatory agents
US4440779A (en) 1981-06-30 1984-04-03 Merck & Co., Inc. Tricyclic derivatives of substituted pyrrole acids as analgesic and anti-inflammatory agents
US4568762A (en) 1981-07-01 1986-02-04 Hoffmann-La Roche Inc. 4-Methyl-2-oxo-cyclopentylidene acetic acid and esters thereof
US4548938A (en) 1981-07-15 1985-10-22 Janssen Pharmaceutica N.V. 5-H-1,3,4-thiadiazolo[3,2-a]pyrimidin-5-one compounds
US4434175A (en) 1981-08-10 1984-02-28 Merck & Co., Inc. Nonsteroidal compounds as anti-inflammatory and analgesic agents
US4490540A (en) 1981-09-14 1984-12-25 Janssen Pharmaceutica N.V. (2-Aryl-4-phenylthioalkyl-1,3-dioxolan-2-ylmethyl)azole derivatives
US4410696A (en) 1981-09-24 1983-10-18 Sumitomo Chemical Company, Limited Antitumor and immunosuppressive 4-carbamoylimidazolium-5-olate derivatives
DE3169269D1 (en) 1981-09-25 1985-04-18 Lacer Sa 1-azaxanthone for use as therapeutic agent, processes for its production and pharmaceutical compositions
US4514415A (en) 1981-10-28 1985-04-30 Ciba Geigy Corporation Benzofuran-2(3H)-ones used as anti-inflammatory agents
US4537981A (en) 1981-11-09 1985-08-27 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane and 7-oxabicycloheptene compounds
US4374139A (en) 1981-11-09 1983-02-15 Hoffmann-La Roche Inc. Levorotatory N-substituted acylmorphinans useful as analgesic agents
US4567201A (en) 1981-11-25 1986-01-28 Takeda Chemical Industries, Ltd. Diphenoxypropane derivatives and compositions of antiasthmatic and antiinflammatory agents thereof
ATE15762T1 (de) 1981-12-08 1985-10-15 Smithkline Beckman Corp Pharmazeutische zusammensetzungen mit gehalt an 7,8-dihydroxy-1-(hydroxy-phenyl)-2,3,4,5tetrahydro-1h-3-benzazepin-derivaten und an einem beta-adrenergischen blocker.
US4891370A (en) 1981-12-14 1990-01-02 Merck & Co., Inc. Cephalosporin derivatives as anti-inflammatory agents
US4536503A (en) 1981-12-14 1985-08-20 Syntex (U.S.A.) Inc. Naphthoxyalkylamines and related compounds as antiinflammatory agents
US4578390A (en) 1981-12-14 1986-03-25 Merck & Co., Inc. Hydroxybenzylamino derivatives as anti-inflammatory agents
US4383994A (en) 1982-01-19 1983-05-17 Mccully Kilmer S Homocysteine thiolactone salts and use thereof as anti-neoplastic agents
DE3204795A1 (de) 1982-02-11 1983-08-18 Bayer Ag, 5090 Leverkusen Azolyl-phenoxy-tetrahydrofuran-2-yliden-methane, verfahren zu ihrer herstellung sowie antimikrobielle mittel, die diese stoffe enthalten
US4512990A (en) 1982-02-18 1985-04-23 Syntex (U.S.A.), Inc. Benzthiazine analogs as antiinflammatory agents
US4435420A (en) 1982-04-12 1984-03-06 Merrell Dow Pharmaceuticals Anti-inflammatory agents and antiasthmatic agents
US4886790A (en) 1982-04-12 1989-12-12 The Research Foundation Of State University Of New York Novel bis(2,2-dimethyl-1-aziridinyl) phosphinic amides for use in the treatment of tumors
US4544501A (en) 1982-04-12 1985-10-01 The Research Foundation Of State University Of New York Bis(2,2-dimethyl-1-aziridinyl)phosphinic amides for use in the treatment of tumors
US4529727A (en) 1982-04-21 1985-07-16 Janssen Pharmaceutical, N.V. Pyrimido[2,1-b][1,3]-thiazines
JPS58185562A (ja) 1982-04-22 1983-10-29 Taisho Pharmaceut Co Ltd １，４−ジヒドロピリジン誘導体
US4418076A (en) 1982-05-03 1983-11-29 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane hydrazone prostaglandin analogs useful in treating thrombolytic diseases
DE3216895A1 (de) 1982-05-06 1983-11-10 Henkel KGaA, 4000 Düsseldorf 2-(3-iod-2-propinyloxy)-ethanol-carbamate, ihre herstellung und ihre verwendung als antimikrobielle substanzen
US4474806A (en) 1982-05-10 1984-10-02 Merck & Co., Inc. Sulfonyl or carbonyl inositol derivatives useful as anti-inflammatory/analgesic agents
US4556675A (en) 1982-05-17 1985-12-03 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane and 7-oxabicycloheptene compounds
US4537904A (en) 1982-05-17 1985-08-27 E. R. Squibb & Sons, Inc. Compositions of 7-oxabicycloheptane and 7-oxabicycloheptene compounds and a method for their use in inhibiting bronchoconstriction
US4614825A (en) 1982-05-17 1986-09-30 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane and 7-oxabicycloheptene compounds
US4416896A (en) 1982-05-17 1983-11-22 E. R. Squibb & Sons, Inc. 7-Oxabicyclopheptane substituted amino prostaglandin analogs useful in the treatment of thrombolytic disease
US4493839A (en) 1982-05-24 1985-01-15 Merck & Co., Inc. 1-Carbapenem-3-carboxylic esters as anti-inflammatory agents
US4465687A (en) 1982-05-24 1984-08-14 Merck & Co., Inc. Thienamycin derivatives as anti-inflammatory agents
US4495197A (en) 1982-05-24 1985-01-22 Merck & Co., Inc. N-Carboxyl-thienamycin esters and analogs thereof as anti-inflammatory agents
US4748018A (en) 1984-02-07 1988-05-31 Stolle Research & Development Corp. Method of passive immunization of mammals using avian antibody
US4511724A (en) 1982-06-10 1985-04-16 Merck & Co., Inc. 5-(Pyrrol-2-oyl)-1,2-dihydro-3H-pyrrolo [1,2-a]pyrrole derivatives as anti-inflammatory and analgesic agents
US4427694A (en) 1982-06-11 1984-01-24 The Vinoxen Company, Inc. Sesamin as a psychotropic agent
US4424202A (en) 1982-06-11 1984-01-03 The Vinoxen Company, Inc. Azelaaldehydates as psychotropic agents
US4440781A (en) 1982-06-11 1984-04-03 The Vinoxen Company, Inc. Oxyoctadecanoates as psychotropic agents
US4463015A (en) 1982-08-18 1984-07-31 E. R. Squibb & Sons, Inc. Aryl substituted 7-oxabicycloheptane compounds, useful in inhibiting platelet aggregation
US4539326A (en) 1982-08-20 1985-09-03 Takeda Chemical Industries, Ltd. 5-Oxo-5H-(1)benzopyrano(2,3-b)pyridine derivatives, their production and use as anti-inflammatory agents
US4489098A (en) 1982-09-28 1984-12-18 The Dow Chemical Company 2,2,3-Trihalopropionaldehydes as antimicrobial agents
US4631283A (en) 1982-09-30 1986-12-23 Ortho Pharmaceutical Corporation Ortho substituted dihydroxy-2(1H)quinazolinone-1-alkanoic acids
US4536512A (en) 1982-10-08 1985-08-20 Merck & Co., Inc. 5-(2,3-Dihydro-1H-pyrrolizin-5-oyl)-2,3-dihydro-1H-pyrrolizine-1-alkanoic or carboxylic acids and use thereof as anti-inflammatory and analgesic agents
US4533671A (en) 1982-10-08 1985-08-06 Merck & Co., Inc. 5-(2,3-Dihydro-1H-pyrrolizin-5-oyl)-2-alkanoic or carboxylic acids and analogs as anti-inflammatory and analgesic agents
US4456615A (en) 1982-10-25 1984-06-26 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted amino prostaglandin analogs and their use in inhibiting platelet aggregation and bronchoconstriction
JPS59112984A (ja) 1982-12-21 1984-06-29 Shionogi & Co Ltd １，４−ベンゾジアゼピン誘導体
US4456616A (en) 1982-12-27 1984-06-26 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted amino prostaglandin analogs and their use in inhibiting platelet aggregation and bronchoconstriction
US4456617A (en) 1983-01-12 1984-06-26 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted amino prostaglandin analogs and their use in inhibiting platelet aggregation and bronchoconstriction
US4466979A (en) 1983-01-21 1984-08-21 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted carbamate prostaglandin analogs useful in treating platelet aggregation and bronchoconstriction
DE3464368D1 (de) 1983-03-09 1987-07-30 Beecham Group Plc Anti-inflammatory pyrazolo pyridines
US4582854A (en) 1983-03-14 1986-04-15 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted oxa prostaglandin analgos useful in the treatment of thrombolytic disease
US4474803A (en) 1983-03-14 1984-10-02 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted thio prostaglandin analogs useful in treating platelet aggregation and bronchoconstriction
JPS59186969A (ja) 1983-04-08 1984-10-23 Yoshitomi Pharmaceut Ind Ltd ベンゾフラン−およびベンゾピランカルボキサミド誘導体
FR2544718B1 (fr) 1983-04-21 1985-12-20 Hexachimie Diniflumate d'ester morpholinoethylique d'acide niflumique, preparation, utilisation en therapeutique comme analgesique et anti-inflammatoire
US5186941A (en) 1983-05-06 1993-02-16 Vestar, Inc. Vesicle formulation for the controlled release of therapeutic agents
US4517188A (en) 1983-05-09 1985-05-14 Mead Johnson & Company 1-Pyrimidinyloxy-3-hetaryl-alkylamino-2-propanols
US4680298A (en) 1983-05-31 1987-07-14 Schering Corporation Tricyclic anti-allergy and use as anti-inflammatory agents
DE3324192A1 (de) 1983-07-05 1985-01-17 Troponwerke Gmbh & Co Kg Depot-antiphlogistika
DE3324193A1 (de) 1983-07-05 1985-01-17 Troponwerke Gmbh & Co Kg Depot-antiphlogistika
FR2559484B2 (fr) 1983-07-06 1986-09-26 Provesan Sa Nouveau derive 7-(pyrrol-1-yl) de l'acide 1-ethyl-1,4-dihydro-4-oxo-(1,8-naphtyridin)-3-carboxylique, sa preparation et son application en tant que medicament
US4550186A (en) 1983-07-11 1985-10-29 Duke University Binuclear copper (II) carboxylates formed from amine-carboxyboranes
US4541956A (en) 1983-07-28 1985-09-17 Unique Technologies, Inc. Tin steroids and their use as antineoplastic agents
CA1239934A (en) 1983-08-05 1988-08-02 Lloyl D. Hayward D-isoidide and nitrates thereof
JPS6038323A (ja) 1983-08-10 1985-02-27 Sankyo Co Ltd 眼科用消炎剤
AU571554B2 (en) 1983-08-24 1988-04-21 Kotobuki Seiyaku Co. Ltd. Azulene sulfonates
US4479953A (en) 1983-08-25 1984-10-30 Merck & Co., Inc. Pyrazine aldimine compounds as antimicrobial agents
US4525479A (en) 1983-08-29 1985-06-25 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted thiocarbamate prostaglandin analogs useful as cardiovascular agents
US4645836A (en) 1983-09-12 1987-02-24 Ortho Pharmaceutical Corporation Process for the preparation of 6,7-dihydroxy-4-alkyl-2(1H) quinazolinone-1-propionic acids
US4474804A (en) 1983-09-19 1984-10-02 E. R. Squibb & Sons, Inc. 7-Oxabicyclo substituted prostaglandin phenyl carboxylic acid derivatives useful as cardiovascular agents
US4656267A (en) 1983-09-29 1987-04-07 Ortho Pharmaceutical Corporation Substituted 2(1H)-quinazolinone-1-alkanoic acids and esters
US4555571A (en) 1983-09-29 1985-11-26 Ortho Pharmaceutical Corporation Substituted 2(1H)-quinazolinone-1-alkanoic acids and esters
US4555570A (en) 1983-09-29 1985-11-26 Ortho Pharmaceutical Corporation Substituted 4-alkyl-2-(1H) quinazolinone-1-alkanoic acid derivatives
US4556739A (en) 1983-09-29 1985-12-03 Ortho Pharmaceutical Corporation 3,4-Dialkoxy-2-alkylcarbonyl analino compounds
US4613600A (en) 1983-09-30 1986-09-23 Mead Johnson & Company Antidepressant 1,2,4-triazolone compounds
US4774256A (en) 1983-10-03 1988-09-27 E. R. Squibb & Sons, Inc. Use of enkephalinase inhibitors as analgesic agents
US4686235A (en) 1983-10-12 1987-08-11 Merck & Co., Inc. Substituted cinnamyl-2,3-dihydrobenzofuran and analogs useful as anti-inflammatory agents
US4778818A (en) 1983-10-12 1988-10-18 Merck & Co., Inc. Substituted 2-(heteroaryl-2-propenyl)phenols useful as anti-inflammatory agents
US4537903A (en) 1983-10-12 1985-08-27 Merck & Co., Inc. Substituted cinnamyl-2,3-dihydrobenzofuran and analogs useful as anti-inflammatory agents
US4522949A (en) 1983-10-20 1985-06-11 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted prostaglandin interphenylene analogs useful as cardiovascular agents
US4492700A (en) 1983-10-24 1985-01-08 Merck & Co., Inc. 3-Halo-2-thiopyrazines as antimicrobial agents
GB8328757D0 (en) 1983-10-27 1983-11-30 Wellcome Found Chemical compounds
US4681879A (en) 1983-11-07 1987-07-21 Hoechst-Roussel Pharmaceuticals Inc. 11-substituted 5H,11H-pyrrolo[2,1-c][1,4]benzoxazepines as antipsychotic and analgesic agents
US4608374A (en) 1983-11-07 1986-08-26 Hoechst-Roussel Pharmaceuticals Inc. 11-substituted 5H,11H-pyrrolo[2,1-c][1,4]benzoxazepines as antipsychotic and analgesic agents
US4667039A (en) 1983-11-07 1987-05-19 Hoechst-Roussel Pharmaceuticals Inc. 11-substituted 5H,11H-pyrrolo(2,1-C) (1,4)benzoxazepines as antipsychotic and analgesic agents
US4524151A (en) 1983-11-14 1985-06-18 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane thio ethers useful as cardiovascular agents
US4563476A (en) 1983-11-21 1986-01-07 Merck & Co., Inc. Substituted 5-hydroxy-2,3-dihydrobenzofurans and analogs thereof useful as anti-inflammatory agents
US4632923A (en) 1984-08-15 1986-12-30 Schering Corporation Substituted hetero spiro pyridine derivatives as anti-allergy and anti-inflammatory agents
US4652564A (en) 1983-12-14 1987-03-24 Schering Corporation Substituted spiro pyridine derivatives as anti-allergy and antiinflammatory agents
