WO2015001085A1 - Humanized or chimeric cd3 antibodies - Google Patents

Humanized or chimeric cd3 antibodies Download PDF

Info

Publication number
WO2015001085A1
WO2015001085A1 PCT/EP2014/064326 EP2014064326W WO2015001085A1 WO 2015001085 A1 WO2015001085 A1 WO 2015001085A1 EP 2014064326 W EP2014064326 W EP 2014064326W WO 2015001085 A1 WO2015001085 A1 WO 2015001085A1
Authority
WO
WIPO (PCT)
Prior art keywords
sequence
seq
antibody
set forth
heavy chain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2014/064326
Other languages
English (en)
French (fr)
Inventor
Edward Van Den Brink
Joost J. Neijssen
Aran Frank Labrijn
Joyce Meesters
Janine Schuurman
Paul Parren
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Genmab BV
Original Assignee
Genmab BV
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from PCT/EP2013/064330 external-priority patent/WO2014006217A1/en
Application filed by Genmab BV filed Critical Genmab BV
Priority to SG11201510739TA priority Critical patent/SG11201510739TA/en
Priority to CN202110540502.3A priority patent/CN113248615B/zh
Priority to AU2014286116A priority patent/AU2014286116A1/en
Priority to BR112015032986-1A priority patent/BR112015032986B1/pt
Priority to CN201480048350.3A priority patent/CN105722529B/zh
Priority to NZ715896A priority patent/NZ715896A/en
Priority to SM20200287T priority patent/SMT202000287T1/it
Priority to KR1020257017076A priority patent/KR20250078622A/ko
Priority to US14/902,757 priority patent/US10465006B2/en
Priority to EA201690167A priority patent/EA201690167A1/ru
Priority to MX2015017487A priority patent/MX373245B/es
Priority to RS20200307A priority patent/RS60131B1/sr
Priority to IL311371A priority patent/IL311371B2/en
Priority to PL14737200T priority patent/PL3016681T3/pl
Priority to BR122023002590-3A priority patent/BR122023002590B1/pt
Priority to JP2016522644A priority patent/JP6546162B2/ja
Priority to KR1020167002903A priority patent/KR102363220B1/ko
Priority to SI201431520T priority patent/SI3016681T1/sl
Priority to UAA201600940A priority patent/UA119646C2/uk
Priority to LTEP14737200.7T priority patent/LT3016681T/lt
Priority to EP14737200.7A priority patent/EP3016681B1/en
Priority to KR1020237015498A priority patent/KR102813816B1/ko
Priority to ES14737200T priority patent/ES2776706T3/es
Priority to DK14737200.7T priority patent/DK3016681T5/da
Priority to EP19217231.0A priority patent/EP3693385A1/en
Priority to MEP-2020-54A priority patent/ME03675B/me
Priority to HRP20200382TT priority patent/HRP20200382T1/hr
Priority to KR1020227004568A priority patent/KR102531517B1/ko
Priority to CA2915575A priority patent/CA2915575A1/en
Priority to IL290613A priority patent/IL290613B2/en
Priority to DK23174159.6T priority patent/DK4249515T3/da
Priority to US15/110,414 priority patent/US10407501B2/en
Priority to FIEP23174159.6T priority patent/FI4249515T3/fi
Priority to ES15700081T priority patent/ES3052034T3/es
Priority to PT231741596T priority patent/PT4249515T/pt
Priority to HK17104925.3A priority patent/HK1231369B/en
Priority to JP2016545932A priority patent/JP6619342B2/ja
Priority to ES23174159T priority patent/ES3038421T3/es
Priority to PL23174159.6T priority patent/PL4249515T3/pl
Priority to SI201532077T priority patent/SI4249515T1/sl
Priority to LTEP23174159.6T priority patent/LT4249515T/lt
Priority to SM20250322T priority patent/SMT202500322T1/it
Priority to HUE23174159A priority patent/HUE072527T2/hu
Priority to HRP20251127TT priority patent/HRP20251127T1/hr
Priority to CN202510481586.6A priority patent/CN120365424A/zh
Priority to PCT/EP2015/050276 priority patent/WO2015104346A1/en
Priority to CN202410218077.XA priority patent/CN118063621A/zh
Priority to CN201580013100.0A priority patent/CN106255507B/zh
Priority to RS20250910A priority patent/RS67220B1/sr
Priority to EP15700081.1A priority patent/EP3091998B1/en
Priority to EP25175408.1A priority patent/EP4631978A3/en
Priority to EP23174159.6A priority patent/EP4249515B1/en
Publication of WO2015001085A1 publication Critical patent/WO2015001085A1/en
Priority to IL243127A priority patent/IL243127B/en
Anticipated expiration legal-status Critical
Priority to US16/544,376 priority patent/US11613575B2/en
Priority to US16/582,428 priority patent/US20200123255A1/en
Priority to JP2019205910A priority patent/JP7208129B2/ja
Priority to CY20201100224T priority patent/CY1122840T1/el
Priority to AU2020202792A priority patent/AU2020202792B9/en
Priority to IL276530A priority patent/IL276530B/en
Priority to JP2022042394A priority patent/JP7389833B2/ja
Priority to AU2022203851A priority patent/AU2022203851B2/en
Priority to US18/109,708 priority patent/US20230374131A1/en
Priority to JP2023196008A priority patent/JP2024026114A/ja
Priority to AU2025256200A priority patent/AU2025256200A1/en
Priority to NL301352C priority patent/NL301352I2/nl
Priority to LTPA2025538C priority patent/LTPA2025538I1/lt
Priority to FIC20250036C priority patent/FIC20250036I1/fi
Priority to FR25C1054C priority patent/FR25C1054I1/fr
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/112Retroviridae (F), e.g. leukemia viruses
    • C07K16/114Lentivirus (G), e.g. human immunodeficiency virus [HIV], feline immunodeficiency virus [FIV] or simian immunodeficiency virus [SIV]
    • C07K16/1145Env proteins, e.g. gp41, gp110/120, gp160, V3, principal neutralising domain [PND] or CD4-binding site
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/42Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
    • C07K16/4208Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig
    • C07K16/4241Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig against anti-human or anti-animal Ig
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854Immunoglobulins
    • G01N33/686Anti-idiotype
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6872Intracellular protein regulatory factors and their receptors, e.g. including ion channels
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41Glycosylation, sialylation, or fucosylation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/51Complete heavy chain or Fd fragment, i.e. VH + CH1
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/515Complete light chain, i.e. VL + CL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/524CH2 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567Framework region [FR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/734Complement-dependent cytotoxicity [CDC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/74Inducing cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/70503Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
    • G01N2333/7051T-cell receptor (TcR)-CD3 complex

Definitions

  • the present invention relates to a humanized or chimeric antibody binding to human CD3, compositions comprising said humanized or chimeric antibody, and use of said humanized or chimeric antibodies in treatment of a disease.
  • CD3 The Cluster of Differentiation 3
  • CD3 The Cluster of Differentiation 3
  • CD3 antibodies raised against CD3 or the T-cell Receptor Complex, which CD3 is part of, are known.
  • An in vitro characterization of five humanized OKT3 effector function variant antibodies has been described [ 1] .
  • Treatment with the anti-CD3 monoclonal antibody hOKT3gamma l(Ala-Ala) results in improved C-peptide responses and clinical parameters for at least 2 years after onset of type 1 diabetes in absence of continued immunosuppressive medications [2] .
  • certain bispecific antibodies targeting with one arm the antigen on the tumor cell and with the other arm for instance CD3 on T cells provide Fc receptor binding by the Fc region.
  • a complex of T cells, tumor cells and effector cells that bind the antibody Fc region is formed, leading to killing of the tumor cells [4] .
  • Catumaxomab consists of a mouseIgG2a/ratIgG2b heterodimer and has been found successful for the treatment of cancer-associated ascites after intraperitoneal application [6] .
  • the mouse/ rat hybrid is immunogenic [7] and cannot be applied for long- term intravenous treatment in humans.
  • cytokine-release-related symptoms i.e. pyrexia, nausea, vomiting, chills, tachycardia and hypotension
  • Another antibody is ertumaxomab (HER2xCD3), which induces cytotoxicity in cell lines with low HER2 expression.
  • Ertumaxomab has been in Phase II clinical development for metastatic breast cancer [ 10]- [ 11] .
  • CD3 antibodies cross- reactive to cynomolgus and/or rhesus monkey CD3 have been described [ 12] -[ 13] , however, further improvements for such cross-reactive antibodies are needed .
  • the present invention relates to a huma nized or chimeric antibody binding to human CD3, wherein said antibody comprises a binding region comprising heavy chain variable (VH) region CDR1 , CDR2, and CDR3 having the sequences as set forth in SEQ ID NOs : 1, 2, and 3, respectively, and light chain variable (VL) region CDR1, CDR2, and CDR3 having the sequences as set forth in SEQ ID NO : 4, the sequence GTN , and the sequence as set forth in SEQ ID NO : 5, respectively.
  • VH heavy chain variable
  • CDR2 light chain variable region
  • VL light chain variable
  • the present invention relates to a bispecific antibody comprising a first binding region of an antibody according to the invention, and a second binding region which binds a different target than said first antigen binding region.
  • the present invention relates to a nucleic acid construct encoding one or more amino acid sequences according to the invention.
  • the present invention relates to an expression vector comprising (i) a nucleic acid sequence encoding a heavy chain sequence of a humanized or chimeric a ntibody according to the invention, (ii) a nucleic acid sequence encoding a light chain sequence of a humanized or chimeric antibody according to the invention, or (iii) both (i) and (ii) .
  • the present invention relates to a host cell comprising an expression vector according to the invention.
  • the present invention relates to a composition comprising the antibody or bispecific antibody according to the invention.
  • the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising the antibody or bispecific antibody according to the invention and a pharmaceutical accepta ble carrier
  • the present invention relates to the antibody or bispecific antibody, the composition, or the pharmaceutical composition according to the invention for use as a medicament. In another aspect, the present invention relates to the antibody or bispecific antibody, the composition, or the pharmaceutical composition according to the invention for use in the treatment of a disease.
  • the present invention relates to a method of treatment of a disease comprising administering the antibody or bispecific antibody, the composition, or the pharmaceutical composition according to the invention, to a subject in need thereof.
  • the present invention relates to a method of diagnosing a disease characterized by involvement or accumulation of CD3-expression cells, comprising administering the humanized or chimeric antibody, the composition or the pharmaceutical composition according to the invention to a subject, optionally wherein said humanized or chimeric antibody is labeled with a detectable agent.
  • the present invention relates to a method for producing an antibody or a bispecific antibody according to the invention, comprising the steps of a) culturing a host cell according to the invention, and b) purifying the antibody from the culture media.
  • the present invention relates to a diagnostic composition comprising an antibody or bispecific antibody according to the invention.
  • the present invention relates to a method for detecting the presence of CD3 antigen, or a cell expressing CD3, in a sample comprising the steps of a) contacting the sample with an antibody or bispecific antibody according to the invention, under conditions that allow for formation of a complex between the antibody or bispecific antibody and CD3, and b) analyzing whether a complex has been formed.
  • the present invention relates to a kit for detecting the presence of CD3 antigen, or a cell expressing CD3, in a sample comprising i) an antibody or bispecific antibody according to the invention, and ii) instructions for use of the kit.
  • the present invention relates to an anti-idiotypic antibody which binds to an antibody according to the invention.
  • Figure 1 Shows binding curves of ( Figure 1A) monospecific antibody variants of IgGl- huCD3 and ( Figure IB) bispecific antibody variants bsIgGl huCD3xHER2 to the human T- cell line Jurkat. Data shown are mean fluorescence intensities (MFI) of one representative experiment, as described in Example 2. The tables show the antibody concentrations (pg/mL) that result in half-maximal binding (EC50).
  • Figure 2 Shows binding curves of ( Figure 2A) monospecific antibody variants of IgGl- huCD3 and ( Figure 2B) bispecific antibody variants bsIgGl huCD3xHE 2 to the cynomolgus T-cell line HSC-F. Data shown are mean fluorescence intensities (MFI) of one representative experiment, as described in Example 2.
  • FIG. 3 T-cell activation by IgGl-huCD3 antibody variants. Expression of CD69 on T- cells from human ( Figure 3A) and cynomolgus ( Figure 3B) origin in PBMC culture was measured by FACS analysis, as described in Example 3. These experiments were performed twice and representative results from one experiment are shown.
  • Figure 4 T-cell proliferation induced by IgGl-huCD3 antibody variants.
  • Human Figure 4A
  • cynomolgus Figure 4B
  • PBMCs were incubated with IgGl-huCD3 antibody variants for 3 days, after which proliferation was measured by a cell proliferation ELISA, as described in Example 4. Representative results from two independent experiments are shown.
  • Figure 5 Induction of human (Figure 5A) and cynomolgus (Figure 5B) T-cell-mediated cytotoxicity by huCD3 antibody variants with non-activating LFLEDA mutations were determined as explained in Example 5. Representative results from two independent experiments performed in duplo are shown.
  • Figure 6 Shows binding curves of non-activating, monospecific antibody variants of IgGl-huCD3 (Figure 6A) and non-activating, bispecific antibody variants bsIgGl- huCD3xHER2 (Figure 6B) to the human T-cell line Jurkat. Data shown are mean fluorescence intensities (MFI) of one representative experiment, as described in Example 2. The tables show the antibody concentrations (pg/mL) that result in half-maximal binding (EC50).
  • MFI mean fluorescence intensities
  • Figure 7 Shows binding curves of non-activating, monospecific antibody variants of IgGl-huCD3 ( Figure 7A) and non-activating, bispecific antibody variants bsIgGl- huCD3xHER2 ( Figure 7B) to the cynomolgus T-cell line HSC-F. Data shown are mean fluorescence intensities (MFI) of one representative experiment, as described in Example 2. The tables show the antibody concentrations ( g/mL) that result in half-maximal binding (EC50).
  • MFI mean fluorescence intensities
  • Figure 8 T-cell activation by non-activating monospecific IgGl-huCD3 ( Figure 8A and B) or non-activating bispecific bsIgGl-huCD3xHER2 antibody variants ( Figure 8C and D).
  • Expression of CD69 on T-cells from human ( Figure 8A and C) and cynomolgus ( Figure 8B and D) origin in PBMC culture was measured by FACS analysis, as described in Example 3. These experiments were performed twice and representative results from one experiment are shown.
  • FIG. 9 T-cell proliferation induced by non-activating monospecific IgGl-huCD3 ( Figure 9A and B) or non-activating bispecific bsIgGl-huCD3xHER2 antibody variants ( Figure 9C and D).
  • T-cell proliferation was measured in human ( Figure 9 A and C) or cynomolgus ( Figure 9B and D) PBMCs that were incubated with various antibody variants for 3 days, after which proliferation was measured by a cell proliferation ELISA, as described in Example 4. Representative results from two independent experiments are shown.
  • Figure 10 Induction of human (Figure 10A) and cynomolgus (Figure 10B) T-cell- mediated cytotoxicity by huCD3 antibody variants with non-activating LFLEDA mutations were determined as explained in Example 5. Representative results from two independent experiments performed in duplo are shown.
  • FIG. 11 Rhesus T-cell activation by IgGl-huCD3 antibody variants. Expression of CD69 on T-cells from rhesus origin in PBMC culture was measured by FACS analysis, as described in Example 6.
  • FIG. 12 T-cell activation by non-activating variants of huCLB-T3/4 antibody. IgGl- huCLB-T3/4 variants were titrated on PBMCs. Expression of CD69 on T-cells in PBMC culture was measured by FACS analysis, as described in Example 7. Representative examples of 3 experiments are shown.
  • FIG. 13 T-cell proliferation by non-activating variants of huCLB-T3/4 antibody.
  • PBMCs were incubated with antibodies for three days, after which proliferation was measured by a cell proliferation ELISA, as described in Example 8. Representative results from two independent experiments are shown.
  • FIG. 14 In vitro T-cell-mediated cytotoxicity induced by non-activating antibody variants of a CD3 antibody. Induction of T-cell-mediated cytotoxicity by antibody variants (N297Q, LFLE, LFLENQ, LFLEDA, DANQ, LFLEDANQPS [Figure 14A-G]) was determined as explained in Example 9. The averages from two experiments performed in duplo are shown.
  • FIG. 15 In vitro T-cell mediated cytotoxicity induced by non-activating huCLB-T3/4 variants. Induction of T-cell mediated cytotoxicity by antibody variants (LFLEDA LAL [ Figure 15A-C] was determined as described in Example 9. The averages from one experiment performed in duplet are shown.
  • FIG 17 Pharmacokinetic (PK) analysis of non-activating huCLB-T3/4 antibody variants were compared to that of wild-type IgGl-huCLB-T3/4 antibody as described in Example 11. Plasma concentration of human IgGl was plotted against time ( Figure 17A). Plasma clearance rate calculated as described in Example 11 ( Figure 17B). The horizontal dotted line represents the average clearance rate of human IgG l antibodies in SCID mice ( 10 mL/day/kg) .
  • Figure 18 The frequency of positive T-cell responses among healthy HLA-typed donors. SI indexes of > 1.9 in both proliferation and IL-2 secretion assays were considered positive responses. Humanized A33 was used as clinical benchmark control antibody that shows high level of immunogenicity in the clinic and routinely induces 20-30% T-cell responses in the EpiScreen Assay. KLH responses were included to check PBMC quality (after thawing) .
  • Figure 19 Sequence alignment of heavy chain (VH) and light chain (VL) variable regions of humanized CD3 antibodies according to the present invention.
  • the present invention relates to a humanized or chimeric antibody binding to human CD3, wherein said antibody comprises a binding region comprising heavy chain variable (VH) region CD 1, CDR2, and CDR3 having the sequences as set forth in SEQ ID NOs : 1 , 2, and 3, respectively, and light chain variable (VL) region CDR1, CDR2, and CDR3 having the sequences as set forth in SEQ ID NO : 4, the sequence GTN, a nd the sequence as set forth in SEQ ID NO : 5, respectively.
  • VH heavy chain variable
  • CDR2 and CDR3 having the sequences as set forth in SEQ ID NOs : 1 , 2, and 3, respectively
  • VL light chain variable
  • antibody as used herein is intended to refer to an immunoglobulin molecule, a fragment of an immunoglobulin molecule, or a derivative of either thereof, which has the ability to specifically bind to an antigen under typical physiological conditions with a ha If- life of significant periods of time, such as at least about 30 minutes, at least about 45 minutes, at least about one hour, at least about two hours, at least about four hours, at least about 8 hours, at least about 12 hours, about 24 hours or more, about 48 hours or more, about 3, 4, 5, 6, 7 or more days, etc.
  • the binding region (or binding domain which may also be used herein, both terms having the same meaning) which interacts with an antigen, comprises variable regions of both the heavy and light chains of the immunoglobulin molecule.
  • the consta nt regions of the antibodies (Abs) may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (such as effector cells and T-cells) and components of the complement system such as Clq, the first component in the classical pathway of complement activation.
  • antibody as used herein, unless otherwise stated or clea rly contradicted by context, includes fragments of an antibody that retain the ability to specifically interact, such as bind, to the antigen . It has been shown that the antigen-binding function of an antibody may be performed by fragments of a full- length antibody.
  • binding fragments encompassed within the term "antibody” include (i) a Fab' or Fab fragment, a monovalent fragment consisting of the V L , V H , Q and C H 1 domains, or a monovalent antibody as described in WO2007059782 (Genmab A/S) ; (ii) F(ab') 2 fragments, bivalent fragments comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting essentially of the V H and CH 1 domains; and (iv) a Fv fragment consisting essentially of the V L and V H domains of a single arm of an antibody.
  • the two domains of the Fv fragment, V L and V H are coded for by separate genes, they may be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V
  • single chain antibodies are encompassed within the term antibody unless otherwise noted or clearly indicated by context.
  • antibody also includes polyclonal antibodies, monoclonal antibodies (mAbs), chimeric antibodies and humanized antibodies, a nd antibody fragments retaining the a bility to specifically bind to the antigen (antigen-binding fragments) provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques.
  • mAbs monoclonal antibodies
  • chimeric antibodies and humanized antibodies a nd antibody fragments retaining the a bility to specifically bind to the antigen (antigen-binding fragments) provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques.
  • An antibody as generated can possess any isotype.
  • immunoglobulin heavy chain "heavy cha in of an immunoglobulin” or “heavy chain” as used herein is intended to refer to one of the chains of an immunoglobulin.
  • a heavy chain is typically comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region (abbreviated herein as CH) which defines the isotype of the immunoglobulin.
  • the heavy chain constant region typically is comprised of three domains, CH I, CH2, and CH3.
  • the heavy chain constant region may further comprise a hinge region .
  • immunoglobulin as used herein is intended to refer to a class of structurally related glycoproteins consisting of two pairs of polypeptide chains, one pair of light (L) low molecular weight chains and one pair of heavy (H) chains, all four potentially inter-connected by disulfide bonds.
  • the structure of immunoglobulins has been well characterized (see for instance [ 14] ) . Within the structure of the immunoglobulin, the two heavy chains are inter-connected via disulfide bonds in the so- called "hinge region".
  • each lig ht chain is typically comprised of several regions; a light chain variable region (abbreviated herein as VL) and a light chain constant region (abbreviated herein as CL) .
  • the light chain constant region typically is comprised of one domain, CL.
  • the VH and VL regions may be further subdivided into regions of hyperva riability (or hypervariable regions which may be hypervariable in sequence and/or form of structurally defined loops), also termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs).
  • Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 (see [ 15]).
  • CDR sequences may be determined by use of the method provided by IMGT [16]-[ 17] .
  • isotype refers to the immunoglobulin class (for instance IgGl, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM) or any allotype thereof, such as IgGlm(za) and IgGlm(f) [SEQ ID NO: 15]) that is encoded by heavy chain constant region genes.
  • the antibody comprises a heavy chain of an immunoglobulin of the IgGl class or any allotype thereof.
  • each heavy chain isotype can be combined with either a kappa ( ⁇ ) or lambda ( ⁇ ) light chain.
  • chimeric antibody refers to a n antibody wherein the variable region is derived from a non-human species (e.g. derived from rodents) and the constant region is derived from a different species, such as human.
  • Chimeric antibodies may be generated by antibody engineering.
  • Antibody engineering is a term used generic for different kinds of modifications of antibodies, and which is a well-known process for the skilled person.
  • a chimeric antibody may be generated by using standard DNA techniques as described in [ 18] .
  • the chimeric may be a genetically or an enzymatically engineered recombinant antibody.
  • Chimeric monoclonal antibodies for therapeutic applications are developed to reduce antibody immunogenicity. They may for typically contain non-human (e.g. murine) variable regions, which are specific for the antigen of interest, and human constant antibody heavy and light chain domains.
  • variable region or “va riable domains” as used in the context of chimeric antibodies, refers to a region which comprises the CDRs and framework regions of both the heavy and light chains of the immunoglobulin.
  • humanized antibody refers to a genetically engineered non-human antibody, which contains human antibody constant domains and non-human variable domains modified to contain a high level of sequence homology to human variable domains. This can be achieved by grafting of the six non-human antibody complementarity-determining regions (CDRs), which together form the antigen binding site, onto a homologous human acceptor framework region (FR) (see [ 19]-[20]). In order to fully reconstitute the binding affinity and specificity of the parental antibody, the substitution of framework residues from the parental antibody (i.e. the non-human antibody) into the human framework regions (back-mutations) may be required.
  • CDRs complementarity-determining regions
  • FR homologous human acceptor framework region
  • a humanized antibody may comprise non-human CDR sequences, primarily human framework regions optionally comprising one or more amino acid back-mutations to the non-human amino acid sequence, and fully human constant regions.
  • additional amino acid modifications which are not necessa rily back-mutations, may be applied to obtain a humanized antibody with preferred characteristics, such as affinity and biochemical properties.
  • humanized or chimeric antibody according to any aspect or embodiment of the present invention may be termed "humanized or chimeric CD3 antibody”, “humanized or chimeric antibody of the invention”, “CD3 antibody”, or “CD3 antibody of the invention”, which all have the same meaning and purpose unless otherwise contradicted by context.
  • the amino acid sequence of an antibody of non-human origin is distinct from antibodies of human origin, and therefore a non-human antibody is potentially immunogenic when administered to human patients.
  • a non-human antibody is potentially immunogenic when administered to human patients.
  • its CDR segments are responsible for the ability of the antibody to bind to its target antigen and humanization aims to maintain the specificity and binding affinity of the antibody.
  • humanization of non-human therapeutic antibodies is performed to minimize its immunogenicity in man while such humanized antibodies at the same time maintain the specificity and binding affinity of the antibody of non-human origin.
  • binding region refers to a region of an antibody which is capable of binding to any molecule, such as a polypeptide, e.g. present on a cell, bacterium, or virion.
  • binding refers to the binding of an antibody to a predetermined antigen or target to which binding typically is with an affinity corresponding to a K D of about 10 6 M or less, e.g. 10 7 M or less, such as about 10 8 M or less, such as about 10 9 M or less, about 10 10 M or less, or about 10 11 M or even less when determined by for instance surface plasmon resonance (SPR) technology in a BIAcore 3000 instrument using the antigen as the ligand and the antibody as the analyte, and binds to the predetermined antigen with an affinity corresponding to a K D that is at least ten-fold lower, such as at least 100 fold lower, for instance at least 1 ,000 fold lower, such as at least 10,000 fold lower, for instance at least 100,000 fold lower than its affinity for binding to a non-specific antigen (e.g .
  • a non-specific antigen e.g .
  • K D K D (M), as used herein, refers to the dissociation equilibrium constant of a particular antibody-antigen interaction .
  • human CD3 refers to the human Cluster of Differentiation 3 protein which is part of the T-cell co-receptor protein complex and is composed of four distinct chains. CD3 is also found in other species, and thus, the term “CD3” may be used herein and is not limited to human CD3 unless contradicted by context.
  • the complex contains a CD3y (gamma) chain (human CD3y chain Swissprot P09693, or cynomolgus monkey CD3y Swissprot Q95LI7), a CD35 (delta) chain (human CD35 Swissprot P04234, or cynomolgus monkey CD35 Swissprot Q95LI8), two CD3E (epsilon) cha ins (human CD3e Swissprot P07766; or cynomolgus CD3e Swissprot Q95LI5), rhesus CD3e (Swissprot G7NCB9), and a ⁇ 3 ⁇ -*3 ⁇ (zeta) chain (human CD3 Swissprot P20963, cynomolgus monkey 003 ⁇ Swissprot Q09TK0) .
  • TCR T-cell receptor
  • amino acid sequences referred to as Swissprot numbers include a signal peptide which is removed after translation of the protein .
  • proteins, such as CD3, present on cell surfaces do not include the signal peptide.
  • amino acid sequences listed in Table 1 do not contain such signal peptide.
  • Such proteins as listed in Table 1 may be termed "mature proteins".
  • SEQ ID NO : 14 shows the amino acid sequence of mature human CD36 (delta)
  • SEQ ID NO : 13 shows the amino acid sequence of mature human CD3s (epsilon)
  • SEQ ID NO : 21 shows the amino acid sequence of mature cynomolgus CD3s
  • SEQ ID NO : 23 shows the amino acid sequence of mature rhesus CD3s.
  • the term "mature” as used herein, refers to a protein which does not comprise any signal or leader sequence.
  • Signal peptide sequence homology, length, a nd the cleavage site position varies significantly between different proteins.
  • Signal peptides may be determined by different methods, e.g . SEQ ID NO : 13 of the present invention has been determined according to the SignalP application (available on http ://www.cbs.dtu.dk/services/SignalP/) .
  • the humanized or chimeric antibody of the present invention binds the epsilon chain of CD3, such as the epsilon chain of huma n CD3 (SEQ ID NO : 13).
  • the humanized or chimeric antibody binds an epitope within amino acids 1-27 of the N-terminai part of human CD3E (epsilon) (SEQ ID NO : 13).
  • the antibody may even further cross- react with other non-human primate species, such as cynomolgus monkeys (cynomolgus CD3 epsilon SEQ ID NO: 21) and/or rhesus monkeys (rhesus CD3 epsilon SEQ ID NO: 23).
  • non-human primate species such as cynomolgus monkeys (cynomolgus CD3 epsilon SEQ ID NO: 21) and/or rhesus monkeys (rhesus CD3 epsilon SEQ ID NO: 23).
  • cross-react refers to the ability of an antibody, such as a humanized or chimeric antibody according to the invention, to bind its target on different species.
  • the humanized CD3 antibody exemplified in the examples described herein has the ability to both bind human (Example 2), cynomolgus (Example 2) and rhesus monkey CD3.
  • an antibody according to the present invention comprising the CDR sequences as defined herein, further comprising framework regions may differ in sequence outside the CDR sequences but still retains the full binding ability as compared the original antibody.
  • the present invention also relates to antibodies comprising an amino acid sequence of the variable region having a certain sequence identity to any sequence herein described.
  • the percent identity between two nucleotide or amino acid sequences may e.g. be determined using the algorithm of E. Meyers and W. Miller [21] .
  • the percent identity between two amino acid sequences may be determined using the Needleman and Wunsch algorithm [22] . Multiple alignments are preferably performed using the Clustal W algorithm [23] (as used e.g. , in Vector NTI Advance® software version 11.5; Invitrogen Inc.).
  • the VH region has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to at least one amino acid sequence as set forth in the VH sequences selected from the group consisting of:
  • VH region has at least 96% amino acid sequence identity to at least one amino acid sequence as set forth in the VH sequences selected from the group consisting of:
  • the VL region has at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity to at least one amino acid sequence as set forth in the VL sequences selected from the group consisting of:
  • the VL region has at least 95% amino acid sequence identity to at least one amino acid sequence as set forth in the VL sequences selected from the group consisting of:
  • the VH region is selected from the group consisting of: a) a VH sequence as set forth in SEQ ID NO : 6;
  • the VL region is selected from the group consisting of: a) a VL sequence as set forth in SEQ ID NO : 10;
  • only one of either the VH or VL sequence is 100% identical to one of the sequences disclosed herein whereas the other may have a sequence identity of at least 90%, at least 95%, at least 97%, or at least 99% amino acid sequence identity with one of the sequences herein disclosed.
  • the VH sequence has at least 97% amino acid sequence identity to at least one amino acid sequence as set forth in the VH sequences selected from the group consisting of:
  • VL sequence has at least 95% amino acid sequence identity to at least one amino acid sequence as set forth in the VL sequences selected from the group consisting of:
  • VL sequence as set forth in SEQ ID NO : 10;
  • VL sequence as set forth in SEQ ID NO : 12.
  • VH and VL sequences are selected from the group consisting of;
  • VH and VL sequence having at least 90% identity to the sequences set forth in SEQ ID NOs: 6 and 10, respectively; 7 and 10, respectively; 8 and 10, respectively; 9 and 10, respectively; 6 and 11, respectively; 7 and 11 , respectively; 8 and 11, respectively; 9 and 11, respectively; 6 and 12, respectively; 7 and 12, respectively; 8 and 12, respectively; and 9 and 12, respectively;
  • VH and VL sequence having at least 95% identity to the sequences set forth in SEQ ID NOs: 6 and 10, respectively; 7 and 10, respectively; 8 and 10, respectively; 9 and 10, respectively; 6 and 11, respectively; 7 and 11, respectively; 8 and 11, respectively; 9 and 11, respectively; 6 and 12, respectively; 7 and 12, respectively; 8 and 12, respectively; and 9 and 12, respectively;
  • VH and VL sequence having at least 97% identity to the sequences set forth in SEQ ID NOs: 6 and 10, respectively; 7 and 10, respectively; 8 and 10, respectively; 9 and 10, respectively; 6 and 11, respectively; 7 and 11, respectively; 8 and 11, respectively; 9 and 11, respectively; 6 and 12, respectively; 7 and 12, respectively; 8 and 12, respectively; and 9 and 12, respectively;
  • VH and VL sequence having at least 99% identity to the sequences set forth in SEQ ID NOs: 6 and 10, respectively; 7 and 10, respectively; 8 and 10, respectively; 9 and 10, respectively; 6 and 11, respectively; 7 and 11, respectively; 8 and 11, respectively; 9 and 11, respectively; 6 and 12, respectively; 7 and 12, respectively; 8 and 12, respectively; and 9 and 12, respectively;
  • VH and VL sequence having at least 100% identity to the sequences set forth in SEQ ID NOs: 6 and 10, respectively; 7 and 10, respectively; 8 and 10, respectively; 9 and 10, respectively; 6 and 11 , respectively; 7 and 11, respectively; 8 and 11, respectively; 9 and 11, respectively; 6 and 12, respectively; 7 and 12, respectively; 8 and 12, respectively; and 9 and 12, respectively;
  • VH sequence having at least 90% identity to the sequence set forth in SEQ ID NO : 6 and a VL sequence having at least 99% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 90% identity to the sequence set forth in SEQ ID NO : 6 and a VL sequence having at least 100% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 95% identity to the sequence set forth in SEQ ID NO : 6 and a VL sequence having at least 90% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 95% identity to the sequence set forth in SEQ ID NO : 6 and a VL sequence having at least 97% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 95% identity to the sequence set forth in SEQ ID NO: 6 and a VL sequence having at least 99% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 95% identity to the sequence set forth in SEQ ID NO : 6 and a VL sequence having at least 100% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 97% identity to the sequence set forth in SEQ ID NO : 6 and a VL sequence having at least 90% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 97% identity to the sequence set forth in SEQ ID NO : 6 and a VL sequence having at least 99% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 97% identity to the sequence set forth in SEQ ID NO : 6 and a VL sequence having at least 100% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 99% identity to the sequence set forth in SEQ ID NO : 6 and a VL sequence having at least 97% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 99% identity to the sequence set forth in SEQ ID NO : 6 and a VL sequence having at least 100% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 100% identity to the sequence set forth in SEQ ID NO : 6 and a VL sequence having at least 90% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 100% identity to the sequence set forth in SEQ ID NO : 6 and a VL sequence having at least 95% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 100% identity to the sequence set forth in SEQ ID NO : 6 and a VL sequence having at least 97% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 100% identity to the sequence set forth in SEQ ID NO : 6 and a VL sequence having at least 99% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • aa a VH sequence having at least 90% identity to the sequence set forth in SEQ ID NO: 7 and a VL sequence having at least 95% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 90% identity to the sequence set forth in SEQ ID NO : 7 and a VL sequence having at least 97% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • ac a VH sequence having at least 90% identity to the sequence set forth in SEQ ID NO : 7 and a VL sequence having at least 99% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • ad a VH sequence having at least 90% identity to the sequence set forth in SEQ ID NO : 7 and a VL sequence having at least 100% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • ae a VH sequence having at least 95% identity to the sequence set forth in SEQ ID NO: 7 and a VL sequence having at least 90% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12; af) a VH sequence having at least 95% identity to the sequence set forth in SEQ ID NO : 7 and a VL sequence having at least 97% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • ah a VH sequence having at least 95% identity to the sequence set forth in SEQ ID NO : 7 and a VL sequence having at least 100% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 97% identity to the sequence set forth in SEQ ID NO : 7 and a VL sequence having at least 99% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 97% identity to the sequence set forth in SEQ ID NO : 7 and a VL sequence having at least 100% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 99% identity to the sequence set forth in SEQ ID NO : 7 and a VL sequence having at least 90% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 99% identity to the sequence set forth in SEQ ID NO : 7 and a VL sequence having at least 95% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • ao a VH sequence having at least 99% identity to the sequence set forth in SEQ ID NO : 7 and a VL sequence having at least 97% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • ap a VH sequence having at least 99% identity to the sequence set forth in SEQ ID NO : 7 and a VL sequence having at least 100% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 100% identity to the sequence set forth in SEQ ID NO : 7 and a VL sequence having at least 97% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 100% identity to the sequence set forth in SEQ ID NO : 7 and a VL sequence having at least 99% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 90% identity to the sequence set forth in SEQ ID NO : 8 and a VL sequence having at least 95% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 90% identity to the sequence set forth in SEQ ID NO : 8 and a VL sequence having at least 97% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 90% identity to the sequence set forth in SEQ ID NO : 8 and a VL sequence having at least 99% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 90% identity to the sequence set forth in SEQ ID NO : 8 and a VL sequence having at least 100% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 95% identity to the sequence set forth in SEQ ID NO : 8 and a VL sequence having at least 90% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 99% identity to the sequence set forth in SEQ ID NO : 8 and a VL sequence having at least 100% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 100% identity to the sequence set forth in SEQ ID NO : 8 and a VL sequence having at least 90% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 100% identity to the sequence set forth in SEQ ID NO : 8 and a VL sequence having at least 95% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 100% identity to the sequence set forth in SEQ ID NO : 8 and a VL sequence having at least 97% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 90% identity to the sequence set forth SEQ ID NO:9 and a VL sequence having at least 100% identity to the sequence set forth SEQ ID NO:10, 11, or 12;
  • VH sequence having at least 95% identity to the sequence set forth SEQ ID NO:9 and a VL sequence having at least 90% identity to the sequence set forth SEQ ID NO:10, 11, or 12;
  • VH sequence having at least 95% identity to the sequence set forth SEQ ID NO:9 and a VL sequence having at least 99% identity to the sequence set forth SEQ ID NO:10, 11, or 12;
  • ch a VH sequence having at least 95% identity to the sequence set forth SEQ ID NO:9 and a VL sequence having at least 100% identity to the sequence set forth SEQ ID NO:10, 11, or 12;
  • VH sequence having at least 97% identity to the sequence set forth SEQ ID NO:9 and a VL sequence having at least 90% identity to the sequence set forth SEQ ID NO:10, 11, or 12;
  • VH sequence having at least 97% identity to the sequence set forth SEQ ID NO:9 and a VL sequence having at least 95% identity to the sequence set forth SEQ ID NO:10, 11, or 12;
  • VH sequence having at least 99% identity to the sequence set forth in SEQ ID NO :9 and a VL sequence having at least 97% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • cp a VH sequence having at least 99% identity to the sequence set forth in SEQ ID NO :9 and a VL sequence having at least 100% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 100% identity to the sequence set forth in SEQ ID NO:9 and a VL sequence having at least 90% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 100% identity to the sequence set forth in SEQ ID NO :9 and a VL sequence having at least 95% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • VH sequence having at least 100% identity to the sequence set forth in SEQ ID NO :9 and a VL sequence having at least 97% identity to the sequence set forth in SEQ ID NO: 10, 11, or 12;
  • the binding region comprises a VH and a VL selected from the group consisting of;
  • the binding region comprises a VH sequence and a VL sequence selected from the group consisting of;
  • the humanized antibody according to the present invention may be generated by comparison of the heavy and light chain variable region amino acid sequences against a database of human germline variable region sequences in order to identify the heavy and light chain human sequence with the appropriate degree of homology for use as human variable framework regions.
  • a series of humanized heavy and light chain variable regions may be designed by grafting, e.g. the murine, CD s onto the frameworks regions (identified as described above) and, if necessary, by back-mutation (mutation of one or more of the human amino acid residues in the framework regions back to the non-human amino acid at the specific position(s)) to the specific murine sequence of residues identified which may be critical to the restoration of the antibody binding efficiency.
  • Variant sequences with the lowest incidence of potential T-cell epitopes may then be selected as determined by application of in silico technologies; iTopeTM and TCEDTM ([24], [25], and [26] ).
  • the humanized antibodies according to the present invention may also be "deimmunized".
  • Deimmmunization may be desired, as within a protein sequence, such as a humanized antibody according to the present invention, the presence of human T-cell epitopes may increase the immunogenicity risk profile as they have the potential to activate helper T-cells. Such activation of helper T-cells may be avoided by deimmunization.
  • Deimmunization may be performed by introducing a mutation in the amino acid sequence of the humanized antibody in order to remove the T-cell epitopes without significantly reducing the binding affinity of the antibody.
  • the humanized antibody may be produced by a method comprising the steps of (i) comparing the non-human full variable heavy chain sequence and/or the full variable light chain sequence to a database of human germline sequences, (ii) selecting the human germline sequence having the highest homology to the non-human sequence to obtain a humanized sequence, (iii) optimizing the humanized sequence by back-mutation(s) if required, and (iv) expressing the sequence in a suitable expression system.
  • a full-length antibody according to the present invention may be produced by a method comprising the steps of (i) comparing the non-human variable heavy chain sequence and the variable light chain sequences to a database of human germline sequences, (ii) selecting the human germline sequence having the highest homology to the non-human sequence, (iii) grafting of the non-human CDRs in to the selected human germ-line to obtain a humanized sequences, (iv) optimizing the humanized sequences by back-mutation(s) if required, (v) identifying constant heavy and light chain sequences, and (vi) expressing the complete heavy chain sequences and complete light chain sequences in suitable expression systems.
  • a full-length antibody according to the present invention may, thus, be produced as described in Example 1. It is within the knowledge of the skilled person to produce a full-length antibody when starting out from either CDR sequences or full variable region sequences. Thus, the skilled person would know how to generate a full-length antibody according to the present invention.
  • complete heavy chain sequences refers to a sequence consisting of variable heavy chain and constant heavy chain sequences.
  • complete light chain sequences refers to a sequence consisting of variable light chain and constant light chain sequences.
  • Back-mutation(s) may be introduced by standard DNA mutagenesis. Such standard techniques for DNA mutagenesis are described in [ 18] . Alternatively, use of commercially available kits such as QuickchangeTM Site-Directed Mutagenesis Kit (Stratagene), or the desired back-mutations may be introduced by de novo DNA synthesis.
  • the antibody is a humanized antibody.
  • Chimeric antibodies may be generated by substituting all constant region sequences of a non-human (such as murine) antibody with constant region sequences of human origin. Thus, fully non-human variable region sequences are maintained in the chimeric antibody.
  • a chimeric antibody according to the present invention may be produced by a method comprising the step of expressing the non-human variable heavy chain (SEQ ID NO :27), non-human variable light chain sequences (SEQ ID NO: 28), human constant heavy chain and human constant light chain sequences in suitable expression systems, and thereby generating a full-length chimeric antibody.
  • Alternative methods may be used. Such methods of producing a chimeric antibody is within the knowledge of the skilled person, and thus, the skilled person would know how to produce a chimeric antibody according to the present invention.
  • the antibody is a chimeric antibody.
  • the antibody is a full-length antibody.
  • full- length antibody refers to an antibody (e.g ., a parent or variant antibody) which contains all heavy and light chain constant and variable domains correspond to those that are normally found in a wild-type antibody of that isotype.
  • the antibody comprises an Fc region comprising a first and a second immunoglobulin heavy chain.
  • Fc region refers to a region comprising, in the direction from the N- to C-terminal, at least a hinge region, a CH2 region and a CH3 region.
  • An Fc region may further comprise a CH I region at the N-terminal end of the hinge region.
  • hinge region refers to the hinge region of an immunoglobulin heavy chain.
  • the hinge region of a human IgGl antibody corresponds to amino acids 216-230 according to the Eu numbering as set forth in Kabat.
  • amino acids of the constant region sequences are herein numbered according to the Eu-index of numbering (described in [27]) and may be termed "according to the Eu numbering as set forth in Kabat", “Eu numbering according to Kabat”, or “according to the Eu numbering system”.
  • CH I region refers to the CH I region of an immunoglobulin heavy chain.
  • CH I region of a human IgGl antibody corresponds to amino acids 118-215 according to the Eu numbering system.
  • the CH I region may also be any of the other subtypes as described herein.
  • CH2 region refers to the CH2 region of an immunoglobulin heavy chain.
  • the CH2 region of a human IgGl antibody corresponds to amino acids 231-340 according to the Eu numbering system.
  • the CH2 region may also be any of the other subtypes as described herein.
  • CH3 region refers to the CH3 region of an immunoglobulin heavy chain.
  • the CH3 region of a human IgGl antibody corresponds to amino acids 341-447 according to the Eu numbering system.
  • the CH3 region may also be any of the other subtypes as described herein.
  • the isotype of the immunoglobulin heavy chain is selected from the group consisting of IgGl, IgG2, IgG3, and IgG4.
  • the immunoglobulin heavy chain may be any allotype within each of the immunoglobulin classes, such as IgGlm(f) (SEQ ID NO : 15).
  • the isotype of the immunoglobulin heavy chains is an IgGl, or any allotype thereof, such as IgGlm(f) (SEQ ID NO: 15).
  • TCR T-cell Receptor
  • Other effector functions e.g. complement activation, may not be wanted, and therefore, reduction of effector functions is desirable.
  • Clq binding is the first step in the complement cascade, and therefore serves as an indicator for complement-dependent cytotoxicity (CDC) capacity of antibodies. If binding of Clq to the antibody can be avoided, activation of the complement cascade can be avoided as well.
  • the antibody comprises an Fc region which has been modified so that binding of Clq to said antibody is reduced compared to a wild-type antibody by at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 99%, or 100%, wherein Clq binding is determined by ELISA.
  • modified refers to the amino acid sequence of an Fc region which is not identical to the amino acid sequence of a wild-type Fc region. I.e. amino acid residues in specific positions of the wild-type Fc region have been substituted, deleted or inserted in order to alter, for example, the binding site for Clq , binding site for other effector molecules or binding to Fc Receptors (FcRs) .
  • modification(s) of the amino acid sequence may be prepared by substituting one or more amino acids with a conservative amino acid or may be prepared by substituting one or more amino acids with an alternative amino acid which is physically and/or functionally similar to the amino acid present in the wild-type. Substitutions may also be prepared by substituting with a non- conservative amino acid.
  • amino acids may be described as conservative or non-conservative amino acids, and may therefore be classified accordingly.
  • Amino acid residues may also be divided into classes defined by alternative physical and functional properties. Thus, classes of amino acids may be reflected in one or both of the following tables:
  • n antibody such as a humanized or chimeric antibody
  • the three letter code, or one letter code is used, including the codes Xaa and X to indicate any amino acid residue. Accordingly, the notation "L234F” or “Leu234Phe” means, that the antibody comprises a substitution of Leucine with Phenylalanine in amino acid position 234.
  • the more than one amino acid may be sepa rated by "," or "/”.
  • the substitution of Leucine for Phenylalanine, Arginine, Lysine or Tryptophan in position 234 is: "Leu234Phe,Arg,Lys,Trp” 0 r "Leu234Phe/Arg/Lys/Trp” or "L234F,R,K,W” or "L234F/R/K/W” or "L234 to F, R, K or W"
  • a substitution embraces a substitution into any one of the other nineteen natural amino acids, or into other amino acids, such as non-natural amino acids.
  • a substitution of amino acid L in position 234 includes each of the following substitutions: 234A, 234C, 234D, 234E, 234F, 234G, 234H, 2341, 234K, 234M, 234N, 234Q, 234R, 234S, 234T, 234V, 234W, 234P, and 234Y. This is, by the way, equivalent to the designation 234X, wherein the X designates any amino acid other than the original amino acid.
  • substitutions can also be designated L234A, L234C, etc., or L234A,C,etc , or L234A/C/etc. The same applies by analogy to each and every position mentioned herein, to specifically include herein any one of such substitutions.
  • the antibody according to the invention may also comprise a deletion of an amino acid residue.
  • deletion may be denoted “del”, and includes, e.g., writing as L234del.
  • the Leucine in position 234 has been deleted from the amino acid sequence.
  • amino acid and “amino acid residue” may herein be used interchangeably.
  • Clq binding refers to the binding of Clq to an antibody, when said antibody is bound to its antigen.
  • bound to its antigen refers to binding of an antibody to its antigen both in vivo and in vitro.
  • reduce refers to the ability of the antibody according to the invention to reduce, minimize or even completely inhibit the binding of Clq to the antibody when compared to the Clq binding to a wild - type antibody.
  • wild-type antibody refers to an antibody which is identical to the antibody to be tested except for not being inert.
  • inert refers to a modified Fc region having reduced or no binding of Clq as determined in Example 10, i.e. where Clq binding is determined by ELISA; reduced or no Fc-mediated T- cell proliferation as determined in Example 4, i.e. T-cell proliferation is measured in a peripheral blood mononuclear cell (PBMC)-based functional assay; and/or reduced or no Fc-mediated CD69 expression as determined in Example 3, i.e.
  • PBMC peripheral blood mononuclear cell
  • the wild-type antibody comprises the naturally occurring amino acids in the immunoglobulin heavy chains, i.e. an antibody which does not comprise any amino acid modifications which may alter or reduce the ability of the antibody to interact with e.g. Clq, Fc Receptors or the like.
  • an antibody which does not comprise any amino acid modifications which may alter or reduce the ability of the antibody to interact with e.g. Clq, Fc Receptors or the like.
  • such a wild-type antibody will remain an activating antibody which is able to bind e.g. Clq.
  • a wild-type antibody and an antibody of the present invention may comprise other amino acid modifications than those affecting the antibody's ability of inducing effector functions, in order to make the antibody a bispecific antibody or the like.
  • ELISA enzyme-jinked Immunosorbent assay which is a test that uses antibodies and color change to identify a substance.
  • a first specific antibody is attached to the plate surface. Thereby the protein from a sample is added wherein binding to said first specific antibody is tested.
  • a second antibody binding the antibody from the sample is added.
  • the second antibody is linked to an enzyme, and, in the final step, a substance containing the enzyme's substrate is added. The subsequent reaction produces a detectable signal, most commonly a color change in the substrate.
  • the concept of the ELISA method is well-known within the art and various ways of performing an ELISA are contemplated to be part of a method to evaluate the antibody according to the invention. Thus, this interpretation is not to be understood as limiting as various forms of ELISAs may be performed such as described in Example 4.
  • the ability of an antibody according to the present invention to bind Clq may be determined by ELISA comprising the steps of (i) coating said antibody on a 96-well plate, (ii) adding 3% serum, (iii) adding an anti-human Clq antibody, (iv) developing the plate, and (v) measuring OD 40S nm.
  • the antibody comprises an Fc region which has been modified so that binding of Clq to said antibody is reduced compared to a wild-type antibody by at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, or 100%, wherein Clq binding is determined by ELISA comprising the steps of (i) coating said antibodies on a 96-well plate, (ii) adding 3% serum, (iii) adding an anti-human Clq, (iv) developing the plate, and (v) measuring OD 40S nm.
  • binding of Clq is evaluated as described in Example 10.
  • Fc Receptor refers to a protein found on the surface of certain cells. FcRs bind to the Fc region of antibodies. There are several different types of FcRs which are classified based on the type of antibody they recognize. E.g. Fey (gamma) Receptors bind to antibodies of the IgG class.
  • Fcy Receptor refers to a group of Fc Receptors belonging to the immunoglobulin superfamily and is the most important Fc receptors for inducing phagocytosis of opsonized (coated) microbes. This family includes several members, FcyRI (CD64), FcyRIIa (CD32a), FcyRIIb (CD32b), FcyRIIIa (CD16a), FcyRIIIb (CD16b), which differ in their antibody affinities due to their different molecular structure. Fc-mediated effector functions form part of the biological activity of human immunoglobulin G (IgG) molecules.
  • IgG human immunoglobulin G
  • effector functions include e.g. antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) which are triggered by the binding of various effector molecules to the Fc region.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • CDC complement-dependent cytotoxicity
  • Fc binding refers to the binding of the Fc region to an Fc Receptor (FcR) or an effector molecule.
  • FcyR binding and “FcyRI binding” refer to binding to or with an Fc region to the Fc gamma Receptor and Fc gamma Receptor I, respectively.
  • T-cells When a CD3 antibody binds T-cells, the wild-type Fc region of the CD3 antibody binds to FcRs present on other cells, e.g. monocytes, which leads to non-specific, Fc-mediated activation of the T-cell. Such non-specific, Fc-mediated activation of T-cells may be undesired.
  • T-cells may also be activated by targeted , or target-specific, T-cell activation. Such targeted T-cell activation may be highly desirable for the treatment of a range of indications, such as cancer.
  • targeted T-cell activation refers to directing the T-cells to specific cells, such as tumor cells by use of a bispecific antibody comprising a first binding region binding a specific target, such as a tumor target on a tumor cell, and a second binding region binding a T- cell specific target, such as CD3.
  • a bispecific antibody comprising a first binding region binding a specific target, such as a tumor target on a tumor cell, and a second binding region binding a T- cell specific target, such as CD3.
  • targeting of T-cells to specific cells e.g. tumor cells
  • a humanized antibody of the present invention has been proven to be inert when tested in several different assays, i.e. see Examples 3 to 5.
  • Another tested CD3 antibody, huCLB-T3/4, comprising amino acid modifications in the Fc region also proved to be inert when tested in different assays, i.e. see Examples 7 to 10.
  • the humanized CD3 antibody according to the present invention comprising the amino acid substitutions L234F, L235E, and D265A, as described in the Examples, showed low levels of CD69 expression on T-cells (Example 3), abrogation of Fc-mediated T-cell proliferation (Example 4), and no non-specific target killing when in the form of a bispecific antibody (Example 5).
  • a humanized antibody of the present invention shows superior results in several assays when compared to a wild-type antibody.
  • An antibody according to the present invention may comprise modifications in the Fc region. When an antibody comprises such modifications it may become an inert, or non-activating, antibody.
  • inertness refers to an Fc region which is at least not able to bind any Fey Receptors, induce Fc- mediated cross-linking of FcRs, or induce FcR-mediated cross-linking of target antigens via two Fc regions of individual antibodies, or is not able to bind Clq.
  • the inertness of an Fc region of a humanized or chimeric CD3 antibody is advantageously tested using the antibody in a monospecific format although an inert Fc region so identified can be used in bispecific or other humanized or chimeric multispecific CD3 antibodies.
  • variants can be constructed to make the Fc region of an antibody inactive for interactions with Fc gamma Receptors and Clq for therapeutic antibody development. Examples of such variants are described herein.
  • the antibody comprises an Fc region which has been modified so that said antibody mediates reduced Fc-mediated T-cell proliferation compared to a wild-type antibody by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100%, wherein said T-cell proliferation is measured in a peripheral blood mononuclear cell (PBMC)-based functional assay.
  • PBMC peripheral blood mononuclear cell
  • the term “reduce” as used herein, refers to a reduction of activity or expression when compared to a control protein, such as an antibody.
  • the term “reduce” when referring to T-cell proliferation refers to the ability of the antibody according to the invention to reduce, minimize or even completely inhibit the proliferation of T-cells when compared to the proliferation of T-cells bound by a wild-type antibody.
  • the ability of an antibody to reduce T-cell proliferation may be evaluated by a PB C-based functional assay, as described in Example 4 and Example 8.
  • the assay is performed with human PBMCs.
  • the assay is performed with cynomolgus PBMCs.
  • the assay is performed with rhesus PBMCs.
  • a PBMC-based assay as herein described may be performed with any species PBMCs to show reduction of T-cell proliferation as long as the species PBMC used are within the cross - reactivity spectra of the antibodies, e.g. human, cynomolgus or rhesus monkeys.
  • peripheral blood mononuclear cell (PBMC)-based functional assay refers to an assay used for evaluating a functional feature of the antibody of the present invention, such as the ability of said antibody to affect T-cell proliferation or CD69 expression, wherein the only cells present are peripheral blood mononuclear cells.
  • T-cell proliferation is measured by a method comprising the steps of incubating PBMCs with antibody in the range of 1 -1000 ng/mL at 37°C in a 5% (vol/vol) C0 2 humidified incubator for three days, adding a chemical compound, such as BrdU, which is incorporated into the DNA of proliferating cells, incubating for five hrs., pelleting cells, drying cells, optionally storing the cells at 4°C, coating cells to ELISA plates, incubating with anti-BrdU-peroxidase for 90 min at room temperature, developing for about 30 min with 1 mg/mL 2,2'-azino-bis (3-ethylbenzothiazoline-6-sulfonic acid), adding 100 ⁇ _ 2% oxalic acid to stop the reaction, and measuring absorbance at 405 nm in a suitable microplate reader.
  • a chemical compound such as BrdU
  • proliferation refers to cell growth in the context of cell division.
  • BrdU refers to 5-bromo-2'-deoxyuridine, which is a homologue to thymidine.
  • BrdU is added to cell culture for a limited period of time (e.g. 4 hours) it will be incorporated into the DNA of proliferating cells. After fixing the cells, detection of incorporated BrdU may be performed in an ELISA using anti-BrdU- peroxidase. BrdU incorporation is therefore a measure for proliferation.
  • the antibody comprises an Fc region which has been modified so that said antibody reduces Fc-mediated CD69 expression by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100% when compared to a wild-type antibody wherein said Fc-mediated CD69 expression is determined in a PBMC-based functional assay.
  • the term “reduce” as used herein refers to a reduction of activity or expression when compared to a control protein, such as an antibody.
  • the term “reduce” when referring to expression level of the T-cell activation marker CD69 refers to a reduction in expression level of CD69 when compared to expression level of CD69 when the T-cell is bound by a wild-type antibody provided that both the binding regions of the antibody binds CD3.
  • An antibody's ability to reduce expression of CD69 may be evaluated by a PBMC-based functional assay, as described in Example 3 and Example 7.
  • expression of CD69 is measured by a method comprising the steps of incubating PBMCs with an antibody in the range of 1-1000 ng/mL at 37°C in a 5% (vol/vol) C0 2 humidified incubator for 16-24 hrs, washing the cells, staining the cells at 4°C with a mouse anti-human CD28-PE and mouse-anti-human CD 69 -A PC antibody, and determining CD69-expression on CD28 positive cells by flow cytometry.
  • CD69 refers to Cluster of Differentiation 69 which is a human transmembrane C-Type lectin protein encoded by the CD69 gene. Activation of T lymphocytes and natural killer (NK) cells, both in vivo and in vitro, induces expression of CD69.
  • CD69 function as a signal transmitting receptor involved in cellular activation events including proliferation, functions as a signal-transmitting receptor in lymphocytes, including natural killer cells and platelets, and the induction of specific genes.
  • peripheral blood mononuclear cell (PBMC)-based functional assay refers to an assay used for evaluating a functional feature of the antibody of the present invention, such as the ability of said antibody to affect T-cell proliferation or CD69 expression, wherein the only cells present are peripheral blood mononuclear cells.
  • a PBMC-based functional assay as described in Example 3, 4, 5, and 7 comprises the steps of (i) incubating PBMCs with an antibody at 37°C in a 5% (vol/vol) C0 2 humidified incubator for about 16-24 hrs, (ii) washing the cells, (iii) staining the cells at 4°C with a mouse anti-human CD28-PE and mouse-anti-human CD 69 -A PC antibody, and (iv) determining the CD69 expression on CD28 positive cells by flow cytometry, when CD69 expression is evaluated.
  • CD69 expression may be determined as described in Example 3, 4, 5, or 7.
  • amino acids in the Fc region that play a dominant role in the interactions with Clq and the Fc Gamma Receptors may be modified.
  • amino acid positions that may be modified include positions L234, L235 and P331. Combinations thereof, such as L234F/L235E/P331S, can cause a profound decrease in binding to human CD64, CD32A, CD16 and Clq.
  • the amino acid in at least one position corresponding to L234, L235 and P331, may be A, A and S, respectively ([1], [28]).
  • L234F and L235E amino acid substitutions can result in Fc regions with abrogated interactions with Fc Gamma Receptors and Clq ([29]-[30]).
  • the amino acids in the positions corresponding to L234 and L235 may be F and E, respectively.
  • a D265A amino acid substitution can decrease binding to all Fc gamma Receptors and prevent ADCC ([31]).
  • the amino acid in the position corresponding to D265 may be A.
  • Binding to Clq can be abrogated by mutating positions D270, K322, P329, and P331. Mutating these positions to either D270A or K322A or P329A or P331A can make the antibody deficient in CDC activity ([32]).
  • the amino acids in at least one position corresponding to D270, K322, P329 and P331, may be A, A, A, and A, respectively.
  • An alternative approach to minimize the interaction of the Fc region with Fc gamma Receptors and Clq is by removal of the glycosylation site of an antibody. Mutating position N297 to e.g. Q, A, and E removes a glycosylation site which is critical for IgG-Fc gamma Receptor interactions.
  • the amino acid in a position corresponding to N297 may be G, Q, A or E ([33]).