US4532327A (en) 1983-12-28 1985-07-30 The United States Of America As Represented By The Secretary Of Agriculture Sesbanimide and the use thereof in treating leukemic tumors
DE3402392A1 (de) 1984-01-25 1985-08-01 Sandoz-Patent-GmbH, 7850 Lörrach Neue ergolinderivate, deren herstellung und deren verwendung
US4533673A (en) 1984-01-26 1985-08-06 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted enaminone prostaglandin analogs and their use in treatment of thrombolytic disease
US4526900A (en) 1984-01-26 1985-07-02 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted oxa prostaglandin analogs and their use in the treatment of thrombolytic disease
US4526901A (en) 1984-01-26 1985-07-02 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted oxamide prostaglandin analogs and their use in treating thrombolytic disease
IN163263B (ko) 1984-02-07 1988-08-27 Pfizer
US4721712A (en) 1984-06-12 1988-01-26 Pfizer Inc. 1,3-disubstituted 2-oxindoles as analgesic and anti-inflammatory agents
US4593029A (en) 1984-02-15 1986-06-03 Syntex (U.S.A.) Inc. Novel ω-(N-imidazolyl)alkyl ethers of 1,2,3,5-tetrahydroimidazo[2,1-b]quinazolin-2-ones
US4558067A (en) 1984-03-01 1985-12-10 Merck & Co., Inc. Phenylthiomethyl-6-hydroxy-2,3-dihydrobenzo-pyran and analogs thereof useful as anti-inflammatory agents
US5135926A (en) 1984-03-14 1992-08-04 Bodor Nicholas S Soft β-adrenergic blocking agents
US4536513A (en) 1984-03-14 1985-08-20 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted prostaglandin interphenylene analogs useful in the treatment of thrombolytic disease
US5202347A (en) 1984-03-14 1993-04-13 Bodor Nicholas S Soft β-adrenergic blocking agents
US5334601A (en) 1984-03-14 1994-08-02 Bodor Nicholas S Soft β-adrenergic blocking agents
US4829086A (en) 1984-03-14 1989-05-09 Bodor Nicholas S Soft β-adrenergic blocking agents
US4556672A (en) 1984-03-19 1985-12-03 Pfizer Inc. 3-Substituted 2-oxindole-1-carboxamides as analgesic and anti-inflammatory agents
US4542155A (en) 1984-04-02 1985-09-17 E. R. Squibb & Sons, Inc. Tetrahydrofuranyl substituted prostaglandin analogs
US4536514A (en) 1984-04-06 1985-08-20 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombolytic disease
US4579867A (en) 1984-04-09 1986-04-01 American Hospital Supply Corporation Stable pharmaceutical compositions of short-acting β-adrenergic receptor blocking agents
US4550187A (en) 1984-04-12 1985-10-29 The Research Foundation Of State University Of New York Synthesis of platinum (IV) antineoplastic agents
US4542156A (en) 1984-04-26 1985-09-17 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted prostaglandin alcohols and their use in the treatment of thrombolytic disease
US4542157A (en) 1984-04-27 1985-09-17 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted oxa prostaglandin analogs and their use in the treatment of thrombolytic disease
US4550120A (en) 1984-04-30 1985-10-29 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted ethers and their use in treating thrombolytic disease
US4569942A (en) 1984-05-04 1986-02-11 Pfizer Inc. N,3-Disubstituted 2-oxindole-1-carboxamides as analgesic and antiinflammatory agents
US4521539A (en) 1984-05-10 1985-06-04 E. R. Squibb & Sons, Inc. Tetrahydrofuranyl substituted ethers
US4542151A (en) 1984-12-17 1985-09-17 E. R. Squibb & Sons, Inc. Tetrahydrothienyl substituted ethers
DK240184D0 (da) 1984-05-15 1984-05-15 Ferrosan As Beta-carboline-3-carboxylic acid derivatives and method of preparing the same
DK240084D0 (da) 1984-05-15 1984-05-15 Ferrosan As New beta-carboline-3-oxadiazolyl derivatives
JPS60248659A (ja) 1984-05-25 1985-12-09 Microbial Chem Res Found ３−〔ｎ−（メルカプトアシル）〕アミノ−４−アリ−ル酪酸誘導体及びそれを有効成分とする鎮痛剤
US4579866A (en) 1984-05-29 1986-04-01 Usv Pharmaceutical Corp. Phenylacetamides as anti-allergy, anti-asthma and anti-inflammatory agents
US4555523A (en) 1984-06-04 1985-11-26 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted thio prostaglandin analogs and their use in the treatment of thrombolytic disease
US4560698A (en) 1984-06-04 1985-12-24 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted thio prostaglandin analogs and their use in the treatment in thrombolytic disease
GB8414518D0 (en) 1984-06-07 1984-07-11 Pfizer Ltd Therapeutic agents
US5310731A (en) 1984-06-28 1994-05-10 Whitby Research, Inc. N-6 substituted-5'-(N-substitutedcarboxamido)adenosines as cardiac vasodilators and antihypertensive agents
GB8416724D0 (en) 1984-06-30 1984-08-01 Sorbio Sa Lab Active compounds
US4552866A (en) 1984-07-05 1985-11-12 E. R. Squibb & Sons, Inc. Use of diamino alcohols as analgesic agents
US4670541A (en) 1984-07-05 1987-06-02 E. R. Squibb & Sons, Inc. Use of diamino alcohols as analgesic agents
US4594188A (en) 1984-07-11 1986-06-10 E. R. Squibb & Sons, Inc. Use of diamino ketones as analgesic agents
US4539312A (en) 1984-07-11 1985-09-03 E. R. Squibb & Sons, Inc. Use of diamino ketones as analgesic agents
US4730052A (en) 1984-07-13 1988-03-08 Taisho Pharmaceutical Co., Ltd. Method for preparing unsymmetrical 1,4-dihydropyridine-3,5-dicarboxylic acid diesters
US4542160A (en) 1984-07-30 1985-09-17 E. R. Squibb & Sons, Inc. Method of use of bicycloheptane substituted prostaglandin analogs as cardiovascular agents
US4611066A (en) 1984-08-10 1986-09-09 Arizona State University Bryostatins 4 to 8
US4845242A (en) 1987-04-28 1989-07-04 Georgia Tech Research Corporation Isocoumarins with basic substituents as serine proteases inhibitors, anticoagulants and anti-inflammatory agents
US4954519A (en) 1987-04-28 1990-09-04 Georgia Tech Research Corporation Isocoumarins with basic substituents as serine proteases inhibitors, anticoagulants and anti-inflammatory agents
WO1986001510A1 (en) 1984-08-24 1986-03-13 Pfizer Inc. Tricyclic oxindole antiinflammatory agents
US4749792A (en) 1984-09-26 1988-06-07 E. R. Squibb & Sons, Inc. Diamino ketones and alcohols as analgesic agents
DE3438351A1 (de) 1984-10-19 1986-04-24 Gödecke AG, 1000 Berlin 4-alkoxy-pyrido(2,3-d)pyrimidin-derivate, verfahren zu deren herstellung und deren verwendung
US4686224A (en) 1984-10-31 1987-08-11 Pfizer Inc. Oxindole antiinflammatory agents
US4644005A (en) 1984-10-31 1987-02-17 Pfizer Inc. Oxindole antiinflammatory agents
US4575512A (en) 1984-11-01 1986-03-11 E. R. Squibb & Sons, Inc. 7-Oxabicycloheptane substituted oxa prostaglandin analogs and their anti-thrombotic compositions and methods
JPS61112075A (ja) 1984-11-05 1986-05-30 Shionogi & Co Ltd チエニルピラゾロキノリン誘導体
US4647585A (en) 1984-11-08 1987-03-03 E. R. Squibb & Sons, Inc. Bicycloheptane substituted ethers
US4650874A (en) 1984-11-26 1987-03-17 G. D. Searle & Co. N-(aralkoxybenzyl)-4(benzhydryl) piperidines
US4661506A (en) 1984-11-30 1987-04-28 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted ox prostaglandin analogs
US4638011A (en) 1984-12-17 1987-01-20 E. R. Squibb & Sons, Inc. Tetrahydrothienyl substituted prostaglandin analogs
US4684747A (en) 1984-12-20 1987-08-04 Yale University N,N'-bis(sulfonyl)hydrazines having antineoplastic activity
US4892887A (en) 1984-12-20 1990-01-09 Yale University N,N'-bis(sulfonyl)hydrazines having antineoplastic activity
FR2575753B1 (fr) 1985-01-07 1987-02-20 Adir Nouveaux derives peptidiques a structure polycyclique azotee, leur procede de preparation et les compositions pharmaceutiques qui les contiennent
US4588743A (en) 1985-01-22 1986-05-13 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane-substituted oxa prostaglandin analogs and their use in the treatment of thrombolytic disease
US4760051A (en) 1985-01-24 1988-07-26 Pickart Loren R Use of GHL-Cu as a wound-healing and anti-inflammatory agent
US4588742A (en) 1985-02-20 1986-05-13 E. R. Squibb & Sons, Inc. Thiabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombotic disease
US4591603A (en) 1985-02-25 1986-05-27 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombotic disease
US4588741A (en) 1985-02-28 1986-05-13 E. R. Squibb & Sons, Inc. Platelet aggregation inhibiting and bronchoconstriction inhibiting thiabicycloheptane substituted amino prostaglandin analog derivatives, compositions, and method of use therefor
US4684653A (en) 1985-03-08 1987-08-04 The Trustees Of Princeton University Pyrido(2,3-d)pyrimidine derivatives
US4927828A (en) 1985-03-08 1990-05-22 The Trustees Of Princeton University Diastereoisomeric tetrahydropyrido-(2,3,d) pyrimidine derivatives
DE3510203A1 (de) 1985-03-21 1986-09-25 Bayer Ag, 5090 Leverkusen Neue iodpropargylether, ein verfahren zu ihrer herstellung und ihre verwendung
US4596828A (en) 1985-03-28 1986-06-24 Merck & Co., Inc. [(2-hydroxy-5-alkoxyphenyl)methylthio]phenylmethanol and derivatives thereof useful as anti-inflammatory agents
US4607049A (en) 1985-04-22 1986-08-19 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted thio prostaglandin analogs useful in the treatment of thrombolytic disease
US4611007A (en) 1985-04-22 1986-09-09 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombotic disease
US4775679A (en) 1985-04-25 1988-10-04 Merck & Co., Inc. Certain heterocyclic-ethyl-2,3-dihydrobenzofurans useful as anti-inflammatory agents
US4713393A (en) 1985-04-25 1987-12-15 Merck & Co., Inc. Phenylpropyl-2,3-dihydrobenzofurans useful as anti-inflammatory agents
US4608386A (en) 1985-04-26 1986-08-26 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane ethers useful in the treatment of thrombotic diseases
US4748153A (en) 1985-04-29 1988-05-31 Merck & Co., Inc. Compounds having somatostatin-like activity useful as local anti-inflammatory agents
US4585755A (en) 1985-04-29 1986-04-29 Merck & Co., Inc. Cyclic and bridged cyclic somatostatin analogs useful as local anti-inflammatory agents
FR2581382B1 (fr) 1985-05-06 1987-06-26 Sanofi Sa Derives n-(quinolyl) glycinamides, leur procede de preparation et leur application therapeutique en tant que psychotropes
US4607048A (en) 1985-05-16 1986-08-19 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted aryl amino prostaglandin analogs and their use in inhibiting platelet aggregation and bronchoconstriction
US4595692A (en) 1985-05-17 1986-06-17 E. R. Squibb & Sons, Inc. 7-thiabicycloheptane substituted ethers
US4611005A (en) 1985-05-21 1986-09-09 E. R. Squibb & Sons, Inc. 5,6-epoxy-7-oxabicycloheptane substituted prostaglandin analogs useful in the treatment of thrombotic disease
FR2599039B1 (fr) 1986-05-22 1988-08-05 Rhone Poulenc Sante Nouvelle substance immuno-suppressive, sa preparation par culture de streptomyces sp. (cbs 162.86) et les compositions pharmaceutiques qui la contiennent
US5202330A (en) 1985-06-03 1993-04-13 E. R. Squibb & Sons, Inc. 2-thio or oxo-4-aryl or heterocyclo-1,5(2H)-pyrimidinedicarboxylic acid diesters and 3-acyl-5-pyrimidinecarboxylic acids and esters
US4628095A (en) 1985-06-05 1986-12-09 G. D. Searle & Co. Substituted N-benzyl-4-(benzhydryl) piperidines
US5026712A (en) 1985-06-05 1991-06-25 Schering Ag Novel imidazo[1,5-a]pyridines, useful as cardiovascular and CNS agents
US4863955A (en) 1985-06-06 1989-09-05 Eli Lilly And Company Scytophycins
US4996229A (en) 1985-06-06 1991-02-26 University Of Hawaii Scytophycins
US4609671A (en) 1985-06-27 1986-09-02 E. R. Squibb & Sons, Inc. 5,6-epoxy-7-oxabicycloheptane substituted amino prostaglandin analogs useful in the treatment of thrombotic disease
US4611006A (en) 1985-06-28 1986-09-09 E. R. Squibb & Sons, Inc. 5,6-epoxy-7-oxabicycloheptane substituted ethers useful in the treatment of thrombotic disease
US4737493A (en) 1985-07-01 1988-04-12 Warner-Lambert Company 7-((substituted)amino)-8-((substituted)carbonyl)-methylamino)-1-oxaspiro(4,5)decanes as analgesic agents
US4663336A (en) 1985-07-01 1987-05-05 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted diamide and its congener prostaglandin analogs useful in the treatment of thrombotic disease
US4998931A (en) 1985-07-05 1991-03-12 Puget Sound Blood Center Method of reducing immunogenicity and inducing immunologic tolerance
US4678802A (en) 1985-07-09 1987-07-07 Pfizer Inc. 1-acylcarbamoyloxindole-3-carboxamides as antiinflammatory agents
US4654335A (en) 1985-07-11 1987-03-31 E. R. Squibb & Sons, Inc. Antihypertensive 1,5-benzothiazepine derivatives, compositions, and method of use therefor
US4704382A (en) 1985-07-29 1987-11-03 G. D. Searle & Co. Phenylpiperazine phosphonates
US4654355A (en) 1985-08-01 1987-03-31 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted amide-thioamide prostaglandin analogs
US4654356A (en) 1985-08-01 1987-03-31 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted diacid diamide prostaglandin analogs
US4647561A (en) 1985-08-05 1987-03-03 E. R. Squibb & Sons, Inc. 1,5-benzodiazepine compounds
US4654357A (en) 1985-08-09 1987-03-31 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted sulfonamide prostaglandin analogs
US4626548A (en) 1985-08-19 1986-12-02 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted prostaglandin compounds useful in the treatment of thrombotic disease
GB8521350D0 (en) 1985-08-28 1985-10-02 Euro Celtique Sa Analgesic composition
US4632931A (en) 1985-09-25 1986-12-30 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted amide-sulfonamide prostaglandin analogs useful in the treatment of thrombotic disease
US4686221A (en) 1985-10-01 1987-08-11 Kanebo, Ltd. Quinolinecarboxylic acid compounds and antimicrobial agent containing the same
US4593042A (en) 1985-10-18 1986-06-03 G. D. Searle & Co. Bicyclo-substituted phenylacetonitrile derivatives
CA1306260C (en) 1985-10-18 1992-08-11 Shionogi & Co., Ltd. Condensed imidazopyridine derivatives
US4652576A (en) 1985-10-18 1987-03-24 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted amide-carbamate prostaglandin analogs
US4639461A (en) 1985-10-28 1987-01-27 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted keto-amide prostaglandin analogs useful in the treatment of thrombotic disease
US4638012A (en) 1985-11-05 1987-01-20 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane α-substituted ketone prostaglandin analogs useful in the treatment of thrombotic disease
DE3540653A1 (de) 1985-11-13 1987-05-14 Schering Ag Neue 3-oxadiazol- und 3-carbonsaeure-ss-carbolinderivate, ihre herstellung und ihre verwendung als arzneimittel
US4824955A (en) 1985-11-15 1989-04-25 Nippon Kayaku Kabushiki Kaisha Selenium oxy chloride-pyridine or bipyridine complexes
US4647573A (en) 1985-11-22 1987-03-03 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted thioamide-amide prostaglandin analogs
US4656185A (en) 1985-12-05 1987-04-07 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted aminoalkyl amide prostaglandin analogs
US5106996A (en) 1985-12-05 1992-04-21 Bristol-Myers Company Process for the preparation of podophyllotoxin
US4618685A (en) 1985-12-18 1986-10-21 Mccully Kilmer S N-homocysteine thiolactonyl retinamide and use thereof as an antineoplastic agent
US5055290A (en) 1985-12-18 1991-10-08 Boehringer Mannehim Gmbh Ciamexone as a selective immunosuppressant
US4668787A (en) 1985-12-20 1987-05-26 Ortho Pharmaceutical Corporation 5,6-dialkoxy-4-imino-2(1H)quinazolinone derivatives
US4622326A (en) 1985-12-23 1986-11-11 Hoechst-Roussel Pharmaceuticals Inc. 6H-isoxazolo(5,4-d)pyrazolo(3,4-b)pyridines, and their use as antihypertensive and analgesic agents
US4849563A (en) 1986-01-21 1989-07-18 Yale University Novel 1-alkyl-1-arenesulfonyl-2-alkoxycarbonylsulfenylhydrazines having antineoplastic activity
US4962114A (en) 1986-01-21 1990-10-09 Yale University 1-alkyl-1-sulfonyl-2-alkoxycarbonylsulfenylhydrazines having antineoplastic activity
US4904786A (en) 1986-01-27 1990-02-27 American Home Products Corporation Quinoline compounds as antiallergic and antiinflammatory agents
US4772703A (en) 1986-01-27 1988-09-20 American Home Products Corporation 2-(phenoxymethyl)-quinazolines as antiallergic and antiinflammatory agents
US4780538A (en) 1986-02-12 1988-10-25 Merck & Co., Inc. Process for 1,4-dihydropyridine compounds using a titanamine catalyst
US4727072A (en) 1986-02-12 1988-02-23 Mcneilab, Inc. 3-alkoxy-2-aminopropylamines compositions and use as cardiovascular agents
US4745123A (en) 1986-02-18 1988-05-17 Warner-Lambert Company Substituted tetrahydro-3-pyridine-carboxylic acid, ester, and amide cholinergic agents
US4652578A (en) 1986-02-24 1987-03-24 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted amide prostaglandin analogs
IL81610A (en) 1986-02-27 1990-12-23 Roussel Uclaf Derivatives of 1,2,5,6-tetrahydropyridin-3-carboxaldehyde oxime,their preparation and pharmaceutical compositions containing them
US4746504A (en) 1986-03-14 1988-05-24 Bio-Technology General Corp. Heavy metal salts of hyaluronic acid and their use as antimicrobial agents
US4784991A (en) 1986-03-14 1988-11-15 Bio-Technology General Corp. Heavy metal salts of hyaluronic acid and their use as antimicrobial agents
US4663337A (en) 1986-04-18 1987-05-05 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted amides useful in the treatment of thrombotic disease
US4707550A (en) 1986-04-28 1987-11-17 Ortho Pharmaceutical Corporation N-(substituted thienyl)-N'-(substituted piperazinyl)-ureas
US4703120A (en) 1986-04-28 1987-10-27 Ortho Pharmaceutical Corporation Furo(3,4-d)pyrimidine-2,4-dione derivatives and intermediates thereof
US4670560A (en) 1986-04-28 1987-06-02 Ortho Pharmaceutical Corporation Thienopyrimidine-2,4-dione derivatives and intermediates thereof
EP0248523B1 (en) 1986-05-07 1991-10-16 FISONS plc Pyrazoles
US4670453A (en) 1986-05-08 1987-06-02 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted amido-carbamoyl prostaglandin analogs useful in the treatment of thrombotic disease
US4835166A (en) 1986-06-09 1989-05-30 Pfizer Inc. Antiallergy and antiinflammatory agents
US5036088A (en) 1986-06-09 1991-07-30 Pfizer Inc. Antiallergy and antiinflammatory agents, compositions and use
US4708966A (en) 1986-06-27 1987-11-24 The Procter & Gamble Company Novel anti-inflammatory agents, pharmaceutical compositions and methods for reducing inflammation
US4833145A (en) 1986-06-30 1989-05-23 The Trustees Of Princeton University 4(3H)-oxo-5,6,7,8-tetrahydropyrido[2,3-d]pyrimidine derivatives
US4650797A (en) 1986-07-18 1987-03-17 E. R. Squibb & Sons, Inc. Substituted 1,5-benzodiazepine compounds
US4877619A (en) 1986-08-25 1989-10-31 Vestar, Inc. Liposomal vesicles for intraperitoneal administration of therapeutic agents
GB8620880D0 (en) 1986-08-29 1986-10-08 Pfizer Ltd Therapeutic agents
US4775757A (en) 1986-09-22 1988-10-04 Ortho Pharmaceutical Corporation Thienopyridines useful as cardiovascular agents
US4734426A (en) 1986-09-24 1988-03-29 E. R. Squibb & Sons, Inc. 5,6-epoxy-7-oxabicycloheptane substituted diamide prostaglandin analogs
US4734424A (en) 1986-09-24 1988-03-29 E. R. Squibb & Sons, Inc. Bicycloheptane substituted diamide and its congener prostaglandin analogs
US4735962A (en) 1986-10-06 1988-04-05 E. R. Squibb & Sons, Inc. 7-thiabicycloheptane substituted diamide and its congener prostaglandin analogs
US4734425A (en) 1986-10-17 1988-03-29 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted hydroxamic acid prostaglandin analogs
US4782071A (en) 1986-11-03 1988-11-01 Warner-Lambert Company Tetrasubstituted urea cholinergic agents
NO874194L (no) 1986-11-07 1988-05-09 Pfizer Ltd Fremgangsmaate ved fremstilling av dihydro-pyridinderivater
US4738978A (en) 1986-11-10 1988-04-19 E. R. Squibb & Sons, Inc. Bisthioamide-7-oxabicycloheptane prostaglandin analogs
US4785085A (en) 1986-11-21 1988-11-15 Bristol-Myers Company Rebeccamycin analogs
US4710508A (en) 1986-12-08 1987-12-01 Warner-Lambert Company O-substituted tetrahydropyridine oxime cholinergic agents
US4786648A (en) 1986-12-08 1988-11-22 Warner-Lambert Company O-substituted tetrahydropyridine oxime cholinergic agents
IT1213555B (it) 1986-12-11 1989-12-20 Boehringer Biochemia Srl 2 metiltiometildiidropiridine, un processo per laloro preparazione e composizioni farmaceutiche che le contengono.
US5702688A (en) 1986-12-23 1997-12-30 Tristrata Technology, Inc. Amphoteric compositions and polymeric forms of alpha hydroxyacids, and their therapeutic use
US4874760A (en) 1987-01-09 1989-10-17 Toa Eiyo, Ltd. 4,7-dihydroisothiazolo(5,4-b)pyridine derivatives and cardiovascular treating agents containing said derivatives
US4945099A (en) 1987-01-12 1990-07-31 Eli Lilly And Company Anti-inflammatory agents
US5098613A (en) 1987-01-12 1992-03-24 Eli Lilly And Company Anti-inflammatory agents
US4791129A (en) 1987-01-20 1988-12-13 Pfizer Inc. 1,3-dicarboxamidooxindoles as analgesic and antiinflammatory agents
US5109024A (en) 1987-02-03 1992-04-28 Merrell Dow Pharmaceuticals Inc. Polyamine derivatives as antineoplastic agents
US4767776A (en) 1987-02-20 1988-08-30 Warner-Lambert Company N-1H-tetrazol-5-yl-2-naphthalene carboxamides and their use as antiallergy and antiinflammatory agents
US4764525A (en) 1987-02-25 1988-08-16 Warner-Lambert Company N-1H-tetrazol-5-ylbenzamides having use as antiallergy and antiinflammatory agents
US4749715A (en) 1987-03-02 1988-06-07 E. R. Squibb & Sons, Inc. 7-oxabicycloheptane substituted amino prostaglandin analogs
US5049387A (en) 1987-03-09 1991-09-17 Alza Corporation Inducing skin tolerance to a sensitizing drug
US5118509A (en) 1987-03-09 1992-06-02 Alza Corporation Inducing skin tolerance to a sensitizing drug
US5017618A (en) 1987-03-16 1991-05-21 University Of Florida Labile derivatives of ketone analogs of 3-substituted-1-alkylamino-2-propanols and their use as beta-adrenergic blockers
US4798841A (en) 1987-03-31 1989-01-17 Warner-Lambert Company Tetrahydropyridine oxime cholinergic agents and method of treatment
US4753946A (en) 1987-04-08 1988-06-28 E. R. Squibb & Sons, Inc. Pyrimidinecarboxylic acid derivatives
FR2613719B1 (fr) 1987-04-10 1991-03-22 Sanofi Sa Derives aromatiques, leur preparation et leur utilisation comme antimicrobiens
US5002955A (en) 1987-04-23 1991-03-26 Hoechst-Roussel Pharmaceuticals Inc. Fused heteroalkylene quinolinamines and use as cholinergic agents
US5219873A (en) 1987-04-24 1993-06-15 Roussel Uclaf Compounds of 1,2,5,6-tetrahydropyridine which are useful as cholinergic agents
US5324648A (en) 1987-04-28 1994-06-28 Georgia Tech Research Corporation Substituted isocoumarins as serine protease inhibitors and anti-inflammatory agents
US4769371A (en) 1987-05-01 1988-09-06 E. R. Squibb & Sons, Inc. Dihydropyrimidine carboxylic acid esters
US6048729A (en) 1987-05-01 2000-04-11 Transkaryotic Therapies, Inc. In vivo protein production and delivery system for gene therapy
US4912248A (en) 1987-05-18 1990-03-27 The Procter & Gamble Company Novel anti-inflammatory agents, pharmaceutical compositions and methods for reducing inflammation
GB8711802D0 (en) 1987-05-19 1987-06-24 Fujisawa Pharmaceutical Co Dithioacetal compounds
US4888434A (en) 1987-05-26 1989-12-19 Dow Corning K.K. Antimicrobial agent
US5019390A (en) 1987-05-29 1991-05-28 Research Corporation Technologies, Inc. Anticancer agent--IMIC
GB8712747D0 (en) 1987-05-30 1987-07-01 Pfizer Ltd Therapeutic agents
US5298633A (en) 1987-06-08 1994-03-29 Allergan, Inc. Intermediates and processes for preparing 4-substituted 2-5(H)-furanones as anti-inflammatory agents
US5037811A (en) 1990-04-17 1991-08-06 Allergan, Inc. 4-(oxygen, sulfur or nitrogen substituted)-methyl 5-hydroxy-2(5H)-furanones as anti-inflammatory agents
US5081147A (en) 1990-03-15 1992-01-14 Allergan, Inc. 4-(1-hydroxy-2-substituted amino)ethyl-5-hydroxy-2(5H)-furanones as anti-inflammatory agents
US5043457A (en) 1990-04-17 1991-08-27 Allergan, Inc. 2(5H)-furanones substituted in the 3 position, as Ca2+ channel antagonists and anti-inflammatory agents
US4889866A (en) 1987-06-11 1989-12-26 Syntex (U.S.A.) Inc. Arylsulfonyl dihydropyridine derivatives
US4752616A (en) 1987-06-29 1988-06-21 E. R. Squibb & Sons, Inc. Arylthioalkylphenyl carboxylic acids, compositions containing same and method of use
GB8716278D0 (en) 1987-07-10 1987-08-19 Fujisawa Pharmaceutical Co Antimicrobial agent
US5008264A (en) 1987-07-13 1991-04-16 Hoechst-Roussel Pharmaceuticals Inc. N-substituted-5,6-dimethoxy-1,2-benzisoxazole-3-propanamine and related compounds as analgesic and hypotensive agents
US5030639A (en) 1987-07-13 1991-07-09 Hoechst-Roussel Pharmaceuticals Inc. N-substituted-5,6-dimethoxy-1,2-benzisoxazole-3-propanamine and related compounds as analgesic and hypotensive agents
US4980365A (en) 1987-07-13 1990-12-25 Hoechst-Roussel Pharmaceuticals Inc. N-substituted-5,6-dimethoxy-1,2-benzisoxazole-3-propanamine and related compounds as analgesic and hypotensive agents
CA1322199C (en) 1987-07-15 1993-09-14 Masami Eigyo N-¬(2-oxopyrrolidin-1-yl) acetyl)| piperazine derivatives and drug for senile dementia