  • Another alternative approach to minimize interaction of the Fc region with Fc gamma Receptors may be obtained by the following mutations; P238A, A327Q, P329A or E233P/L234V/L235A/G236del ( [31]).
  • human IgG2 and IgG4 subclasses are considered naturally compromised in their interactions with Clq and Fc gamma Receptors although, interactions with Fey Receptors (Fc gamma Receptors) were reported ( [34]- [35]). Mutations abrogating these residual interactions can be made in both isotypes, resulting in reduction of unwanted side-effects associated with FcR binding.
  • these include L234A and G237A, and for IgG4, L235E.
  • the amino acid in a position corresponding to L234 and G237 in a human IgG2 heavy chain may be A and A, respectively.
  • the amino acid in a position corresponding to L235 in a human IgG4 heavy chain may be E.
  • the hinge region of the antibody can also be of importance with respect to interactions with Fc gamma Receptors and complement ( [38]-[39]). Accordingly, mutations in or deletion of the hinge region can influence effector functions of an antibody.
  • cross-linking refers to the indirect bridging of antibody Fab arm(s) (monovalently or bivalently) bound to the target antigen by FcR- bearing cell through binding to the antibody Fc region.
  • an antibody which binds its target antigen on target antigen-bearing cells may cross-link with another cell expressing FcRs.
  • unspecific killing refers to the killing of cells by the cytotoxic function of T-cells or other effector cells, through tumor target antigen- independent activation of said cells.
  • unspecific killing is meant that the tumor- target bearing cells may be killed by e.g. cytotoxic T-cells and not by the antibody binding the tumor target by e.g. induction of CDC.
  • a non- activating Fc region may be obtained by modifying one or more of at least five specific amino acid positions in the Fc region.
  • the antibody comprises a first and a second immunoglobulin heavy chain, wherein in at least one of said first and second immunoglobulin heavy chains one or more amino acids in the positions corresponding to positions L234, L235, D265, N297, and P331 in a human IgGl heavy chain, are not L, L, D, N, and P, respectively.
  • one or more amino acids in the position corresponding to positions L234, L235, D265, N297, and P331 in a human IgG l heavy chain are not L, L, D, N, and P, respectively.
  • one or more amino acids in the positions corresponding to positions L234, L235 and D265 in a human IgGl heavy chain are not L, L and D, respectively, and the amino acids in the positions corresponding to N297 and P331 in a human IgG l heavy chain, are N and P, respectively.
  • amino acid corresponding to positions refers to an amino acid position number in a human IgGl heavy chain. Unless otherwise stated or contradicted by context, the amino acids of the constant region sequences are herein numbered according to the Eu-index of numbering (described in [27]).
  • an amino acid or segment in one sequence that "corresponds to" an amino acid or segment in another sequence is one that aligns with the other amino acid or segment using a standard sequence alignment program such as ALIGN, ClustalW or similar, typically at default settings and has at least 50%, at least 80%, at least 90%, or at least 95% identity to a human IgGl heavy chain. It is considered well-known in the art how to align a sequence or segment in a sequence and thereby determine the corresponding position in a sequence to an amino acid position according to the present invention.
  • amino acid may be defined as described above.
  • the amino acid is not or similar wording when referring to amino acids in a heavy chain is to be understood to mean that the amino acid is any other amino acid than the specific amino acid mentioned.
  • the amino acid in the position corresponding to L234 in a human IgGl heavy chain is not L means that the amino acid may be any of the other naturally or non-natu rally occurring amino acids than L.
  • the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is not D.
  • the amino acid in the position corresponding to D265 in a human IgGl heavy chain is not D, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
  • the amino acids in the positions corresponding to position D265 in a human IgGl heavy chain is hydrophobic or polar amino acids.
  • hydrophobic refers to an amino acid residue selected from the group consisting of; A, C, F, G, H, I, L, M, R, T, V, W, and Y.
  • amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group of amino acids consisting of; A, C, F, G, H, I, L, M, R, T, V, W and Y.
  • polar refers to any amino acid residue selected from the group consisting of; C, D, E, H, K, N, Q, R, S, and T.
  • amino acid in the position corresponding to position D265 in a human heavy chain is selected from the group consisting of; C, E, H, K, N, Q, R, S, and T.
  • amino acid in the position corresponding to position D265 in a human IgGl heavy chain is an aliphatic uncharged, aromatic or acidic amino acid .
  • aliphatic uncharged refers to any amino acid residue selected from the group consisting of: A, G, I, L, and V.
  • amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, G, I, L, and V.
  • aromatic refers to any amino acid residue selected from the group consisting of: F, T, and W.
  • amino acid in at least one of said first and second heavy chains is selected from the group consisting of; F, T, and W.
  • amino acid residues refers to any amino acid residue chosen from the group consisting of: D and E.
  • amino acid residues chosen from the group consisting of: D and E.
  • the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, E, F, G, I, L, T, V, and W.
  • the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is not D.
  • the amino acid in the position corresponding to D265 in a human IgGl heavy chain is not D, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgG l heavy chain, are N and P, respectively.
  • the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is hydrophobic or polar amino acid.
  • hydrophobic refers to an amino acid residue selected from the group consisting of; A, C, F, G, H, I, L, M, R, T, V, W, and Y.
  • amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group of amino acids consisting of; A, C, F, G, H, I, L, M, R, T, V, W and Y.
  • polar as used herein in relation to amino acid residues, refers to any amino acid residue selected from the group consisting of; C, D, E, H, K, N, Q, R, S, and T.
  • the amino acid in the position corresponding to position D265 in a human heavy chain is selected from the group consisting of; C, E, H, K, N, Q, R, S, and T.
  • the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group of amino acids consisting of; A, C, F, G, H, I, L, M, R, T, V, W and Y.
  • the amino acids in the positions corresponding to position D265 in a human heavy chain is selected from the group consisting of; C, E, H, K, N, Q, R, S, and T.
  • the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is aliphatic uncharged, aromatic or acidic amino acids.
  • aliphatic uncharged refers to any amino acid residue selected from the group consisting of: A, G, I, L, and V.
  • amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, G, I, L, and V.
  • aromatic refers to any amino acid residue selected from the group consisting of: F, T, and W.
  • amino acid in both said first and second heavy chains is selected from the group consisting of; F, T, and W.
  • amino acid residues refers to any amino acid residue chosen from the group consisting of: D and E.
  • amino acid residues chosen from the group consisting of: D and E.
  • the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, E, F, G, I, L, T, V, and W.
  • the amino acid in the position corresponding to position N297 in a human IgGl heavy chain is not N.
  • the amino acid in the position corresponding to N297 in a human IgGl heavy chain is not N, and the amino acid in the position corresponding to position P331 in a human IgGl heavy chain, is P.
  • the amino acid in the position corresponding to positions N297 in a human IgGl heavy chain is not N.
  • the amino acid in the position corresponding to N297 in a human IgGl heavy chain is not N
  • the amino acid in the position corresponding to position P331 in a human IgGl heavy chain is P.
  • the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are not L and L, respectively.
  • the amino acids in the positions corresponding to L234 and L235 in a human IgGl heavy chain are not L and L, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
  • the amino acids corresponding to positions L234 and L235 in a human IgG l heavy chain are selected from the group consisting of; A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, Y, V.
  • the amino acids in the positions corresponding to positions L234 and L235 in a human IgG l heavy chain are hydrophobic or polar amino acids.
  • hydrophobic refers to an amino acid residue selected from the group consisting of; A, C, F, G, H, I, L, M, R, T, V, W, and Y.
  • amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, C, F, G, H, I, M, R, T, V, W, and Y.
  • polar refers to any amino acid residue selected from the group consisting of; C, D, E, H, K, N, Q, R, S, and T.
  • amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group of amino acids consisting of; C, D, E, H, K, N, Q, R, S, and T.
  • the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, C, D, E, F, G, H, I, K, M, N, Q, R, S, T, V, W, and Y.
  • the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are not L and L, respectively.
  • the amino acids in the positions corresponding to L234 and L235 in a human IgGl heavy chain are not L and L, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
  • the amino acids in the positions corresponding to L234 and L235 in a human IgGl heavy chain are hydrophobic or polar amino acids.
  • the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, C, F, G, H, I, M, R, T, V, W, and Y.
  • the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group of amino acids consisting of; C, D, E, H, K, N, Q, R, S, and T.
  • the amino acids in the positions corresponding to positions L234 and L235 in a human IgG l heavy chain are each selected from the group consisting of; A, C, D, E, F, G, H, I, K, M, N, Q, R, S, T, V, W, and Y.
  • the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are aliphatic uncharged, aromatic or acidic amino acids.
  • aliphatic uncharged refers to any amino acid residue selected from the group consisting of: A, G, I, L, and V.
  • amino acids in at least one of said first and second heavy chains are each selected from the group consisting of; A, G, I, and V.
  • amino acid residues refers to any amino acid residue selected from the group consisting of: F, T, and W.
  • amino acids in at least one of said first and second heavy chains are each selected from the group consisting of; F, T, and W.
  • amino acid residues refers to any amino acid residue chosen from the group consisting of: D and E.
  • amino acids in at least one of said first and second heavy chains are each selected from the group consisting of; D and E.
  • the amino acids in the positions corresponding to L234 and L235 are each selected from the group consisting of; A, D, E, F, G, I, T, V, and W.
  • the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are F and E; or A and A, respectively.
  • the amino acids in the positions corresponding to L234 and L235 in a human IgGl heavy chain are F and E; or A and A, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
  • amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are F and E; or A and A, respectively.
  • the amino acids in the positions corresponding to L234 and L235 in a human IgGl heavy chain are F and E; or A and A, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
  • the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are F and E, respectively.
  • amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are F and E, respectively.
  • At least one of said first and second heavy chains at least the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain, are A and A, respectively.
  • At least the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are A and A, respectively.
  • the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are not L, L, and D, respectively.
  • the amino acids in the positions corresponding to L234, L235, and D265 in a human IgGl heavy chain are not L, L and D, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
  • the amino acids corresponding to positions L234 and L235 in a human IgGl heavy chain are selected from the group consisting of; A, C, D, E, F, G, H, I, K, M, N, P, Q, R, S, T, Y, V, and W, and the amino acid corresponding to position D265 is selected from the group consisting of; A, C, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, Y, V, and W.
  • the amino acids in the positions corresponding to positions L234, L235 and D265 in a human IgGl heavy chain are hydrophobic or polar amino acids.
  • hydrophobic refers to an amino acid residue selected from the group consisting of; A, C, F, G, H, I, L, M, R, T, V, W, and Y.
  • amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group of amino acids consisting of; A, C, F, G, H, I, L, M, R, T, V, W and Y, and the amino acids in the positions corresponding to positions L234 and L235 in a human IgG l heavy chain are each selected from the group consisting of; A, C, F, G, H, I, M, R, T, V, W, and Y.
  • polar refers to any amino acid residue selected from the group consisting of; C, D, E, H, K, N, Q, R, S, and T.
  • amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group of amino acids consisting of; C, D, E, H, K, N, Q, R, S, and T
  • amino acid in the position corresponding to position D265 in a human heavy chain is selected from the group consisting of; C, E, H, K, N, Q, R, S, and T.
  • the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, C, D, E, F, G, H, I, K, M, N, Q, R, S, T, V, W, and Y, and the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, C, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, and Y.
  • the amino acids in the positions corresponding to L234, L235, and D265 in a human IgGl heavy chain are hydrophobic or polar amino acids.
  • the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group of amino acids consisting of; A, C, F, G, H, I, L, M, R, T, V, W and Y, and the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, C, F, G, H, I, M, R, T, V, W, and Y.
  • the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group of amino acids consisting of; C, D, E, H, K, N, Q, R, S, and T
  • the amino acid in the position corresponding to position D265 in a human heavy chain is selected from the group consisting of; C, E, H, K, N, Q, R, S, and T.
  • the amino acids in the positions corresponding to positions L234 and L235 in a human IgG l heavy chain are each selected from the group consisting of; A, C, D, E, F, G, H, I, K, M, N, Q, R, S, T, V, W, and Y, and the amino acid in the position corresponding to position D265 in a human IgG l heavy chain is selected from the group consisting of; A, C, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, and Y.
  • the amino acids in the positions corresponding to positions L234, L235 and D265 in a human IgGl heavy chain are aliphatic uncharged, aromatic or acidic amino acids.
  • aliphatic uncharged refers to any amino acid residue selected from the group consisting of: A, G, I, L, and V.
  • amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, G, I, L, and V
  • amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, G, I, and V.
  • amino acid residues refers to any amino acid residue selected from the group consisting of: F, T, and W.
  • amino acids in at least one of said first and second heavy chains are each selected from the group consisting of; F, T, and W.
  • amino acid residues refers to any amino acid residue chosen from the group consisting of: D and E.
  • amino acids in at least one of said first and second heavy chains are each selected from the group consisting of; D and E.
  • the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, E, F, G, I, L, T, V, and W, and the amino acids in the positions corresponding to L234 and L235 are each selected from the group consisting of; A, D, E, F, G, I, T, V, and W.
  • the amino acids in the positions corresponding to positions L234, L235 and D265 in a human IgGl heavy chain are not L, L, and D, respectively.
  • the amino acids in the positions corresponding to L234, L235, and D265 in a human IgGl heavy chain are not L, L, and D, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgG l heavy chain, are N and P, respectively.
  • the amino acids in the positions corresponding to L234, L235, and D265 in a human IgGl heavy chain are aliphatic uncharged, aromatic or acidic amino acids.
  • the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, G, I, L, and V, and the amino acids in the positions corresponding to positions L234 and L235 in a human IgGl heavy chain are each selected from the group consisting of; A, G, I, and V.
  • amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are each selected from the group consisting of; D and E.
  • the amino acid in the position corresponding to position D265 in a human IgGl heavy chain is selected from the group consisting of; A, E, F, G, I, L, T, V, and W, and the amino acids in the positions corresponding to L234 and L235 are each selected from the group consisting of; A, D, E, F, G, I, T, V, and W.
  • the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are F, E, and A; or A, A, and A, respectively.
  • the amino acids in the positions corresponding to L234, L235, and D265 in a human IgGl heavy chain are F, E, and A; or A, A, and A, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
  • the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are F, E, and A; or A, A, and A, respectively.
  • the amino acids in the positions corresponding to L234, L235, and D265 in a human IgGl heavy chain are F, E, and A; or A, A, and A, respectively, and the amino acids in the positions corresponding to positions N297 and P331 in a human IgGl heavy chain, are N and P, respectively.
  • the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are F, E, and A, respectively.
  • amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are F, E, and A, respectively.
  • the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are A, A, and A, respectively.
  • amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain are A, A, and A, respectively.
  • the amino acids in the positions corresponding to positions L234, L235, D265, N297, and P331 in a human IgGl heavy chain are F, E, A, Q, and S, respectively.
  • amino acids in the positions corresponding to positions L234, L235, D265, N297, and P331 in a human IgGl heavy chain are F, E, A, Q, and S, respectively.
  • the antibody according to the invention comprises a VH sequence as set out in SEQ ID NO: 8, a VL sequence as set out in SEQ ID NO: 10, and in at least one of the heavy chains the amino acids in positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
  • the antibody according to the invention comprises a VH sequence as set out in SEQ ID NO : 8, a VL sequence as set out in SEQ ID NO: 12, and in at least one of the heavy chains the amino acids in positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
  • the antibody according to the invention comprises a VH sequence as set out in SEQ ID NO : 6, a VL sequence as set out in SEQ ID NO: 10, and in at least one of the heavy chains the amino acids in positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
  • the antibody according to the invention comprises a VH sequence as set out in SEQ ID NO :6, a VL sequence as set out in SEQ ID NO: 12, and in at least one of the heavy chains the amino acids in positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
  • the antibody according to the invention comprises a VH sequence as set out in SEQ ID NO :9, a VL sequence as set out in SEQ ID NO: 10, and in at least one of the heavy chains the amino acids in positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
  • the antibody according to the invention comprises a VH sequence as set out in SEQ ID NO :9, a VL sequence as set out in SEQ ID NO: 12, and in at least one of the heavy chains the amino acids in positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
  • the present invention relates to a multispecific antibody comprising at least a first binding region of an antibody according to a ny aspect or embodiment herein described, and one or more binding regions which binds one or more different targets than the first binding region.
  • a multispecific antibody may be a bispecific antibody.
  • the present invention relates to a bispecific antibody comprising a first binding region of an antibody according to any aspect or embodiment herein described, and a second binding region which binds a different target than the first binding region.
  • multispecific antibody refers to an antibody having specificities for at least two different, such as at least three, typically non-overlapping, epitopes. Such epitopes may be on the same or different targets. If the epitopes are on different targets, such targets may be on the same cell or different cells or cell types.
  • bispecific antibody refers to an antibody having specificities for at least two different, typically non-overlapping, epitopes. Such epitopes may be on the same or different targets. If the epitopes are on different targets, such targets may be on the same cell or different cells or cell types.
  • the bispecific antibody comprises a first and a second heavy chain.
  • the embodiments relating to modification of the Fc region and embodiments relating to specific amino acid substitutions are contemplated to be part of any bispecific antibody according to the invention.
  • at least one of the first and second heavy chains comprise one or more amino acids modified as defined in any embodiment herein described, such as those described to in relation to providing an inert Fc region.
  • both said first and second heavy chains comprise one or more amino acids modified as defined in any embodiment herein described, such as those described to in relation to providing an inert Fc region .
  • the bispecific antibody comprises an Fc region modified according to any aspect or embodiment herein described; or at least one of said first and second heavy chains comprise one or more amino acids modified as defined in any aspect or embodiment herein described.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 8 and a VL sequence as set out in SEQ ID NO : 10; and wherein the Fc region has been modified so that binding of Clq to said antibody is reduced compared to a wild-type antibody by at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, or 100%, wherein Clq binding is determined by ELISA.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 8 and a VL sequence as set out in SEQ ID NO: 12; and wherein the Fc region has been modified so that binding of Clq to said antibody is reduced compared to a wild-type antibody by at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, or 100%, wherein Clq binding is determined by ELISA.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 6 and a VL sequence as set out in SEQ ID NO : 10; and wherein the Fc region has been modified so that binding of Clq to said antibody is reduced compared to a wild-type antibody by at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, or 100%, wherein Clq binding is determined by ELISA.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 6 and a VL sequence as set out in SEQ ID NO : 12; and wherein the Fc region has been modified so that binding of Clq to said antibody is reduced compared to a wild-type antibody by at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, or 100%, wherein Clq binding is determined by ELISA.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO :9 and a VL sequence as set out in SEQ ID NO : 10; and wherein the Fc region has been modified so that binding of Clq to said antibody is reduced compared to a wild-type antibody by at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, or 100%, wherein Clq binding is determined by ELISA.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO :9 and a VL sequence as set out in SEQ ID NO : 12; and wherein the Fc region has been modified so that binding of Clq to said antibody is reduced compared to a wild-type antibody by at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, or 100%, wherein Clq binding is determined by ELISA.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO: 8 and a VL sequence as set out in SEQ ID NO : 10; and wherein the Fc region has been modified so that said antibody mediates reduced Fc-mediated T-cell proliferation compared to a wild-type antibody by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100%, wherein said T-cell proliferation is measured in a peripheral blood mononuclear cell (PBMC)-based functional assay.
  • PBMC peripheral blood mononuclear cell
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 8 and a VL sequence as set out in SEQ ID NO : 12; and wherein the Fc region has been modified so that said antibody mediates reduced Fc-mediated T-cell proliferation compared to a wild-type antibody by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100%, wherein said T-cell proliferation is measured in a peripheral blood mononuclear cell (PBMC)-based functional assay.
  • PBMC peripheral blood mononuclear cell
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 6 and a VL sequence as set out in SEQ ID NO : 10; and wherein the Fc region has been modified so that said antibody mediates reduced Fc-mediated T-cell proliferation compared to a wild-type antibody by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100%, wherein said T-cell proliferation is measured in a peripheral blood mononuclear cell (PBMC)-based functional assay.
  • PBMC peripheral blood mononuclear cell
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 6 and a VL sequence as set out in SEQ ID NO : 12; and wherein the Fc region has been modified so that said antibody mediates reduced Fc-mediated T-cell proliferation compared to a wild-type antibody by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100%, wherein said T-cell proliferation is measured in a peripheral blood mononuclear cell (PBMC)-based functional assay.
  • PBMC peripheral blood mononuclear cell
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO :9 and a VL sequence as set out in SEQ ID NO : 10; and wherein the Fc region has been modified so that said antibody mediates reduced Fc-mediated T-cell proliferation compared to a wild-type antibody by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100%, wherein said T-cell proliferation is measured in a peripheral blood mononuclear cell (PBMC)-based functional assay.
  • PBMC peripheral blood mononuclear cell
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO :9 and a VL sequence as set out in SEQ ID NO : 12; and wherein the Fc region has been modified so that said antibody mediates reduced Fc-mediated T-cell proliferation compared to a wild-type antibody by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100%, wherein said T-cell proliferation is measured in a peripheral blood mononuclear cell (PBMC)-based functional assay.
  • PBMC peripheral blood mononuclear cell
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO: 8 and a VL sequence as set out in SEQ ID NO : 10; and wherein the Fc region has been modified so that said antibody reduces Fc-mediated CD69 expression by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100% when compared to a wild-type antibody wherein said Fc-mediated CD69 expression is determined in a PBMC-based functional assay.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 8 and a VL sequence as set out in SEQ ID NO: 12; and wherein the Fc region has been modified so that said antibody reduces Fc- mediated CD69 expression by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100% when compared to a wild-type antibody wherein said Fc- mediated CD69 expression is determined in a PBMC-based functional assay.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 6 and a VL sequence as set out in SEQ ID NO: 10; and wherein the Fc region has been modified so that said antibody reduces Fc- mediated CD69 expression by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100% when compared to a wild-type antibody wherein said Fc- mediated CD69 expression is determined in a PBMC-based functional assay.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 6 and a VL sequence as set out in SEQ ID NO: 12; and wherein the Fc region has been modified so that said antibody reduces Fc- mediated CD69 expression by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100% when compared to a wild-type antibody wherein said Fc- mediated CD69 expression is determined in a PBMC-based functional assay.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO :9 and a VL sequence as set out in SEQ ID NO: 10; and wherein the Fc region has been modified so that said antibody reduces Fc- mediated CD69 expression by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100% when compared to a wild -type antibody wherein said Fc- mediated CD69 expression is determined in a PBMC-based functional assay.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 9 and a VL sequence as set out in SEQ ID NO : 12 ; and wherein the Fc region has been modified so that said antibody reduces Fc- mediated CD69 expression by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 99% or 100% when compared to a wild -type antibody wherein said Fc- mediated CD69 expression is determined in a PBMC-based functional assay.
  • the bispecific anti body comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 8 and a VL sequence as set out in SEQ ID NO : 10; and wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgG l heavy chain, are F, E, and A, respectively.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 8 and a VL sequence as set out in SEQ ID NO : 12; and wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgG l heavy chain, are F, E, and A, respectively.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 6 and a VL sequence as set out in SEQ ID NO : 10; and wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgG l heavy chain, are F, E, and A, respectively.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 6 and a VL sequence as set out in SEQ ID NO : 12; and wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgG l heavy chain, are F, E, and A, respectively.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 9 and a VL sequence as set out in SEQ ID NO : 10; and wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgG l heavy chain, are F, E, and A, respectively.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 9 and a VL sequence as set out in SEQ ID NO : 12; and wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
  • the bispecific antibody of the present invention is a diabody, a cross-body, or a bispecific antibody obtained via a controlled Fab arm exchange, e.g. DuoBody® (such as described in [41]) as those described in the present invention.
  • a controlled Fab arm exchange e.g. DuoBody® (such as described in [41]) as those described in the present invention.
  • bispecific antibodies include but are not limited to (i) IgG-like molecules with complementary CH3 domains to force heterodimerization; (ii) recombinant IgG-like dual targeting molecules, wherein the two sides of the molecule each contain the Fab fragment or part of the Fab fragment of at least two different antibodies; (iii) IgG fusion molecules, wherein full length IgG antibodies are fused to extra Fab fragment or parts of Fab fragment; (iv) Fc fusion molecules, wherein single chain Fv molecules or stabilized diabodies are fused to heavy-chain constant- domains, Fc-regions or parts thereof; (v) Fab fusion molecules, wherein different Fab- fragments are fused together, fused to heavy-chain constant-domains, Fc-regions or parts thereof; and (vi) ScFv-and diabody-based and heavy chain antibodies (e.g., domain antibodies, Nanobodies®) wherein different single chain Fv molecules or different diabodies or different heavy-chain
  • IgG-like molecules with complementary CH3 domains molecules include but are not limited to the Triomab® (Trion Pharma/Fresenius Biotech, [42] ), the Knobs-into-Holes (Genentech, [43]), CrossMAbs (Roche, [44]) and the electrostatically- matched (Amgen, [45]-[46] ; Chugai, [47] ; Oncomed, [48]), the LUZ-Y (Genentech), DIG- body and PIG-body (Pharmabcine), the Strand Exchange Engineered Domain body (SEEDbody)(EMD Serono, [49]), the Biclonics (Merus), FcAAdp (Regeneron, [50] ), bispecific IgGl and IgG2 (Pfizer/Rinat, [51]), Azymetric scaffold (Zymeworks/Merck, [52]), mAb-Fv (Xencor, [53]), bivalent bispecific antibodies (
  • IgG-like dual targeting molecules include but are not limited to Dual Targeting (DT)-Ig (GSK/Domantis), Two-in-one Antibody (Genentech), Cross-linked Mabs (Karmanos Cancer Center), mAb2 (F-Star, [54]), Zy bodiesTM (Zyngenia), approaches with common light chain (Crucell/Merus, [55]), KABodies (Novlmmune) and CovX-body® (CovX/Pfizer).
  • DT Dual Targeting
  • GSK/Domantis Two-in-one Antibody
  • Cross-linked Mabs Karmanos Cancer Center
  • mAb2 F-Star, [54]
  • Zy bodiesTM Zyngenia
  • approaches with common light chain Crucell/Merus, [55]
  • KABodies Novlmmune
  • CovX-body® CovX/Pfizer
  • IgG fusion molecules include but are not limited to Dual Variable Domain (DVD)-IgTM (Abbott, [56]), Dual domain double head antibodies (Unilever; Sanofi Aventis, [57]), IgG-like Bispecific (ImClone/Eli Lilly), Ts2Ab (Medlmmune/AZ) and BsAb (Zymogenetics), HERCULES (Biogen personal, [58]), scFv fusion (Novartis), scFv fusion (Changzhou Adam Biotech Inc, [59]) and TvAb (Roche, [59], [60]).
  • DVD Dual Variable Domain
  • D Dual Domain
  • Dual domain double head antibodies Unilever; Sanofi Aventis, [57]
  • IgG-like Bispecific ImClone/Eli Lilly
  • Ts2Ab Medlmmune/AZ
  • BsAb Zymogenetics
  • HERCULES Biogen personal, [58]
  • Fc fusion molecules include but are not limited to ScFv/Fc Fusions (Academic Institution), SCORPION (Emergent BioSolutions/Trubion, Zymogenetics/BMS), Dual Affinity Retargeting Technology (Fc-DARTTM) (MacroGenics, [62], [63]) and Dual(ScFv)2-Fab (National Research Center for Antibody Medicine - China).
  • Fab fusion bispecific antibodies include but are not limited to F(ab)2 (Medarex/AMGEN), Dual-Action or Bis-Fab (Genentech), Dock-and-Lock® (DNL) (ImmunoMedics), Bivalent Bispecific (Biotecnol) and Fab-Fv (UCB-Celltech).
  • ScFv-, diabody-based and domain antibodies include but are not limited to Bispecific T Cell Engager (BiTE®) (Micromet, Tandem Diabody (Tandab) (Affimed), Dual Affinity Retargeting Technology (DARTTM) (MacroGenics), Single-chain Diabody (Academic), TCR-like Antibodies (AIT, ReceptorLogics), Human Serum Albumin ScFv Fusion (Merrimack) and COMBODY (Epigen Biotech), dual targeting na nobodies® (Ablynx), dual targeting heavy chain only domain antibodies.
  • any monospecific antibody fulfilling the assay conditions herein described may form the basis of a bispecific antibody.
  • a bispecific antibody wherein one of the binding regions binds CD3 may originate from any monospecific CD3 antibody tested in the functional assays and fulfilling the requirements stated herein.
  • Such a bispecific antibody may be provided by the methods described in [41], which is hereby incorporated by reference.
  • each of said first and second heavy chain comprises at least a hinge region, a CH2 and CH3 region, wherein in said first heavy chain at least one of the amino acids in the positions corresponding to a position selected from the group consisting of T366, L368, K370, D399, F405, Y407, and K409 in a human IgGl heavy chain has been substituted, and in said second heavy chain at least one of the amino acids in the positions corresponding to a position selected from the group consisting of T366, L368, K370, D399, F405, Y407, and K409 in a human IgGl heavy chain has been substituted, and wherein said first and said second heavy chains are not substituted in the same positions.
  • substituted refers to that the amino acid in a specific amino acid position has been substituted with another naturally or non-naturally occurring amino acid.
  • a "substituted" amino acid in a position corresponding to the position in a human IgG l heavy chain means the amino acid at the particular position is different from the naturally occurring amino acid in an IgGl heavy chain.
  • the amino acid in the position corresponding to K409 in a human IgGl heavy chain is not K, L or M, and optionally the amino acid in the position corresponding to F405 in a human IgGl heavy chain is F, and in said second heavy chain at least one of the amino acids in the positions corresponding to a position selected from the group consisting of; T366, L368, K370, D399, F405, and Y407 in a human IgGl heavy chain has been substituted.
  • the amino acid in the position corresponding to K409 in a human IgGl heavy chain is not K, L or M
  • the amino acid in the position corresponding to F405 in a human IgG l heavy chain is not F and optionally the amino acid in the position corresponding to K409 in a human IgGl heavy chain is K.
  • the amino acid in the position corresponding to F405 in a human IgGl heavy chain is not F, R, and G
  • the amino acids in said positions corresponding to a position selected form the group consisting of; T366, L368, K370, D399, Y407, and K409 in a human IgGl heavy chain has been substituted.
  • the amino acid in position corresponding to K409 in a human IgGl heavy chain is not K, L or M in said first heavy chain, and the amino acid in position corresponding to F405 in a human IgGl heavy chain is not F.
  • the amino acid in the position corresponding to F405 in a human IgGl heavy chain is L in said first heavy chain
  • the amino acid in the position corresponding to K409 in a human IgGl heavy chain is R in said second heavy chain, or vice versa .
  • the amino acid in the position corresponding to K409 in a human IgGl heavy chain is R in the first heavy chain
  • the amino acid in the position corresponding to F405 in a human IgGl heavy chain is L in the second heavy chain.
  • the humanized or chimeric CD3 antibody of the invention contains in at least one of the first and second heavy chain one or more of the inactivating substitutions as disclosed in any one of the above embodiments, such as L234F, L235E, and D265A; and that the amino acid in the position corresponding to F405 is not F.
  • the humanized or chimeric CD3 antibody of the invention contains in at least one of the first and second heavy chain one or more of the inactivating substitutions as disclosed in any one of the above embodiments, such as L234F, L235E, and D265A; and a further substitution in the K409 position, such as K409R.
  • the humanized or chimeric CD3 antibody of the invention contains in both the first and second heavy chain one or more of the inactivating substitutions as disclosed in any one of the above embodiments, such as L234F, L235E, and D265A; and a substitution in the F405 position, such as F405L.
  • the humanized or chimeric CD3 antibody of the invention contains in both the first and second heavy chain one or more of the inactivating substitutions as disclosed in any one of the above embodiments, such as L234F, L235E, and D265A; and a further substitution in the K409 position, such as K409R.
  • Such antibodies are useful for generating a bispecific antibody.
  • the amino acids in the positions corresponding to position L234, L235, and D265 in a human IgGl heavy chain are F, E, and A, respectively, the amino acid in the position corresponding to F405 in a human IgGl heavy chain is L in the first heavy chain, and the amino acid in the position corresponding to K409 in a human IgGl heavy chain is R in the second heavy chain.
  • the amino acids in the positions corresponding to L234, L235, D265, N297, and P331 in a human IgGl heavy chain are F, E, A, N, and P respectively, the amino acid in the position corresponding to F405 in a human IgGl heavy chain is L in the first heavy chain, and the amino acid in the position corresponding to K409 in a human IgGl heavy chain is R in the second heavy chain.
  • the amino acids in the positions corresponding to position L234, L235, and D265 in a human IgGl heavy chain are F, E, and A, respectively, the amino acid in the position corresponding to K409 in a human IgGl heavy chain is R in the first heavy chain, and the amino acid in the position corresponding to F405 in a human IgGl heavy chain is L in the second heavy chain.
  • the amino acids in the positions corresponding to L234, L235, D265, N297, and P331 in a human IgGl heavy chain are F, E, A, N, and P respectively, the amino acid in the position corresponding to K409 in a human IgGl heavy chain is R in the first heavy chain, and the amino acid in the position corresponding to F405 in a human IgGl heavy chain is L in the second heavy chain.
  • the amino acids in the positions corresponding to position L234, L235, and D265 in a human IgGl heavy chain are F, E, and A, respectively, the amino acid in the position corresponding to F405 in a human IgGl heavy chain is L in the first heavy chain, and the amino acid in the position corresponding to K409 in a human IgGl heavy chain is R in the second heavy chain.
  • the amino acids in the positions corresponding to L234, L235, D265, N297, and P331 in a human IgG l heavy chain are F, E, A, N, and P respectively, the amino acid in the position corresponding to F405 in a human IgGl heavy chain is L in the first heavy chain, and the amino acid in the position corresponding to K409 in a human IgGl heavy chain is R in the second heavy chain.
  • the amino acids in the positions corresponding to position L234, L235, and D265 in a human IgGl heavy chain are F, E, and A, respectively, the amino acid in the position corresponding to K409 in a human IgGl heavy chain is R in the first heavy chain, and the amino acid in the position corresponding to F405 in a human IgGl heavy chain is L in the second heavy chain.
  • the amino acids in the positions corresponding to L234, L235, D265, N297, and P331 in a human IgGl heavy chain are F, E, A, N, and P respectively
  • the amino acid in the position corresponding to K409 in a human IgGl heavy chain is R in the first heavy chain
  • the amino acid in the position corresponding to F405 in a human IgGl heavy chain is L in the second heavy chain.
  • T-cell recruitment to specific target cells provides a way of killing the target cells.
  • target cells such as cancer or tumor cells
  • the present inventors have shown that a bispecific CD3xHER2 antibody comprising the specific amino acid substitutions L234F, L235E, and D265A in both of the heavy chains, was able to induce killing of AU565 cells as described in Example 5.
  • T-cell mediated killing may be obtained by a bispecific antibody targeting CD3 with the first binding region and another target with the second binding region.
  • the first binding region is according to any embodiments described herein for the humanized or chimeric CD3 antibody, and the second binding region binds a different target than the first binding region.
  • the antibody when the antibody is a bispecific antibody, at least one half of the antibody, i.e. one of the pair of heavy and light chains of the antibody, is a humanized or chimeric antibody as herein described.
  • one half of the bispecific antibody is a humanized or chimeric antibody binding CD3 according to the present invention and the other half may be humanized, chimeric, fully non-human or fully human binding a second target.
  • the antibody comprises a first and a second heavy chain, a first and second light chain, wherein said first heavy and said first light chains are humanized or chimeric and are connected via disulfide bridges forming a first binding region; and said second heavy and light chains are fully human and are connected via disulfide bridges forming a second binding region, wherein said first binding region is according to any aspect or embodiment herein described, and said second binding region binds a different target.
  • the antibody comprises a first and a second heavy chain, a first and second light chain, wherein said first heavy and said first light chains are humanized or chimeric and are connected via disulfide bridges forming a first binding region; and said second heavy and light chains are humanized or chimeric and are connected via disulfide bridges forming a second binding region, wherein said first binding region is according to any aspect or embodiment herein described, and said second binding region binds a different epitope of CD3 than said first binding region.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 8, and a VL sequence as set out in SEQ ID NO : 10; a second binding region comprising a VH sequence as set out in SEQ ID NO: 19, and a VL sequence as set out in SEQ ID NO: 20; wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 8, and a VL sequence as set out in SEQ ID NO : 10; a second binding region comprising a VH sequence as set out in SEQ ID NO :29, and a VL sequence as set out in SEQ ID NO: 30; wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 8, and a VL sequence as set out in SEQ ID NO : 10; a second binding region comprising a VH sequence as set out in SEQ ID NO: 19, and a VL sequence as set out in SEQ ID NO: 20; wherein in both the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 8, and a VL sequence as set out in SEQ ID NO : 10; a second binding region comprising a VH sequence as set out in SEQ ID NO: 29, and a VL sequence as set out in SEQ ID NO : 30; wherein in both the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 8, and a VL sequence as set out in SEQ ID NO : 12; a second binding region comprising a VH sequence as set out in SEQ ID NO: 19, and a VL sequence as set out in SEQ ID NO: 20; wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 8, and a VL sequence as set out in SEQ ID NO : 12; a second binding region comprising a VH sequence as set out in SEQ ID NO: 29, and a VL sequence as set out in SEQ ID NO: 30; wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 8, and a VL sequence as set out in SEQ ID NO : 12; a second binding region comprising a VH sequence as set out in SEQ ID NO: 19, and a VL sequence as set out in SEQ ID NO : 20; wherein in both the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 8, and a VL sequence as set out in SEQ ID NO : 12; a second binding region comprising a VH sequence as set out in SEQ ID NO: 29, and a VL sequence as set out in SEQ ID NO: 30; wherein i n both the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 6, and a VL sequence as set out in SEQ ID NO : 10; a second binding region comprising a VH sequence as set out in SEQ ID NO: 19, and a VL sequence as set out in SEQ ID NO: 20; wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 6, and a VL sequence as set out in SEQ ID NO : 10; a second binding region comprising a VH sequence as set out in SEQ ID NO: 29, and a VL sequence as set out in SEQ ID NO: 30; wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position correspond ing to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 6, and a VL sequence as set out in SEQ ID NO : 10; a second binding region comprising a VH sequence as set out in SEQ ID NO: 19, and a VL sequence as set out in SEQ ID NO: 20; wherein in both the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO: 6, and a VL sequence as set out in SEQ ID NO : 10; a second binding region comprising a VH sequence as set out in SEQ ID NO: 29, and a VL sequence as set out in SEQ ID NO : 30; wherein in both the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO :6, and a VL sequence as set out in SEQ ID NO : 12; a second binding region comprising a VH sequence as set out in SEQ ID NO: 19, and a VL sequence as set out in SEQ ID NO: 20; wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 6, and a VL sequence as set out in SEQ ID NO : 12; a second binding region comprising a VH sequence as set out in SEQ ID NO: 29, and a VL sequence as set out in SEQ ID NO: 30; wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO : 6, and a VL sequence as set out in SEQ ID NO : 12; a second binding region comprising a VH sequence as set out in SEQ ID NO: 19, and a VL sequence as set out in SEQ ID NO : 20; wherein in both the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO: 6, and a VL sequence as set out in SEQ ID NO : 12; a second binding region comprising a VH sequence as set out in SEQ ID NO: 29, and a VL sequence as set out in SEQ ID NO : 30; wherein in both the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO :9, and a VL sequence as set out in SEQ ID NO : 10; a second binding region comprising a VH sequence as set out in SEQ ID NO: 19, and a VL sequence as set out in SEQ ID NO: 20; wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO :9, and a VL sequence as set out in SEQ ID NO : 10; a second binding region comprising a VH sequence as set out in SEQ ID NO: 29, and a VL sequence as set out in SEQ ID NO: 30; wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO :9, and a VL sequence as set out in SEQ ID NO : 10; a second binding region comprising a VH sequence as set out in SEQ ID NO: 19, and a VL sequence as set out in SEQ ID NO : 20; wherein in both the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the a mino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO :9, and a VL sequence as set out in SEQ ID NO : 10; a second binding region comprising a VH sequence as set out in SEQ ID NO: 29, and a VL sequence as set out in SEQ ID NO : 30; wherein in both the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO :9, and a VL sequence as set out in SEQ ID NO : 12; a second binding region comprising a VH sequence as set out in SEQ ID NO: 19, and a VL sequence as set out in SEQ ID NO: 20; wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO :9, and a VL sequence as set out in SEQ ID NO : 12; a second binding region comprising a VH sequence as set out in SEQ ID NO: 29, and a VL sequence as set out in SEQ ID NO: 30; wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO :9, and a VL sequence as set out in SEQ ID NO : 12 ; a second binding region comprising a VH sequence as set out in SEQ ID NO: 19, and a VL sequence as set out in SEQ ID NO : 20; wherein in both the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • the bispecific antibody comprises a first binding region comprising a VH sequence as set out in SEQ ID NO :9, and a VL sequence as set out in SEQ ID NO : 12; a second binding region comprising a VH sequence as set out in SEQ ID NO: 29, and a VL sequence as set out in SEQ ID NO : 30; wherein in both the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively; and wherein in the first heavy chain the amino acid in the position corresponding to position F405 in a human IgGl heavy chain, is L, and in the second heavy chain the amino acid in the position corresponding to position K409 in a human IgGl heavy chain, is R.
  • diisulfide bridges refers to the covalent bond between two Cysteine residues, i.e. said interaction may also be designated a Cys-Cys interaction.
  • target refers to a molecule to which the binding region of the antibody according to the invention binds.
  • the term includes any antigen towards which the raised antibody is directed.
  • the first heavy and the first light chains are humanized or chimeric and are connected via disulfide bridges forming a first binding region; and the second heavy and light chains are fully human and are connected via disulfide bridges forming a second binding region, wherein the first binding region is according to any aspect or embodiment herein described, and the second binding region binds a different target; and wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
  • the first heavy and the first light chains are humanized or chimeric and are connected via disulfide bridges forming a first binding region; and the second heavy and light chains are fully human and are connected via disulfide bridges forming a second binding region, wherein the first binding region is according to any aspect or embodiment herein described, and the second binding region binds a different epitope of CD3 than the first binding region; and wherein in at least one of the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
  • the first heavy and the first light chains are humanized or chimeric and are connected via disulfide bridges forming a first binding region; and the second heavy and light chains are fully human and are connected via disulfide bridges forming a second binding region, wherein the first binding region is according to any aspect or embodiment herein described, and the second binding region binds a different target; and wherein in both the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
  • the first heavy and the first light chains are humanized or chimeric and are connected via disulfide bridges forming a first binding region; and the second heavy and light chains are fully human and are connected via disulfide bridges forming a second binding region, wherein the first binding region is according to any aspect or embodiment herein described, and the second binding region binds a different epitope of CD3 than the first binding region; and wherein in both the first and second heavy chains the amino acids in the positions corresponding to positions L234, L235, and D265 in a human IgGl heavy chain, are F, E, and A, respectively.
  • the present invention relates to a nucleic acid construct encoding one or more sequences set out in Table 1.
  • the present invention relates to a nucleic acid construct encoding any one of the sequences set out in SEQ ID NOs: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, and 26.
  • the invention relates to nucleic acid construct encoding a sequence of a humanized or chimeric CD3 antibody according to the present invention, to expression vectors comprising a nucleic acid construct according to the present invention, to host cells comprising such expression vectors, and to methods of producing such an antibody by culturing such host cells under appropriate conditions whereby the antibody is produced and, optionally, retrieved .
  • Humanized CD3 antibodies may also be denoted as "huCD3".
  • the invention provides an expression vector comprising (i) a nucleic acid sequence encoding a heavy chain sequence of a humanized or chimeric antibody according to the invention, (ii) a nucleic acid sequence encoding a light chain sequence of a humanized or chimeric antibody according to the invention, or (iii) both (i) and (ii).
  • the expression vector comprises one or more nucleic acid constructs or nucleic acid sequences according to any aspect or embodiment herein described.
  • the expression vector of the invention comprises a nucleic acid sequence encoding one or more of the heavy chain and light chain CDR sequences selected from the g roup consisting of: SEQ ID NOs. : 1, 2, 3, 4, and 5; and the sequence GTN.
  • the invention provides an expression vector comprising a nucleic acid sequence encoding one or more amino acid sequences selected from the group consisting of SEQ ID NOs: 6, 7, 8, 9, 10, 11, 12, 19, 20, 27, 28, 29, and 30, or any combination thereof.
  • the expression vector comprises a nucleic acid sequence encoding the VH CDR3 amino acid sequence as set forth in SEQ ID NO: 3.
  • the expression vector comprises a nucleic acid sequence encoding a VH amino acid sequence selected from SEQ ID NOs: 6, 7, 8, 9, 19, 27, and 29.
  • the expression vector comprises a nucleic acid sequence encoding a VL amino acid sequence selected from SEQ ID NOs: 10, 11, 12, 20, 28, and 30.
  • the expression vector comprises a nucleic acid sequence encoding the constant region of a human antibody light chain, of a human antibody heavy chain, or both.
  • the invention provides an expression vector comprising a nucleic acid sequence encoding the amino acid sequence according to SEQ ID NOs: 15, 16, 23, 24, 25, and 26.
  • the expression vector comprises a nucleic acid sequence encoding a variant of one or more of the above amino acid sequences, said variant having at most 25 amino acid modifications, such as at most 20, such as at most 15, 14, 13, 12, or 11 amino acid modifications, such as 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid modifications, such as deletions or insertions, preferably substitutions, such as conservative or non-conservative substitutions, or at least 80% identity to any of said sequences, such as at least 85% identity or 90% identity or 95% identity, such as 96% identity or 97% identity or 98% identity or 99% identity to any of the afore-mentioned amino acid sequences.
  • the present invention also relates to nucleic acid sequences different from the above mentioned nucleic acid sequences but which due to the variance of the genetic code encode the same amino acid sequence as an antibody of the present invention.
  • the nucleic acid sequence may vary but result in an identical amino acid sequences as any amino acid sequence herein described. It is well-known for the skilled person how to identify such further nucleic acid sequences based on the genetic code.
  • the expression vector further comprises a nucleic acid sequence encoding the constant region of a light chain, a heavy chain or both light and heavy chains of an antibody, e.g. a human antibody.
  • Such expression vectors as described above may be used for recombinant production of antibodies of the invention.
  • An expression vector in the context of the present invention may be any suitable vector, including chromosomal, non-chromosomal, and synthetic nucleic acid vectors (a nucleic acid sequence comprising a suitable set of expression control elements).
  • suitable vectors include derivatives of SV40, bacterial plasmids, phage DNA, baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, and viral nucleic acid (RNA or DNA) vectors.
  • a humanized or chimeric CD3 antibody-encoding nucleic acid is comprised in a naked DNA or RNA vector, including, for example, a linear expression element (as described in for instance [64]), a compacted nucleic acid vector (as described in for instance [65] and/or [66]), a plasmid vector such as pBR322, pUC 19/18, or pUC 118/119, a "midge" minimally-sized nucleic acid vector (as described in for instance [67] ), or as a precipitated nucleic acid vector construct, such as a CaP0 4 -precipitated construct (as described in for instance [68], [69], [70], and [71]).
  • a linear expression element as described in for instance [64]
  • a compacted nucleic acid vector as described in for instance [65] and/or [66]
  • a plasmid vector such as pBR322, pUC 19/18, or pUC 118/
  • the vector is suitable for expression of the humanized or chimeric CD3 antibody in a bacterial cell.
  • examples of such vectors include expression vectors such as BlueScript (Stratagene), pIN vectors ( [74]), pET vectors (Novagen, Madison WI) and the like.
  • An expression vector may also or alternatively be a vector suitable for expression in a yeast system. Any vector suitable for expression in a yeast system may be employed. Suitable vectors include, for example, vectors comprising constitutive or inducible promoters such as alpha factor, alcohol oxidase and PGH (reviewed in : [75] and [76]).
  • a nucleic acid construct and/or vector may also comprise a nucleic acid sequence encoding a secretion/localization sequence, which can target a polypeptide, such as a nascent polypeptide chain, to the periplasmic space or into cell culture media.
  • a secretion/localization sequence which can target a polypeptide, such as a nascent polypeptide chain, to the periplasmic space or into cell culture media.
  • Such sequences are known in the art, and include secretion leader or signal peptides, organelle- targeting sequences (e. g., nuclear localization sequences, ER retention signals, mitochondrial transit sequences, chloroplast transit sequences), membrane localization/anchor sequences (e. g . , stop transfer sequences, GPI anchor sequences), and the like which are well-known in the art.
  • humanized or chimeric CD3 antibody-encoding nucleic acids may comprise or be associated with any suitable promoter, enhancer, and other expression-facilitating elements.
  • suitable promoter, enhancer, and other expression-facilitating elements include strong expression promoters (e. g . , human CMV IE promoter/enhancer as well as RSV, SV40, SL3-3, MMTV, and HIV LTR promoters), effective poly (A) termination sequences, an origin of replication for plasmid product in E. coli, an antibiotic resistance gene as selectable marker, and/or a convenient cloning site (e.g. , a polylinker) .
  • Nucleic acid constructs and/or vectors may also comprise an inducible promoter as opposed to a constitutive promoter such as CMV IE (the skilled person will recognize that such terms are actually descriptors of a degree of gene expression under certain conditions) .
  • the humanized or chimeric CD3 antibody-encoding expression vector is positioned in and/or delivered to the host cell or host animal via a viral vector.
  • Such expression vectors may be used for recombinant production of humanized or chimeric CD3 antibodies.
  • the invention provides a host cell comprising an expression vector according to the invention .
  • the humanized or chi meric CD3 antibodies of any aspect or embodiment described herein are provided by use of recombinant eukaryotic, recombina nt prokaryotic, or recombinant microbial host cell which produces the antibody. Accordingly, the invention provides a recombinant eukaryotic, recombinant prokaryotic, or recombinant microbial host cell, which produces a humanized or chimeric CD3 antibody or immunoglobulin as defined herein .
  • host cells include yeast, bacterial and mammalian cells, such as CHO or H EK-293 cells.
  • the host cell comprises a nucleic acid sequence sta bly integrated into the cellular genome that comprises a sequence coding for expression of a humanized or chimeric CD3 antibody described herein.
  • the host cell comprises a non -integrated nucleic acid sequence, such as a plasmid, cosmid, phagemid, or linear expression element, which comprises a sequence coding for expression of a humanized or chimeric CD3 antibody described herein .
  • recombinant host cell (or simply “host cell”), as used herein, is intended to refer to a cell into which an expression vector or nucleic acid construct or sequence has been introduced . It should be understood that such terms are intended to refer not only to the particular subject cell, but also to the progeny of such a cell . Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term “host cell” as used herein.