PL154186B1 (en) 1987-07-15 1991-07-31 Wellcome Found Method for manufacturing arylic derivatives of the hydroxamic acid
GB8716971D0 (en) 1987-07-17 1987-08-26 Pfizer Ltd Therapeutic agents
US4767756A (en) 1987-07-17 1988-08-30 E. R. Squibb & Sons, Inc. 3-substituted benzazepines
US4794110A (en) 1987-07-20 1988-12-27 Hoechst-Roussel Pharmaceuticals, Inc. 5-Aryl-11-substituted-5H,11H-pyrrolo[2,1-c][1,4]benzoxazepined as analgesic and hypotensive agents
US4771047A (en) 1987-07-27 1988-09-13 E. R. Squibb & Sons, Inc. Benzazepine derivatives
US4847290A (en) 1987-08-17 1989-07-11 Sumner Burstein Delta 1-thc-7-oic acid and analgesic and anti-inflammatory agents
CA1305148C (en) 1987-08-19 1992-07-14 Hiromu Matsumura Carbamoylpyrrolidone derivatives and drugs for senile dementia
US4774239A (en) 1987-08-26 1988-09-27 E. R. Squibb & Sons, Inc. Benzazepine derivatives
FR2620704B1 (fr) 1987-09-17 1991-04-26 Sanofi Sa Derives de (benzyl-4 piperidino)-1 propanol-2, leur preparation, leur utilisation comme antimicrobiens et les produits les contenant
US4826990A (en) 1987-09-30 1989-05-02 American Home Products Corporation 2-aryl substituted heterocyclic compounds as antiallergic and antiinflammatory agents
US4942236A (en) 1987-09-30 1990-07-17 American Home Products Corporation 2-aryl substituted pyridyl-containing phenyl sulfonamido compounds as antiallergic and antiinflammatory agents
US4895953A (en) 1987-09-30 1990-01-23 American Home Products Corporation 2-Aryl substituted heterocyclic compounds as antiallergic and antiinflammatory agents
US5654484A (en) 1987-10-08 1997-08-05 Merrell Pharmaceuticals Inc. Polyamine derivatives as antineoplastic agents
GB8726950D0 (en) 1987-11-18 1987-12-23 Boots Co Plc Chemical process
US5266562A (en) 1987-11-19 1993-11-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Anti-inflammatory agents
US5055466A (en) 1987-11-23 1991-10-08 E. R. Squibb & Sons, Inc. N-morpholino derivatives and their use as anti-hypertensive agents
US4847303A (en) 1987-11-23 1989-07-11 The Procter & Gamble Company Tert-butylphenyl compounds useful as anti-inflammatory agents
US4883872A (en) 1987-11-25 1989-11-28 E. R. Squibb & Sons, Inc. 3-oxo-1,2,4-triazolo(4,3-A) pyrimidine-6-carboxylic acid esters
US4847379A (en) 1987-11-30 1989-07-11 E. R. Squibb & Sons, Inc. 3,6-dihydro-1,5(2H)-pyrimidinecarboxylic acid esters
US4910192A (en) 1987-12-04 1990-03-20 Sri International Topically active steroidal anti-inflammatory agents
HUT58275A (en) 1987-12-11 1992-02-28 Mitsui Petrochemical Ind Process for producing amines and pharmaceutical compositions containing them
US4870210A (en) 1987-12-18 1989-09-26 American Home Products Corporation Aminoguanidine derivative as anti-inflammatory agents
US4824831A (en) 1987-12-21 1989-04-25 E. R. Squibb & Sons, Inc. 4,5-dihydro-1H-benzazepine-3-carboxylic acid esters which are useful as anti-hypertensive agents
JPH01294683A (ja) 1988-02-04 1989-11-28 Kanebo Ltd 新規白金錯体および該化合物を有効成分とする抗腫瘍剤並びに該化合物製造用中間体
US4889859A (en) 1988-02-05 1989-12-26 The Trustees Of Princeton University Pyrido[2,3-d]pyrimidine derivatives
GB8803259D0 (en) 1988-02-12 1988-03-09 Zambeletti Spa L Compounds
GB8803963D0 (en) 1988-02-19 1988-03-23 Pfizer Ltd Therapeutic agents
GB8804439D0 (en) 1988-02-25 1988-03-23 Pfizer Ltd Dihydropyridines
US5217958A (en) 1988-03-03 1993-06-08 E. R. Squibb & Sons, Inc. 1,2-hydroxy phosphonates and derivatives thereof
US4900748A (en) 1988-03-04 1990-02-13 The United States Of America As Represented By The Department Of Health And Human Services Carbamates related to (-)-physostigmine as cholinergic agents
GB2216515A (en) 1988-03-04 1989-10-11 Nippon Shinyaku Co Ltd Acylphenol derivatives
US4906634A (en) 1988-03-08 1990-03-06 Schering A.G. Novel N-[4-(aminosubstituted)phenyl]methanesulfonamides and their use as cardiovascular agents
US4835157A (en) 1988-03-15 1989-05-30 Ortho Pharmaceutical Corporation Thieno- and furopyrimidine-2,4-dione piperidine derivatives as serotonin antagonists and alpha adrenergic blocking agents
US4981843A (en) 1988-04-07 1991-01-01 E. R. Squibb & Sons, Inc. N-heterocyclic alcohol derivatives
US5152980A (en) 1988-05-19 1992-10-06 The Beth Israel Hospital Association Induction of tolerance to a foreign antigen IL-2 receptor-binding substances
US4970318A (en) 1988-05-24 1990-11-13 Pfizer Inc. Aromatic and heterocyclic carboxamide derivatives as antineoplastic agents
US4882333A (en) 1988-05-25 1989-11-21 The Trustess Of Princeton University N-(5,6,7,8-tetrahydropyrido[2,3-d]pyrimidin-6-yl-alkanoyl)-glutamic acid derivatives
US4882334A (en) 1988-05-25 1989-11-21 The Trustees Of Princeton University N-(5,6,7,8-tetrahydropyrido]2,3-d]pyrimidin-6-ylethl-thineyl-and furylcarbonyl)-glutamic acid derivatives
US5208250A (en) 1988-05-25 1993-05-04 Warner-Lambert Company Known and selected novel arylmethylenyl derivatives of thiazolidinones, imidazolidinones and oxazolidinones useful as antiallergy agents and anti-inflammatory agents
US5306822A (en) 1988-05-25 1994-04-26 Warner-Lambert Company Arylmethylenyl derivatives of oxazolidinone
US4871746A (en) 1988-05-31 1989-10-03 The Trustees Of Princeton University N-[N-(tetrahydropyrido[2,3-D]pyrimidinylmethyl)-aminomethylbenzoyl]glutamic acid derivatives as neoplastic growth inhibitors
US4857644A (en) 1988-06-09 1989-08-15 American Home Products Corporation Aryl sulfonopiperazines as anti-inflammatory agents
JPH03504975A (ja) 1988-06-14 1991-10-31 セル―エスシーアイ　コーポレイション 異種官能性細胞免疫剤、それを含有するワクチン及びその使用方法
US4981792A (en) 1988-06-29 1991-01-01 Merck & Co., Inc. Immunosuppressant compound
US5290772A (en) 1988-06-29 1994-03-01 Merck & Co., Inc. Immunosuppressant agent
JPH0211501A (ja) 1988-06-30 1990-01-16 Chisso Corp 抗菌剤組成物
US5051423A (en) 1988-07-13 1991-09-24 Schering Ag Derivatized alkanolamines as cardiovascular agents
US4888335A (en) 1988-07-25 1989-12-19 Mcneilab, Inc. 3-alkoxy-2-aminopropyl heterocyclic amines and their use as cardiovascular agents
US5232939A (en) 1988-07-26 1993-08-03 Sankyo Company Limited Use of imidazopyrazole derivatives as analgesics and anti-inflammatory agents
US5665752A (en) 1988-07-26 1997-09-09 Sankyo Company, Limited Use of imidazopyrazole derivatives as analgesics and anti-inflammatory agents
US5354768A (en) 1988-07-26 1994-10-11 Sankyo Company, Limited Use of imidazopyrazole derivatives as analgesics and anti-inflammatory agents
US4977144A (en) 1988-08-02 1990-12-11 Ciba-Geigy Corporation Imidazo[4,5-b]pyridine derivatives as cardiovascular agents
US5175160A (en) 1988-08-09 1992-12-29 Daiichi Pharmaceutical Co., Ltd. Antimicrobial agent for animals
US5691346A (en) 1988-08-10 1997-11-25 The Australian National University Castanospermine as an anti-inflammatory and immunosuppressant agent
DE3829524A1 (de) 1988-08-31 1990-03-01 Behringwerke Ag Verwendung von transglutaminasen als immunsuppressiva
JPH0635464B2 (ja) 1988-09-02 1994-05-11 明治製菓株式会社 新規セフェム化合物、その製造法及び抗菌剤
US5185362A (en) 1988-09-14 1993-02-09 Mcneilab, Inc. Diphenylamine cardiovascular agents, compositions and use
US5073570A (en) 1988-09-14 1991-12-17 Lonza Inc. Mono-iodopropargyl esters of dicarboxylic anhydrides and their use as antimicrobial agents
US5219884A (en) 1988-09-14 1993-06-15 Taito Co., Ltd. Immunosuppressant
JPH02111766A (ja) 1988-10-20 1990-04-24 Taiho Yakuhin Kogyo Kk ベンゾチアジアゼピン誘導体及びその塩
US5006542A (en) 1988-10-31 1991-04-09 E. R. Squibb & Sons, Inc. Arylthioalkylphenyl carboxylic acids, derivatives thereof, compositions containing same and method of use
US4959383A (en) 1988-10-31 1990-09-25 E. R. Squibb & Sons, Inc. Phenylsulfone alkenoic acids, derivatives thereof, compositions containing same and method of use
US5070099A (en) 1988-10-31 1991-12-03 E. R. Squibb & Sons, Inc. Arylthioalkylphenyl carboxylic acids, derivatives thereof, compositions containing same method of use
US4883811A (en) 1988-11-17 1989-11-28 Misra Raj N 7-Oxabicycloheptane imino interphenylene substituted prostaglandin analogs useful in the treatment of thrombotic disease
US5256680A (en) 1988-11-29 1993-10-26 Warner-Lambert Company 3,5-di-tertiary-butyl-4-hydroxyphenyl-1,3,4-thiadiazoles, and oxadiazoles and 3,5-di-tertiary-butyl-4-hydroxy-phenyl-1,2,4-thiadazoles, oxadiazoles and triazoles as antiinflammatory agents
US5155122A (en) 1988-11-29 1992-10-13 Warner-Lambert Company 3,5-di-tertiary-butyl-4-hydroxyphenyl-1,3,4-thiadiazoles, and oxadiazoles and 3,5-di-tertiary-butyl-4-hydroxy-phenyl-1,2,4-thiadazoles, oxadiazoles and triazoles as antiinflammatory agents
US4897397A (en) 1988-12-16 1990-01-30 Schering Corporation Aryl-alkynoic, alkenoic or alkanoic compounds and compositions useful as antiallergy and anti-inflammatory agents
JPH02178263A (ja) 1988-12-27 1990-07-11 Kaken Pharmaceut Co Ltd アザアズレン誘導体、その製造法およびそれを有効成分とする抗アレルギー剤および抗炎症剤
US5013751A (en) 1989-01-10 1991-05-07 Alcon Laboratories, Inc. (+) Suprofen esters and amides as opthalmic anti-inflammatory agents
US4906655A (en) 1989-01-24 1990-03-06 Warner-Lambert Company Novel 1,2-cyclohexylaminoaryl amides useful as analgesic agents
JP2694361B2 (ja) 1989-02-09 1997-12-24 アストラ アクチエボラグ 抗菌剤
US5084281A (en) 1989-02-14 1992-01-28 Dillon Richard S Method and solution for treating tissue wounds
US4954526A (en) 1989-02-28 1990-09-04 The United States Of America As Represented By The Department Of Health And Human Services Stabilized nitric oxide - primary amine complexes useful as cardiovascular agents
US5540931A (en) 1989-03-03 1996-07-30 Charles W. Hewitt Methods for inducing site-specific immunosuppression and compositions of site specific immunosuppressants
US4981870A (en) 1989-03-07 1991-01-01 Pfizer Inc. Use of 4-phenyl-1,2,3,4-tetrahydro-1-naphthalenamine derivatives in the treatment of psychosis, inflammation and as immunosuppressants
EP0388153B1 (en) 1989-03-15 1994-12-28 Merck & Co. Inc. Immunosuppressant agent
US4952692A (en) 1989-04-04 1990-08-28 E. R. Squibb & Sons, Inc. Benzazepine derivatives
US5068323A (en) 1989-04-21 1991-11-26 Merck & Co., Inc. Thermally re-arranged FK-506 derivatives having immunosuppressant activity
IT1230145B (it) 1989-05-05 1991-10-14 Boehringer Biochemia Srl Complessi di rutenio (iii) come agenti antineoplastici.
US4981865A (en) 1989-05-26 1991-01-01 Warner-Lambert Co. N-hydroxyamide, N-hydroxythioamide, hydroxyurea, and N-hydroxythiourea derivatives of selected nsaids as antiinflammatory agents
US5075330A (en) 1989-05-26 1991-12-24 Warner-Lambert Co. N-hydroxyamide, N-hydroxythioamide, N-hydroxyurea, and N-hydroxythiourea derivatives of selected NSAIDS as antiinflammatory agents
US5112846A (en) 1989-05-26 1992-05-12 Warner-Lambert Company N-hydroxyamide, N-hydroxythioamide, hydroxyurea, and N-hydroxythiourea derivatives of selected nsaids as antiinflammatory agents
US5140031A (en) 1989-05-31 1992-08-18 E. R. Squibb & Sons, Inc. Pyranyl cyanoguanidine derivatives
FI902771A0 (fi) 1989-06-09 1990-06-04 Warner Lambert Co Foerfarande foer framstaellning av antiinflammatoriska 1,3,4-tiadiazoler och 1,3,4-oxadiazoler.
US5017578A (en) 1989-06-09 1991-05-21 Hoechst-Roussel Pharmaceuticals Inc. N-heteroaryl-purin-6-amines useful as analgesic and anticonvulsant agents
US4962119A (en) 1989-06-09 1990-10-09 Warner-Lambert Company Triazole derivatives of fenamates as antiinflammatory agents
US5066668A (en) 1989-06-09 1991-11-19 Warner-Lambert Co. Triazole derivatives of fenamates as antiinflammatory agents
US5104656A (en) 1989-06-16 1992-04-14 Seth Pyare L Percutaneous treatment with a high potency non-steroidal anti-inflammatory agent
US4931457B1 (en) 1989-06-28 1993-11-16 Hoechst-Roussel Pharmaceuticals Incorporated Naphthylamino-and naphthyloxy-pyridineamin compounds useful as topical antiinflammatory agents for the treatment of skin disorders
US4939137A (en) 1989-06-28 1990-07-03 Ortho Pharmaceutical Corporation Ring-fused thienopyrimidinedione derivatives
US5116867A (en) 1989-06-30 1992-05-26 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services D-propranolol as a selective adenosine antagonist
US5068247A (en) 1989-07-07 1991-11-26 Yoshitomi Pharmaceutical Industries, Ltd. 2-aminopentanoic acid compounds and their use as immunosuppressants
DE3925109A1 (de) 1989-07-28 1991-01-31 Max Planck Gesellschaft Extrakte der pflanze acanthospermum hispidum
DE69008454T2 (de) 1989-08-07 1994-08-25 Takeda Chemical Industries Ltd Nitrolsothiolderivate, ihre Herstellung und Verwendung.