  • Recombinant host cells include, for example, eukaryotic host cells, such as CHO cells, HEK-293 cells, PER.C6, NSO cells, and lymphocytic cells, and proka ryotic cells such as E. coli and other eukaryotic hosts such as plant cells and fungi .
  • eukaryotic host cells such as CHO cells, HEK-293 cells, PER.C6, NSO cells, and lymphocytic cells
  • proka ryotic cells such as E. coli and other eukaryotic hosts such as plant cells and fungi .
  • the invention relates to a method for producing a humanized or chimeric CD3 antibody of the invention, said method comprising the steps of a) culturing a host cell of the invention as described herein above, and b) retrieving and/or purifying the antibody of the invention from the culture media .
  • the nucleotide sequence encoding a sequence of a humanized or chimeric CD3 antibody further encodes a second moiety, such as a therapeutic polypeptide.
  • a therapeutic polypeptide such as a therapeutic polypeptide.
  • Exemplary therapeutic polypeptides are described elsewhere herein.
  • the invention relates to a method for producing a humanized or chimeric CD3 antibody fusion protein, said method comprising the steps of
  • the invention provides a composition comprising the antibody or bispecific antibody according to any aspect and embodiment herein described .
  • the invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising the antibody or bispecific antibody as defined in any one of the aspects and embodiments herein described, and a pharmaceutically acceptable ca rrier.
  • compositions may be formulated with pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients in accordance with conventional techniques such as those disclosed in [77] .
  • the pharmaceutically acceptable carriers or d iluents as well as any other known adjuvants and excipients should be suitable for the humanized or chimeric antibody of the present invention and the chosen mode of administration. Suitability for carriers and other components of pharmaceutical compositions is determined based on the lack of significant negative impact on the desired biological properties of the chosen compound or pharmaceutical composition of the present invention (e.g. , less than a substantial impact ( 10% or less relative inhibition, 5% or less relative inhibition, etc. )) on antigen binding .
  • a pharmaceutical composition of the present invention may also include diluents, fillers, salts, buffers, detergents (e.
  • a nonionic detergent such as Tween-20 or Tween-80
  • stabilizers e.g., sugars or protein-free amino acids
  • preservatives tissue fixatives
  • solubilizers and/or other materials suitable for inclusion in a pharmaceutical composition.
  • the actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be va ried so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
  • the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • the pharmaceutical composition may be administered by any suitable route and mode. Suitable routes of administering a humanized or chimeric antibody of the present invention in vivo and in vitro are well known in the art and may be selected by those of ordinary skill in the art.
  • a pharmaceutical composition of the present invention is administered parenterally.
  • parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and include epidermal, intravenous, intramuscular, intra -arterial, intrathecal, intracapsular, intra-orbital, intracardiac, intradermal, intraperitoneal, intratendinous, transtracheal, subcutaneous, subcuticular, intra-articular, subcapsular, subarachnoid, intraspinal, intracranial, intrathoracic, epidural and intrasternal injection and infusion.
  • composition is administered by intravenous or subcutaneous injection or infusion.
  • Pharmaceutically acceptable carriers include any and all suitable solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonicity agents, antioxidants and absorption-delaying agents, and the like that are physiologically compatible with a humanized or chimeric antibody of the present invention.
  • aqueous and nonaqueous carriers examples include water, saline, phosphate buffered saline, ethanol, dextrose, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, corn oil, peanut oil, cottonseed oil, and sesame oil, carboxymethyl cellulose colloidal solutions, tragacanth gum and injectable organic esters, such as ethyl oleate, and/or various buffers.
  • Other carriers are well known in the pharmaceutical arts.
  • Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • the use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of the present invention is contemplated.
  • active compound it is contemplated to also refer to the humanized or chimeric antibody according to the present invention.
  • Proper fluidity may be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
  • compositions of the present invention may also comprise pharmaceutically acceptable antioxidants for instance (1) water-soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha- tocopherol, and the like; and (3) metal-chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
  • water-soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like
  • oil-soluble antioxidants such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated
  • compositions of the present invention may also comprise isotonicity agents, such as sugars, polyalcohols, such as mannitol, sorbitol, glycerol or sodium chloride in the compositions.
  • isotonicity agents such as sugars, polyalcohols, such as mannitol, sorbitol, glycerol or sodium chloride in the compositions.
  • compositions of the present invention may also contain one or more adjuvants appropriate for the chosen route of administration such as preservatives, wetting agents, emulsifying agents, dispersing agents, preservatives or buffers, which may enhance the shelf life or effectiveness of the pharmaceutical composition.
  • adjuvants appropriate for the chosen route of administration such as preservatives, wetting agents, emulsifying agents, dispersing agents, preservatives or buffers, which may enhance the shelf life or effectiveness of the pharmaceutical composition.
  • the humanized or chimeric antibody of the present invention may be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
  • Such carriers may include gelatin, glyceryl monostearate, glyceryl distearate, biodegradable, biocompatible polymers such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, poly-orthoesters, and polylactic acid alone or with a wax, or other materials well known in the art. Methods for the preparation of such formulations are generally known to those skilled in the art (see e.g., [78]).
  • the humanized or chimeric antibody of the present invention may be formulated to ensure proper distribution in vivo.
  • Pharmaceutically acceptable carriers for parenteral administration include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • the use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of the present invention is contemplated. Other active or therapeutic compounds may also be incorporated into the compositions.
  • compositions for injection must typically be sterile and stable under the conditions of manufacture and storage.
  • the composition may be formulated as a solution, micro-emulsion, liposome, or other ordered structure suitable to high drug concentration.
  • the carrier may be an aqueous or a non-aqueous solvent or dispersion medium containing for instance water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
  • the proper fluidity may be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • a coating such as lecithin
  • surfactants it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as glycerol, mannitol, sorbitol, or sodium chloride in the composition.
  • Prolonged absorption of the injectable compositions may be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
  • Sterile injectable solutions may be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients e.g.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients e.g. from those enumerated above.
  • sterile powders for the preparation of sterile injectable solutions examples of methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • Sterile injectable solutions may be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • examples of methods of preparation are vacuum-drying and freeze- drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the present invention relates to a humanized or chimeric antibody, or pharmaceutical composition of the invention as defined in any aspect or embodiment herein descri bed, for use as a medicament.
  • the present invention relates to a humanized or chimeric antibody, or pharmaceutical composition of the invention as defined in any aspect or embodiment herein described, for use in the treatment of a disease.
  • the humanized or chimeric antibody or pharmaceutical composition of the invention can be used as in the treatment of any cancer wherein the effector mechanisms of cytotoxic T-cells are desired.
  • the humanized or chimeric antibody may be administered to cells in culture, e.g., in vitro or ex vivo, or to human subjects, e.g . in vivo, to treat or prevent disorders such as cancer, inflammatory or autoimmune disorders.
  • the term "subject" is typically a human which respond to the humanized or chimeric antibody, or pharmaceutical composition. Subjects may for instance include human patients having disorders that may be corrected or ameliorated by modulating a target function or by leading to killing of the cell, directly or indirectly.
  • the present invention provides methods for treating or preventing a disorder, such as cancer, wherein recruitment of T-cells would contribute to the treatment or prevention, which method comprises administration of a therapeutically effective amount of a humanized or chimeric antibody, or pharmaceutical composition of the present invention to a subject in need thereof.
  • the method typically involves administering to a subject a humanized or chimeric antibody in an amount effective to treat or prevent the disorder.
  • the present invention relates to a method of treatment of cancer comprising administering the humanized or chimeric antibody or pharmaceutical composition of the invention as defined in any aspect and embodiments herein described, to a subject in need thereof.
  • the present invention relates to the use or the method as defined in any aspect or embodiments herein described wherein the humanized or chimeric antibody is a bispecific antibody specifically binding to both CD3 and a cancer-specific target, or a target that is overexpressed in cancer or associated with cancer, such as HER2, CD19, EpCAM, EGFR, CD66e (or CEA, CEACAM5), CD33, EphA2 or MCSP (or HMW- MAA) and wherein the disease is cancer, such as breast cancer, prostate cancer, non-small cell lung cancer, bladder cancer, ovarian cancer, gastric cancer, colorectal cancer, esophageal cancer and squamous cell carcinoma of the head & neck, cervical cancer, pancreatic cancer, testis cancer, malignant melanoma, a soft-tissue cancer (e.g ., synovial sarcoma), an indolent or aggressive form of B-cell lymphoma, chronic lymphatic leukemia or acute lymphatic leukemia
  • cancer
  • the efficient dosages and dosage regimens for the humanized or chimeric antibody depend on the disease or condition to be treated and may be determined by the persons skilled in the art.
  • a physician having ordinary skill in the art may readily determine and prescribe the effective amount of the pharmaceutical composition required.
  • the physician could start doses of the humanized or chimeric antibody employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
  • a suitable dose of a composition of the present invention will be that amount of the humanized or chimeric antibody which is the lowest dose effective to produce a therapeutic effect according to a particular dosage regimen. Such an effective dose will generally depend upon the factors described above.
  • an "effective amount" for therapeutic use may be measured by its ability to stabilize the progression of disease.
  • the ability of a compound to inhibit cancer may, for example, be evaluated in an animal model system predictive of efficacy in human tumors.
  • this property of a composition may be evaluated by examining the ability of the humanized or chimeric antibody to inhibit cell growth or to induce cytotoxicity by in vitro assays known to the skilled practitioner.
  • a therapeutically effective amount of a therapeutic compound, i.e. a therapeutic humanized or chimeric antibody, or pharmaceutical composition according to the invention may decrease tumor size, or otherwise ameliorate symptoms in a subject.
  • One of ordinary skill in the art would be able to determine such amounts based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected.
  • An exemplary, non-limiting range for a therapeutically effective amount of a humanized or chimeric antibody of the invention is about 0.001-30 mg/kg, such as about 0.001-20 mg/kg, such as about 0.001-10 mg/kg, such as about 0.001-5 mg/kg, for example about 0.001-2 mg/kg, such as about 0.001-1 mg/kg, for instance about 0.001 , about 0.01 , about 0.1 , about 1, about 5, about 8, about 10, about 12, about 15, about 18 mg/kg.
  • Administration may e.g. be intravenous, intramuscular, intraperitoneal, or subcutaneous, and for instance administered proximal to the site of the target.
  • Dosage regimens in the above methods of treatment and uses are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
  • the efficacy of the treatment is monitored during the therapy, e.g. at predefined points in time.
  • an effective daily dose of a pharmaceutical composition may be administered as two, three, four, five, six or more sub-doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms.
  • the humanized or chimeric antibody, or pharmaceutical composition is administered by slow continuous infusion over a long period, such as more than 24 hours, in order to minimize any unwanted side effects.
  • a humanized or chimeric antibody of the present invention While it is possible for a humanized or chimeric antibody of the present invention to be administered alone, it is preferable to administer the humanized or chimeric antibody as a pharmaceutical composition as described above.
  • An effective dose of a humanized or chimeric antibody of the invention may also be administered using a weekly, biweekly or triweekly dosing period.
  • the dosing period may be restricted to, e.g., 8 weeks, 12 weeks or until clinical progression has been established.
  • an effective dose of a humanized or chimeric antibody of the invention may be administered every second, third or fourth week.
  • the humanized or chimeric antibody may be administered by infusion in a weekly dosage of calculated by mg/m 2 .
  • dosages can, for example, be based on the mg/kg dosages provided above according to the following : dose (mg/kg) x 70: 1.8.
  • Such administration may be repeated, e.g. , 1 to 8 times, such as 3 to 5 times.
  • the administration may be performed by continuous infusion over a period of from 2 to 24 hours, such as of from 2 to 12 hours.
  • the humanized or chimeric antibody may be administered by slow continuous infusion over a long period, such as more than 24 hours, in order to reduce toxic side effects.
  • the humanized or chimeric antibody may be administered in a weekly dosage of calculated as a fixed dose for up to 8 times, such as from 4 to 6 times when given once a week. Such regimen may be repeated one or more times as necessary, for example, after 6 months or 12 months.
  • Such fixed dosages can, for example, be based on the mg/kg dosages provided above, with a body weight estimate of 70 kg.
  • the dosage may be determined or adjusted by measuring the amount of humanized or chimeric antibody of the present invention in the blood upon administration by for instance taking out a biological sample and using anti-idiotypic antibodies which target the binding region of the humanized or chimeric antibodies of the present invention.
  • the humanized or chimeric antibody may be administered by maintenance therapy, such as, e.g. , once a week for a period of 6 months or more.
  • a humanized or chimeric antibody may also be administered prophylactically in order to reduce the risk of developing cancer, delay the onset of the occurrence of an event in cancer progression, and/or reduce the risk of recurrence when a cancer is in remission.
  • compositions may be formulated in dosage unit form for ease of administration and uniformity of dosage.
  • Dosage unit form refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • the specification for the dosage unit forms of the present invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
  • a humanized or chimeric antibody may also be administered prophylactically in order to reduce the risk of developing cancer, delay the onset of the occurrence of an event in cancer progression, and/or reduce the risk of recurrence when a cancer is in remission. This may be especially useful in patients wherein it is difficult to locate a tumor that is known to be present due to other biological factors.
  • the humanized or chimeric antibody of the invention may also be used for diagnostic purposes, using a composition comprising a humanized or chimeric antibody as described herein. Accordingly, the invention provides diagnostic methods and compositions using the humanized or chimeric antibodies described herein. Such methods and compositions can be used for purely diagnostic purposes, such as detecting or identifying a disease, as well as for monitoring of the progress of therapeutic treatments, monitoring disease progression, assessing status after treatment, monitoring for recurrence of disease, evaluating risk of developing a disease, and the like.
  • the present invention relates to a method of diagnosing a disease characterized by involvement or accumulation of CD3-expression cells, comprising administering the humanized or chimeric antibody according to the invention, the composition according to the invention, or the pharmaceutically composition according to the invention to a subject, optionally wherein said humanized or chimeric antibody is labeled with a detectable agent.
  • the humanized or chimeric antibody of the present invention is used ex vivo, such as in diagnosing a disease in which cells expressing a specific target of interest and to which the humanized or chimeric antibody binds, are indicative of disease or involved in the pathogenesis, by detecting levels of the target or levels of cells which express the target of interest on their cell surface in a sample taken from a patient. This may be achieved, for example, by contacting the sample to be tested, optionally along with a control sample, with the humanized or chimeric antibody according to the invention under conditions that allow for binding of the antibody to the target. Complex formation can then be detected (e.g., using an ELISA).
  • the level of humanized or chimeric antibody or antibody-target complex is analyzed in both samples and a statistically significant higher level of humanized or chimeric antibody or antibody-target complex in the test sample indicates a higher level of the target in the test sample compared with the control sample.
  • Examples of conventional immunoassays in which humanized or chimeric antibodies of the present invention can be used include, without limitation, ELISA, RIA, FACS assays, plasmon resonance assays, chromatographic assays, tissue immunohistochemistry, Western blot, and/or immunoprecipitation.
  • the present invention relates to a method of diagnosing a disease characterized by involvement or accumulation of CD3-expressing cells, comprising administering an antibody, bispecific antibody, composition or pharmaceutical composition according to any aspect or embodiment herein described, to a subject, optionally wherein the antibody is labeled with a detectable label.
  • the invention relates to a method for detecting the presence of a target, or a cell expressing the target, in a sample comprising :
  • the sample is a biological sample.
  • the sample is a tissue sample known or suspected of containing a specific target and/or cells expressing the target.
  • in situ detection of the target expression may be accomplished by removing a histological specimen from a patient, and providing the humanized or chimeric antibody of the present invention to such a specimen.
  • the humanized or chimeric antibody may be provided by applying or by overlaying the humanized or chimeric antibody to the specimen, which is then detected using suitable means. It is then possible to determine not only the presence of the target or ta rget-expressing cells, but also the d istribution of the target or target - expressing cells in the examined tissue (e.g . , in the context of assessing the spread of cancer cells) .
  • histological methods such as staining procedures
  • the humanized or chimeric antibody can be labeled with a detectable substance to allow bound antibody to be detected .
  • bound (primary) specific humanized or chimeric antibody may be detected by a n antibody which is labeled with a detectable substance and which binds to the primary specific humanized or chimeric antibody.
  • a diagnostic composition comprising an antibody or bispecific antibody according to any aspect or embodiments herein described may be used .
  • the present invention relates to a diagnostic composition comprising an antibody or bispecific antibody according to any aspect or embodiment herein described.
  • the level of target in a sample can also be estimated by a competition immunoassay utilizing target standards labeled with a detectable substance and an unlabeled target-specific humanized or chimeric antibody.
  • a competition immunoassay utilizing target standards labeled with a detectable substance and an unlabeled target-specific humanized or chimeric antibody.
  • the biological sample, the labeled target standard(s) and the ta rget-specific humanized or chimeric antibody are combined, and the amount of labeled target standard bound to the unlabeled target-specific humanized or chimeric antibody is determined .
  • the amount of target in the biological sample is inversely proportional to the amount of labeled target standard bound to the target-specific humanized or chimeric antibody.
  • Suitable labels for the ta rget-specific humanized or chimeric antibody, secondary antibody and/or target standard used in in vitro diagnostic techniques include, without limitation, various enzymes, prosthetic groups, fluorescent materials, luminescent materials, and radioactive materials.
  • suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, and acetylcholinesterase
  • suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin
  • suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhoda mine, dichlorotriazinylamine fluorescein, dansyl chloride and phycoerythrin
  • an example of a luminescent material includes luminol
  • suitable radioactive material include 12S I, 131 I, 3S S, and 3 H .
  • the target-specific humanized or chimeric antibody of the invention is used in the in vivo imaging of target-expressing tissues such as tumors.
  • antibody fragments such as, e.g. , (Fab') 2 f Fab and Fab' fragments, are particularly advantageous because of their rapid distribution kinetics.
  • In vivo imaging can be performed by any suitable technique.
  • a target-specific humanized or chimeric antibody e.g., an antibody or a fragment
  • labeled with 99 Tc, 1 1 I, m In or other gamma-ray emitting isotope may be used to image target-specific antibody accumulation or distribution in target-expressing tissues such as tumors with a gamma scintillation camera (e.g. , an Elscint Apex 409ECT device), typically using low-energy, high resolution collimator or a low-energy all-purpose collimator.
  • a gamma scintillation camera e.g. , an Elscint Apex 409ECT device
  • typically using low-energy, high resolution collimator or a low-energy all-purpose collimator typically using low-energy, high resolution collimator or a low-energy all-purpose collimator.
  • labeling with 89 Zr, 76 Br, 18 F or other positron-emitting radionuclide may be used to image target-specific humanized or chimeric antibody, or antibody fragment distribution in tumors using positron emission tomography (PET) .
  • PET positron emission tomography
  • the images obtained by the use of such techniques may be used to assess biodistribution of target in a patient, mammal, or tissue, for example in the context of using target as a biomarker for the presence of cancer/tumor cells. Variations on this technique may include the use of magnetic resonance imaging (MR! to improve imaging over gamma camera techniques.
  • MR magnetic resonance imaging
  • Conventional immunoscintigraphy methods and principles are described in, e.g., [79], [80], and [81] .
  • such images may also, or alternatively, serve as the basis for surgical techniques to remove tumors.
  • in vivo imaging techniques may allow for the identification and localization of a tumor in a situation where a patient is identified as having a tumor (due to the presence of other biomarkers, metastases, etc.), but the tumor cannot be identified by traditional analytical techniques. All of these methods are features of the present invention.
  • the in vivo imaging and other diagnostic methods provided by the present invention are particularly useful in the detection of micrometastases in a human patient (e.g., a patient not previously diagnosed with cancer or a patient in a period of recovery/ remission from a cancer).
  • the present invention provides an in vivo imaging method wherein a target-specific humanized or chimeric antibody of the present invention is conjugated to a detection-promoting radio-opaque agent, the conjugated humanized or chimeric antibody is administered to a host, such as by injection into the bloodstream, and the presence and location of the labeled humanized or chimeric antibody in the host is assayed.
  • a target-specific humanized or chimeric antibody of the present invention is conjugated to a detection-promoting radio-opaque agent
  • the conjugated humanized or chimeric antibody is administered to a host, such as by injection into the bloodstream, and the presence and location of the labeled humanized or chimeric antibody in the host is assayed.
  • the present invention provides a method for screening for the presence of disease-related cells in a human patient or a biological sample taken from a human patient and/or for assessing the distribution of target-specific humanized or chimeric antibody prior to target-specific ADC therapy.
  • radioisotopes may be bound to a target-specific humanized or chimeric antibody either directly or indirectly by using an intermediary functional group.
  • intermediary functional groups include chelators, such as ethylenediaminetetraacetic acid and diethylenetriaminepentaacetic acid (see for instance [82]).
  • diagnostic methods may be performed using target-specific antibodies that are conjugated to dyes (such as with the biotin-streptavidin complex), contrast agents, fluorescent compounds or molecules and enhancing agents (e.g. paramagnetic ions) for magnetic resonance imaging (MRI) (see, e.g. , [83], which describes MRI techniques and the preparation of antibodies conjugated to a MRI enhancing agent).
  • dyes such as with the biotin-streptavidin complex
  • contrast agents e.g. paramagnetic ions
  • fluorescent compounds or molecules e.g. paramagnetic ions
  • enhancing agents e.g. paramagnetic ions
  • Such diagnostic/detection agents may be selected from agents for use in MRI, and fluorescent compounds.
  • a target-specific humanized or chimeric antibody In order to load a target-specific humanized or chimeric antibody with radioactive metals or paramagnetic ions, it may be necessary to react it with a reagent having a long tail to which a multiplicity of chelating groups are attached for binding the ions.
  • a tail may be a polymer such as a polylysine, polysaccharide, or another derivatized or derivatizable chain having pendant groups to which may be bound chelating groups such as, e.g., porphyrins, polyamines, crown ethers, bisthiosemicarbazones, polyoximes, and like groups known to be useful for this purpose.
  • Chelates may be coupled to target-specific humanized or chimeric antibodies using standard chemistries.
  • the present invention provides a diagnostic target-specific humanized or chimeric antibody, wherein the target-specific humanized or chimeric antibody is conjugated to a contrast agent (such as for magnetic resonance imaging, computed tomography, or ultrasound contrast-enhancing agent) or a radionuclide that may be, for example, a gamma-, beta-, alpha-, Auger electron-, or positron-emitting isotope.
  • a contrast agent such as for magnetic resonance imaging, computed tomography, or ultrasound contrast-enhancing agent
  • a radionuclide that may be, for example, a gamma-, beta-, alpha-, Auger electron-, or positron-emitting isotope.
  • the present invention relates to a diagnostic composition comprising an antibody or bispecific antibody according to the invention.
  • the invention relates to a kit for detecting the presence of target antigen or a cell expressing the target, in a sample, comprising :
  • the present invention provides a kit for detecting the presence of a CD3 antigen, or a cell expressing CD3, in a sample comprising the steps of; a) contacting the sample with an antibody or bispecific antibody according to the invention, under conditions that allow for formation of a complex between the antibody or bispecific antibody and CD3; and
  • the present invention provides a kit for diagnosis of cancer comprising a container comprising a target-specific humanized or chimeric antibody, and one or more reagents for detecting binding of the target-specific humanized or chimeric antibody to the target.
  • Reagents may include, for example, fluorescent tags, enzymatic tags, or other detectable tags.
  • the reagents may also include secondary or tertiary antibodies or reagents for enzymatic reactions, wherein the enzymatic reactions produce a product that may be visualized.
  • the present invention provides a diagnostic kit comprising one or more target-specific humanized or chimeric antibodies of the present invention in labeled or unlabeled form in suitable container(s), reagents for the incubations for an indirect assay, and substrates or derivatizing agents for detection in such an assay, depending on the nature of the label. Control reagent(s) and instructions for use also may be included.
  • Diagnostic kits may also be supplied for use with a target-specific humanized or chimeric antibody, such as a labeled target-specific antibody, for the detection of the presence of the target in a tissue sample or host.
  • a target-specific humanized or chimeric antibody typically may be provided in a lyophilized form in a container, either alone or in conjunction with additional antibodies specific for a target cell or peptide.
  • a pharmaceutically acceptable carrier e.g., an inert diluent
  • components thereof such as a Tris, phosphate, or carbonate buffer, stabilizers, preservatives, biocides, inert proteins, e.g., serum albumin, or the like
  • additional reagents also typically in separate container(s)
  • a secondary antibody capable of binding to the target-specific humanized or chimeric antibody which typically is present in a separate container, is also included.
  • the second antibody is typically conjugated to a label and formulated in a manner similar to the target-specific humanized or chimeric antibody of the present invention.
  • target-specific humanized or chimeric antibodies may be used to define subsets of cancer/tumor cells and characterize such cells and related tumor tissues.
  • the invention relates to an anti-idiotypic antibody which binds to a humanized or chimeric antibody of the invention as described herein.
  • An anti-idiotypic (Id) antibody is an antibody which recognizes unique determinants generally associated with the antigen-binding site of an antibody.
  • An anti-Id antibody may be prepared by immunizing an animal of the same species and genetic type as the source of a CD3 monoclonal antibody with the monoclonal antibody to which an anti-Id is being prepared. The immunized animal typically can recognize and respond to the idiotypic determinants of the immunizing antibody by producing an antibody to these idiotypic determinants (the anti-Id antibody).
  • Such antibodies are described in for instance US 4,699,880. Such antibodies are further features of the present invention.
  • An anti-Id antibody may also be used as an "immunogen" to induce an immune response in yet another animal, producing a so-called anti-anti-Id antibody.
  • An anti-anti-Id antibody may be epitopically identical to the original monoclonal antibody, which induced the anti-Id antibody.
  • Anti-Id antibodies may be varied (thereby producing anti-Id antibody variants) and/or derivatized by any suitable technique, such as those described elsewhere herein with respect to CD3-specific antibodies of the present invention.
  • a monoclonal anti-Id antibody may be coupled to a carrier such as keyhole limpet hemocyanin (KLH) and used to immunize BALB/c mice.
  • Sera from these mice typically will contain anti-anti-Id antibodies that have the binding properties similar, if not identical , to an original/parent CD3 antibody.
  • CD3e (epsilon) DKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGS
  • Humanization of a murine CD3 antibody (US 8,236,308, described herein as IgGl-CD3) was performed by Antitope (Cambridge, UK) using their improved version of the germline humanization (CDR-grafting) technology (EP 0 629 240).
  • CDR-grafting germline humanization
  • 4 different VH chains (SEQ ID NOs:6, 7, 8, and 9) and 3 different VL chains (SEQ ID NOs: 10, 11, and 12) were designed. By combining these 4 VH with the 3 VL chains, 12 different antibodies were generated.
  • the humanized variants are described herein as huCD3.
  • humanized variants comprising a VH and a VL according to the invention, are described as, e.g., IgGl-huCD3-H lLl meaning that said specific variant is of the IgG l isotype, is a humanized CD3 and comprises the VH amino acid sequence termed "H I" and is defined according to SEQ ID NO :6, and the VL amino acid sequence termed "LI" and is defined according to SEQ ID NO: 10.
  • H I refers to the variable heavy chain region VH l
  • LI refers to the variable light chain region VL1, and so forth.
  • the variants IgGl-huCD3-H lLl (humanized CD3 comprising the VH l sequence set forth in SEQ ID NO : 6 and the VL1 sequence set forth in SEQ ID NO: 10), IgGl-huCD3-H lL2 (humanized CD3 comprising the VH l sequence set forth in SEQ ID NO: 6 and the VL2 sequence set forth in SEQ ID NO: 11), IgG l-huCD3-H lL3 (humanized CD3 comprising the VH l sequence set forth in SEQ ID NO: 6 and the VL3 sequence set forth in SEQ ID NO : 12), IgGl-huCD3-H3L3 (humanized CD3 comprising the VH3 sequence set forth in SEQ ID NO: 8 and the VL3 sequence set forth in SEQ ID NO : 12), IgG l-huCD3- H4L1 (humanized CD3 comprising the VH4 sequence set forth in SEQ ID NO: 10),
  • an antibody comprising the heavy and light chain variable region sequences of huCLB-T3/4 (SEQ ID NOs: 17 and 18, respectively) were used as a control antibody (Labrijn et al., PNAS 2013, 110: 5145-50) and to verify different non- activating mutation combinations in the Fc region (see Examples 8 to 10).
  • the huCBL-T3/4 is a humanized version of the murine CD3 antibody CLB-T3/4 (Parren et al., Res Immunol. 1991, 142(9) : 749-63).
  • an antibody comprising the heavy and light chain variable region sequences of the CD20 antibody 7D8 (SEQ ID NO: 29 corresponding to the VH sequence and SEQ ID NO :30 corresponding to the VL sequence) was used as a positive control.
  • a positive control it is termed "IgGl-CD20".
  • IgGl-CD3 i.e. the chimeric, parental CD3 antibody
  • IgGl-huCD3 and IgGl-huCLB-T3/4 antibodies were used in monospecific and bispecific format, where the bispecific antibodies were generated as described below.
  • an antibody against HER2 was used.
  • the VH and VL sequences for this HER2-specific antibody (antibody 169, SEQ ID NOs: 19 and 20, respectively) were described before (WO2012/143524 [Genmab] ; Labrijn et al., PNAS 2013, 110 : 5145-50).
  • the antibody was used in both monospecific and bispecific formats, and is termed "IgGl-HER2". b!2 antibody
  • the antibody bl2 a gpl20 specific antibody (Barbas, CF. J Mol Biol. 1993 Apr 5;230(3) : 812-23.) was used as a negative control, and is termed "IgGl-bl2".
  • Antibodies were expressed as IgGl, K or IgGl, . with or without the non- activating mutations described below and with a mutation in the CH3 domain enabling the generation of bispecific antibodies by the method described below : IgGl-HER2-K409R, IgGl-bl2-K409R, IgGl-CD3-F405L. Plasmid DNA mixtures encoding both heavy and light chain of antibodies were transiently transfected to Freestyle HEK293F cells (Invitrogen, US) using 293fectin (Invitrogen, US) essentially as described by the manufacturer.
  • Bispecific antibodies were generated in vitro using the DuoBody® platform technology, i.e. 2-MEA-induced Fab-arm exchange as described in WO 2011/147986 and Labrijn et al. (Labrijn et al., PNAS 2013, 110: 5145-50; Gramer et al. , MAbs 2013, 5 : 962- 973).
  • IgGl molecules carrying a single mutation in the CH3 domain were generated : in one parental IgGl antibody the F405L mutation (i.e. the IgGl-CD3 antibody), in the other parental IgGl antibody the K409R mutation (i.e. the HER2 or bl2 antibodies) .
  • the generated bispecific antibodies are described as "K409R IgGl backbone” and "F405L IgG l backbone” in the following.
  • a non-activating Fc region prevents the antibody from interacting with Fc-receptors present on blood cells, such as monocytes, or with Clq to activate the classical complement pathway.
  • Reduction of the Fc activity was tested in antibody variants that contain different combinations of amino acid substitutions in the Fc region. Maximally five amino acid substitutions were introduced, which include the mutations N297Q, L234A, L235A, L234F, L235E, D265A, and P331S. Substitutions in one or more of these five amino acid positions were introduced in the K409R and/or F405L IgGl backbone.
  • N297Q refers to the N297Q substitution, termed IgGl-huCLB-T3/4-N297Q
  • LFLE refers to the L234F/L235E substitutions, termed IgGl-huCLB-T3/4-LFLE
  • LALA refers to the L234A/L235A substitutions, termed IgGl-huCLB-T3/4-LALA
  • LFLENQ refer to the L234F/L235E/N297Q substitutions, termed IgGl-huCLB-T3/4-LFLENQ
  • LFLEDA refers to the L234F/L235E/D265A substitutions, termed IgGl-huCLB-T3/4-LFLEDA
  • DA refers to the D265A substitution, termed IgGl-huCLB-T3/4-DA
  • DAPS refers to the D265A substitution, termed IgGl-huCL
  • Figure 1A shows that binding to Jurkat cells of the IgGlA-huCD3 variants IgGl-huCD3-H lLl (SEQ ID NOs: 6 and 10, respectively), IgGl-huCD3-H lL2 (SEQ ID NOs:6 and 11, respectively), IgGl-huCD3-H lL3 (SEQ ID NOs: 6 and 12, respectively), IgGl-huCD3-H3L3 (SEQ ID NOs: 8 and 12, respectively), and IgG l-huCD3-H4Ll (SEQ ID NOs:9 and 10, respectively) with wild-type Fc region was observed for all variants, and that binding ability of IgGl-CD3-LFLEDA (parental CD3 antibody as described in Example 1 with non-activating LFLEDA mutations) and IgGl-huCD3-H3Ll-LFLEDA with non-activating LFLEDA mutations were similar to huCD3 variants with wild
  • Figure 6A shows that binding to Jurkat cells of the IgGl-CD3-LFLEDA (parental CD3 antibody as described in Example 1 with non-activating LFLEDA mutations), IgG l-huCD3-H3Ll -LFLEDA, IgGl-huCD3-H3L3-LFLEDA, IgGl-3huCD3-H lLl-LFLEDA, IgGl-huCD3-Hl L3-LFLEDA, IgG l-huCD3-H4Ll -LFLEDA, and IgGl-huCD3-H4L3-LFLEDA with the non-activating LFLEDA mutations were similar to binding ability to huCD3 va riants with wild-type Fc regions.
  • Figures IB shows that bispecific antibody variants bsIgGl CD3 x HER2, bsIgGl CD3 x bl2-LFLEDA, and bsIgGl huCD3-H3Ll x HER2-LFLEDA also bind to Jurkat cells.
  • the maximal binding values for these bispecific antibodies are higher than the maximal binding values of the monospecific antibodies.
  • the EC50 concentrations of the bispecific antibodies were 6 to 10-fold higher. Again, no binding was observed for the negative control antibody IgGl-bl2.
  • FIG. 6B shows that bispecific non-activating Fc antibody variants bsIgGl huCD3-H3Ll x HER2-LFLEDA, bsIgGl-huCD3-H3L3 x HER2-LFLEDA, bsIgGl-huCD3-H lLl x HER2-LFLEDA, bsIgGl-huCD3-H lL3 x HER2-LFLEDA, bsIgGl-huCD3-H4Ll x HER2- LFLEDA, and bsIgG l-huCD3-H4L3 x HER2-LFLEDA also bind to Jurkat cells.
  • the maximal binding values for these bispecific antibodies are higher than the maximal binding values of the monospecific antibodies.
  • the EC50 concentrations of the bispecific antibodies were 4 to 10-fold higher. Monovalent binding allows more antibodies to accumulate on the cell surface, thus, the higher binding values for the bispecific antibodies. Again, no binding were observed for the negative control antibody IgGl-bl2.
  • Figures 2A shows that binding of the IgG l-huCD3 variants IgGl-huCD3- H 1L1, IgGl-huCD3-H lL2, IgGl-huCD3-H lL3, IgGl-huCD3-H3L3, and IgGl-huCD3-H4Ll with wild-type Fc region and IgGl-CD3-LFLEDA, IgGl-huCD3-H3Ll -LFLEDA to the cynomolgus T-cell line HSC-F was similar. No binding was observed for the control antibody huCLB-T3/4, which does not cross-react with cynomolgus CD3, and the negative control antibody IgGl-bl2.
  • Figure 7A shows that binding of the IgGl -huCD3 variants IgGl-CD3-LFLEDA, IgGl-huCD3-H3 LI -LFLEDA, IgGl-huCD3-H3L3- LFLEDA, IgGl-huCD3-H l LI -LFLEDA, IgGl- huCD3-H lL3-LFLEDA, IgGl-huCD3-H4Ll-LFLEDA, and IgGl-huCD3-H4L3-LFLEDA to the cynomolgus T-cell line HSC-F was similar. No binding was observed for the negative control antibody IgGl-bl2.
  • FIG. 2B shows that bispecific antibody variants bsIgGl CD3 x HER2 and bsIgG l huCD3-H3 LI- LFLEDA also bind to HSC-F cells.
  • the maximal binding values for these bispecific antibodies are higher than the maximal binding values of the monospecific anti-CD3 variants.
  • the EC50 concentrations of the bispecific antibodies were 10 to 12 -fold higher than that of the monospecific anti-CD3 antibodies. Again, no binding was observed for the negative control antibody IgGl-bl2.
  • Figure 7B shows that bispecific non-activating Fc antibodies variants bsIgGl huCD3-H3Ll x HER2-LFLEDA, bsIgGl-huCD3-H3L3 x HER2-LFLEDA, bsIgGl-huCD3-H lLl x HER2-LFLEDA, bsIgGl-huCD3-H lL3 x HER2-LFLEDA, bsIgGl-huCD3-H4Ll x HER2- LFLEDA, and bsIgGl-huCD3-H4L3 x HER2-LFLEDA also bind to HSC-F cells.
  • the maximal binding values for these bispecific antibodies are higher than the maximal binding values of the monospecific anti-CD3 variants.
  • the EC50 concentrations of the bispecific antibodies were 3 to 6-fold higher than that of the monospecific anti-huCD3 antibodies. Again, no binding was observed for the negative control antibody IgGl -bl2.
  • CD69 expression is an early marker of T-cell activation.
  • CD3 antibodies could mediate cross-linking of T-cells and immune cells through binding of CD3 expressed by T- cells and Fc receptors expressed by immune cells by the Fc region of the antibody, such as the IgGl Fc region. This could lead to T-cell activation and induction of CD69.
  • Antibody variants containing a non-activating Fc region do not bind Fc receptors. Therefore, it was anticipated that non-activating CD3 antibodies do not induce T-cell activation and CD69 expression as the non-activating Fc region does not bind to Fc receptor expressing immune cells and thus cannot cross-link T-cells and immune cells.
  • LFLEDA variants contain F405L or K409R mutations as described in Example 1.
  • PBMCs were isolated from whole blood or buffy coat by density gradient separation using Leucosep tubes (#227290; Greiner Bio-one, Alphen a/d Rijn, The Netherlands), washed with PBS and re-suspended in culture medium.
  • a dose response series of huCD3 antibody variants, a negative control (IgGl - bl2) and positive controls (IgE-huCD3 and parental IgGl-CD3) were prepared in culture medium (ranging from 0.1 to 1,000 ng/mL in 10-fold dilutions) and added to the wells of a 96-well round bottom plate containing human or cynomolgus PBMCs. After 16-24 hours incubation, cells were pelleted by centrifugation and supernatant (containing cytokines) was collected and stored at -20°C.
  • Figure 3 shows that IgGl-CD3 (as described in Example 1) and humanized IgGl-huCD3 variants with wild-type IgGl Fc region induced similar levels of CD69 expression on T-cells from human ( Figure 3A) and cynomolgus ( Figure 3B) origin.
  • Non- activating (LFLEDA) IgG l-CD3-LFLEDA and IgGl-huCD3-H3Ll variants induced low levels of CD69 expression in human T-cells.
  • No expression of CD69 was induced by the non- activating IgGl-huCD3 variants in cynomolgus T-cells.
  • the control antibody IgGl-bl2 also did not induce expression of CD69 in human or cynomolgus T-cells.
  • Figure 8 shows that non-activating (LFLEDA) IgGl-huCD3-H3 LI -LFLEDA, IgGl-huCD3-H3L3- LFLEDA, IgGl-3huCD3-H lLl-LFLEDA, IgGl-huCD3-H lL3-LFLEDA, IgGl-huCD3-H4Ll -LFLEDA, and IgGl-huCD3-H4L3-LFLEDA variants induced low levels of CD69 expression in human T-cells.
  • Figures 8A and 8B show induction of CD69 expression on T-cells from cynomolgus monkey.
  • the minor activation by non-activating variants observed may be due to cross-linking of CD3 molecules through bivalent binding of CD3 antibodies. Such explanation is supported by the observation that the activation is reduced at the highest concentration where antibody binding is monovalent.
  • the control antibody IgGl-bl2 also did not induce expression of CD69 in human or cynomolgus T-cells.
  • Figures 8C and 8D show that non-activating bispecific antibody variants bsIgGl-huCD3-H3Ll x HER2-LFLEDA, bsIgGl-huCD3-H3L3 x HER2-LFLEDA, bsIgGl- huCD3-H lLl x HER2-LFLEDA, bsIgGl-huCD3-H lL3 x HER2-LFLEDA, bsIgGl-huCD3-H4Ll x HER2-LFLEDA, and bsIgGl-huCD3-H4L3 x HER2-LFLEDA do not induce expression of CD69 in T-cells from humans ( Figure 8C) or cynomolgus monkeys ( Figure 8D). However, at the higher antibody concentrations some induction of CD69 expression was observed .
  • Example 4 T-cell proliferation induced by humanized CD3 antibody variants.
  • PBMCs Human or cynomolgus PBMCs, isolated from whole blood or buffy coat, were incubated in 96-well culture plates with dilution series (ranging from 0.1 to 1,000 ng/mL in 10-fold dilutions) of IgGl huCD3 antibody variants.
  • IgE-CD3 and IgGl-huCLB-T3/4 were included as positive controls and IgGl-bl2 as negative control.
  • BrdU Roche Applied Science, Mannheim, Germany
  • Cells were then pelleted by centrifugation and supernatant collected and stored at -20°C. Plates were dried and stored at 4°C until ELISA was performed.
  • BrdU incorporation in the DNA was determined by ELISA according to the manufacturer's instructions (Roche Applied Science). Cells were fixed to the plates, where after the plates were incubated for 90 minutes at RT with an anti-BrdU antibody conjugated with peroxidase. Plates were washed with PBST and binding was detected using ABTS buffer (instead of the TMB solution provided with the kit). Color development was stopped after 30 min by adding 2% oxalic acid to the wells. OD405 nm was then measured on an EL808 ELISA-reader.
  • Figure 4 shows that incubation of PBMCs with parental IgGl-CD3 and humanized IgGl-huCD3 variants with wild-type IgGl Fc region induced strong proliferation of human ( Figure 4A) and cynomolgus (Figure 4B) T-cells, even at very low concentrations of antibody. Incubation with non-activating LFLEDA variants of the IgGl- huCD3 antibodies did not induce proliferation of human T-cells ( Figures 4A and 9A) or cynomolgus T-cells ( Figures 4B and 9B).
  • Figures 9C and 9D show that non-activating bispecific antibody variants bsIgGl-huCD3-H3Ll x HER2-LFLEDA, bsIgGl-huCD3-H3L3 x HER2-LFLEDA, bsIgGl- huCD3-H lLl x HER2-LFLEDA, bsIgGl-huCD3-H lL3 x HER2-LFLEDA, bsIgGl-huCD3-H4Ll x HER2-LFLEDA, and bsIgGl-huCD3-H4L3 x HER2-LFLEDA do not induce proliferation of T- cells isolated from humans ( Figure 9C) or cynomolgus monkeys ( Figure 9D).
  • Tumor-specific T-cell cytotoxicity can be mediated by bispecific antibodies that bind with one arm to CD3 and the other arm to a tumor-specific target, such as HER2. Simultaneous binding of bispecific antibodies to both T-cells and tumor cells will lead to T- cell activation and tumor cell specific cytotoxicity.
  • T-cell mediated cytotoxicity against HER2-positive tumor cells was evaluated using bispecific antibodies against CD3 (humanized variants) and HER2.
  • AU565 human breast carcinoma cells were cultured in RPMI 1640 supplemented with 10% (vol/vol) heat inactivated CCS, 1.5 g/L sodium bicarbonate (Lonza), 1 mM sodium pyruvate, 4.5 g/L glucose (Sigma), 50 IU/mL penicillin, and 50 pg/mL streptomycin.
  • the cell line was maintained at 37°C in a 5% (vol/vol) C0 2 humidified incubator.
  • AU565 cells were cultured to near confluency, after which cells were trypsinized, re-suspended in culture medium and passed through a cell strainer to obtain a single cell suspension. 5xl0 4 cells were seeded in each well of a 96-well culture plate, and cells were incubated at least 3 hrs at 37°C, 5% C0 2 to allow adherence to the plate.
  • Human or cynomolgus PBMCs were isolated from whole blood or buffy coat. Isolated PBMCs were washed with PBS, re-suspended in culture medium and added in a 1 : 1 ratio to the AU565 tumor cells in the 96-well plates. The percentage of T-cells present in PBMCs was measured by FACS-analysis, using a mouse anti-human CD3-PerCP (BD, #345766) antibody (for staining T-cells), which is cross-reactive with cynomolgus CD3. The T-cell content in the population of used PBMCs was typically 50 to 60%.
  • Dilution series (final concentrations ranging from 0.001 up to 10,000 ng/mL) of bispecific antibody variants bsIgGl CD3 x HE 2-LFLEDA, bsIgGl CD3 x bl2-LFLEDA, bsIgGl huCD3-H3Ll x HER2-LFLEDA, bsIgGl-huCD3-H3L3 x HER2-LFLEDA, bsIgGl- huCD3-H lLl x HER2- LFLEDA, bsIgGl-huCD3-H lL3 x HER2-LFLEDA, bsIgGl-huCD3-H lL3 x HER2-LFLEDA, bsIgGl-huCD3-H4Ll x HER2-LFLEDA, and bsIgGl-huCD3-H4L3 x HER2-LFLEDA were
  • LFLEDA antibody variants contain F405L or K409R mutations for preparation in bispecific format (see Example 1). Plates were incubated for 3 days at 37°C, 5% C0 2 . Incubation of cells with 1 ⁇ staurosporin (#S6942-200, Sigma) was used as reference for 100% tumor cell kill. Plates were washed twice with PBS, and 150 L culture medium containing 10% Alamar blue was added to each well. Plates were incubated for 4 hours at 37°C, 5% C0 2 . Absorbance at 590 nm was measured (Envision, Perkin Elmer, Waltham, MA).
  • Bispecific CD3xHER2-LFLEDA antibody variants (bsIgGl-huCLB-T3/4xHER2- LFLEDA and bsIgGl-CD3xHER2-LFLEDA) induced killing of AU565 cells at low concentrations using human effector cells ( Figure 5A) or cynomolgus effector cells ( Figure 5B).
  • the CD3 bispecific control antibody huCLB-T3/4xHER2-LFLEDA which shows no cross-reactivity with cynomolgus CD3, only induced killing of AU565 cells when human PBMCs were used ( Figure 5A).
  • FIG. 5B Incubation with monospecific IGGl-bl2 or IgGl-HER2-LFLEDA or bsIgGl-CD3xbl2-LFLEDA antibodies did not induce unspecific killing of target cells.
  • Bispecific antibody variants bsIgGl huCD3-H3Ll x HER2-LFLEDA, bsIgGl- huCD3-H3L3 x HER2-LFLEDA, bsIgGl-huCD3-H lLl x HER2-LFLEDA, bsIgGl-huCD3-H lL3 x HER2-LFLEDA, bsIgG l-huCD3-H4Ll x HER2-LFLEDA, and bsIgGl-huCD3-H4L3 x HER2-LFLEDA induced killing of AU565 cells at low concentrations using human effector cells (Figure 10A) or cynomolgus effector cells ( Figure 10B).
  • CD69 expression on rhesus T-cells was evaluated to determine early activation of T-cells after incubation with humanized CD3 (huCD3) antibody variants with wild-type IgGl Fc region. Isolation of rhesus PBMCs and evaluation of CD69 expression by flow cytometry was performed as described in Example 3.
  • Figure 11 shows that humanized CD3 antibody variants IgGl-huCD3-H lLl, IgGl-huCD3-H lL2, IgGl-huCD3-H lL3, IgGl-huCD3-H3L3, and IgGl-huCD3-H4Ll induced CD69 expression on T-cells from rhesus origin to similar levels as IgGl-CD3 (as described in Example 1).
  • the negative control antibody IgG l-bl2 did not induce expression of CD69 in rhesus T-cells.
  • the huCD3 variants according to the present invention may be used in experiments involving rhesus monkey CD3.
  • the huCD3 va riants are cross -reactive with rhesus monkey CD3.
  • Example 7 T-cell activation by non-activating variants of huCLB-T3/4
  • CD69 expression on T-cells was evaluated by FACS analysis to determine early activation of T-cells after incubation with IgGl-huCLB-T3/4 variants with mutations in the Fc region (see Example 1).
  • PBMCs were isolated from whole blood or buffy coat by density gradient separation using Leucosep tubes (#227290; Greiner Bio-one, Alphen a/d Rijn, The Netherlands), washed with PBS and resuspended in culture medium.
  • IgGl-huCLB-T3/4 variants a negative control (IgGl-huCLB-T3/4-Fab) and positive control (IgE-huCLB-T3/4) were prepared in culture medium (ranging from 1 to 1000 ng/mL in 3 -fold dilutions) and added to the wells of a 96- well round bottom plate containing the PBMCs. After 16-24 hours incubation, cells were pelleted by centrifugation and supernatant (containing cytokines) collected and stored at - 20°C.
  • Figure 12 A shows that CD69 expression was high on cells which were incubated with IgE-huCLB-T3/4, IgGl-huCLB-T3/4, IgGl-huCLB-T3/4-DA and IgGl- huCLB-T3/4-DAPS.
  • Incubation with IgGl -huCLB-T3/4-N297Q induced somewhat lower expression levels of CD69 compared to wild-type IgGl-huCLB-T3/4, and incubation with IgGl-huCLB-T3/4-LFLE and IgGl-huCLB-T3/4-LFLEPS induced CD69 to a lesser extent.
  • Figure 12B shows that CD69 expression was high on cells which were incubated with IgE-huCLB-T3/4 and IgGl-huCLB-T3/4. Incubation with IgGl-huCLB-T3/4- LALA induced somewhat lower expression levels of CD69 compared to wild-type IgGl- huCLB-T3/4, and incubation with IgG l-huCLB-T3/4-LFLEDA and IgGl-bl2 (negative control) did not induce any expression of CD69 on T-cells.
  • Example 8 T-cell proliferation by non-activating variants of huCLB-T3/4
  • huCLB-T3/4 variants (described in Example 1) on the proliferation of T-cells was evaluated by the Cell proliferation ELISA kit from Roche Applied Science (Cell Proliferation ELISA, BrdU kit, # 11647229001; Roche Applied Science, Mannheim, Germany), which was performed according to the manufacturer's instructions.
  • PBMCs isolated from whole blood or buffy coat, were incubated in 96-well culture plates with dilution series (ranging from 0.1 to 1000 ng/mL) of IgG l-CD3 variants.
  • IgE-CD3 and IgGl-CD3 were included as positive controls and IgG l-bl2 (with K409R mutation for generation of bispecific antibodies) as a negative control.
  • BrdU Roche Applied Science, Mannheim, Germany
  • Cells were then pelleted by centrifugation and supernatant collected and stored at -20°C. Plates were dried and stored at 4°C until ELISA was performed.
  • BrdU incorporation in the DNA was determined by ELISA according to the manufacturer's instructions (Cell Proliferation ELISA, BrdU kit, # 11647229001; Roche Applied Science). Cells were fixed to the plates, where after the plates were incubated for 90 minutes at room temperature (RT) with an anti-BrdU antibody conjugated with peroxidase. Plates were washed with PBST and binding was detected using ABTS buffer (instead of the TMB solution provided with the kit). Color development was stopped after 30 min by adding 2% oxalic acid to the wells. OD405 nm was then measured on an EL808 ELISA-reader.
  • Figure 13A shows that incubation of PBMCs with IgGl -huCLB-T3/4, IgGl- huCLB-T3/4-DA and IgGl- huCLB-T3/4-DAPS induced strong proliferation of T-cells, even at very low concentrations of antibody. Incubation with IgGl-huCLB-T3/4-N297Q induced dose-dependent proliferation, which was comparable to the IgE-huCLB-T3/4 positive control.
  • Figure 13B shows that incubation of PBMCs with IgGl -huCLB-T3/4 induced strong proliferation of T-cells, even at very low concentrations of antibody. Incubation with IgE-huCLB-T3/4 (positive control) and IgGl-huCLB-T3/4-LALA induced dose-dependent proliferation. Incubation of PBMCs with IgGl -huCLB-T3/4-LFLEDA did not induce proliferation of T-cells.
  • Example 9 In vitro T-cell-mediated cytotoxicity induced by non-activating antibody variants huCLB-T3/4
  • AU565 human breast carcinoma cells were cultured in RPMI 1640 supplemented with 10% (vol/vol) heat inactivated CCS, 1.5 g/L sodium bicarbonate (Lonza), 1 mM sodium pyruvate, 4.5 g/L glucose (Sigma), 50 IU/mL penicillin, and 50 Mg/mL streptomycin.
  • the cell line was maintained at 37°C in a 5% (vol/vol) C0 2 humidified incubator.
  • AU565 cells were cultured to near confluency. Cells were trypsinized, re-suspended in culture medium and passed through a cell strainer to obtain a single cell suspension. 5xl0 4 cells were seeded in each well of a 96-well culture plate, and cells were incubated at least 3 hrs. at 37°C, 5% C02 to allow adherence to the plate.
  • PBMC Peripheral blood mononuclear cells
  • Dilution series (final concentrations ranging from 0.004 to 1000 ng/mL) of IgGl-bl2, IgGl-huCLB-T3/4, IgGl-HER2, and bispecific huCLB-T3/4xbl2 and huCLB- T3/4xHER2 antibodies expressed as different Fc-variants, wild type, N297Q, LFLE, LA LA, LFLENQ, LFLEDA, DANQ, and LFLEDENQPS, were prepared in culture medium and added to the plates. Plates were incubated for 3 days at 37°C, 5% C0 2 .
  • Interaction of Clq with antibodies bound to a target cell is the first step in the classical pathway of complement activation. Since wild-type IgGl harbors the interaction site for Clq, the interaction of Clq to these non-activating IgGl variants by an ELISA was evaluated.
  • Dilution series (range 7-30,000 ng/mL in 4-fold dilutions) of IgGl-huCLB- T3/4, bsIgGl-huCLB-T3/4xHER2 and IgGl-CD20 (positive control) and non-activating antibody variants as described above in Example 1 thereof were coated on 96-well Microlon ELISA plates (Greiner, Germany) overnight at 4°C. Plates were washed and blocked with PBS supplemented with 0.025% Tween 20 and 0.1% gelatine.
  • the reaction was stopped by the addition of 100 ⁇ _ 2% oxalic acid. Absorbance was measured at 405 nm in a microplate reader (Biotek, Winooski, VT). Log transformed data were analyzed by fitting sigmoidal dose-response curves with variable slope using GraphPad Prism software.
  • Figure 16A shows that the antibodies with wild-type IgGl Fc regions, IgGl- CD20 and IgGl-huCLB-T3/4 showed Clq binding. No binding of Clq was detected on all evaluated antibody variants with non-activating mutations (N297Q, LFLE, LFLENQ, LFLEDA, DA, DAPS, DANQ, LFLEPS, LFLEDANQPS, LA LA).
  • Figure 16B shows that the antibody with wild-type IgGl Fc reigon bsIgGl- huCLB-T3/4xHER2 showed Clq binding. No binding of Clq was detected on all evaluated antibody variants with non-activating mutations (N297Q, LFLE, LFLENQ, LFLEDA, DA, DAPS, DANQ, LFLEPS, LFLEDANQPS, LALA).
  • Figure 16C and Figure 16D show that the antibodies with wild-type IgGl Fc regions, IgGl-CD20, IgGl-huCLB-T3/4, and bsIgGl-huCLB-T3/4xHER2 showed Clq binding. No binding of Clq was detected on the antibody variants with non-activating mutations (LFLEDA and LALA).
  • mice in this study were housed in a barrier unit of the Central Laboratory Animal Facility (Utrecht, The Netherlands) and kept in filter-top cages with water and food provided ad libitum. All experiments were approved by the Utrecht University animal ethics committee. 7-10 Weeks old C.B-17 SCID mice (C.B-17/Icr-Prkdc ⁇ Scid>/IcrIcoCrl, Charles-River) were injected intravenously with 100 g wild-type antibody (IgGl-huCLB- T3/4, IgGl-HER2, or bsIgG-huCLB-T3/4xHER2) or non-activating variants thereof (LALA, LFLEDA, LFLENQ, DANQ or LFLEDANQPS) using 3 mice per group.
  • wild-type antibody IgGl-huCLB- T3/4, IgGl-HER2, or bsIgG-huCLB-T3/4xHER2
  • Human IgG concentrations were determined using a total hlgG sandwich ELISA.
  • mouse mAb anti-human IgG-kappa clone MH 16 (#M 1268, CLB Sanquin, The Netherlands), coated to 96-well Microlon ELISA plates (Greiner, Germany) at a concentration of 2 g/mL was used as capturing antibody.
  • PBS PBS supplemented with 0.2% bovine serum albumin
  • samples were added, serially diluted with ELISA buffer (PBS supplemented with 0.05% Tween 20 and 0.2% bovine serum albumin), and incubated on a plate shaker for 1 h at room temperature ( T).
  • Plasma clearance rates (mL/day/kg) were calculated based on the area under the curve (AUC), according to the following equation :
  • Figure 17A shows that the plasma human IgG concentrations were lower for antibody variants N297Q, DANQ, LFLENQ, and LFLEDANQPS when compared to wild-type antibodies, suggesting a faster clearance.
  • the human IgG concentrations in plasma for antibody variants LFLEDA and LALA were similar to those of wild-type antibodies.
  • Figure 17B shows that the plasma clearance rates of antibody variants N297Q, DANQ and LFLENQ were 2 to 3-fold higher than that of wild-type antibody.
  • the clearance rate of antibody variant LFLEDANQPS was 3-5 times higher than that of wild- type antibody.
  • Plasma clearance rates of antibody variants LFLEDA and LALA were similar to that of wild-type antibody.
  • Example 12 In vitro immunogenicity assessment of the IgGl-LFLEDA backbone
  • IgGl-HER2-LFLEDA In order to determine the potential for clinical immunogenicity of the IgGl - LFLEDA-K409R backbone, Antitope's EpiScreenTM platform was applied to IgGl-HER2- LFLEDA.
  • PBMCs were isolated from a cohort of 50 HLA-typed healthy donors representing the European and North American population. After CD8+ T-cell depletion the PBMC preparations were individually frozen and stored. Thawed PBMCs were subsequently cultured and incubated with IgGl-HER2-LFLEDA-K409R or one of the control samples (IgGl-HER2 or IgGl-HER2-LFLE-K409R) for 5 to 8 days.
  • IgGl-HER2-LFLEDA-K409R (as well as IgGl-HER2 and IgGl-HER2-LFLE-K409R) showed low potential for immunogenicity with frequencies of responses below 10%.
  • the positive control humanized A33 (e.g. [84]) was used as clinical benchmark control antibody that shows high levels of immunogenicity in the clinic and routinely induces 20-30% T-cell responses in the EpiScreen Assay.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Cell Biology (AREA)
  • Oncology (AREA)
  • Virology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Pathology (AREA)
  • Microbiology (AREA)
  • Communicable Diseases (AREA)
  • Transplantation (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
PCT/EP2014/064326 2013-07-05 2014-07-04 Humanized or chimeric cd3 antibodies Ceased WO2015001085A1 (en)