US4904674A (en) 1989-08-16 1990-02-27 Hoechst-Roussel Pharmaceuticals Inc. 1-(Benzo[b]thienyl)-2-(thienyl)ethenes and related compounds useful as anti-inflammatory agents
US5252745A (en) 1989-08-25 1993-10-12 Rohm And Haas Company Preparation and use of iodopropargyl esters of α-amino acid derivatives as antimicrobial agents
US4988710A (en) 1989-08-25 1991-01-29 Washington University Aryl-cycloalkyl-alkanolamines for treatment of cholinergic neurotoxins
US5077404A (en) 1989-08-29 1991-12-31 Piper James R Cyclized 5,10-dideazaaminopterin compounds
US5101072A (en) 1989-09-06 1992-03-31 Yale University Sulfonylhydrazines and their use as antineoplastic agents and as antitrypanosomal agents
US5214068A (en) 1989-09-06 1993-05-25 Yale University Sulfonylhydrazines and their use as antineoplastic agents and as antitrypanosomal agents
US4966967A (en) 1989-09-15 1990-10-30 Berlex Laboratories, Inc. 3,4,5,6-tetrahydro-2H-1,7,4-benzodioxazonines as cardiovascular agents
US4970226A (en) 1989-10-03 1990-11-13 Harbor Branch Oceanographic Institution, Inc. Bis-indole imidazole compounds which are useful antitumor and antimicrobial agents
US5071848A (en) 1989-10-23 1991-12-10 Abbott Laboratories Tricyclic quinoline antineoplastic agents
US4992448A (en) 1989-10-24 1991-02-12 Hoechst-Roussel Pharmaceuticals Inc. Benzocycloalkylaminopyridinamines and related compounds as topical antiinflammatory agents for the treatment of skin disorders
US5037835A (en) 1989-10-24 1991-08-06 Hoechst-Roussel Pharmaceuticals Inc. Benzocycloalkylaminopyridinamines and related compounds as topical antiinflammatory agents for the treatment of skin disorders
US4959378A (en) 1989-10-24 1990-09-25 Hoechst-Roussel Pharmaceuticals Inc. Aminopyridinylaminophenol compounds useful as topical antiinflammatory agents for the treatment of skin disorders
EP0425016B1 (en) 1989-10-27 1995-12-20 The Procter & Gamble Company Antimicrobial method and formulation employing type II endoglycosidase and antimicrobial agent
FR2653767B1 (fr) 1989-10-30 1992-02-14 Lafon Labor Derives de 1-(aminophenyl)-2-piperidinopropanone, procede et utilisation en therapeutique.
US4988728A (en) 1989-11-03 1991-01-29 Alcon Laboratories, Inc. Suprofen esters and amides as ophthalmic anti-inflammatory agents
US5064837A (en) 1989-11-13 1991-11-12 Schering Corporation 3-substituted-1-aryl-2(h)-quinolones and their pharmaceutical compositions
US5208228A (en) 1989-11-13 1993-05-04 Merck & Co., Inc. Aminomacrolides and derivatives having immunosuppressive activity
GB8926512D0 (en) 1989-11-23 1990-01-10 Pfizer Ltd Therapeutic agents
GB9024617D0 (en) 1989-12-05 1991-01-02 Ici Plc Heterocyclic compounds
US4996206A (en) 1989-12-11 1991-02-26 The Trustees Of Princeton University N-(pyrrolo[2,3-d]pyrimidin-3-ylacyl)-glutamic acid derivatives
US5095037B1 (en) 1989-12-21 1995-12-19 Nissho Kk Combined anti-inflammatory agent
US5064835A (en) 1990-03-01 1991-11-12 Merck & Co., Inc. Hydroxymacrolide derivatives having immunosuppressive activity
US5306718A (en) 1990-03-06 1994-04-26 Warner-Lambert Company Oxime and amine substituted azabicyclo and azocyclo muscarinic agonists and methods of treatment
US5346911A (en) 1990-03-06 1994-09-13 Warner-Lambert Company Azabicyclo and azacyclo oxime and amine cholinergic agents and methods of treatment
WO1991013900A1 (en) 1990-03-13 1991-09-19 Acic (Canada) Inc. Process for producing 2,2'-o-cyclonucleosides, nucleosides, and analogs thereof
US5091430A (en) 1990-03-13 1992-02-25 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services O6 -substituted guanine compounds and methods for depleting O6 -alkylguanine-DNA alkyltransferase levels
US5360811A (en) 1990-03-13 1994-11-01 Hoechst-Roussel Pharmaceuticals Incorporated 1-alkyl-, 1-alkenyl-, and 1-alkynylaryl-2-amino-1,3-propanediols and related compounds as anti-inflammatory agents
US5079247A (en) 1990-03-14 1992-01-07 American Cyanamid Company N1 -substituted benz(cd)indol-2-imine compounds as cardiovascular agents
US5212172A (en) 1990-03-15 1993-05-18 Allergan, Inc. 4-(1-hydroxy-2-substituted amino)ethyl-5-hydroxy-2(5H)-furanones as anti-inflammatory agents
US5574041A (en) 1990-03-16 1996-11-12 Beth Israel Hospital Association Use of spiperone derivatives as immunosuppressant agents
ES2121779T3 (es) 1990-03-16 1998-12-16 Beth Israel Hospital Utilizacion de espiperona como agente inmunosupresor y antiinflamatorio.
US5223516A (en) 1990-03-22 1993-06-29 E. R. Squibb & Sons, Inc. 3,3,3-trifluoro-2-mercaptomethyl-N-tetrazolyl substituted propanamides and method of using same
US5081261A (en) 1990-03-23 1992-01-14 Allergan, Inc. 4-(1-hydroxy-2-N-substituted sulfonamido) ethyl-5-hydroxy-2(5H)-furanones and 4-(N-substituted sulfonamido)-2-ethenyl-5-hydroxy-2(5H)-furanones as anti-inflammatory agents
US5234937A (en) 1990-03-27 1993-08-10 Warner-Lambert Company 3,5-di-tertiary-butyl-4-hydroxphenyl oxazolyl methanones and related compounds as antiinflammatory agents
US5143928A (en) 1990-03-27 1992-09-01 Warner-Lambert Company 3,5-di-tertiarybutyl-4-hydroxyphenylmethylene derivatives of 2-substituted thiazolidinones, oxazolidinones, and imidazolidinones as antiinflammatory agents
US5086064A (en) 1990-03-27 1992-02-04 Warner-Lambert Company 3,5-di-tertiary-butyl-4-hydroxyphenyl thiazolyl, oxazolyl, and imidazolyl methanones and related compounds as antiinflammatory agents
US5234939A (en) 1990-03-27 1993-08-10 Warner-Lambert Company 3,5-di-tertiary-butyl-4-hydroxyphenyl imidazolyl methanones and related compounds as antiinflammatory agents
US5013850A (en) 1990-03-30 1991-05-07 Allergan, Inc. 4-ethyl and 4-ethenyl-5-hydroxy-2(5H)-furanones substituted on alpha carbon of the ethyl or ethenyl side chain with a long chain alkyl group and on the beta carbon with a polar group, as anti-inflammatory agents
US5061813A (en) 1990-04-02 1991-10-29 E. R. Squibb & Sons, Inc. Substituted cyanoimino benzopyranes
US5198449A (en) 1990-04-27 1993-03-30 A. H. Robins Company Incorporated N-substituted alpha-arylazacycloalkylmethanamines and their use as cardiovascular agents
JPH0413679A (ja) 1990-05-07 1992-01-17 Wakunaga Pharmaceut Co Ltd 新規ジヒドロピリジン誘導体
US5260444A (en) 1990-05-07 1993-11-09 Wakunaga Seiyaku Kabushiki Kaisha Dihydropyridine derivative
EP0458160A3 (en) 1990-05-25 1992-03-18 Sociedad Espanola De Especialidades Farmaco-Terapeuticas, S.A. Substituted diphenylmethane derivatives as analgesic or anti-inflammatory agents
US5036070A (en) 1990-06-13 1991-07-30 American Home Products Corporation Polycyclic phenalkyl amines as psychotropic agents
DE4019024A1 (de) 1990-06-14 1991-12-19 Bayer Ag Verwendung der efomycine a, e und g als entzuendungshemmende mittel
US5189036A (en) 1990-06-20 1993-02-23 Schering Ag Imidazolylbenzoyl substituted heterocycles
US5192773A (en) 1990-07-02 1993-03-09 Vertex Pharmaceuticals, Inc. Immunosuppressive compounds
US5073560A (en) 1990-07-20 1991-12-17 Fisons Corporation Spiro-isoxazolidine derivatives as cholinergic agents
US5211937A (en) 1990-07-30 1993-05-18 Glycomed Incorporated Method of determining a site of inflammation utilizing elam-1 ligands
JPH04364160A (ja) 1990-08-03 1992-12-16 Terumo Corp チオウレア誘導体およびこれを含有する抗菌剤および抗潰瘍剤
US5124455A (en) 1990-08-08 1992-06-23 American Home Products Corporation Oxime-carbamates and oxime-carbonates as bronchodilators and anti-inflammatory agents
US5399553A (en) 1990-08-09 1995-03-21 Wakunaga Seiyaku Kabushiki Kaisha Tricyclic compound or salts thereof, method for producing the same and anti-microbial agent containing the same
KR920004385A (ko) 1990-08-09 1992-03-27 와꾸나가 기스께 신규 삼환화합물 또는 그의 염, 이의 제조방법 및 이를 함유하는 항균제
US5302592A (en) 1990-08-17 1994-04-12 Rohm And Haas Company Use of substituted 3-thioacryloyl compounds as antimicrobial agents
US5308837A (en) 1990-08-22 1994-05-03 Merrell Dow Pharmaceuticals Inc. 5'-amine substituted adenosine analogs as immunosuppressants
US5318965A (en) 1990-08-24 1994-06-07 Abbott Laboratories Quinobenzoxazine, antineoplastic agents
US5059602A (en) 1990-08-27 1991-10-22 Hoechst-Roussel Pharmaceuticals Inc. 4-substituted dihydropyrido(4,3-d)pyrimidines as analgesics and topical antiinflammatory agents for the treatment of skin disorders
US5095019A (en) 1990-08-27 1992-03-10 Hoechst-Roussel Pharmaceuticals Inc. 4-substituted dihydropyrido(4,3-D)pyrimidines as analgesics and topical antiinflammatory agents for the treatment of skin disorders
US5091528A (en) 1990-09-12 1992-02-25 Allergan, Inc. 6- or 7- (2-imino-2-imidazolidine)-1,4-benzoxazines as α adrenergic agents
US5470857A (en) 1990-09-14 1995-11-28 Marion Merrell Dow Inc. Carbocyclic nucleoside analogs useful as immunosuppressants
US5244896A (en) 1990-09-14 1993-09-14 Marion Merrell Dow Inc. Carbocyclic adenosine analogs useful as immunosuppressants
US5514688A (en) 1990-09-14 1996-05-07 Merrell Dow Pharmaceuticals Inc. Carbocyclic adenosine analogs useful as immunosuppressants
US5096700A (en) 1990-09-28 1992-03-17 The Procter & Gamble Company Halogenated aminohexanoates and aminobutyrates antimicrobial agents
JPH0764841B2 (ja) 1990-10-03 1995-07-12 ファイザー製薬株式会社 インドール誘導体およびその用途
US5216165A (en) 1990-10-03 1993-06-01 American Home Products Corporation N-substituted aminoquinolines as analgesic agents
US5143918A (en) 1990-10-11 1992-09-01 Merck & Co., Inc. Halomacrolides and derivatives having immunosuppressive activity
DE4033415A1 (de) 1990-10-20 1992-04-23 Bayer Ag Antimikrobielle mittel sowie substituierte 2-cyclohexan-1-yl-amin-derivate und deren herstellung
JPH06503329A (ja) 1990-12-07 1994-04-14 ジ・アップジョン・カンパニー 抗炎症剤として有用なホスホン酸誘導体
US5209930A (en) 1990-12-10 1993-05-11 Rohm And Haas Company Preparation and use of n-iodopropargyl oxycarbonyl amino acid esters and derivatives as antimicrobial agents
JP2528741B2 (ja) 1991-01-09 1996-08-28 ファイザー製薬株式会社 オキサゾ―ル、チアゾ―ルおよびイミダゾ―ル化合物
CA2078790C (en) 1991-01-21 1998-10-06 Susumu Kamata 3-benzylidene-1-carbamoyl-2-pyrrolidone analogues
US5248682A (en) 1991-01-31 1993-09-28 Warner-Lambert Company 2-substituted-4,6-di-tertiary-butyl-5-hydroxy-1,3-pyrimidines useful as antiinflammatory agents
US5177079A (en) 1991-01-31 1993-01-05 Warner-Lambert Company 2-substituted-4,6-di-tertiarybutyl-5-hydroxy-1,3-pyrimidines useful as antiinflammatory agents
JPH06505239A (ja) 1991-01-31 1994-06-16 ワーナー−ランバート・コンパニー 抗炎症剤として有用な４，６−ジ−第三ブチル−５−ヒドロキシ−１，３−ピリミジンの置換されたヘテロアリール類似体
US5679640A (en) 1991-02-12 1997-10-21 Cytel Corporation Immunosuppressant peptides
US5359066A (en) 1991-02-28 1994-10-25 Wakunaga Pharmaceutical Co., Ltd. Certain tricyclic pyrido[3,2,1-ij]cinnoline-8-carboxylates, useful as antimicrobial agents
US5856364A (en) 1991-03-01 1999-01-05 Warner Lambert Company Therapeutic antiviral-wound healing compositions and methods for preparing and using same
US5674912A (en) 1991-03-01 1997-10-07 Warner-Lambert Company Sunscreen-wound healing compositions and methods for preparing and using same
US5863938A (en) 1991-03-01 1999-01-26 Warner Lambert Company Antibacterial-wound healing compositions and methods for preparing and using same
US5874479A (en) 1991-03-01 1999-02-23 Warner-Lambert Company Therapeutic permeation enhanced-wound healing compositions and methods for preparing and using same
EP0502550B1 (en) 1991-03-07 1995-01-04 Mect Corporation Colominic acid and partial hydrolysis products of colominic acid for the preparation of medicaments for the treatment of hepatitis, nephritis and arthritis
DE69220397T2 (de) 1991-03-13 1997-10-02 Morinaga Milk Industry Co Ltd Antimikrobielles Peptid und antimikrobieller Wirkstoff
GB9107043D0 (en) 1991-04-04 1991-05-22 Pfizer Ltd Therapeutic agents
US5147877A (en) 1991-04-18 1992-09-15 Merck & Co. Inc. Semi-synthetic immunosuppressive macrolides
EP0591528B1 (en) 1991-04-22 1998-12-23 Otsuka Pharmaceutical Factory, Inc. PYRAZOLO[1,5-a]PYRIMIDINE DERIVATIVE AND ANTI-INFLAMMATORY CONTAINING THE SAME