Priority Applications (68)

Application Number Priority Date Filing Date Title
SG11201510739TA SG11201510739TA (en) 2013-07-05 2014-07-04 Humanized or chimeric cd3 antibodies
CN202110540502.3A CN113248615B (zh) 2013-07-05 2014-07-04 人源化或嵌合cd3抗体
AU2014286116A AU2014286116A1 (en) 2013-07-05 2014-07-04 Humanized or chimeric CD3 antibodies
BR112015032986-1A BR112015032986B1 (pt) 2013-07-05 2014-07-04 Anticorpo, microrganismo, composição, métodos para produzir um anticorpo e in vitro para detectar a presença de antígeno de cd3 ou uma célula que expressa cd3 em uma amostra, e, kit
CN201480048350.3A CN105722529B (zh) 2013-07-05 2014-07-04 人源化或嵌合cd3抗体
NZ715896A NZ715896A (en) 2013-07-05 2014-07-04 Humanized or chimeric cd3 antibodies
SM20200287T SMT202000287T1 (it) 2013-07-05 2014-07-04 Anticorpi anti-cd3 umanizzati o chimerici
KR1020257017076A KR20250078622A (ko) 2013-07-05 2014-07-04 인간화 또는 키메라 cd3 항체
US14/902,757 US10465006B2 (en) 2013-07-05 2014-07-04 Humanized or chimeric CD3 antibodies
EA201690167A EA201690167A1 (ru) 2013-07-05 2014-07-04 Гуманизованные или химерные антитела к cd3
MX2015017487A MX373245B (es) 2013-07-05 2014-07-04 Anticuerpos cd3 humanizados o quiméricos.
RS20200307A RS60131B1 (sr) 2013-07-05 2014-07-04 Humanizovana ili himerna anti-cd3 antitela
IL311371A IL311371B2 (en) 2013-07-05 2014-07-04 CD3 antibodies of human origin or chimeras
PL14737200T PL3016681T3 (pl) 2013-07-05 2014-07-04 Humanizowane lub chimeryczne przeciwciała CD3
BR122023002590-3A BR122023002590B1 (pt) 2013-07-05 2014-07-04 Anticorpo humanizado ou quimérico de ligação ao cd3 humano, anticorpo biespecífico, microrganismo, composição, composição farmacêutica, uso dos mesmos, método para produzir um anticorpo, composição de diagnóstico, método in vitro para detectar a presença de antígeno cd3, ou uma célula expressando cd3, em uma amostra, kit para detectar a presença de antígeno cd3, ou uma célula que expressa cd3, em uma amostra e anticorpo anti-idiotípico
JP2016522644A JP6546162B2 (ja) 2013-07-05 2014-07-04 ヒト化またはキメラcd3抗体
KR1020167002903A KR102363220B1 (ko) 2013-07-05 2014-07-04 인간화 또는 키메라 cd3 항체
SI201431520T SI3016681T1 (sl) 2013-07-05 2014-07-04 Humanizirana ali himerna CD3 protitelesa
UAA201600940A UA119646C2 (uk) 2013-07-05 2014-07-04 Гуманізоване антитіло, що зв`язується з сd3 людини
LTEP14737200.7T LT3016681T (lt) 2013-07-05 2014-07-04 Humanizuoti arba chimeriniai cd3 antikūnai
EP14737200.7A EP3016681B1 (en) 2013-07-05 2014-07-04 Humanized or chimeric cd3 antibodies
KR1020237015498A KR102813816B1 (ko) 2013-07-05 2014-07-04 인간화 또는 키메라 cd3 항체
ES14737200T ES2776706T3 (es) 2013-07-05 2014-07-04 Anticuerpos contra CD3 humanizados o quiméricos
DK14737200.7T DK3016681T5 (da) 2013-07-05 2014-07-04 Humaniserede eller kimære CD3-antistoffer
EP19217231.0A EP3693385A1 (en) 2013-07-05 2014-07-04 Humanized or chimeric cd3 antibodies
MEP-2020-54A ME03675B (me) 2013-07-05 2014-07-04 Humanizovana ili himerna anтi-cd3 antiтela
HRP20200382TT HRP20200382T1 (hr) 2013-07-05 2014-07-04 Humanizirana ili kimerna protutijela cd3
KR1020227004568A KR102531517B1 (ko) 2013-07-05 2014-07-04 인간화 또는 키메라 cd3 항체
CA2915575A CA2915575A1 (en) 2013-07-05 2014-07-04 Humanized or chimeric cd3 antibodies
IL290613A IL290613B2 (en) 2013-07-05 2014-07-04 Humanized or chimeric cd3 antibodies
DK23174159.6T DK4249515T3 (en) 2014-01-09 2015-01-08 Humanized or chimeric cd3 antibodies
US15/110,414 US10407501B2 (en) 2014-01-09 2015-01-08 Humanized or chimeric CD3 antibodies
FIEP23174159.6T FI4249515T3 (fi) 2014-01-09 2015-01-08 Humanisoituja tai kimeerisiä CD3-vasta-aineita
ES15700081T ES3052034T3 (en) 2014-01-09 2015-01-08 Humanized or chimeric cd3 antibodies
PT231741596T PT4249515T (pt) 2014-01-09 2015-01-08 Anticorpos contra cd3 humanizados ou quiméricos
HK17104925.3A HK1231369B (en) 2014-01-09 2015-01-08 Humanized or chimeric cd3 antibodies
JP2016545932A JP6619342B2 (ja) 2014-01-09 2015-01-08 ヒト化またはキメラcd3抗体
ES23174159T ES3038421T3 (en) 2014-01-09 2015-01-08 Humanized or chimeric cd3 antibodies
PL23174159.6T PL4249515T3 (pl) 2014-01-09 2015-01-08 Humanizowane lub chimeryczne przeciwciała cd3
SI201532077T SI4249515T1 (sl) 2014-01-09 2015-01-08 Humanizirana ali himerna cd3 protitelesa
LTEP23174159.6T LT4249515T (lt) 2014-01-09 2015-01-08 Humanizuoti arba chimeriniai cd3 antikūnai
SM20250322T SMT202500322T1 (it) 2014-01-09 2015-01-08 Anticorpi per cd3 umanizzati o chimerici
HUE23174159A HUE072527T2 (hu) 2014-01-09 2015-01-08 Humanizált vagy kiméra CD3 ellenanyagok
HRP20251127TT HRP20251127T1 (hr) 2014-01-09 2015-01-08 Humanizirana ili himerična cd3 protutijela
CN202510481586.6A CN120365424A (zh) 2014-01-09 2015-01-08 人源化或嵌合cd3抗体
PCT/EP2015/050276 WO2015104346A1 (en) 2014-01-09 2015-01-08 Humanized or chimeric cd3 antibodies
CN202410218077.XA CN118063621A (zh) 2014-01-09 2015-01-08 人源化或嵌合cd3抗体
CN201580013100.0A CN106255507B (zh) 2014-01-09 2015-01-08 人源化或嵌合cd3抗体
RS20250910A RS67220B1 (sr) 2014-01-09 2015-01-08 Humanizovana ili himerna cd3 antitela
EP15700081.1A EP3091998B1 (en) 2014-01-09 2015-01-08 Humanized or chimeric cd3 antibodies
EP25175408.1A EP4631978A3 (en) 2014-01-09 2015-01-08 Humanized or chimeric cd3 antibodies
EP23174159.6A EP4249515B1 (en) 2014-01-09 2015-01-08 Humanized or chimeric cd3 antibodies
IL243127A IL243127B (en) 2013-07-05 2015-12-15 Humanized or chimeric cd3 antibodies
US16/544,376 US11613575B2 (en) 2014-01-09 2019-08-19 Humanized or chimeric CD3 antibodies
US16/582,428 US20200123255A1 (en) 2013-07-05 2019-09-25 Humanized or chimeric cd3 antibodies
JP2019205910A JP7208129B2 (ja) 2014-01-09 2019-11-14 ヒト化またはキメラcd3抗体
CY20201100224T CY1122840T1 (el) 2013-07-05 2020-03-16 Ανθρωποποιημενα ή χιμαιρικα αντισωματα cd3
AU2020202792A AU2020202792B9 (en) 2013-07-05 2020-04-28 Humanized or chimeric CD3 antibodies
IL276530A IL276530B (en) 2013-07-05 2020-08-05 CD3 antibodies of human origin or chimeras
JP2022042394A JP7389833B2 (ja) 2014-01-09 2022-03-17 ヒト化またはキメラcd3抗体
AU2022203851A AU2022203851B2 (en) 2013-07-05 2022-06-03 Humanized or chimeric CD3 antibodies
US18/109,708 US20230374131A1 (en) 2014-01-09 2023-02-14 Humanized or chimeric cd3 antibodies
JP2023196008A JP2024026114A (ja) 2014-01-09 2023-11-17 ヒト化またはキメラcd3抗体
AU2025256200A AU2025256200A1 (en) 2013-07-05 2025-10-24 Humanized or chimeric CD3 antibodies
NL301352C NL301352I2 (nl) 2014-01-09 2025-11-25 epcoritamab
LTPA2025538C LTPA2025538I1 (enExample) 2014-01-09 2025-11-27
FIC20250036C FIC20250036I1 (fi) 2014-01-09 2025-12-09 Epkoritamabi
FR25C1054C FR25C1054I1 (fr) 2014-01-09 2025-12-11 Anticorps anti-cd3 humanisés ou chimériques