US5091389A (en) 1991-04-23 1992-02-25 Merck & Co., Inc. Lipophilic macrolide useful as an immunosuppressant
US5093338A (en) 1991-04-23 1992-03-03 Merck & Co., Inc. Lipophilic macrolide useful as an immunosuppressant
EP0510912B1 (en) 1991-04-24 1998-01-07 Morinaga Milk Industry Co., Ltd. Antimicrobial peptide and antimicrobial agent
US5223503A (en) 1991-04-29 1993-06-29 Eli Lilly And Company 6-substituted pyrido[2,3-d]pyrimidines as antineoplastic agents
US5225571A (en) 1991-04-30 1993-07-06 Allergan, Inc. Substituted dihydroxy-bis-[5-hydroxy-2(5H)-furanone-4-yl]-alkanes as anti-inflammatory agents
US5183906A (en) 1991-04-30 1993-02-02 Allergan, Inc. 2- and 5-alkyl and phenyl substituted 4-(1-hydroxy, 1-acyloxy or 1-carbamoyloxy)-5-hydroxy-2 (5h)-furanones as anti-inflammatory agents
US5191084A (en) 1991-05-01 1993-03-02 American Home Products Corporation Phenyl pyrazolidinones as bronchodilators and anti-inflammatory agents
US5250700A (en) 1991-05-01 1993-10-05 American Home Products Corporation Phenyl pyrazolidinones as bronchodilators and anti-inflammatory agents
US5138051A (en) 1991-08-07 1992-08-11 American Home Products Corporation Rapamycin analogs as immunosuppressants and antifungals
US5143927A (en) 1991-05-09 1992-09-01 Warner-Lambert Company 3-(thiazolidone, oxazolidinone, imidazolidinone)-indoles as antiinflammatory agents
US5143929A (en) 1991-05-09 1992-09-01 Warner-Lambert Company 2-substituted thiazolidinone, oxazolidinone, and imidazolidinone derivatives of fenamates as antiinflammatory agents
US5250552A (en) 1991-05-09 1993-10-05 Warner-Lambert Company 3-[thiazolidinone, oxazolidinone, imidazolidinone]-indoles as antiinflammatory agents
US5114958A (en) 1991-05-09 1992-05-19 Warner-Lambert Company 1,2,4-oxadiazole and 1,2,4-thiadiazole derivatives of fenamates as antiinflammatory agents
US5250678A (en) 1991-05-13 1993-10-05 Merck & Co., Inc. O-aryl, O-alkyl, O-alkenyl and O-alkynylmacrolides having immunosuppressive activity
US5262533A (en) 1991-05-13 1993-11-16 Merck & Co., Inc. Amino O-aryl macrolides having immunosuppressive activity
US5565560A (en) 1991-05-13 1996-10-15 Merck & Co., Inc. O-Aryl,O-alkyl,O-alkenyl and O-alkynylmacrolides having immunosuppressive activity
US5162334A (en) 1991-05-13 1992-11-10 Merck & Co., Inc. Amino O-alkyl, O-alkenyl and O-alkynlmacrolides having immunosuppressive activity
US5432183A (en) 1991-05-31 1995-07-11 Pfizer Inc. Use of rapamycin prodrugs as immunosuppressant agents
ATE164163T1 (de) 1991-06-19 1998-04-15 Upjohn Co Dialkyl (dialkoxyphosphinyl)methyl phosphate als antientzündungsmittel
US5124347A (en) 1991-07-31 1992-06-23 Warner-Lambert Co. 3-5-ditertiarybutylphenyl-4-hydroxymethylidene derivatives of 1,3-dihydro-2H-indole-2-ones as antiinflammatory agents
US5149701A (en) 1991-08-01 1992-09-22 Merck & Co., Inc. C-31 methylated FR-900520 cyclic hemiketal immunosuppressant agents
US5273979A (en) 1991-08-01 1993-12-28 Merck & Co., Inc. C-31 desmethyl FR-900520 cyclic hemiketal immunosuppressant agent
US5169851A (en) 1991-08-07 1992-12-08 American Home Products Corporation Rapamycin analog as immunosuppressants and antifungals
US5202332A (en) 1991-08-07 1993-04-13 American Home Products Corporation Rapamycin analog as immunosuppressant
US5189042A (en) 1991-08-22 1993-02-23 Merck & Co. Inc. Fluoromacrolides having immunosuppressive activity
US5597831A (en) 1991-08-29 1997-01-28 Vufb A.S 6-[X-(2-hydroxyethyl) aminoalkyl]-5,11-dioxo-5,6-dihydro-11-H-indeno[1,2-c]isoquinolines and their use as antineoplastic agents
US5202350A (en) 1991-08-29 1993-04-13 Bristol-Myers Squibb Co. Furanone anti-inflammatory agents
US5171864A (en) 1991-08-30 1992-12-15 Allergan, Inc. Di-(5-hydroxy-2(5H)-2-oxo-4-furyl)methyl-alpha,omega alkane-dioates and N,N-bis-(5-hydroxy-2(5H)-2-oxo-4-furyl)methyl-alpha,omega-dialkanoic acid amides as anti-inflammatory agents
US5169963A (en) 1991-08-30 1992-12-08 Allergan, Inc. Di-(5-hydroxy-2(5H)2-oxo-4-furyl)alkylmethyl-alpha,omega alkanedioates and N,N-bis-(5-hydroxy-2(5H)2-oxo-4-furyl)alkylmethyl-alpha,omega-dialkanoic acid amides as anti-inflammatory agents
US5708002A (en) 1991-09-05 1998-01-13 Abbott Laboratories Macrocyclic immunomodulators
US5604234A (en) 1991-09-05 1997-02-18 Abbott Laboratories Substituted thiol macrolactam immunomodulators
US5252732A (en) 1991-09-09 1993-10-12 Merck & Co., Inc. D-heteroaryl, O-alkylheteroaryl, O-alkenylheteroaryl and O-alkynylheteroarylmacrolides having immunosuppressive activity
US5208241A (en) 1991-09-09 1993-05-04 Merck & Co., Inc. N-heteroaryl, n-alkylheteroaryl, n-alkenylheteroaryl and n-alkynylheteroarylmacrolides having immunosuppressive activity
US5270319A (en) 1991-09-09 1993-12-14 Warner-Lambert Company 5-hydroxy-2-pyrimidinylmethylene derivatives useful as antiinflammatory agents
US5247076A (en) 1991-09-09 1993-09-21 Merck & Co., Inc. Imidazolidyl macrolides having immunosuppressive activity
EP0605474B1 (en) 1991-09-26 2003-11-26 THE GOVERNMENT OF THE UNITED STATES OF AMERICA as represented by THE SECRETARY of the DEPARTMENT OF HEALTH AND HUMAN SERVICES Carbamate analogs of thiaphysovenine, pharmaceutical compositions, and method for inhibiting cholinesterases
WO1993008191A1 (en) 1991-10-15 1993-04-29 Warner-Lambert Company Azabicyclo oxime and amine cholinergic agents and methods of treatment
US5280045A (en) 1991-10-16 1994-01-18 The Procter & Gamble Company 4(3,5-bis(1,1-dimethylethyl-4-hydroxyphenyl)-4-oxobutanamide compound useful as an anti-inflammatory agent
US5266567A (en) 1991-10-24 1993-11-30 Rohm And Haas Company Halopropargylated cyclic quaternary ammonium compounds as antimicrobial agents
US6063630A (en) 1991-11-05 2000-05-16 Transkaryotic Therapies, Inc. Targeted introduction of DNA into primary or secondary cells and their use for gene therapy
US5151413A (en) 1991-11-06 1992-09-29 American Home Products Corporation Rapamycin acetals as immunosuppressant and antifungal agents
JPH07505045A (ja) 1991-11-22 1995-06-08 ザ ジェネラル ホスピタル コーポレイション 移植における特異的寛容
US5723466A (en) 1991-12-06 1998-03-03 Hoechst Marion Roussel, Inc. Trans cyclopentanyl purine analogs useful as immunosuppressants
US5817672A (en) 1991-12-06 1998-10-06 Hoechst Marion Roussel, Inc. Trans cyclopentanyl purine analogs useful as immunosuppressants
US5817660A (en) 1991-12-06 1998-10-06 Hoechst Marion Roussel, Inc. Trans cyclopentanyl purine analogs useful as immunosuppressants
US5817661A (en) 1991-12-06 1998-10-06 Hoechst Marion Roussel, Inc. Trans cyclopentanyl purine analogs useful as immunosuppressants
US5472973A (en) 1991-12-12 1995-12-05 Scios Nova Inc. Fluorenyl derivatives as anti-inflammatory agents
ZA929008B (en) 1991-12-13 1993-05-21 Bristol Myers Squibb Co Piperazinyl- and piperidinyl-cyclohexanols.
US5225418A (en) 1991-12-17 1993-07-06 Du Pont Merck Pharmaceutical Company 5H-(1,2)benzisothiazolo[2,3-a]quinoline-5-ones and analogs as antiinflammatory agents
US5212189A (en) 1991-12-17 1993-05-18 Warner-Lambert Company Thiadiazole or oxadiazole analogs of fenamic acids containing substituted hydroxamate side chains as antiinflammatory agents
US5438064A (en) 1991-12-23 1995-08-01 American Home Products Corporation Derivatives of 4-anilinoquinoline-3-carboxamide as analgesic agents
US5238689A (en) 1992-01-07 1993-08-24 Procept, Inc. Use of ruthenium red as immunosuppressive agents
DE69220679T2 (de) 1992-01-23 1997-10-23 Morinaga Milk Industry Co Ltd Antibakterielles mittel und behandlung von gegenständen mit diesem
US5378848A (en) 1992-02-12 1995-01-03 Shionogi & Co., Ltd. Condensed imidazopyridine derivatives
US5658564A (en) 1992-02-19 1997-08-19 The General Hospital Corporation Xenograft thymus
US5196431A (en) 1992-02-24 1993-03-23 Warner-Lambert Company 2-substituted amino-4, 6-di-tertiary-buthyl-5-hydroxy-1, 3-pyrimidines as antiinflammatory agents
US5220025A (en) 1992-02-24 1993-06-15 Warner-Lambert Company 2-substituted amino-4, 6-di-tertiary-butyl-5-hydroxy-1, 3-pyrimidines as antiinflammatory agents
JPH07500613A (ja) 1992-03-02 1995-01-19 ファイザー・インコーポレーテッド 免疫抑制剤及び抗真菌剤としてのマクロライドのデソサミノ誘導体
US5157051A (en) 1992-03-05 1992-10-20 The Dow Chemical Company Composition and use of 3-thiocyano-2-halo-2-propenenitriles as antimicrobial agents
US5187175A (en) 1992-03-06 1993-02-16 Warner-Lambert Company 2-carbonyl substituted-5-hydroxy-1, 3-pyrimidines as antiinflammatory agents
US5196424A (en) 1992-03-24 1993-03-23 Eli Lilly And Company N-[2-amino-4-substituted[[(pyrrollo or pyrido)[2,3-d]pyrimidinyl]-alkyl]benzoyl]-L-glutamic acids
US5389675A (en) 1992-03-27 1995-02-14 The United States Of America As Represented By The Department Of Health And Human Services Mixed ligand metal complexes of nitric oxide-nucleophile adducts useful as cardiovascular agents
CA2091194A1 (en) 1992-04-08 1993-10-09 Richard D. Connell 2-oxo-ethyl derivatives as immunosuppressants
AU3904493A (en) 1992-04-13 1993-11-18 Fujisawa Pharmaceutical Co., Ltd. Substituted 3-pyrrolidinylthio-carbapenems as antimicrobial agents
US5256664A (en) 1992-04-28 1993-10-26 Bristol-Myers Squibb Company Antidepressant 3-halophenylpiperazinylpropyl derivatives of substituted triazolones and triazoldiones
US5552397A (en) 1992-05-18 1996-09-03 E. R. Squibb & Sons, Inc. Substituted azepinone dual inhibitors of angiotensin converting enzyme and neutral exdopeptidase
US5346913A (en) 1992-05-26 1994-09-13 Rohm And Haas Company N-iodopropargyl hydantoin compounds, compositions, preparation, and use as antimicrobial agents
US5244917A (en) 1992-06-02 1993-09-14 The Dupont Merck Pharmaceutical Company Substituted naphthofurans as anti-inflammatory agents
US5284840A (en) 1992-06-12 1994-02-08 Merck & Co., Inc. Alkylidene macrolides having immunosuppressive activity
US5284877A (en) 1992-06-12 1994-02-08 Merck & Co., Inc. Alkyl and alkenyl macrolides having immunosuppressive activity
WO1994000430A1 (en) 1992-06-23 1994-01-06 Zaidan Hojin Biseibutsu Kagaku Kenkyu Kai Novel antibiotics with immunosuppressive activity, delaminomycins, and production thereof
US5338753A (en) 1992-07-14 1994-08-16 Sumner H. Burstein (3R,4R)-Δ6 -tetrahydrocannabinol-7-oic acids useful as antiinflammatory agents and analgesics
DE69319432T2 (de) 1992-07-31 1998-10-29 Pfizer Peptide aus Derivaten der 4-Amino-2.2.-Difluoro-3-Oxo-1.6-Hexandisäure als Wirkstoffe gegen Entzündungen
US5240929A (en) 1992-08-03 1993-08-31 Warner-Lambert Company 2-heterocyclic-5-hydroxy-1,3-pyrimidines useful as antiinflammatory agents
AU4848193A (en) 1992-09-23 1994-04-26 Upjohn Company, The Arylmethylphosphonates and phosphonic acids useful as anti-inflammatory agents
JPH08501569A (ja) 1992-10-02 1996-02-20 アルバータ リサーチ カウンスル 糖質結合ペプチドの抗炎症性、免疫寛容原性、および免疫阻害性
JP2711202B2 (ja) 1992-10-06 1998-02-10 東洋製薬株式会社 ブドウ球菌抗菌剤
DK0619730T3 (da) 1992-10-08 2001-01-29 Supratek Pharma Inc Sammensætninger af antineoplastiske midler inkorporeret i miceller
GB9221220D0 (en) 1992-10-09 1992-11-25 Sandoz Ag Organic componds
EP0627406B1 (en) 1992-10-21 1998-10-28 Yoshitomi Pharmaceutical Industries, Ltd. 2-amino-1,3-propanediol compound and immunosuppressant
US5843452A (en) 1992-11-09 1998-12-01 Pharmagenesis, Inc. Immunotherapy composition and method
ES2058024B1 (es) 1992-11-10 1995-05-01 Menarini Lab Nuevo derivado arilpropionico, procedimiento de fabricacion del mismo y su utilizacion como analgesico.
US5260300A (en) 1992-11-19 1993-11-09 American Home Products Corporation Rapamycin carbonate esters as immuno-suppressant agents
JP2738486B2 (ja) 1992-11-20 1998-04-08 ファイザー製薬株式会社 抗炎症剤としての新規なイソオキサゾリン類
DE69319921T2 (de) 1992-12-01 1999-04-15 Minnesota Mining & Mfg Dauerhafte antimikrobische mittel
DK148292D0 (da) 1992-12-09 1992-12-09 Lundbeck & Co As H Forbindelser
FR2699176B1 (fr) 1992-12-11 1995-03-03 Adir Nouveaux composés bicycliques de pyrimidine, leur procédé de préparation et les compositions pharmaceutiques les renfermant.
US5474766A (en) 1992-12-18 1995-12-12 Washington University Methods and compositions for inhibition of hepatic clearance of tissue-type plasminogen activator
IL108031A0 (en) 1992-12-22 1994-04-12 Procter & Gamble Difluoro pentapeptide derivatives and pharmaceutical compositions containing them
GB9226830D0 (en) 1992-12-23 1993-02-17 Celltech Ltd Chemical compounds
US5693645A (en) 1992-12-23 1997-12-02 Beth Israel Deaconess Medical Center, Inc. Use of spiperone or spiperone derivatives as immunosuppressant agents
US5298522A (en) 1993-01-22 1994-03-29 Pfizer Inc. 6-chloro-5-fluoro-3-(2-thenoyl)-2-oxindole-1-carboxamide as an analgesic and anti-inflammatory agent while maintaining a normal urine protein/creatinine ratio
ATE163930T1 (de) 1993-01-29 1998-03-15 American Cyanamid Co Aminocycloalkanobenzodioxole als beta-3 selektive adrenergische wirkstoffe
US5424301A (en) 1993-02-01 1995-06-13 Warner-Lambert Company Starch stabilized o-substituted tetrahydropyridine oxime cholinergic agents
EP0610744B1 (en) 1993-02-09 1998-11-04 Bayer Corporation Sulfonamide aminomethylene derivatives as immunosuppressants
US5686469A (en) 1993-02-09 1997-11-11 Miles Inc. Aminomethylene derivaties as immunosuppressants
JP2709530B2 (ja) 1993-02-09 1998-02-04 ファイザー・インク． 抗炎症薬としてのオキシンドール１−［ｎ−（アルコキシカルボニル）］カルボキサミド類および１−（ｎ−カルボキサミド）カルボキサミド類
US5385918A (en) 1993-02-09 1995-01-31 Miles Inc. Aminomethylene-peptides as immunosuppressants
JP3525221B2 (ja) 1993-02-17 2004-05-10 味の素株式会社 免疫抑制剤
US5463181A (en) 1993-02-23 1995-10-31 Merrell Dow Pharmaceuticals Inc. Farnesyl: protein transferase inhibitors as anticancer agents
WO1994019357A1 (en) 1993-02-23 1994-09-01 Merrell Dow Pharmaceuticals Inc. Farnesyl:protein transferase inhibitors as anticancer agents
CA2090171A1 (en) 1993-02-23 1994-08-24 Peter W. Schiller Opioid receptor antagonists, their synthesis and use as analgesic and immunosuppressive compounds
US5292736A (en) 1993-02-26 1994-03-08 Sterling Winthrop Inc. Morpholinoalkylindenes as antiglaucoma agents
CA2116621C (en) 1993-03-03 2001-07-24 Rene C. Gaudreault Novel anticancer agents
US5391544A (en) 1993-03-04 1995-02-21 Kagome Kabushiki Kaisha Cyathane derivatives and antimicrobial agents containing same
FR2702214B1 (fr) 1993-03-05 1995-04-14 Adir Nouveaux composés (aryl(alkyl)carbonyl)-hétérocycliques, leurs procédés de préparation et les compositions pharmaceutiques qui les contiennent.
US5484788A (en) 1993-03-26 1996-01-16 Beth Israel Hospital Association Buspirone as a systemic immunosuppressant
EP0618182B1 (en) 1993-03-31 1996-12-18 Kagome Kabushiki Kaisha Indene derivatives and antimicrobial agents containing them
JPH06298611A (ja) 1993-04-16 1994-10-25 Nippon Chemiphar Co Ltd 抗菌剤
US5459151A (en) 1993-04-30 1995-10-17 American Home Products Corporation N-acyl substituted phenyl piperidines as bronchodilators and antiinflammatory agents
US5393771A (en) 1993-05-12 1995-02-28 Brisol-Myers Squibb Company 4-substituted benzopyran and related compounds
US5654294A (en) 1993-05-13 1997-08-05 Bristol-Myers Squibb Spiro lactam dual action inhibitors
US5380738A (en) 1993-05-21 1995-01-10 Monsanto Company 2-substituted oxazoles further substituted by 4-fluorophenyl and 4-methylsulfonylphenyl as antiinflammatory agents
CA2163517C (en) 1993-05-24 2011-03-15 William E. Beschorner Surrogate tolerogenesis for the development of tolerance to xenografts
ES2164704T3 (es) 1993-05-24 2002-03-01 Aventis Bulk S P A Derivados en posicion 36 de rifamicinas y su uso como agentes antimicrobianos.
US6106834A (en) 1993-06-02 2000-08-22 Research Corporation Technologies, Inc. Use of anti-CD45 leukocyte antigen antibodies for immunomodulation
US6024957A (en) 1993-06-02 2000-02-15 Research Corporation Technologies, Inc. Immunomodulators and methods for the prevention and reversal of organ transplant rejection using same
US5436265A (en) 1993-11-12 1995-07-25 Merck Frosst Canada, Inc. 1-aroyl-3-indolyl alkanoic acids and derivatives thereof useful as anti-inflammatory agents
US5288693A (en) 1993-06-25 1994-02-22 Rohm And Haas Company 2-(3-oxoalk(en)yl)-3-isothiazolones and derivatives as antimicrobial agents
DE4321306A1 (de) 1993-06-26 1995-01-05 Sanol Arznei Schwarz Gmbh Disulfide
DE69420564T2 (de) 1993-07-02 2000-05-04 Univ Nottingham Immunsuppressive und antiallergische verbindungen; z.b. n-(3-oxohexanoyl)-homoserinlacton
US5494895A (en) 1993-07-22 1996-02-27 Merck & Co., Inc. Scorpion peptide margatoxin with immunosuppressant activity
JPH0741484A (ja) 1993-07-29 1995-02-10 Katayama Seiyakushiyo:Kk セフェム化合物及び抗菌剤
CA2168853A1 (en) 1993-08-06 1995-02-16 Giulio Dondio Hydroisoquinoline derivatives
JP3193205B2 (ja) 1993-08-09 2001-07-30 日本臓器製薬株式会社 好酸球増多抑制剤
WO1995005830A1 (en) 1993-08-20 1995-03-02 The Regents Of The University Of California Polyanion anti-inflammatory agents
US5385902A (en) 1993-09-01 1995-01-31 Rohm And Haas Company Iodopropargylated oxalic derivatives as antimicrobial agents
US5512678A (en) 1993-09-14 1996-04-30 Merrell Pharmaceuticals Inc. 5-(1-fluoro-vinyl)-1H-pyrimidine-2,4-dione derivatives useful as antineoplastic agents
JPH09503761A (ja) 1993-09-24 1997-04-15 メレルファーマスーティカルズ インコーポレイテッド 治療に使用するトリアリール−エチレン誘導体類
US5525633A (en) 1993-09-24 1996-06-11 Merrell Dow Pharmaceuticals Inc. Triaryl-ethylene derivatives
US5470885A (en) 1993-09-29 1995-11-28 The Research Foundation Of The State University Of New York Fluorocarbons as anti-inflammatory agents
US5547966A (en) 1993-10-07 1996-08-20 Bristol-Myers Squibb Company Aryl urea and related compounds
US5837702A (en) 1993-10-07 1998-11-17 Bristol-Myers Squibb Co. 4-arylamino-benzopyran and related compounds
US5401758A (en) 1993-10-07 1995-03-28 Bristol-Myers Squibb Company Pyridinyl cyanoguanidine compounds
US5681571A (en) 1993-10-08 1997-10-28 Duotol Ab Immunological tolerance-inducing agent
US6153203A (en) 1993-10-08 2000-11-28 Duotol Ab Immunological tolerance-inducing agent
US5580892A (en) 1993-10-22 1996-12-03 Allergan Method for using 2-(2-alkylphenylamino)-oxazolines as adrenergic agents
TW249754B (ko) 1993-10-26 1995-06-21 Alpha I Biomedicals Inc
US5541230A (en) 1993-11-05 1996-07-30 Us Health Therapeutic polyamines
US5554373A (en) 1993-11-05 1996-09-10 Seabrook; Samuel G. Compositions containing anti-microbial agents and methods for making and using same
CA2175215C (en) 1993-11-19 2008-06-03 Yat Sun Or Semisynthetic analogs of rapamycin (macrolides) being immunomodulators
DE69428546T2 (de) 1993-11-22 2002-04-11 Merck & Co Inc 3-acylaminobenzazepine
EP0730596A4 (en) 1993-11-22 1997-07-30 Merck & Co Inc BENZODIAZEPINES
CA2177375A1 (en) 1993-11-26 1995-06-01 Edward F. Kleinman 3-aryl-2-isoxazolines as antiinflammatory agents
KR0182324B1 (ko) 1993-11-26 1999-05-01 알렌 제이. 스피겔 항염증제로서의 이속사졸린 화합물
US5612350A (en) 1993-11-30 1997-03-18 Abbott Laboratories Macrocyclic immunomodulators with novel cyclohexyl ring replacements
US5462950A (en) 1993-12-21 1995-10-31 Eli Lilly And Company Methods of treating menstrual symptoms and compositions therefore
US5631283A (en) 1994-02-02 1997-05-20 The United States Of America As Represented By The Secretary Of The Army Use of sialic acid or antibodies to sialidase as anti-infectious agents and anti-inflammatory agents
US5444043A (en) 1994-02-18 1995-08-22 The Regents Of The University Of California Cyclic heptapeptide anti-inflammatory agent
US5508417A (en) 1994-02-23 1996-04-16 Rohm And Haas Company Broad-spectrum isothiazole antimicrobial agents
US5482925A (en) 1994-03-17 1996-01-09 Comedicus Incorporated Complexes of nitric oxide with cardiovascular amines as dual acting cardiovascular agents
US5650391A (en) * 1994-03-21 1997-07-22 Jewish Hospital Of St. Louis Methods and compositions for inhibition of hepatic clearance of tissue factor pathway inhibitor
EP0673881B1 (en) 1994-03-25 1999-06-16 Kabushiki Kaisha Kaisui Kagaku Kenkyujo Antimicrobial agent
US5451686A (en) 1994-04-15 1995-09-19 Allergan, Inc. 3 and 5 alkyl and phenyl 4-(hydroxy or acyloxy)-alkyl substituted 2(5H)-furanones as anti-inflammatory agents
WO1995029891A1 (fr) 1994-04-28 1995-11-09 Yamanouchi Pharmaceutical Co., Ltd. Derive de n-(3-pyrrolidinyl)benzamide
US5683709A (en) 1994-05-05 1997-11-04 Ciba Vision Corporation Poly(benzalkonium salt) as an anti-microbial agent for aqueous drug compositions
JP3179286B2 (ja) 1994-05-19 2001-06-25 ファイザー製薬株式会社 Ｎ−ヒドロキシ尿素系抗炎症剤
US5476876A (en) 1994-05-24 1995-12-19 The Procter & Gamble Company Di-tert-butylphenol compounds useful as anti-inflammatory agents
US5880280A (en) 1994-06-15 1999-03-09 Merck & Co., Inc. Aryl, alkyl, alkenyl and alkynylmacrolides having immunosuppressive activity
US5550233A (en) 1994-06-21 1996-08-27 Merck & Co., Inc. Aryl, alkyl, alkenyl and alkynylmacrolides having immunosuppressive activity
FR2721610B1 (fr) 1994-06-28 1996-08-23 Adir Nouveaux dérivés (thia)cycloalkyl [b] indoles, leur procédé de préparation et les compositions pharmaceutiques qui les contiennent.