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
PCT/EP2013/064330 WO2014006217A1 (en) 2012-07-06 2013-07-05 Dimeric protein with triple mutations
EPPCT/EP2013/064330 2013-07-05
DKPA201400009 2014-01-09
PCT/EP2014/050340 WO2014108483A1 (en) 2013-01-10 2014-01-09 Inert format
DKPA201400009 2014-01-09
EPPCT/EP2014/050340 2014-01-09

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/902,757 A-371-Of-International US10465006B2 (en) 2013-07-05 2014-07-04 Humanized or chimeric CD3 antibodies
US16/582,428 Division US20200123255A1 (en) 2013-07-05 2019-09-25 Humanized or chimeric cd3 antibodies

Publications (1)

Publication Number Publication Date
WO2015001085A1 true WO2015001085A1 (en) 2015-01-08

Family

ID=52143134

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/EP2014/064326 Ceased WO2015001085A1 (en) 2013-07-05 2014-07-04 Humanized or chimeric cd3 antibodies
PCT/EP2015/050276 Ceased WO2015104346A1 (en) 2014-01-09 2015-01-08 Humanized or chimeric cd3 antibodies

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/EP2015/050276 Ceased WO2015104346A1 (en) 2014-01-09 2015-01-08 Humanized or chimeric cd3 antibodies

Country Status (32)

Country Link
US (5) US10465006B2 (enExample)
EP (5) EP3693385A1 (enExample)
JP (7) JP6546162B2 (enExample)
KR (4) KR102531517B1 (enExample)
CN (5) CN105722529B (enExample)
AU (4) AU2014286116A1 (enExample)
BR (1) BR122023002590B1 (enExample)
CA (1) CA2915575A1 (enExample)
CY (1) CY1122840T1 (enExample)
DK (2) DK3016681T5 (enExample)
EA (1) EA201690167A1 (enExample)
ES (3) ES2776706T3 (enExample)
FI (2) FI4249515T3 (enExample)
FR (1) FR25C1054I1 (enExample)
HR (2) HRP20200382T1 (enExample)
HU (3) HUE048722T2 (enExample)
IL (4) IL290613B2 (enExample)
LT (3) LT3016681T (enExample)
ME (1) ME03675B (enExample)
MX (2) MX373245B (enExample)
NL (1) NL301352I2 (enExample)
NO (1) NO2025057I1 (enExample)
NZ (1) NZ715896A (enExample)
PL (2) PL3016681T3 (enExample)
PT (2) PT3016681T (enExample)
RS (2) RS60131B1 (enExample)
SG (2) SG10201800982QA (enExample)
SI (2) SI3016681T1 (enExample)
SM (2) SMT202000287T1 (enExample)
UA (1) UA119646C2 (enExample)
WO (2) WO2015001085A1 (enExample)
ZA (1) ZA201800385B (enExample)