US5786344A (en) 1994-07-05 1998-07-28 Arch Development Corporation Camptothecin drug combinations and methods with reduced side effects
US5656661A (en) 1994-07-27 1997-08-12 The Procter & Gamble Company Dihydrobenzofuran and related compounds useful as anti-inflammatory agents
US5525606A (en) 1994-08-01 1996-06-11 The United States Of America As Represented By The Department Of Health And Human Services Substituted 06-benzylguanines and 6(4)-benzyloxypyrimidines
JPH0853424A (ja) 1994-08-11 1996-02-27 Kureha Chem Ind Co Ltd ベンズイミダゾールスルホン酸アミド誘導体
US5461070A (en) 1994-08-29 1995-10-24 The Regents Of The University Of California Anti-flammatory method using indole alkaloids
US5684002A (en) 1994-09-07 1997-11-04 The Procter & Gamble Company Dihydorbenzofuran and related compounds useful as anti-inflammatory agents
US5693648A (en) 1994-09-30 1997-12-02 Merck & Co., Inc. O-aryl, O-alkyl, O-alkenyl and O-alkynyl-macrolides having immunosuppressive activity
US5554645A (en) 1994-10-03 1996-09-10 Mars, Incorporated Antineoplastic cocoa extracts and methods for making and using the same
WO1996011002A1 (fr) 1994-10-05 1996-04-18 Hisamitsu Pharmaceutical Co., Inc. Agent anti-inflammatoire a usage externe
JP3121503B2 (ja) 1994-10-18 2001-01-09 レンゴー株式会社 抗菌剤
US5510361A (en) 1994-10-20 1996-04-23 The Procter & Gamble Company Di-tert-butylphenol compounds with heterocyclic moiety, useful as anti-inflammatory agents
US5545734A (en) 1994-10-25 1996-08-13 Merck & Co., Inc. Aryl and heteroaryl macrolides having immunosuppressive activity
US5512687A (en) 1994-10-28 1996-04-30 Procept, Inc. Compounds for inhibiting immune response
DE69527640T2 (de) 1994-11-10 2003-04-24 Cellena Ag Ebmatingen Zusammensetzungen die gemischte transferrine als wirkstoff für induktion von immunotoleranz gegen antigen enthalten
US5622948A (en) 1994-12-01 1997-04-22 Syntex (U.S.A.) Inc. Pyrrole pyridazine and pyridazinone anti-inflammatory agents
US5723718A (en) 1994-12-20 1998-03-03 St. Joseph's Hospital And Medical Center Induction of immune tolerance to tumor cells
US5770201A (en) 1994-12-23 1998-06-23 Rijsuniversiteit Te Leiden HA-2 antigenic peptide
US5552422A (en) 1995-01-11 1996-09-03 Merck Frosst Canada, Inc. Aryl substituted 5,5 fused aromatic nitrogen compounds as anti-inflammatory agents
US5648376A (en) 1995-01-19 1997-07-15 Pharmagenesis, Inc. Immunosuppressant diterpene compound
US5872109A (en) 1995-02-07 1999-02-16 Shiseido Company, Ltd. Anti-inflammatory agent
US5506228A (en) 1995-02-23 1996-04-09 Merck & Co., Inc. 2,6-diaryl pyridazinones with immunosuppressant activity
US5670504A (en) 1995-02-23 1997-09-23 Merck & Co. Inc. 2,6-diaryl pyridazinones with immunosuppressant activity
GB9504497D0 (en) 1995-03-07 1995-04-26 Smithkline Beecham Plc Pharmaceuticals
JPH08253430A (ja) * 1995-03-17 1996-10-01 Kanagawa Kagaku Gijutsu Akad Ｌｄｌレセプター媒介薬物輸送方法
US5604262A (en) 1995-03-22 1997-02-18 Research Corporation Technologies, Inc. Topical antimicrobial agents
US5612060A (en) 1995-05-25 1997-03-18 Alexander; J. Wesley Enhancement of transplant graft survival through nutritional immunomodulation and immunosuppressive therapy
US5552411A (en) 1995-05-26 1996-09-03 Warner-Lambert Company Sulfonylquinolines as central nervous system and cardiovascular agents
US5618813A (en) 1995-05-26 1997-04-08 Abbott Laboratories Benzo[5.6]pyrano[2.3.4-ij]quinolizine and benzo[5.6]thiopyrano[2.3.4-ij]quinolizine derivatives as antibacterial and antineoplastic agents
US5753715A (en) 1995-06-02 1998-05-19 Ortho Pharmaceutical Corporation 2-disubstituted cyclohexenyl and cyclohexyl antimicrobial agents
US5643950A (en) 1995-06-02 1997-07-01 Ortho Pharmaceutical Corporation Triphenylalkyl antimicrobial agents
US6238908B1 (en) 1995-06-07 2001-05-29 Aastrom Biosciences, Inc. Apparatus and method for maintaining and growth biological cells
AU720378B2 (en) 1995-06-07 2000-06-01 Merck & Co., Inc. Novel N-(4-oxo-2,3,4,5-tetrahydro-1H-1, 5-benzodiazepin-3yl)-3-amides
US5612370A (en) 1995-06-07 1997-03-18 Bristol-Myers Squibb Company Phenylglycine and phenylalaninen amido benzopyran derivatives
US5612323A (en) 1995-06-07 1997-03-18 Bristol-Myers Squibb Company Phosphinic ester substituted benzopyran derivatives
US5869057A (en) 1995-06-07 1999-02-09 Rock; Edwin P. Recombinant vaccines to break self-tolerance
US5631251A (en) 1995-06-07 1997-05-20 Merck & Co., Inc. 5-cyclopropyl-1,4 benzodiazepine-2-ones
US5869478A (en) 1995-06-07 1999-02-09 Bristol-Myers Squibb Company Sulfonamido substituted benzopyran derivatives
US5726171A (en) 1995-06-07 1998-03-10 Merck & Co Inc N-(1-alkyl-5-phenyl-2,3,4,5-tetrahydro-1H-benzo B! 1,4!diazepin-3yl)-acetamides
US5753687A (en) 1995-06-19 1998-05-19 Ontogen Corporation Modulators of proteins with phosphotryrosine recognition units
BR9601909A (pt) 1995-07-13 1999-10-13 Smithkline Beecham Corp N,n-dietil-8,8-dipropil-2-azaspiro(4,5)decano-2-propan amina dimaleato
US6156311A (en) 1995-07-27 2000-12-05 The American National Red Cross Modulators of expression and function of LRP in alzheimer's disease
EP0842266A4 (en) 1995-08-04 1999-07-21 Gen Hospital Corp TRANSGENIC PORK AND PORK CELLS HAVING HLA GENES OF MAN
US5686488A (en) 1995-08-25 1997-11-11 Alcon Laboratories, Inc. Polyethoxylated castor oil products as anti-inflammatory agents
US5776946A (en) 1995-08-28 1998-07-07 Mcgeer; Patrick L. Peripheral benzodiazepine receptor ligands as antiinflammatory agents
JPH09110877A (ja) 1995-10-17 1997-04-28 Katayama Seiyakushiyo:Kk セフェム化合物、その製造法及びそれを含有する抗菌剤
US6103235A (en) 1995-10-30 2000-08-15 The United States Of America As Represented By The Department Of Health And Human Services Methods of inducing immune tolerance using immunotoxins
US5696156A (en) 1995-10-31 1997-12-09 Merck & Co. Inc. Triterpene derivatives with immunosuppressant activity
US5679705A (en) 1995-10-31 1997-10-21 Merck & Co., Inc. Triterpene derivatives with immunosuppressant activity
US5883119A (en) 1995-10-31 1999-03-16 Merck & Co., Inc. Triterpene derivatives with immunosuppressant activity
US5696117A (en) 1995-11-07 1997-12-09 Ortho Pharmaceutical Corporation Benzoxazine antimicrobial agents
US6087096A (en) 1995-11-13 2000-07-11 Dau; Peter C. Method of intrafamily fragment analysis of the T cell receptor α and β chain CDR3 regions
US5684204A (en) 1995-11-15 1997-11-04 The Procter & Gamble Company Sulfur containing di-tert-butylphenol compounds useful as anti-inflammatory agents
US5891653A (en) 1995-12-29 1999-04-06 Attfield; Derrick Cecil Method of suppressing graft rejection by means of stress proteins
US6069167A (en) 1996-01-16 2000-05-30 University Technology Corporation Use of antioxidant agents to treat cholestatic liver disease
US5707990A (en) 1996-01-30 1998-01-13 Ortho Pharmaceutical Corporation 2-substituted amino and thio alkyl benzoxazine antimicrobial agents
US5684041A (en) 1996-02-01 1997-11-04 The Procter & Gamble Company Dihydrobenzofuran and related compounds useful as anti-inflammatory agents
US5672620A (en) 1996-02-01 1997-09-30 The Procter & Gamble Company Dihydrobenzofuran and related compounds useful as anti-inflammatory agents
US5686471A (en) 1996-02-01 1997-11-11 The Procter & Gamble Company Dihydrobenzofuran and related compounds useful as anti-inflammatory agents
US5618835A (en) 1996-02-01 1997-04-08 The Procter & Gamble Company Dihydrobenzofuran and related compounds useful as anti-inflammatory agents
US5750543A (en) 1996-02-01 1998-05-12 The Procter & Gamble Company Dihydrobenzofuran and related compounds useful as anti-inflammatory agents
US5684031A (en) 1996-02-01 1997-11-04 The Procter & Gamble Company Dihydrobenzofuran and related compounds useful as anti-inflammatory agents
US5821250A (en) 1996-02-01 1998-10-13 The Procter & Gamble Company Dihydrobenzofuran and related compounds useful as anti-inflammatory agents
US5760041A (en) 1996-02-05 1998-06-02 American Cyanamid Company 4-aminoquinazoline EGFR Inhibitors
US5859027A (en) 1996-02-26 1999-01-12 Chektec Corporation Antimicrobial agent
IT1283951B1 (it) 1996-03-15 1998-05-07 Mendes Srl Uso della acetil l-carnitina o dei suoi sali farmacologicamente accettabili per il trattamento terapeutico o la profilassi di
US6043247A (en) 1996-04-19 2000-03-28 Novo Nordisk A/S Modulators of molecules with phosphotyrosine recognition units
CA2253597A1 (en) 1996-05-09 1997-11-13 The General Hospital Corporation Mixed chimerism and tolerance
US5739169A (en) 1996-05-31 1998-04-14 Procept, Incorporated Aromatic compounds for inhibiting immune response
US5688825A (en) 1996-05-31 1997-11-18 University Of Connecticut Anandamide amidase inhibitors as analgesic agents
WO1997046532A1 (en) 1996-06-03 1997-12-11 Boehringer Ingelheim Pharmaceuticals, Inc. 2-benzyl-4-sulfonyl-4h-isoquinolin-1,3-diones and their use as anti-inflammatory agents
US5773469A (en) 1996-06-18 1998-06-30 Ortho Pharmaceutical Corporation Diaryl antimicrobial agents
IT1290801B1 (it) 1996-07-05 1998-12-11 Mendes Srl Uso della acetil l-carnitina, della isovaleril l-carnitina, della propionil l-carnitina o dei loro sali farmacologicamente accettabili
US5677318A (en) 1996-07-11 1997-10-14 Merck Frosst Canada, Inc. Diphenyl-1,2-3-thiadiazoles as anti-inflammatory agents
US5877184A (en) 1996-08-06 1999-03-02 Merck & Co., Inc. Macrolides having immunosuppressive activity
US5874476A (en) 1997-07-14 1999-02-23 Rohm And Haas Company Dihaloformaldoxime carbamates as antimicrobial agents
US6030624A (en) 1996-08-16 2000-02-29 Uab Research Foundation Mucosal immunogens for novel vaccines
EP0834322A3 (en) 1996-10-04 1998-04-22 BOEHRINGER INGELHEIM INTERNATIONAL GmbH Mycosis vaccine
US5874594A (en) 1996-10-16 1999-02-23 Merck & Co., Inc. Triterpene derivatives with immunosuppressant activity
US5763478A (en) 1996-10-16 1998-06-09 Merck & Co., Inc. Triterpene derivatives with immunosuppressant activity
FR2754713B1 (fr) 1996-10-22 1999-01-08 Roc Sa Utilisation de complexes pour la preparation de compositions pour le traitement des peaux sensibles, procede de preparation et compositions hypoallergeniques
US6391303B1 (en) 1996-11-18 2002-05-21 Emisphere Technologies, Inc. Methods and compositions for inducing oral tolerance in mammals
US5684042A (en) 1997-01-10 1997-11-04 Medlogic Global Corporation Cyanoacrylate compositions comprising an antimicrobial agent
US6124495A (en) 1997-03-11 2000-09-26 Beacon Laboratories, Inc. Unsaturated oxyalkylene esters and uses thereof
US5939455A (en) 1997-03-11 1999-08-17 Beacon Laboratories, Inc. Therapeutic augmentation of oxyalkylene diesters and butyric acid derivatives
US5948407A (en) 1997-03-19 1999-09-07 Shire Laboratories Inc. Oral induction of tolerance to parenterally administered non-autologous polypeptides
US5801193A (en) 1997-04-15 1998-09-01 Immune Modulation, Inc. Compositions and methods for immunosuppressing
US6344476B1 (en) 1997-05-23 2002-02-05 Bayer Corporation Inhibition of p38 kinase activity by aryl ureas
EP1017697A1 (en) 1997-09-23 2000-07-12 Novo Nordisk A/S MODULES OF PROTEIN TYROSINE PHOSPHATASES (PTPases)
EP1030819A4 (en) 1997-09-30 2001-11-21 Cel Sci Corp IMMUNOGENOUS CONJUGATED POLYPEPTIDES FOR THE TREATMENT OF HERPES-SIMPLEX VIRUS
TW492882B (en) 1997-11-28 2002-07-01 Caleb Pharmaceuticals Inc Cholinergic antagonist plaster composition
US6262044B1 (en) 1998-03-12 2001-07-17 Novo Nordisk A/S Modulators of protein tyrosine phosphatases (PTPASES)
EP1069135B1 (en) 1998-03-31 2006-08-09 Nisshin Seifun Group Inc. Proteins having immunomodulatory activity and remedies for immunological diseases
US6329153B1 (en) 1998-06-22 2001-12-11 Vanderbilt University Method for evaluating immunosuppressive regimens
US6660843B1 (en) 1998-10-23 2003-12-09 Amgen Inc. Modified peptides as therapeutic agents
AU4676500A (en) 1999-04-28 2000-11-10 Northwestern University Localization of major peptide autoepitopes for nucleosome specific t cells of systemic lupus erythematosus
US6525035B1 (en) 1999-06-10 2003-02-25 Sass & Sass, Inc. Therapeutic composition and methods
US6410556B1 (en) 1999-09-10 2002-06-25 Novo Nordisk A/S Modulators of protein tyrosine phosphateses (PTPases)
US6525242B1 (en) 1999-11-02 2003-02-25 The University Of Connecticut Propagation of human hepatocytes in non-human mammals
EP1246839B1 (en) 1999-12-08 2004-06-16 Xcyte Therapies, Inc. Depsipeptide and congeners thereof for use as immunosuppressants
US6261595B1 (en) 2000-02-29 2001-07-17 Zars, Inc. Transdermal drug patch with attached pocket for controlled heating device
US6395767B2 (en) 2000-03-10 2002-05-28 Bristol-Myers Squibb Company Cyclopropyl-fused pyrrolidine-based inhibitors of dipeptidyl peptidase IV and method
US6596762B2 (en) 2001-05-17 2003-07-22 The Regents Of The University Of Colorado Antioxidant compositions and use for treatment of hepatic steatosis and steatohepatitis
EP1534823A4 (en) 2002-07-12 2008-12-31 Biomarin Pharm Inc USE OF ISOCYANATE BINDING AGENTS FOR PRODUCING BIOPOLYMER-HYDRAULIC ACTIVE SUBSTANCE CONJUGATES
US20050026823A1 (en) * 2003-06-20 2005-02-03 Biomarin Pharmaceutical Inc. Use of the chaperone receptor-associated protein (RAP) for the delivery of therapeutic compounds to the brain and other tissues
EP1638605B1 (en) 2003-06-20 2014-01-08 Raptor Pharmaceutical, Inc. Delivery of therapeutic compounds to the brain and other tissues
US8877714B2 (en) 2005-06-14 2014-11-04 Raptor Pharmaceutical Inc. Compositions comprising receptor-associated protein (RAP) variants specific for LRP2 and uses thereof

Also Published As

Publication number Publication date
WO2008036682A2 (en) 2008-03-27
US8795627B2 (en) 2014-08-05
CN101594878A (zh) 2009-12-02
EP2063905B1 (en) 2014-07-30
WO2008036682A3 (en) 2009-04-09
US20120251444A1 (en) 2012-10-04
HK1132930A1 (en) 2010-03-12
EP2063905A2 (en) 2009-06-03
JP2010503710A (ja) 2010-02-04
CA2663377A1 (en) 2008-03-27
EP2063905A4 (en) 2010-05-19
MX2009002893A (es) 2009-07-10

Similar Documents

Publication Publication Date Title
KR20090071598A (ko) 수용체 결합 단백질(ｒａｐ)-접합체 투여에 의한 간 질환의 치료
JP2010503710A5 (ko)
CN101262890B (zh) 抑肽酶多肽作为载体在药物缀合物中的用途
AU2002322720B2 (en) Compositions and methods for modulating blood-brain barrier transport
EP2784082B1 (en) Disease site-delivering pharmaceutical compositions comprising paclitaxel.
AU2002322720A1 (en) Compositions and methods for modulating blood-brain barrier transport
JP2016145231A (ja) 受容体関連タンパク質（ｒａｐ）ペプチド−フコシダーゼ阻害薬複合体による肝障害処置のための方法
US20120157380A1 (en) Pegylated human apoa-1 and process for production thereof
US20160184446A1 (en) Method of inhibiting body cavity fluid accumulation
US20190345262A1 (en) Targeted anticoagulant
WO2013068590A1 (en) Lipocalin muteins as vegf antagonists for use in treating diseases caused or promoted by increased vascularization

Legal Events

Date Code Title Description
A201 Request for examination
E902 Notification of reason for refusal
J201 Request for trial against refusal decision
A107 Divisional application of patent
J301 Trial decision

Free format text: TRIAL NUMBER: 2015101002646; TRIAL DECISION FOR APPEAL AGAINST DECISION TO DECLINE REFUSAL REQUESTED 20150513

Effective date: 20161014