Cited By (63)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2015104346A1 (en) * 2014-01-09 2015-07-16 Genmab B.V. Humanized or chimeric cd3 antibodies
CN105296421A (zh) * 2015-11-24 2016-02-03 高岱清 一种双特异性抗体活化的t细胞及制备方法与应用
WO2017009442A1 (en) * 2015-07-15 2017-01-19 Genmab A/S Humanized or chimeric cd3 antibodies
WO2017162587A1 (en) * 2016-03-22 2017-09-28 F. Hoffmann-La Roche Ag Protease-activated t cell bispecific molecules
EP3252078A1 (en) 2016-06-02 2017-12-06 F. Hoffmann-La Roche AG Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer
WO2017220990A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 antibodies
WO2018011421A1 (en) * 2016-07-14 2018-01-18 Genmab A/S Multispecific antibodies against cd40 and cd137
WO2018162749A1 (en) 2017-03-09 2018-09-13 Genmab A/S Antibodies against pd-l1
EP3409322A1 (en) 2017-06-01 2018-12-05 F. Hoffmann-La Roche AG Treatment method
WO2018220099A1 (en) 2017-06-02 2018-12-06 F. Hoffmann-La Roche Ag Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer
WO2019034580A1 (en) 2017-08-14 2019-02-21 Morphosys Ag HUMANIZED ANTIBODIES FOR CD3
WO2019175198A2 (en) 2018-03-12 2019-09-19 Genmab A/S Antibodies
WO2020076992A1 (en) 2018-10-11 2020-04-16 Inhibrx, Inc. 5t4 single domain antibodies and therapeutic compositions thereof
WO2020076970A1 (en) 2018-10-11 2020-04-16 Inhibrx, Inc. B7h3 single domain antibodies and therapeutic compositions thereof
WO2020077257A1 (en) 2018-10-11 2020-04-16 Inhibrx, Inc. Pd-1 single domain antibodies and therapeutic compositions thereof
WO2020076977A2 (en) 2018-10-11 2020-04-16 Inhibrx, Inc. Dll3 single domain antibodies and therapeutic compositions thereof
US10669337B2 (en) 2014-07-25 2020-06-02 Cytomx Therapeutics, Inc. Bispecific anti-CD3 antibodies, bispecific activatable anti-CD3 antibodies, and methods of using the same
US10882907B2 (en) 2017-06-21 2021-01-05 Gilead Sciences, Inc. Multispecific antibodies that target HIV GP120 and CD3
WO2021048423A1 (en) 2019-09-12 2021-03-18 Genmab A/S Bispecific antibodies binding to 5t4 and cd3 for use in treatment of cancer
JP2021510081A (ja) * 2017-12-28 2021-04-15 上海細胞治療集団有限公司Shanghai Cell Therapy Group Co., Ltd. 抗体修飾キメラ抗原受容体修飾t細胞及びその使用
WO2021141996A1 (en) * 2020-01-06 2021-07-15 Cytomx Therapeutics, Inc. Single- and multi-chain polypeptides that bind specifically to cd3 epsilon
WO2021155071A1 (en) 2020-01-29 2021-08-05 Inhibrx, Inc. Cd28 single domain antibodies and multivalent and multispecific constructs thereof
WO2021185934A1 (en) 2020-03-18 2021-09-23 Genmab A/S Antibodies binding to b7h4
WO2021167952A3 (en) * 2020-02-20 2021-09-30 The Feinstein Institutes For Medical Research Agonist antibodies against endoglin and uses thereof
US11161906B2 (en) 2013-07-25 2021-11-02 Cytomx Therapeutics, Inc. Multispecific antibodies, multispecific activatable antibodies and methods of using the same
WO2021224499A1 (en) 2020-05-08 2021-11-11 Genmab A/S Bispecific antibodies against cd3 and cd20
US11242390B2 (en) 2016-03-22 2022-02-08 Hoffmann-La Roche Inc. Protease-activated T cell bispecific molecules
WO2022046644A1 (en) 2020-08-25 2022-03-03 Gilead Sciences, Inc. Multi-specific antigen binding molecules targeting hiv and methods of use
WO2022049220A2 (en) 2020-09-02 2022-03-10 Genmab A/S Antibody therapy
WO2022053658A1 (en) 2020-09-10 2022-03-17 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma
WO2022053656A1 (en) 2020-09-10 2022-03-17 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating follicular lymphoma
WO2022053657A1 (en) 2020-09-10 2022-03-17 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma
WO2022053654A1 (en) 2020-09-10 2022-03-17 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma
WO2022053653A1 (en) 2020-09-10 2022-03-17 Genmab A/S Bispecific antibodies against cd3 and cd20 for treating chronic lymphocytic leukemia
WO2022053655A1 (en) 2020-09-10 2022-03-17 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating follicular lymphoma
WO2022069724A1 (en) 2020-10-02 2022-04-07 Genmab A/S Antibodies capable of binding to ror2 and bispecific antibodies binding to ror2 and cd3
EP4026848A1 (en) 2015-12-09 2022-07-13 F. Hoffmann-La Roche AG Type ii anti-cd20 antibody for reducing the cytokine release syndrome
US11472889B2 (en) 2017-10-14 2022-10-18 Cytomx Therapeutics, Inc. Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof
WO2022228706A1 (en) 2021-04-30 2022-11-03 F. Hoffmann-La Roche Ag Dosing for treatment with anti-cd20/anti-cd3 bispecific antibody
WO2022228705A1 (en) 2021-04-30 2022-11-03 F. Hoffmann-La Roche Ag Dosing for combination treatment with anti-cd20/anti-cd3 bispecific antibody and anti-cd79b antibody drug conjugate
WO2022234146A1 (en) 2021-05-07 2022-11-10 Genmab A/S PHARMACEUTICAL COMPOSITIONS COMPRISING BISPECIFIC ANTIBODIES BINDING TO B7H4 and CD3
US11498965B2 (en) 2017-10-20 2022-11-15 Green Cross Corporation Anti-CD3 antibody and pharmaceutical composition for cancer treatment comprising same
EP4039707A4 (en) * 2019-09-30 2022-11-16 Harbour Biomed (Shanghai) Co., Ltd TARGETED CD3 ANTIBODY, BISPECIFIC ANTIBODY AND USE THEREOF
WO2023057571A1 (en) 2021-10-08 2023-04-13 Genmab A/S Antibodies binding to cd30 and cd3
WO2023144306A1 (en) 2022-01-28 2023-08-03 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma
WO2023144290A1 (en) 2022-01-28 2023-08-03 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma
WO2023180353A1 (en) 2022-03-23 2023-09-28 F. Hoffmann-La Roche Ag Combination treatment of an anti-cd20/anti-cd3 bispecific antibody and chemotherapy
WO2023198727A1 (en) 2022-04-13 2023-10-19 F. Hoffmann-La Roche Ag Pharmaceutical compositions of anti-cd20/anti-cd3 bispecific antibodies and methods of use
WO2023198839A2 (en) 2022-04-13 2023-10-19 Genmab A/S Bispecific antibodies against cd3 and cd20
RU2808138C1 (ru) * 2019-09-30 2023-11-23 Хабэ Биомед (Шанхай) Ко., Лтд Антитело, нацеливающееся на cd3, биспецифическое антитело и их применение
WO2024088987A1 (en) 2022-10-26 2024-05-02 F. Hoffmann-La Roche Ag Combination therapy for the treatment of cancer
WO2024094822A1 (en) 2022-11-02 2024-05-10 Genmab A/S Bispecific antibodies against cd3 and cd20 for treating richter's syndrome
WO2024102948A1 (en) 2022-11-11 2024-05-16 Celgene Corporation Fc receptor-homolog 5 (fcrh5) specific binding molecules and bispecific t-cell engaging antibodies including same and related methods
US12103982B2 (en) 2014-11-20 2024-10-01 Hoffmann-La Roche Inc. T cell activating bispecific antigen binding molecules
WO2024208898A1 (en) 2023-04-05 2024-10-10 Genmab A/S Pharmaceutical compositions comprising antibodies binding to cd30 and cd3
WO2024213754A1 (en) 2023-04-13 2024-10-17 Genmab A/S Methods of treating lymphoma with bispecific antibodies against cd3 and cd20
US12139553B2 (en) 2014-11-20 2024-11-12 Hoffmann-La Roche Inc. T cell activating bispecific antigen binding molecules
JP2025081581A (ja) * 2015-04-13 2025-05-27 ファイザー・インク 治療抗体およびその使用
WO2025116732A1 (en) * 2023-12-01 2025-06-05 Rijksuniversiteit Groningen Methods and kits for detecting proliferating cells
WO2025199352A2 (en) 2024-03-20 2025-09-25 Juno Therapeutics, Inc. Antibodies specific for solute carrier family 34 member 2 (slc34a2)
WO2025240670A2 (en) 2024-05-15 2025-11-20 Abalytics Oncology, Inc. Anti-pd-1 antibodies and related binding molecules and methods and uses thereof
EP4678661A2 (en) 2015-01-08 2026-01-14 Genmab A/S Bispecific antibodies against cd3 and cd20
US12570751B2 (en) 2017-08-04 2026-03-10 Genmab A/S Binding agents binding to PD-L1 and CD137 and use thereof

Families Citing this family (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
PT3434767T (pt) 2010-11-30 2026-01-23 Chugai Pharmaceutical Co Ltd Agente terapêutico indutor de citotoxicidade
AU2013285355A1 (en) 2012-07-06 2015-01-29 Genmab B.V. Dimeric protein with triple mutations
JOP20200236A1 (ar) 2012-09-21 2017-06-16 Regeneron Pharma الأجسام المضادة لمضاد cd3 وجزيئات ربط الأنتيجين ثنائية التحديد التي تربط cd3 وcd20 واستخداماتها
TWI635098B (zh) 2013-02-01 2018-09-11 再生元醫藥公司 含嵌合恆定區之抗體
TWI701042B (zh) 2014-03-19 2020-08-11 美商再生元醫藥公司 用於腫瘤治療之方法及抗體組成物
ES2900898T3 (es) * 2014-04-07 2022-03-18 Chugai Pharmaceutical Co Ltd Anticuerpos biespecíficos inmunoactivadores
CA2947157A1 (en) 2014-05-13 2015-11-19 Chugai Seiyaku Kabushiki Kaisha T cell-redirected antigen-binding molecule for cells having immunosuppression function
AU2015350075B2 (en) 2014-11-17 2021-06-03 Regeneron Pharmaceuticals, Inc. Methods for tumor treatment using CD3xCD20 bispecific antibody
US10556952B2 (en) 2015-03-30 2020-02-11 Regeneron Pharmaceuticals, Inc. Heavy chain constant regions with reduced binding to Fc gamma receptors
TWI784917B (zh) 2015-09-23 2022-11-21 美商再生元醫藥公司 最優化抗cd3雙特異性抗體及其用途
EP3371311B1 (en) 2015-11-06 2021-07-21 Orionis Biosciences BV Bi-functional chimeric proteins and uses thereof
WO2017086367A1 (ja) 2015-11-18 2017-05-26 中外製薬株式会社 免疫抑制機能を有する細胞に対するt細胞リダイレクト抗原結合分子を用いた併用療法
JP6925278B2 (ja) 2015-11-18 2021-08-25 中外製薬株式会社 液性免疫応答の増強方法
DK3411398T3 (da) 2016-02-05 2024-06-24 Orionis Biosciences BV Målrettede terapeutiske midler og anvendelse heraf
CA3046489A1 (en) 2016-12-07 2018-06-14 Progenity Inc. Gastrointestinal tract detection methods, devices and systems
US10906985B2 (en) 2017-02-06 2021-02-02 Orionis Biosciences, Inc. Targeted engineered interferon and uses thereof
US20210138213A1 (en) 2017-03-30 2021-05-13 Progenity, Inc. Treatment of a disease of the gastrointestinal tract with an immune modulatory agent released using an ingestible device
US11542330B2 (en) * 2017-05-08 2023-01-03 Adimab, Llc Anti-CD3-binding domains and antibodies comprising them, and methods for their generation and use
US20190100587A1 (en) * 2017-10-02 2019-04-04 Covagen Ag IgG1 Fc MUTANTS WITH ABLATED EFFECTOR FUNCTIONS
CN107860925B (zh) * 2017-11-03 2019-07-12 合肥瀚科迈博生物技术有限公司 用于检测血清中HuA21抗体的ELISA检测试剂盒
WO2019160904A1 (en) * 2018-02-15 2019-08-22 Macrogenics, Inc. Variant cd3-binding domains and their use in combination therapies for the treatment of disease
CA3093330A1 (en) * 2018-03-14 2019-09-19 Novimmune Sa Anti-cd3 epsilon antibodies and methods of use thereof
PL3797121T3 (pl) * 2018-05-23 2024-09-23 Pfizer Inc. Przeciwciała swoiste dla CD3 i ich zastosowania
MX420253B (es) * 2018-05-24 2025-02-10 Janssen Biotech Inc Anticuerpos anti-cd3 y usos de estos.
WO2019246312A1 (en) 2018-06-20 2019-12-26 Progenity, Inc. Treatment of a disease of the gastrointestinal tract with an immunomodulator
WO2019246317A1 (en) 2018-06-20 2019-12-26 Progenity, Inc. Treatment of a disease or condition in a tissue originating from the endoderm
IL280875B2 (en) 2018-08-31 2024-12-01 Regeneron Pharma Dosing strategy that mitigates cytokine release syndrome for cd3/c20 bispecific antibodies
CN116726361A (zh) 2018-11-19 2023-09-12 比奥拉治疗股份有限公司 用生物治疗剂治疗疾病的方法和装置
AU2019339582A1 (en) * 2018-12-04 2021-06-17 Novartis Ag Binding molecules against CD3 and uses thereof
TWI905099B (zh) 2019-05-21 2025-11-21 瑞士商諾華公司 Cd19 結合分子及其用途
WO2021119482A1 (en) 2019-12-13 2021-06-17 Progenity, Inc. Ingestible device for delivery of therapeutic agent to the gastrointestinal tract
AU2020411480B2 (en) 2019-12-23 2023-12-21 Denali Therapeutics Inc. Progranulin variants
CN113563473A (zh) * 2020-04-29 2021-10-29 三生国健药业(上海)股份有限公司 四价双特异性抗体、其制备方法和用途
IL298444A (en) 2020-05-27 2023-01-01 Janssen Biotech Inc Proteins containing cd3 antigen binding sites and uses thereof
KR102671734B1 (ko) * 2021-04-13 2024-06-04 건국대학교 글로컬산학협력단 개과 동물의 CD3ε 특이적 항체 또는 그의 항원 결합 단편
CN115558023A (zh) * 2021-07-02 2023-01-03 安源医药科技(上海)有限公司 抗cd3抗体及其用途
CN119212716A (zh) * 2022-05-09 2024-12-27 杭州微诺迈博生物科技有限公司 包含多特异性抗体的治疗剂及其在肿瘤治疗中的应用
EP4695308A1 (en) * 2023-09-14 2026-02-18 Invitrogen BioServices India Private Limited Engineered antibodies and uses thereof
WO2025061993A1 (en) 2023-09-21 2025-03-27 Domain Therapeutics Anti-ccr8 monoclonal antibodies and their therapeutic use
WO2025061994A1 (en) 2023-09-21 2025-03-27 Domain Therapeutics Anti-ccr8 monoclonal antibodies and their therapeutic use

Citations (42)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4699880A (en) 1984-09-25 1987-10-13 Immunomedics, Inc. Method of producing monoclonal anti-idiotype antibody
US5057313A (en) 1986-02-25 1991-10-15 The Center For Molecular Medicine And Immunology Diagnostic and therapeutic antibody conjugates
WO1992022653A1 (en) 1991-06-14 1992-12-23 Genentech, Inc. Method for making humanized antibodies
EP0629240A1 (en) 1992-02-19 1994-12-21 Scotgen Limited Altered antibodies, products and processes relating thereto
US5589466A (en) 1989-03-21 1996-12-31 Vical Incorporated Induction of a protective immune response in a mammal by injecting a DNA sequence
WO1998050431A2 (en) 1997-05-02 1998-11-12 Genentech, Inc. A method for making multispecific antibodies having heteromultimeric and common components
US5973972A (en) 1995-11-03 1999-10-26 Samsung Electronics, Co., Ltd. Precharge system for a semiconductor memory device
US6077835A (en) 1994-03-23 2000-06-20 Case Western Reserve University Delivery of compacted nucleic acid to cells
WO2000046147A2 (en) 1999-02-03 2000-08-10 Biosante Pharmaceuticals, Inc. Therapeutic calcium phosphate particles and methods of manufacture and use
WO2000070087A1 (en) 1999-05-14 2000-11-23 Copernicus Therapeutics, Inc. Automated nucleic acid compaction device
US6331175B1 (en) 1985-07-05 2001-12-18 Immunomedics, Inc. Method and kit for imaging and treating organs and tissues
WO2002020039A2 (de) 2000-09-04 2002-03-14 Horst Lindhofer Verwendung von trifunktionellen bispezifischen und trispezifischen antikörpern zur behandlung von malignem aszites
WO2007042261A2 (en) * 2005-10-11 2007-04-19 Micromet Ag Compositions comprising cross-species-specific antibodies and uses thereof
WO2007059782A1 (en) 2005-11-28 2007-05-31 Genmab A/S Recombinant monovalent antibodies and methods for production thereof
US7262028B2 (en) 2002-07-18 2007-08-28 Crucell Holland B.V. Recombinant production of mixtures of antibodies
WO2007110205A2 (en) 2006-03-24 2007-10-04 Merck Patent Gmbh Engineered heterodimeric protein domains
EP1870459A1 (en) 2005-03-31 2007-12-26 Chugai Seiyaku Kabushiki Kaisha Methods for producing polypeptides by regulating polypeptide association
WO2008003116A2 (en) 2006-07-05 2008-01-10 F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. Method for engineering immunoglobulins
WO2008119567A2 (en) 2007-04-03 2008-10-09 Micromet Ag Cross-species-specific cd3-epsilon binding domain
WO2008157379A2 (en) 2007-06-21 2008-12-24 Macrogenics, Inc. Covalent diabodies and uses thereof
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
WO2010015792A1 (en) 2008-08-06 2010-02-11 Argenta Discovery Limited Nitrogen containing heterocyclic compounds useful as bifunctional modulators of m3 receptors and beta-2 receptors
WO2010022692A1 (de) 2008-08-27 2010-03-04 Continental Automotive Gmbh Verfahren zur ermittlung eines unfallschwerekriteriums mittels eines beschleunigungssignals und eines körperschallsignals
US20100155133A1 (en) 2005-01-13 2010-06-24 The Wiremold Company Downward facing receptacle assembly for cable raceway
WO2010080538A1 (en) 2008-12-19 2010-07-15 Macrogenics, Inc. Covalent diabodies and uses thereof
WO2010129304A2 (en) 2009-04-27 2010-11-11 Oncomed Pharmaceuticals, Inc. Method for making heteromultimeric molecules
WO2011028952A1 (en) 2009-09-02 2011-03-10 Xencor, Inc. Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens
US7951918B2 (en) 2006-03-17 2011-05-31 Biogen Idec Ma Inc. Stabilized polypeptide compositions
WO2011066501A1 (en) 2009-11-30 2011-06-03 Centocor Ortho Biotech Inc. Antibody fc mutants with ablated effector functions
WO2011117329A1 (en) 2010-03-26 2011-09-29 F. Hoffmann-La Roche Ag Bispecific, bivalent anti-vegf/anti-ang-2 antibodies
WO2011131746A2 (en) 2010-04-20 2011-10-27 Genmab A/S Heterodimeric antibody fc-containing proteins and methods for production thereof
WO2011143545A1 (en) 2010-05-14 2011-11-17 Rinat Neuroscience Corporation Heterodimeric proteins and methods for producing and purifying them
CN102250246A (zh) 2011-06-10 2011-11-23 常州亚当生物技术有限公司 抗VEGF/PDGFRβ双特异性抗体及其应用
WO2011147986A1 (en) 2010-05-27 2011-12-01 Genmab A/S Monoclonal antibodies against her2
WO2012025530A1 (en) 2010-08-24 2012-03-01 F. Hoffmann-La Roche Ag Bispecific antibodies comprising a disulfide stabilized - fv fragment
WO2012025525A1 (en) 2010-08-24 2012-03-01 Roche Glycart Ag Activatable bispecific antibodies
WO2012058768A1 (en) 2010-11-05 2012-05-10 Zymeworks Inc. Stable heterodimeric antibody design with mutations in the fc domain
WO2012113813A1 (en) * 2011-02-23 2012-08-30 F. Hoffmann-La Roche Ag Antibodies against human il33r and uses thereof
WO2012143524A2 (en) 2011-04-20 2012-10-26 Genmab A/S Bispecific antibodies against her2 and cd3
WO2012162067A2 (en) 2011-05-21 2012-11-29 Macrogenics, Inc. Cd3-binding molecules capable of binding to human and non-human cd3
WO2013060867A2 (en) 2011-10-27 2013-05-02 Genmab A/S Production of heterodimeric proteins

Family Cites Families (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
PL216630B1 (pl) * 2002-10-17 2014-04-30 Genmab As Izolowane ludzkie przeciwciało monoklonalne wiążące ludzki CD20, związane z tym przeciwciałem transfektoma, komórka gospodarza, transgeniczne zwierzę lub roślina, kompozycja, immunokoniugat, cząsteczka bispecyficzna, wektor ekspresyjny, kompozycja farmaceutyczna, zastosowanie medyczne, zestaw oraz przeciwciało antyidiotypowe i jego zastosowanie
CN1942483B (zh) 2004-04-13 2012-09-26 弗·哈夫曼-拉罗切有限公司 抗p型选凝素抗体
US7850962B2 (en) 2004-04-20 2010-12-14 Genmab A/S Human monoclonal antibodies against CD20
JP2008528668A (ja) 2005-02-03 2008-07-31 アンチトープ リミテッド ヒト抗体及びタンパク質
EP1860120B1 (en) 2005-02-08 2018-01-24 The Chemo-Sero-Therapeutic Research Institute Method for improving antibody
EP2500352A1 (en) 2005-08-19 2012-09-19 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
AU2008234019B2 (en) * 2007-04-03 2014-05-29 Amgen Research (Munich) Gmbh Cross-species-specific bispecific binders
JP5397668B2 (ja) 2008-09-02 2014-01-22 ソニー株式会社 記憶素子および記憶装置
FR2935974B1 (fr) 2008-09-15 2010-10-08 Centre Nat Rech Scient Derives de metalloporphyrines, nanoparticules les comprenant
AU2009299794B2 (en) * 2008-10-01 2015-08-13 Amgen Research (Munich) Gmbh Cross-species-specific single domain bispecific single chain antibody
WO2010045340A1 (en) 2008-10-14 2010-04-22 Centocor Ortho Biotech Inc. Methods of humanizing and affinity-maturing antibodies
US8786135B2 (en) 2010-03-25 2014-07-22 Mitsubishi Electric Research Laboratories, Inc. Wireless energy transfer with anisotropic metamaterials
TWI653333B (zh) * 2010-04-01 2019-03-11 安進研究(慕尼黑)有限責任公司 跨物種專一性之PSMAxCD3雙專一性單鏈抗體
BR112013000796B1 (pt) 2010-07-14 2021-08-31 Merck Sharp & Dohme Corp Anticorpo isolado ou um fragmento de ligação ao antígeno, composição farmacêutica, métodos para inibir a montagem de ligantes difusíveis derivados de ß-amiloide, para inibir a fosforilação de proteína tau em ser202/thr205, para identificar um suposto agente terapêutico, para detectar ligantes difusíveis derivados de ß-amiloide e para diagnosticar uma doença associada aos ligantes difusíveis derivados de ß-amiloide, e, kit para detectar ligantes difusíveis derivados de ß-amiloide
TW201208703A (en) * 2010-08-17 2012-03-01 Roche Glycart Ag Combination therapy of an afucosylated CD20 antibody with an anti-VEGF antibody
PT3434767T (pt) * 2010-11-30 2026-01-23 Chugai Pharmaceutical Co Ltd Agente terapêutico indutor de citotoxicidade
CN108517010A (zh) 2012-01-27 2018-09-11 普罗典娜生物科学有限公司 识别α-突触核蛋白的人源化抗体
AU2013285355A1 (en) * 2012-07-06 2015-01-29 Genmab B.V. Dimeric protein with triple mutations
HUE048722T2 (hu) 2013-07-05 2020-08-28 Genmab As Humanizált vagy kiméra CD3 ellenanyagok
US20160355588A1 (en) * 2013-07-12 2016-12-08 Zymeworks Inc. Bispecific CD3 and CD19 Antigen Binding Constructs
KR102225489B1 (ko) * 2013-12-17 2021-03-10 제넨테크, 인크. 항-cd3 항체 및 이의 사용 방법
UA120286C2 (uk) * 2015-01-08 2019-11-11 Ґенмаб А/С Біспецифічне антитіло проти cd3 і cd20
AU2016293073B2 (en) 2015-07-15 2022-12-22 Genmab A/S Humanized or chimeric CD3 antibodies
CH713600A2 (de) 2017-03-21 2018-09-28 Digi Sens Ag Vorrichtung und Verfahren zum Messen einer Last.
EP3668898B1 (en) * 2017-08-14 2023-07-05 MorphoSys AG Humanized antibodies for cd3
CN116406293A (zh) * 2020-09-10 2023-07-07 健玛保 用于治疗滤泡性淋巴瘤的联合疗法中的针对cd3和cd20的双特异性抗体
US20240034812A1 (en) * 2020-09-10 2024-02-01 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma
JP2023541858A (ja) * 2020-09-10 2023-10-04 ジェンマブ エー/エス 慢性リンパ球性白血病を治療するためのcd3及びcd20に対する二重特異性抗体
JP2023542291A (ja) * 2020-09-10 2023-10-06 ジェンマブ エー/エス びまん性大細胞型b細胞リンパ腫を治療するための併用療法におけるcd3及びcd20に対する二重特異性抗体

Patent Citations (43)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4699880A (en) 1984-09-25 1987-10-13 Immunomedics, Inc. Method of producing monoclonal anti-idiotype antibody
US6331175B1 (en) 1985-07-05 2001-12-18 Immunomedics, Inc. Method and kit for imaging and treating organs and tissues
US5057313A (en) 1986-02-25 1991-10-15 The Center For Molecular Medicine And Immunology Diagnostic and therapeutic antibody conjugates
US5589466A (en) 1989-03-21 1996-12-31 Vical Incorporated Induction of a protective immune response in a mammal by injecting a DNA sequence
WO1992022653A1 (en) 1991-06-14 1992-12-23 Genentech, Inc. Method for making humanized antibodies
EP0629240A1 (en) 1992-02-19 1994-12-21 Scotgen Limited Altered antibodies, products and processes relating thereto
US6077835A (en) 1994-03-23 2000-06-20 Case Western Reserve University Delivery of compacted nucleic acid to cells
US5973972A (en) 1995-11-03 1999-10-26 Samsung Electronics, Co., Ltd. Precharge system for a semiconductor memory device
WO1998050431A2 (en) 1997-05-02 1998-11-12 Genentech, Inc. A method for making multispecific antibodies having heteromultimeric and common components
WO2000046147A2 (en) 1999-02-03 2000-08-10 Biosante Pharmaceuticals, Inc. Therapeutic calcium phosphate particles and methods of manufacture and use
WO2000070087A1 (en) 1999-05-14 2000-11-23 Copernicus Therapeutics, Inc. Automated nucleic acid compaction device
WO2002020039A2 (de) 2000-09-04 2002-03-14 Horst Lindhofer Verwendung von trifunktionellen bispezifischen und trispezifischen antikörpern zur behandlung von malignem aszites
US7262028B2 (en) 2002-07-18 2007-08-28 Crucell Holland B.V. Recombinant production of mixtures of antibodies
US20100155133A1 (en) 2005-01-13 2010-06-24 The Wiremold Company Downward facing receptacle assembly for cable raceway
EP1870459A1 (en) 2005-03-31 2007-12-26 Chugai Seiyaku Kabushiki Kaisha Methods for producing polypeptides by regulating polypeptide association
US7612181B2 (en) 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
WO2007042261A2 (en) * 2005-10-11 2007-04-19 Micromet Ag Compositions comprising cross-species-specific antibodies and uses thereof
US8236308B2 (en) 2005-10-11 2012-08-07 Micromet Ag Composition comprising cross-species-specific antibodies and uses thereof
WO2007059782A1 (en) 2005-11-28 2007-05-31 Genmab A/S Recombinant monovalent antibodies and methods for production thereof
US7951918B2 (en) 2006-03-17 2011-05-31 Biogen Idec Ma Inc. Stabilized polypeptide compositions
WO2007110205A2 (en) 2006-03-24 2007-10-04 Merck Patent Gmbh Engineered heterodimeric protein domains
WO2008003116A2 (en) 2006-07-05 2008-01-10 F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. Method for engineering immunoglobulins
WO2008119567A2 (en) 2007-04-03 2008-10-09 Micromet Ag Cross-species-specific cd3-epsilon binding domain
WO2008157379A2 (en) 2007-06-21 2008-12-24 Macrogenics, Inc. Covalent diabodies and uses thereof
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
WO2010015792A1 (en) 2008-08-06 2010-02-11 Argenta Discovery Limited Nitrogen containing heterocyclic compounds useful as bifunctional modulators of m3 receptors and beta-2 receptors
WO2010022692A1 (de) 2008-08-27 2010-03-04 Continental Automotive Gmbh Verfahren zur ermittlung eines unfallschwerekriteriums mittels eines beschleunigungssignals und eines körperschallsignals
WO2010080538A1 (en) 2008-12-19 2010-07-15 Macrogenics, Inc. Covalent diabodies and uses thereof
WO2010129304A2 (en) 2009-04-27 2010-11-11 Oncomed Pharmaceuticals, Inc. Method for making heteromultimeric molecules
WO2011028952A1 (en) 2009-09-02 2011-03-10 Xencor, Inc. Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens
WO2011066501A1 (en) 2009-11-30 2011-06-03 Centocor Ortho Biotech Inc. Antibody fc mutants with ablated effector functions
WO2011117329A1 (en) 2010-03-26 2011-09-29 F. Hoffmann-La Roche Ag Bispecific, bivalent anti-vegf/anti-ang-2 antibodies
WO2011131746A2 (en) 2010-04-20 2011-10-27 Genmab A/S Heterodimeric antibody fc-containing proteins and methods for production thereof
WO2011143545A1 (en) 2010-05-14 2011-11-17 Rinat Neuroscience Corporation Heterodimeric proteins and methods for producing and purifying them
WO2011147986A1 (en) 2010-05-27 2011-12-01 Genmab A/S Monoclonal antibodies against her2
WO2012025530A1 (en) 2010-08-24 2012-03-01 F. Hoffmann-La Roche Ag Bispecific antibodies comprising a disulfide stabilized - fv fragment
WO2012025525A1 (en) 2010-08-24 2012-03-01 Roche Glycart Ag Activatable bispecific antibodies
WO2012058768A1 (en) 2010-11-05 2012-05-10 Zymeworks Inc. Stable heterodimeric antibody design with mutations in the fc domain
WO2012113813A1 (en) * 2011-02-23 2012-08-30 F. Hoffmann-La Roche Ag Antibodies against human il33r and uses thereof
WO2012143524A2 (en) 2011-04-20 2012-10-26 Genmab A/S Bispecific antibodies against her2 and cd3
WO2012162067A2 (en) 2011-05-21 2012-11-29 Macrogenics, Inc. Cd3-binding molecules capable of binding to human and non-human cd3
CN102250246A (zh) 2011-06-10 2011-11-23 常州亚当生物技术有限公司 抗VEGF/PDGFRβ双特异性抗体及其应用
WO2013060867A2 (en) 2011-10-27 2013-05-02 Genmab A/S Production of heterodimeric proteins

Non-Patent Citations (60)

* Cited by examiner, † Cited by third party
Title
"Fundamental Immunology", 1989, RAVEN PRESS
"Radiolabeled Monoclonal Antibodies For Imaging And Therapy", 1988, PLENUM PRESS
"Remington: The Science and Practice of Pharmacy", 1995, MACK PUBLISHING CO.
"Sustained and Controlled Release Drug Delivery Systems", 1978, MARCEL DEKKER, INC.
BARBAS, CF, J MOL BIOL., vol. 230, no. 3, 5 April 1993 (1993-04-05), pages 812 - 23
BENVENISTY; RESHEF, PNAS USA, vol. 83, 1986, pages 9551 - 55
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BOKEMEYER ET AL., J CLIN ONCOL (MEETING ABSTRACTS, 2009, pages 3036
BREKKE ET AL., J IMMUNOL, vol. 177, 2006, pages 1129 - 1138
BROCHET, X. ET AL., NUCI.ACIDS RES., vol. 36, 2008, pages W503 - 508
BROWN ET AL.: "Biotechnology And Pharmacy", 1993, CHAPMAN & HALL, article "Clinical Use of Monoclonal Antibodies", pages: 227 - 49
BRUHNS ET AL., BLOOD, vol. 113, 2009, pages 3716 - 3725
BRYSON ET AL., BIODRUGS, vol. 24, no. 1, 2010, pages 1 - 8
CANFIELD ET AL., J. EXP.MED., 1991, pages 1483 - 91
CHASE ET AL.: "Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING CO., article "Medical Applications of Radioisotopes", pages: 624 - 652
CORARO; PEARSON, SOMATIC CELL GENETICS, vol. 7, 1981, pages 603
DALL'ACQUA WF ET AL., J IMMUNOL, vol. 177, 2006, pages 1129 - 1138
DUNCAN ET AL., NATURE, 1988, pages 738 - 40
E. MEYERS; W. MILLER, COMPUT. APPL. BIOSCI, vol. 4, 1988, pages 11 - 17
F. AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1987, GREENE PUBLISHING AND WILEY INTERSCIENCE
GIUDICELLI, V.; BROCHET, X; LEFRANC, M.-P., COLD SPRING HARB PROTOC., vol. 2011, no. 6, 1 June 2011 (2011-06-01)
GRAMER ET AL., MABS, vol. 5, 2013, pages 962 - 973
GRANT ET AL., METHODS IN ENZYMOL, vol. 153, 1987, pages 516 - 544
HEISS ET AL., INT J CANCER, vol. 127, 2010, pages 2209 - 2221
HEROLD ET AL., DIABETES, vol. 54, no. 6, 2005, pages 1763 - 9
HEZAREH M ET AL: "Effector function activities of a panel of mutants of a broadly neutralizing antibody against human immunodeficiency virus type 1", JOURNAL OF VIROLOGY, THE AMERICAN SOCIETY FOR MICROBIOLOGY, US, vol. 75, no. 24, 1 December 2001 (2001-12-01), pages 12161 - 12168, XP002339184, ISSN: 0022-538X, DOI: 10.1128/JVI.75.24.12161-12168.2001 *
HUSTON ET AL., PNAS USA, vol. 85, 1988, pages 5879 - 5883
IDUSOGIE EE ET AL., J IMMUNOL., vol. 164, 2000, pages 4178 - 84
JING LI: "Phase I trial of a humanized, Fc receptor nonbinding anti-CD3 antibody, hu12F6mu in patients receiving renal allografts", MABS, vol. 2, no. 4, 10 August 2010 (2010-08-10), pages 449 - 556, XP055101687 *
JONES ET AL., LANCET ONCOL, vol. 10, 2009, pages 1179 - 1187
KABAT, E.A. ET AL.: "Sequences of proteins of immunological interest", 1991, NIH PUBLICATION NO. 91-3242, pages: 662,680,
KIEWE ET AL., CLIN CANCER RES, vol. 12, 2006, pages 3085 - 3091
LABRIJN ET AL., PNAS, vol. 110, 2013, pages 5145 - 50
LEABMAN ET AL., MABS, vol. 5, no. 6, 2013, pages 896 - 903
LEFRANC MP ET AL., DEV COMP IMMUNOL., vol. 27, no. 1, January 2003 (2003-01-01), pages 55 - 77
LI BOHUA ET AL: "Construction and characterization of a humanized anti-human CD3 monoclonal antibody 12F6 with effective immunoregulation functions", IMMUNOLOGY, BLACKWELL PUBLISHING, OXFORD, GB, vol. 116, no. 4, 1 December 2005 (2005-12-01), pages 487 - 498, XP002600947, ISSN: 0019-2805, [retrieved on 20051007], DOI: 10.1111/J.1365-2567.2005.02247.X *
LIGHTLE, S. ET AL., PROTEIN SCIENCE, 2010, pages 753 - 62
LINKE ET AL., MABS, vol. 2, 2010, pages 129 - 136
LUIS E. HINOJOSA ET AL: "Construction of a Recombinant Non-Mitogenic Anti-Human CD3 Antibody", HYBRIDOMA, vol. 29, no. 2, 1 April 2010 (2010-04-01), pages 115 - 124, XP055101580, ISSN: 1554-0014, DOI: 10.1089/hyb.2009.0042 *
LUM; THAKUR, BIODRUGS, vol. 25, 2011, pages 365 - 379
MULLER; KONTERMANN, BIODRUGS, vol. 24, 2010, pages 89 - 98
NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 444 - 453
OGANESYAN ET AL., ACTA CRYST., 2008, pages 700 - 4
PARREN ET AL., J. CLIN INVEST., vol. 90, 1992, pages 1537 - 1546
PARREN ET AL., RES IMMUNOL., vol. 142, no. 9, 1991, pages 749 - 63
PERRY ET AL., DRUGS R D, vol. 9, no. 6, 2008, pages 385 - 396
RITTER G ET AL., CANCER RES., vol. 61, 2001, pages 6851 - 9
RUF ET AL., BR J CLIN PHARMACOL, vol. 69, 2010, pages 617 - 625
SAMBROOK ET AL.: "Molecular Cloning: A laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
SCHAKOWSKI ET AL., MOL THER, vol. 3, 2001, pages 793 - 800
SHIELDS ET AL., J. BIOL. CHEM., 2001, pages 6591 - 604
STAERZ, NATURE, vol. 314, 1985, pages 628 - 631
SYKES; JOHNSTON, NAT BIOTECH, vol. 17, 1997, pages 355 - 59
T CELL EPITOPE DATABASE, Retrieved from the Internet <URL:http://www.iedb.org>
THOMPSON: "Clustal W algorithm", 1994
VAN HEEKE; SCHUSTER, J BIOL CHEM, vol. 264, 1989, pages 5503 - 5509
WIGLER ET AL., CELL, vol. 14, 1978, pages 725
WOODLE E STEVE ET AL: "Phase I trial of a humanized, Fc receptor nonbinding OKT3 antibody, huOKT3gamma1(Ala-Ala) in the treatment of acute renal allograft rejection", TRANSPLANTATION, WILLIAMS AND WILKINS, BALTIMORE US, vol. 68, no. 5, 15 September 1999 (1999-09-15), pages 608 - 616, XP009134473, ISSN: 0041-1337 *
WU ET AL.: "Antibody Engineering", 2010, SPRINGER, article "Generation and Characterization of a Dual Variable Domain Immunoglobulin (DVD-IgTM) Molecule"
XU ET AL., CELL IMMUNOL., vol. 200, no. 1, 2000, pages 16 - 26

Cited By (122)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11161906B2 (en) 2013-07-25 2021-11-02 Cytomx Therapeutics, Inc. Multispecific antibodies, multispecific activatable antibodies and methods of using the same
US10407501B2 (en) 2014-01-09 2019-09-10 Genmab A/S Humanized or chimeric CD3 antibodies
US11613575B2 (en) 2014-01-09 2023-03-28 Genmab A/S Humanized or chimeric CD3 antibodies
WO2015104346A1 (en) * 2014-01-09 2015-07-16 Genmab B.V. Humanized or chimeric cd3 antibodies
US11802158B2 (en) 2014-07-25 2023-10-31 Cytomx Therapeutics, Inc. Bispecific anti-CD3 antibodies, bispecific activatable anti-CD3 antibodies, and methods of using the same
US10669337B2 (en) 2014-07-25 2020-06-02 Cytomx Therapeutics, Inc. Bispecific anti-CD3 antibodies, bispecific activatable anti-CD3 antibodies, and methods of using the same
US12139553B2 (en) 2014-11-20 2024-11-12 Hoffmann-La Roche Inc. T cell activating bispecific antigen binding molecules
US12103982B2 (en) 2014-11-20 2024-10-01 Hoffmann-La Roche Inc. T cell activating bispecific antigen binding molecules
EP4678661A2 (en) 2015-01-08 2026-01-14 Genmab A/S Bispecific antibodies against cd3 and cd20
JP2025081581A (ja) * 2015-04-13 2025-05-27 ファイザー・インク 治療抗体およびその使用
CN114989302B (zh) * 2015-07-15 2025-08-05 根马布股份公司 人源化或嵌合cd3抗体
CN114989302A (zh) * 2015-07-15 2022-09-02 根马布股份公司 人源化或嵌合cd3抗体
JP2018526981A (ja) * 2015-07-15 2018-09-20 ゲンマブ エー/エス ヒト化またはキメラcd3抗体
IL256562B2 (en) * 2015-07-15 2024-07-01 Genmab As Human CD3 antibodies or chimeras
JP2022023862A (ja) * 2015-07-15 2022-02-08 ゲンマブ エー/エス ヒト化またはキメラcd3抗体
IL256562B1 (en) * 2015-07-15 2024-03-01 Genmab As Humanized or chimeric cd3 antibodies
CN108368172B (zh) * 2015-07-15 2022-06-14 根马布股份公司 人源化或嵌合cd3抗体
US11359015B2 (en) 2015-07-15 2022-06-14 Genmab A/S Humanized or chimeric CD3 antibodies
CN108368172A (zh) * 2015-07-15 2018-08-03 根马布股份公司 人源化或嵌合cd3抗体
WO2017009442A1 (en) * 2015-07-15 2017-01-19 Genmab A/S Humanized or chimeric cd3 antibodies
KR102786353B1 (ko) * 2015-07-15 2025-03-26 젠맵 에이/에스 인간화 또는 키메라 cd3 항체
JP2025038049A (ja) * 2015-07-15 2025-03-18 ジェンマブ エー/エス ヒト化またはキメラcd3抗体
JP7604351B2 (ja) 2015-07-15 2024-12-23 ジェンマブ エー/エス ヒト化またはキメラcd3抗体
AU2016293073B2 (en) * 2015-07-15 2022-12-22 Genmab A/S Humanized or chimeric CD3 antibodies
KR20180030635A (ko) * 2015-07-15 2018-03-23 젠맵 에이/에스 인간화 또는 키메라 cd3 항체
CN105296421A (zh) * 2015-11-24 2016-02-03 高岱清 一种双特异性抗体活化的t细胞及制备方法与应用
CN105296421B (zh) * 2015-11-24 2019-01-29 高岱清 一种双特异性抗体活化的t细胞及制备方法与应用
EP4026848A1 (en) 2015-12-09 2022-07-13 F. Hoffmann-La Roche AG Type ii anti-cd20 antibody for reducing the cytokine release syndrome
WO2017162587A1 (en) * 2016-03-22 2017-09-28 F. Hoffmann-La Roche Ag Protease-activated t cell bispecific molecules
RU2830288C2 (ru) * 2016-03-22 2024-11-18 Ф. Хоффманн-Ля Рош Аг Активируемые протеазой связывающие т-клетки биспецифические молекулы
IL260637B2 (en) * 2016-03-22 2023-08-01 Hoffmann La Roche Bi-specific molecules for activated t cells-protease
IL260637B1 (en) * 2016-03-22 2023-04-01 Hoffmann La Roche Bi-specific molecules for activated t cells-protease
US11242390B2 (en) 2016-03-22 2022-02-08 Hoffmann-La Roche Inc. Protease-activated T cell bispecific molecules
EP3252078A1 (en) 2016-06-02 2017-12-06 F. Hoffmann-La Roche AG Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer
WO2017220990A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 antibodies
WO2017220988A1 (en) 2016-06-20 2017-12-28 Kymab Limited Multispecific antibodies for immuno-oncology
WO2017220989A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
WO2018011421A1 (en) * 2016-07-14 2018-01-18 Genmab A/S Multispecific antibodies against cd40 and cd137
US11091557B2 (en) 2016-07-14 2021-08-17 Genmab A/S Methods of producing multispecific antibodies against CD40 and CD137
US11084882B2 (en) 2016-07-14 2021-08-10 Genmab A/S Multispecific antibodies against CD40 and CD137
IL264142B1 (en) * 2016-07-14 2025-04-01 Genmab As Multispecific antibodies against CD40 and CD137
US11440966B2 (en) 2016-07-14 2022-09-13 Genmab A/S Multispecific antibodies against CD40 and CD137
AU2017296095B2 (en) * 2016-07-14 2024-05-02 BioNTech SE Multispecific antibodies against CD40 and CD137
US11939388B2 (en) 2016-07-14 2024-03-26 Genmab A/S Multispecific antibodies against CD40 and CD137
US12077596B2 (en) 2016-07-14 2024-09-03 Genmab A/S Multispecific antibodies against CD40 and CD137
IL264142B2 (en) * 2016-07-14 2025-08-01 Genmab As Multispecific antibodies against cd40 and cd137
WO2018162749A1 (en) 2017-03-09 2018-09-13 Genmab A/S Antibodies against pd-l1
EP4527854A3 (en) * 2017-03-09 2025-06-25 Genmab A/S Antibodies against pd-l1
EP4527854A2 (en) 2017-03-09 2025-03-26 Genmab A/S Antibodies against pd-l1
EP3409322A1 (en) 2017-06-01 2018-12-05 F. Hoffmann-La Roche AG Treatment method
WO2018219901A1 (en) 2017-06-01 2018-12-06 F. Hoffmann-La Roche Ag Treatment method
WO2018220099A1 (en) 2017-06-02 2018-12-06 F. Hoffmann-La Roche Ag Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer
US10882907B2 (en) 2017-06-21 2021-01-05 Gilead Sciences, Inc. Multispecific antibodies that target HIV GP120 and CD3
US11597759B2 (en) 2017-06-21 2023-03-07 Gilead Sciences, Inc. Multispecific antibodies that target HIV GP120 and CD3
US12570751B2 (en) 2017-08-04 2026-03-10 Genmab A/S Binding agents binding to PD-L1 and CD137 and use thereof
US11472880B2 (en) 2017-08-14 2022-10-18 Morphosys Ag Humanized antibodies for CD3
WO2019034580A1 (en) 2017-08-14 2019-02-21 Morphosys Ag HUMANIZED ANTIBODIES FOR CD3
US11472889B2 (en) 2017-10-14 2022-10-18 Cytomx Therapeutics, Inc. Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof
US11859010B2 (en) 2017-10-14 2024-01-02 Cytomx Therapeutics, Inc. Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof
US12460017B2 (en) 2017-10-14 2025-11-04 Cytomx Therapeutics, Inc. Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof
US11498965B2 (en) 2017-10-20 2022-11-15 Green Cross Corporation Anti-CD3 antibody and pharmaceutical composition for cancer treatment comprising same
JP2021510081A (ja) * 2017-12-28 2021-04-15 上海細胞治療集団有限公司Shanghai Cell Therapy Group Co., Ltd. 抗体修飾キメラ抗原受容体修飾t細胞及びその使用
US12358994B2 (en) 2017-12-28 2025-07-15 Shanghai Cell Therapy Group Co., Ltd. Antibody-modified chimeric antigen receptor modified T cell and uses thereof
EP3733839A4 (en) * 2017-12-28 2021-09-29 Shanghai Cell Therapy Group Co., Ltd T-CELL MODIFIED BY ANTIBODY MODIFIED ANTIBODY ANTIGEN RECEIVER AND THEIR USES
JP7431171B2 (ja) 2017-12-28 2024-02-14 上海細胞治療集団有限公司 抗体修飾キメラ抗原受容体修飾t細胞及びその使用
US11130819B2 (en) 2018-03-12 2021-09-28 Genmab A/S Antibodies
US11970544B2 (en) 2018-03-12 2024-04-30 Genmab A/S Antibodies
WO2019175198A2 (en) 2018-03-12 2019-09-19 Genmab A/S Antibodies
US11008399B2 (en) 2018-03-12 2021-05-18 Genmab A/S Antibodies
WO2020076977A2 (en) 2018-10-11 2020-04-16 Inhibrx, Inc. Dll3 single domain antibodies and therapeutic compositions thereof
US11945869B2 (en) 2018-10-11 2024-04-02 Inhibrx, Inc. PD-1 single domain antibodies and therapeutic compositions thereof
US12297271B2 (en) 2018-10-11 2025-05-13 Inhibrx Biosciences, Inc. PD-1 single domain antibodies and therapeutic compositions thereof
US11208485B2 (en) 2018-10-11 2021-12-28 Inhibrx, Inc. PD-1 single domain antibodies and therapeutic compositions thereof
WO2020076970A1 (en) 2018-10-11 2020-04-16 Inhibrx, Inc. B7h3 single domain antibodies and therapeutic compositions thereof
US12365728B2 (en) 2018-10-11 2025-07-22 Inhibrx Biosciences, Inc. DLL3 single domain antibodies and therapeutic compositions thereof
WO2020076992A1 (en) 2018-10-11 2020-04-16 Inhibrx, Inc. 5t4 single domain antibodies and therapeutic compositions thereof
WO2020077257A1 (en) 2018-10-11 2020-04-16 Inhibrx, Inc. Pd-1 single domain antibodies and therapeutic compositions thereof
WO2021048423A1 (en) 2019-09-12 2021-03-18 Genmab A/S Bispecific antibodies binding to 5t4 and cd3 for use in treatment of cancer
EP4039707A4 (en) * 2019-09-30 2022-11-16 Harbour Biomed (Shanghai) Co., Ltd TARGETED CD3 ANTIBODY, BISPECIFIC ANTIBODY AND USE THEREOF
RU2808138C1 (ru) * 2019-09-30 2023-11-23 Хабэ Биомед (Шанхай) Ко., Лтд Антитело, нацеливающееся на cd3, биспецифическое антитело и их применение
JP2022550832A (ja) * 2019-09-30 2022-12-05 和▲ハク▼医▲薬▼(▲蘇▼州)有限公司 Cd3を標的とする抗体、二重特異性抗体及びその使用
WO2021141996A1 (en) * 2020-01-06 2021-07-15 Cytomx Therapeutics, Inc. Single- and multi-chain polypeptides that bind specifically to cd3 epsilon
US12545731B2 (en) 2020-01-06 2026-02-10 Cytomx Therapeutics, Inc. Single-and multi-chain polypeptides that bind specifically to CD3 epsilon
WO2021155071A1 (en) 2020-01-29 2021-08-05 Inhibrx, Inc. Cd28 single domain antibodies and multivalent and multispecific constructs thereof
US12522661B2 (en) 2020-01-29 2026-01-13 Inhibrx Biosciences, Inc. CD28 single domain antibodies and multivalent and multispecific constructs thereof
WO2021167952A3 (en) * 2020-02-20 2021-09-30 The Feinstein Institutes For Medical Research Agonist antibodies against endoglin and uses thereof
WO2021185934A1 (en) 2020-03-18 2021-09-23 Genmab A/S Antibodies binding to b7h4
US11261254B1 (en) 2020-03-18 2022-03-01 Genmab A/S Antibodies
US12435154B2 (en) 2020-05-08 2025-10-07 Genmab A/S Bispecific antibodies against CD3 and CD20
WO2021224499A1 (en) 2020-05-08 2021-11-11 Genmab A/S Bispecific antibodies against cd3 and cd20
WO2022046644A1 (en) 2020-08-25 2022-03-03 Gilead Sciences, Inc. Multi-specific antigen binding molecules targeting hiv and methods of use
US12195524B2 (en) 2020-08-25 2025-01-14 Gilead Sciences, Inc. Multi-specific antigen binding molecules targeting HIV and methods of use
WO2022049220A2 (en) 2020-09-02 2022-03-10 Genmab A/S Antibody therapy
WO2022053655A1 (en) 2020-09-10 2022-03-17 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating follicular lymphoma
WO2022053658A1 (en) 2020-09-10 2022-03-17 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma
US11858995B2 (en) 2020-09-10 2024-01-02 Genmab A/S Bispecific antibodies against CD3 and CD20 for treating chronic lymphocytic leukemia
WO2022053656A1 (en) 2020-09-10 2022-03-17 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating follicular lymphoma
US11845805B2 (en) 2020-09-10 2023-12-19 Genmab A/S Bispecific antibody against CD3 and CD20 in combination therapy for treating diffuse large B-cell lymphoma
WO2022053657A1 (en) 2020-09-10 2022-03-17 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma
WO2022053654A1 (en) 2020-09-10 2022-03-17 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma
WO2022053653A1 (en) 2020-09-10 2022-03-17 Genmab A/S Bispecific antibodies against cd3 and cd20 for treating chronic lymphocytic leukemia
US11535679B2 (en) 2020-09-10 2022-12-27 Genmab A/S Bispecific antibody against CD3 and CD20 in combination therapy for treating follicular lymphoma
US11608383B2 (en) 2020-09-10 2023-03-21 Genmab A/S Bispecific antibody against CD3 and CD20 in combination therapy for treating follicular lymphoma
US11548952B2 (en) 2020-09-10 2023-01-10 Genmab A/S Bispecific antibody against CD3 and CD20 in combination therapy for treating diffuse large B-cell lymphoma
WO2022069724A1 (en) 2020-10-02 2022-04-07 Genmab A/S Antibodies capable of binding to ror2 and bispecific antibodies binding to ror2 and cd3
WO2022228705A1 (en) 2021-04-30 2022-11-03 F. Hoffmann-La Roche Ag Dosing for combination treatment with anti-cd20/anti-cd3 bispecific antibody and anti-cd79b antibody drug conjugate
WO2022228706A1 (en) 2021-04-30 2022-11-03 F. Hoffmann-La Roche Ag Dosing for treatment with anti-cd20/anti-cd3 bispecific antibody
WO2022234146A1 (en) 2021-05-07 2022-11-10 Genmab A/S PHARMACEUTICAL COMPOSITIONS COMPRISING BISPECIFIC ANTIBODIES BINDING TO B7H4 and CD3
WO2023057571A1 (en) 2021-10-08 2023-04-13 Genmab A/S Antibodies binding to cd30 and cd3
WO2023144306A1 (en) 2022-01-28 2023-08-03 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma
WO2023144290A1 (en) 2022-01-28 2023-08-03 Genmab A/S Bispecific antibody against cd3 and cd20 in combination therapy for treating diffuse large b-cell lymphoma
WO2023180353A1 (en) 2022-03-23 2023-09-28 F. Hoffmann-La Roche Ag Combination treatment of an anti-cd20/anti-cd3 bispecific antibody and chemotherapy
WO2023198839A2 (en) 2022-04-13 2023-10-19 Genmab A/S Bispecific antibodies against cd3 and cd20
WO2023198727A1 (en) 2022-04-13 2023-10-19 F. Hoffmann-La Roche Ag Pharmaceutical compositions of anti-cd20/anti-cd3 bispecific antibodies and methods of use
WO2024088987A1 (en) 2022-10-26 2024-05-02 F. Hoffmann-La Roche Ag Combination therapy for the treatment of cancer
WO2024094822A1 (en) 2022-11-02 2024-05-10 Genmab A/S Bispecific antibodies against cd3 and cd20 for treating richter's syndrome
WO2024102948A1 (en) 2022-11-11 2024-05-16 Celgene Corporation Fc receptor-homolog 5 (fcrh5) specific binding molecules and bispecific t-cell engaging antibodies including same and related methods
WO2024208898A1 (en) 2023-04-05 2024-10-10 Genmab A/S Pharmaceutical compositions comprising antibodies binding to cd30 and cd3
WO2024213754A1 (en) 2023-04-13 2024-10-17 Genmab A/S Methods of treating lymphoma with bispecific antibodies against cd3 and cd20
WO2025116732A1 (en) * 2023-12-01 2025-06-05 Rijksuniversiteit Groningen Methods and kits for detecting proliferating cells
WO2025199352A2 (en) 2024-03-20 2025-09-25 Juno Therapeutics, Inc. Antibodies specific for solute carrier family 34 member 2 (slc34a2)
WO2025240670A2 (en) 2024-05-15 2025-11-20 Abalytics Oncology, Inc. Anti-pd-1 antibodies and related binding molecules and methods and uses thereof

Also Published As

Publication number Publication date
JP6546162B2 (ja) 2019-07-17
AU2020202792A1 (en) 2020-05-21
IL276530A (en) 2020-09-30
HUS2500051I1 (hu) 2025-12-28
AU2025256200A1 (en) 2025-11-13
LT4249515T (lt) 2025-08-25
FR25C1054I1 (fr) 2026-01-16
AU2020202792B2 (en) 2022-06-23
SI3016681T1 (sl) 2020-04-30
SMT202500322T1 (it) 2025-11-10
EP3016681A1 (en) 2016-05-11
DK3016681T3 (da) 2020-03-09
ME03675B (me) 2020-10-20
UA119646C2 (uk) 2019-07-25
JP2020005635A (ja) 2020-01-16
WO2015104346A1 (en) 2015-07-16
BR122023002590B1 (pt) 2023-12-05
JP2024026114A (ja) 2024-02-28
JP7389833B2 (ja) 2023-11-30
CN120365424A (zh) 2025-07-25
HUE048722T2 (hu) 2020-08-28
AU2022203851B2 (en) 2025-07-24
JP2017505121A (ja) 2017-02-16
KR20230073341A (ko) 2023-05-25
HK1231369A1 (en) 2017-12-22
SG11201510739TA (en) 2016-01-28
NL301352I2 (nl) 2025-12-16
PL3016681T3 (pl) 2020-06-15
US20230374131A1 (en) 2023-11-23
PT3016681T (pt) 2020-03-26
US10465006B2 (en) 2019-11-05
KR20160027177A (ko) 2016-03-09
JP7208129B2 (ja) 2023-01-18
ES3038421T3 (en) 2025-10-13
IL290613B1 (en) 2024-07-01
RS67220B1 (sr) 2025-10-31
FIC20250036I1 (fi) 2025-12-09
NO2025057I1 (no) 2025-12-11
HUE072527T2 (hu) 2025-11-28
EA201690167A1 (ru) 2016-06-30
JP2022101539A (ja) 2022-07-06
JP2022163009A (ja) 2022-10-25
JP7757247B2 (ja) 2025-10-21
JP6619342B2 (ja) 2019-12-11
ES3052034T3 (en) 2025-12-30
AU2022203851A1 (en) 2022-06-23
CN105722529A (zh) 2016-06-29
EP3016681B1 (en) 2019-12-18
MX373245B (es) 2020-05-11
IL311371A (en) 2024-04-01
CY1122840T1 (el) 2021-05-05
KR102363220B1 (ko) 2022-02-15
US20160333095A1 (en) 2016-11-17
EP4249515A2 (en) 2023-09-27
RS60131B1 (sr) 2020-05-29
AU2014286116A1 (en) 2016-02-04
PL4249515T3 (pl) 2025-12-22
JP7104000B2 (ja) 2022-07-20
US20200199229A1 (en) 2020-06-25
HRP20251127T1 (hr) 2025-11-21
HRP20200382T1 (hr) 2020-06-12
LTPA2025538I1 (enExample) 2025-12-29
AU2020202792B9 (en) 2022-07-07
JP2020048564A (ja) 2020-04-02
NZ715896A (en) 2022-02-25
CN106255507B (zh) 2025-05-02
SMT202000287T1 (it) 2020-07-08
MX2015017487A (es) 2016-03-21
EP4631978A3 (en) 2025-12-24
CN106255507A (zh) 2016-12-21
IL311371B2 (en) 2024-09-01
SI4249515T1 (sl) 2025-11-28
US10407501B2 (en) 2019-09-10
EP4249515A3 (en) 2023-11-15
IL243127B (en) 2020-08-31
KR102531517B1 (ko) 2023-05-12
CN113248615A (zh) 2021-08-13
JP2016529882A (ja) 2016-09-29
US20200123255A1 (en) 2020-04-23
CA2915575A1 (en) 2015-01-08
CN118063621A (zh) 2024-05-24
IL290613A (en) 2022-04-01
US11613575B2 (en) 2023-03-28
EP4249515B1 (en) 2025-06-18
LT3016681T (lt) 2020-03-25
US20160168247A1 (en) 2016-06-16
BR112015032986A2 (pt) 2017-08-22
MX2020004503A (es) 2020-08-13
ES2776706T3 (es) 2020-07-31
KR20250078622A (ko) 2025-06-02
CN105722529B (zh) 2021-06-08
EP3693385A1 (en) 2020-08-12
DK4249515T3 (en) 2025-09-15
DK3016681T5 (da) 2020-05-04
CN113248615B (zh) 2025-07-04
PT4249515T (pt) 2025-09-08
IL290613B2 (en) 2024-11-01
ZA201800385B (en) 2019-09-25
KR20220025210A (ko) 2022-03-03
IL311371B1 (en) 2024-05-01
EP3091998A1 (en) 2016-11-16
IL276530B (en) 2022-03-01
EP3091998B1 (en) 2025-08-20
FI4249515T3 (fi) 2025-09-02
SG10201800982QA (en) 2018-03-28
EP4631978A2 (en) 2025-10-15
KR102813816B1 (ko) 2025-05-29

Similar Documents

Publication Publication Date Title
AU2020202792B2 (en) Humanized or chimeric CD3 antibodies
HK40092168B (en) Humanized or chimeric cd3 antibodies
HK40092168A (en) Humanized or chimeric cd3 antibodies
HK40035360A (en) Humanized or chimeric cd3 antibodies
HK1224574A1 (en) Humanized or chimeric cd3 antibodies
HK1224574B (en) Humanized or chimeric cd3 antibodies
HK1231369B (en) Humanized or chimeric cd3 antibodies

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14737200

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2915575

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 243127

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: MX/A/2015/017487

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 122023002590

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2016522644

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14902757

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015032986

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20167002903

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2014737200

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2014286116

Country of ref document: AU

Date of ref document: 20140704

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201690167

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: A201600940

Country of ref document: UA

ENP Entry into the national phase

Ref document number: 112015032986

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20151230

WWP Wipo information: published in national office

Ref document number: 1020257017076

Country of ref document: KR